1C03A

Crystal structure of ypd1p (triclinic form)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
167
structure length
163
Chain Sequence
STIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDEDDEEIKIKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN YDL235C
publication title Insights into eukaryotic multistep phosphorelay signal transduction revealed by the crystal structure of Ypd1p from Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 62
structure length 163
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1c03A00
3US6A 3KYIA 1FR0A 4PACA 3IQTA 4EUKB 1WN0A 1QSPA 1Y6DA 3U3BA 1C03A 1OXBA 1OXKA 2LCHA 1BDJB 1SR2A 3KYJA 2LP4A 2A0BA 4G78A 2R25A 2LD6A 1C02A 1TQGA 2Q4FA 3MYFA 1A0BA 1YVIA 1I5NA 2OOCA
chains in the Genus database with same CATH superfamily
2YWAA 3T6BA 1LIHA 1UG7A 3GEIA 1ZYRF 3H2UA 1DOWA 3KYIA 1TFKB 4O6MA 3B29A 3GM3A 4XLNF 3ZTZA 4E0HA 3E9VA 3LLKA 3EJNA 1CGOA 2P0NA 5B1AC 5DS6A 3TD7A 3OA1A 5TJ5E 4J7YA 3VM6A 3K33A 2V3CC 4WJ0A 2XLEA 3SZRA 1BR1A 4HEAJ 3NKEA 2KK1A 2IOQA 2X51A 2NUPB 2R9RB 4NY3A 1ZHTA 2PX3A 3PMRA 3TJ6A 1LPEA 4WGYA 3WG7C 4EBBA 1KTMA 4JTCB 2AWYA 4MNDA 1E85A 3NMKA 4JEAA 2EIMC 4C7OA 1RXQA 3EZIA 1U0BB 1Z23A 1AVOB 1TFOB 1H7IA 1PD1A 256BA 3DMDA 3EHMA 2XL6A 4JTAB 4NTAA 2XM4A 4AX2A 1E83A 4XLPF 2GWWA 1YYJA 2YL3A 3H2VA 4YWQA 2L7AA 4PFPA 3AG2C 2JX0A 5B3SC 1Z63A 4NCQA 2OJED 2CNWA 2WZGA 4J7TA 1HW1A 3LESA 1OCZC 3QVZA 2J0WA 2YZSA 3EG9B 2VCCA 3FOPA 3IQ5A 2KQ9A 3RYLA 3S29A 3SXMA 3PCVA 2EILC 4FESA 5BQGA 3T4RA 3U3BA 1T5OA 5DQTA 4QDLA 2XL4A 2Y3DA 2I8BA 2XLVA 4U5HA 3U8PA 3SXYA 4CS8C 3DI5A 3QW1A 1V54C 1E84A 1HW2A 2LP4A 4MS2A 3NYJA 4OD5A 4WGZA 3U0CA 1OCRC 5E2QA 5COMA 1VK5A 1WWPA 4EHPA 2FFHA 1YYXA 3ZVRA 2MHRA 1I4ZA 2CNWD 3GEEA 4KI2A 3I4UA 3S28A 2MWQA 1I5NA 2WVOA 2M4EA 1FFHA 1ZHZA 2D4UA 2UUHA 2Y69C 3DE8A 4DRJB 3JZ0A 2XXAA 1JR8A 2AP3A 2CYDA 2EPNA 2PFDA 1O87A 1HE9A 4YN0B 4DVZA 1UFBA 2Y3BA 3S9OA 4JE9A 2LCHA 1OCOC 1TWHA 2IBFA 1Z5ZA 3ABKC 4R32A 5DS5A 3KYJA 5KYUA 2A0BA 1W2WA 3W2WA 4U5FE 2LSEA 2OQMA 3OWTA 1D0XA 1PCXA 2J7PA 2RSEB 5B1BC 3VYWA 2Q9CA 2NG1A 3O55A 1M56C 1TQGA 3M15A 4FWVA 4WABA 3F47A 4E17A 3Q6MA 4F4BA 1A41A 5A69A 2OJQA 2LIGA 4KNWA 4HE8D 4IB4A 2G3KA 4CSAA 4FAPB 5KYWB 5BUOA 3IHUA 5F5FA 2KYHA 3JYYA 4EWCA 1D0ZA 4IGGA 4CDYA 4CJOA 1SF8A 5IY5C 2CDQA 2EPKX 3ZDLA 2B0JA 3MBGA 5JT4A 1C17M 1BZ4A 4N06A 4Z9JA 2RD9A 3KH2A 2J7PD 4I1OB 5KYXB 2VC9A 4G7OF 2Y3GA 2OU6A 1M2VB 2GAQA 2HV7A 2XLDA 1FMVA 2EIKC 5CI8A 3RQFA 4ONSA 3ZC4A 4MVQA 3TK0A 4DRIB 1ZHYA 3JCUQ 3BEHA 2YLDA 1E86A 1T01A 1C02A 2YQYA 3EPVA 5GPGB 1T6IA 1K05A 1T6QA 2J9BA 2VCBA 2ZPAA 1VLTA 2LFFA 2PBEA 3DJNB 3EGDB 5JSLA 1VYIA 3VRCA 4CBEA 4W8PA 3AGTA 2L9JA 1NFNA 1M2OA 2W4BA 3LAYA 4YT2A 3QVYA 3S0XA 2JPUA 2R7OA 1GQAA 1XZPA 3HKKA 3NMIA 4NQFA 5K0IA 2CW0F 5KYYA 3V5ZA 1ZW3A 4EUKB 4O6NA 1TWAA 3KPHA 3SXZA 1L3PA 1TWGA 4N6HA 5EK0A 2HZ8A 4OIPF 4D4XA 4CSAC 4OIQF 1YZAA 1SR2A 3L1MA 3B0UX 2ETSA 3TULA 2I15A 5DVWA 2ASRA 1NFOA 2P61A 4EKWA 2QLAA 4PJJA 1AUEA 1VYKA 2OG2A 1ORSC 1OW8A 4YJWA 2KNHA 4ZLCA 1A0BA 3HNJA 1NG1A 2XS8A 5L0HA 1YLMA 2R02A 1HMDA 3W8HA 3HNLA 3SP1A 3CZ6A 1NLXA 1APCA 2D5RB 3W2VA 3X1OA 2HMZA 3KMIA 4C3EA 2C04A 4MVUA 4U5EE 1CGME 3UMKA 3RIPA 1VMAA 3EHNA 3HNIA 3ASNC 4IWBA 3ZTMA 3EQLF 1HE1A 3HLZA 1OXKA 4IAQA 3C8ZA 2P6VA 3LS1A 4YK5A 2A68F 2IXOA 2XLOA 2EPMX 3SYNA 1R5ID 2VCAA 1RKEA 2W9YA 3W4YA 1U6HA 4J30B 3DAFA 4PK4A 5E3CA 5L0CA 1TKNA 2XLWA 1YAUO 4IJJA 1EA8A 1Q0DA 3KL4A 2R7RA 1JPJA 4MTGA 1FNTc 2H7OA 1FFTC 2UUIA 1ZU4A 2XL8A 3U2MA 1ZVZA 2XRHA 2A6EF 2ZXOA 1V74B 1SMYF 1FMWA 3DD7A 1MMAA 1TR2A 3GORA 4RBNA 3J06A 3H65A 1Y4CA 3GODA 4MVRA 1VB5A 4Z9HA 2HMQA 2J9VA 4BJ5C 2A69F 3NDBB 1YA7O 4M63A 2R7QA 4OINF 4AE4A 5HV9A 2IYLD 2YL7A 4I44A 3T6GB 4C7OB 3MLGA 2YLGA 1J8YF 1A7EA 1OKKA 2XM0A 3DAGA 3ECSA 4JIOA 5E33A 2NUTA 3ZG1A 3X2QC 4GQHA 3FDQA 4OIOF 1Q0FA 2CGEA 5DS4A 2Q9AA 2MYSA 3TOMA 3ITFA 2YHSA 2YL1A 3ABLC 2OEXA 1T6UA 3QW0A 1SZIA 3FVYA 3V7OA 3K1IA 1AEPA 1MQVA 4XPYA 3C8GA 1WOLA 1U89A 3UR3C 2HFIA 1A7DA 1NBBA 2IXNA 3AGUA 3QMKA 4J32B 3UNGC 1JPNA 4DXWA 3FMSA 2R7UA 3IQTA 1R4TA 2NSFA 1KNYA 1J8MF 3C7JA 4U9DA 1H9GA 4LDKA 3RFYA 4UDVA 3B0VC 1DOVA 3SNHA 2L6GA 1ZU5A 3B71A 3GANA 4IAOA 2R7VA 1FTSA 3N0TA 3EGXA 3G50A 1CPQA 3CAXA 3HJCA 2E87A 3M4BA 2L6FA 3B0PA 4E7SA 2KJGA 2LK4A 4NC3A 5A6BA 1RMVA 4U9EA 1RJ9A 2H8AA 2R25A 3M4CA 2L6HA 4PFOA 2X0CA 4DRHB 1MNEA 3C8GD 5A6KA 2C03A 4MQ9F 3NRHA 3CSKA 4MVOA 4C3BA 2YKZA 4U5CE 3WHNA 3LEVA 5T1DB 3IQ6A 2QUPA 2HSQA 5T3TA 1S7ZA 4E7ZA 2XXAB 4NTFA 4O7GA 2R7TA 1D1BA 2AVKA 4O79A 1RCPA 3SEOA 2Y39A 4YL3A 1BR2A 1WN0A 3Q6NA 1Q0MA 1C03A 4JJGA 2YVKA 1LI7A 3EGXB 1D0YA 1LVKA 3AG3C 2VB6A 3AJMA 4BEMJ 5KYUB 4MVMA 3IEEA 3K1IC 4MTFA 3EH1A 2XLHA 4YL1A 4CX9A 4LLCA 2BL2A 2HKVA 3FAJA 3S84A 3U9JA 2QE9A 3F46A 1A7VA 3Q7GA 5KYXA 2R05A 1YVIA 2YL0A 1Q0KA 4N6CA 5D92A 2M64A 3RQGA 3FHDA 2WB7A 4Q4ZF 1GS9A 3US6A 1NZEA 3WODF 1FR0A 3NMJA 2NPUA 4A2NB 4BEJA 5FCLA 2L81A 5AC4A 2HS5A 2OKUA 3L0IA 4JEBA 1LKXA 3S90A 3RVZA 3ZWIA 2J9WA 2AU5A 3AQCA 3TJ5A 3U9MA 3JTLO 4CIPA 3RKOF 4DBRA 2EPOA 2P1AA 4JKVA 2QTVA 1GGQA 2WZFA 4LLEA 4JJFA 1EKYA 4QI2A 4XPXA 1BDJB 1WTYA 3TOLA 3NYLA 2WVQA 2EPLX 3JYHA 2R7WA 1D1AA 4XPWA 1QKRA 4LDRA 5A6JA 5L0IA 5L3VA 4AK9A 3ZSUA 3AQBA 2R03A 4YL0A 5D91A 4G78A 1MMNA 1V4AA 3VF0A 3HNKA 3KKBA 4B6IA 4X0RA 3MYFA 4LDQA 4XEKA 5EGYA 4CJGA 1PD0A 2DB4A 2HJ3A 4JRZA 1QVXA 3IQCA 4P9FA 3U5SA 5JS5A 4BJ1A 3DJUB 2DI3A 2FAPB 2XS1A 1ST6A 3DM9B 3ZQYA 3GEHA 4BPMA 4CDVA 1LE2A 3DKAA 4CIHA 4RDAA 3W8IA 5KYYB 1MNDA 3IPMO 3RVYA 4CDAA 2G62A 3U3FA 3U8VA 3CEXA 2R7SA 2OCCC 1OXBA 3MFNA 4JURI 1VTMP 2ICWG 3FAPB 5F5HA 3O39A 2QY9A 3K1HA 1JAFA 1S05A 2PNOA 3ZQVA 4U5GA 1IW7F 1SYQA 4DOZA 4HFFB 2H7BA 4FX5A 4BJTA 1NU7D 1HY5A 4D4NA 5EHHA 3JRMO 3RQEA 5KYNA 4K7BA 5B3IA 2TMVP 4P9TA 3FOOA 2KC3A 4H4KC 4ER9A 1FAPB 1ORJA 1ZHXA 3T9OA 2A6HF 2J45A 5HSWA 1QZXA 3M1CB 5F28E 3UMIA 4CS9A 1T9KA 1EQ1A 1QQ3A 3EG9A 4EBJA 4XQ1A 3GWLA 3O10A 1HMOA 3HTKC 1LE4A 2J9UA 5AGFA 2NSGA 5JUAA 1F1MA 5L3QA 3POVA 1YARO 2CCYA 3O6XA 2ZXPA 5JLIA 1RKEB 1M6TA 1ZHWA 2ZXWC 4OD4A 2KGOA 3RH3A 3V5XA 4IARA 3LLIA 3CQZA 4JC7A 4HFKB 3DM5A 1Z3IX 2AWCA 3I5QA 2PP4A 1OR3A 4KNVA 3S27A 4H54A 3AG4C 4PACA 2KW3C 2QNLA 4EBKA 1ZW2A 1G4WR 4PR9A 3R2PA 1OR2A 1YA9A 2DYRC 2ZD9A 4ZLDA 2W4MA 4U5BE 5JRAA 3K66A 4CS7A 2YLIA 5L0JA 1QSPA 2P7VA 5CI9A 2WVNA 3AG1C 5JP7A 3G4XA 2KSFA 4XTKA 2DGJA 2IM8A 4MVZA 4DVYP 1OKKD 3JSEO 3UGPA 4AE4B 1Z7Qc 2GDCA 4G7ZF 2VASA 4GYTA 3T6JA 3AOUA 1QPUA 3LJBA 1OCCC 3TQOA 4CS9C 2LQGA 1O5HA 2NUTB 3EFOA 4PJMA 2J46A 1IZMA 2VH3A 5AC5A 2Q4FA 3BRJA 3C18A 2Y3HA 4MW8A 1PV3A 1XWJA 2W45A 1L7CA 4BG0A 1ORYA 1GM5A 1YZCA 2OOCA 4ULVA 2IXPA 1LS4A 4LACB 1O3UA 5KYWA 1ZZPA 4XWJA 2V26A 3C8GB 3E70C 4BJ6A 1G5ZA 1BR4A 3K6BA 3VAYA 2EINC 2O9XA 2IXMA 1JMWA 2XSEA 3ABMC 1OW6A 2HV6A 3G4ZA 3MX3A 2PF4E 2Q7RA 4AL0A 5A6AA 1Y6DA 1LI5A 5CIVA 2J0XA 4JVSA 4K1OA 3UGOA 1QLEC 3A11A 3RF3A 5A6BD 2LFDA 3C63A 3NKDA 3RW0A 3DXJF 1N1CA 1V55C 1M2VA 1M57C 2Q9BA 1VOMA 3PDMP 3EFOB 1H6GA 5BQHA 3LS0A 3JSZA 1RKCA 4K0DA 4JTDB 1MMGA 1NU9C 1RJ9B 2EIJC 4PJNA 2A0UA 4W8KA 3A9CA 4CS8A 5L0FA 4QI0A 4O6YA 1OQCA 2BC5A 2Z15A 3EZHA 3GM1A 4LERA 3EGDA 3PHF2 3LNMB 4NTBA 3DWWA 4I3MA 4P6IC 1Z6AA 4KBLA 4ULWA 3C62A 2A1DD 2GFHA 2OEVA 4KC9A 4OIRF 1H9TA 1CPRA 4G7HF 4Q5SF 4EIYA 1K40A 4L6RA 3JRTA 4E0IA 5JVEA 2ZXRA 4IRUA 4U5DE 2H7VC 4E18A 4JW1A 3QZCA 1CGNA 3V5YA 5BQIA 1VLSA 3B9QA 4I1MA 4JCZA 4N4WA 3EH2A 2J8WA 1JRAA 1I4YA 1WASA 3LUTB 5DQZA 1B68A 5DLJA 1KU2A 4BJ6C 3ATPA 2R7XA 3I5PA 4GEHA 4MVSA 2HUJA 1WGWA 3NG1A 4Z9IA 1WATA 2F22A 1G4US 3GWNA 3DZAA 4YT5A 4Q7CA 1OW7A 2GA0A 3QTHA 5COGA 2BE5F 2XLMA 1YJGA 3JT1A 3K7DA 1YDIA 4A4AA 2DYSC 4XEFA 2WZLA 4YT8A 3M79A 3L8JA 4XEVA 1JOGA 4DJ9A 2FGYA 2PX0A 1G8XA 1LM3B 1TWCA 2Q00A 4ANJA 3N2ZB 3U2LA 3R7CA 1XZQA 1LS1A 2JD3A 5T3WA 5E3AA 1K04A 1BBHA 1E2XA 4DBQA 3FXHA 2HJMA 3ASOC 4MTOA 4RD9A 4C3DA 4AL1A 3MYIA 5L0GA 2B0HA 3L8IA 2Q3TA 1NSGB 3ZIBA 2NUPA 3LNRA 4JCHA 3OEOA 5L0DA 3N24A 3Q7LA 2G3VA 3SXKA 3UMHA 5COFA 4YT4A 3GM2A 2YRFA 3LEOA 4JZAA 2WL8A 2HSBA 1D1CA 2LD6A 4PJLA 1MMDA 3WAQA 2YEVA 4MW3A 5FZTA 1EI7A 4BJ5A 3NYMA 3DE9A 3L34A 1Q0GA 4G0HA
chains in the Genus database with same CATH topology
3US6A 3KYIA 1FR0A 4PACA 3IQTA 4EUKB 1WN0A 1QSPA 1Y6DA 3U3BA 1C03A 1OXBA 1OXKA 2LCHA 1BDJB 1SR2A 3KYJA 2LP4A 2A0BA 4G78A 2R25A 2LD6A 1C02A 1TQGA 2Q4FA 3MYFA 1A0BA 1YVIA 1I5NA 2OOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3US6 A;  3KYI A;  1FR0 A;  4PAC A;  3IQT A;  4EUK B;  1WN0 A;  1QSP A;  1Y6D A;  3U3B A;  1C03 A;  1OXB A;  1OXK A;  2LCH A;  1BDJ B;  1SR2 A;  3KYJ A;  2LP4 A;  2A0B A;  4G78 A;  2R25 A;  2LD6 A;  1C02 A;  1TQG A;  2Q4F A;  3MYF A;  1A0B A;  1YVI A;  1I5N A;  2OOC A; 
#chains in the Genus database with same CATH topology
 2YWA A;  3T6B A;  1LIH A;  1UG7 A;  3GEI A;  1ZYR F;  3H2U A;  1DOW A;  3KYI A;  1TFK B;  4O6M A;  3B29 A;  3GM3 A;  4XLN F;  3ZTZ A;  4E0H A;  3E9V A;  3LLK A;  3EJN A;  1CGO A;  2P0N A;  5B1A C;  5DS6 A;  3TD7 A;  3OA1 A;  5TJ5 E;  4J7Y A;  3VM6 A;  3K33 A;  2V3C C;  4WJ0 A;  2XLE A;  3SZR A;  1BR1 A;  4HEA J;  3NKE A;  2KK1 A;  2IOQ A;  2X51 A;  2NUP B;  2R9R B;  4NY3 A;  1ZHT A;  2PX3 A;  3PMR A;  3TJ6 A;  1LPE A;  4WGY A;  3WG7 C;  4EBB A;  1KTM A;  4JTC B;  2AWY A;  4MND A;  1E85 A;  3NMK A;  4JEA A;  2EIM C;  4C7O A;  1RXQ A;  3EZI A;  1U0B B;  1Z23 A;  1AVO B;  1TFO B;  1H7I A;  1PD1 A;  256B A;  3DMD A;  3EHM A;  2XL6 A;  4JTA B;  4NTA A;  2XM4 A;  4AX2 A;  1E83 A;  4XLP F;  2GWW A;  1YYJ A;  2YL3 A;  3H2V A;  4YWQ A;  2L7A A;  4PFP A;  3AG2 C;  2JX0 A;  5B3S C;  1Z63 A;  4NCQ A;  2OJE D;  2CNW A;  2WZG A;  4J7T A;  1HW1 A;  3LES A;  1OCZ C;  3QVZ A;  2J0W A;  2YZS A;  3EG9 B;  2VCC A;  3FOP A;  3IQ5 A;  2KQ9 A;  3RYL A;  3S29 A;  3SXM A;  3PCV A;  2EIL C;  4FES A;  5BQG A;  3T4R A;  3U3B A;  1T5O A;  5DQT A;  4QDL A;  2XL4 A;  2Y3D A;  2I8B A;  2XLV A;  4U5H A;  3U8P A;  3SXY A;  4CS8 C;  3DI5 A;  3QW1 A;  1V54 C;  1E84 A;  1HW2 A;  2LP4 A;  4MS2 A;  3NYJ A;  4OD5 A;  4WGZ A;  3U0C A;  1OCR C;  5E2Q A;  5COM A;  1VK5 A;  1WWP A;  4EHP A;  2FFH A;  1YYX A;  3ZVR A;  2MHR A;  1I4Z A;  2CNW D;  3GEE A;  4KI2 A;  3I4U A;  3S28 A;  2MWQ A;  1I5N A;  2WVO A;  2M4E A;  1FFH A;  1ZHZ A;  2D4U A;  2UUH A;  2Y69 C;  3DE8 A;  4DRJ B;  3JZ0 A;  2XXA A;  1JR8 A;  2AP3 A;  2CYD A;  2EPN A;  2PFD A;  1O87 A;  1HE9 A;  4YN0 B;  4DVZ A;  1UFB A;  2Y3B A;  3S9O A;  4JE9 A;  2LCH A;  1OCO C;  1TWH A;  2IBF A;  1Z5Z A;  3ABK C;  4R32 A;  5DS5 A;  3KYJ A;  5KYU A;  2A0B A;  1W2W A;  3W2W A;  4U5F E;  2LSE A;  2OQM A;  3OWT A;  1D0X A;  1PCX A;  2J7P A;  2RSE B;  5B1B C;  3VYW A;  2Q9C A;  2NG1 A;  3O55 A;  1M56 C;  1TQG A;  3M15 A;  4FWV A;  4WAB A;  3F47 A;  4E17 A;  3Q6M A;  4F4B A;  1A41 A;  5A69 A;  2OJQ A;  2LIG A;  4KNW A;  4HE8 D;  4IB4 A;  2G3K A;  4CSA A;  4FAP B;  5KYW B;  5BUO A;  3IHU A;  5F5F A;  2KYH A;  3JYY A;  4EWC A;  1D0Z A;  4IGG A;  4CDY A;  4CJO A;  1SF8 A;  5IY5 C;  2CDQ A;  2EPK X;  3ZDL A;  2B0J A;  3MBG A;  5JT4 A;  1C17 M;  1BZ4 A;  4N06 A;  4Z9J A;  2RD9 A;  3KH2 A;  2J7P D;  4I1O B;  5KYX B;  2VC9 A;  4G7O F;  2Y3G A;  2OU6 A;  1M2V B;  2GAQ A;  2HV7 A;  2XLD A;  1FMV A;  2EIK C;  5CI8 A;  3RQF A;  4ONS A;  3ZC4 A;  4MVQ A;  3TK0 A;  4DRI B;  1ZHY A;  3JCU Q;  3BEH A;  2YLD A;  1E86 A;  1T01 A;  1C02 A;  2YQY A;  3EPV A;  5GPG B;  1T6I A;  1K05 A;  1T6Q A;  2J9B A;  2VCB A;  2ZPA A;  1VLT A;  2LFF A;  2PBE A;  3DJN B;  3EGD B;  5JSL A;  1VYI A;  3VRC A;  4CBE A;  4W8P A;  3AGT A;  2L9J A;  1NFN A;  1M2O A;  2W4B A;  3LAY A;  4YT2 A;  3QVY A;  3S0X A;  2JPU A;  2R7O A;  1GQA A;  1XZP A;  3HKK A;  3NMI A;  4NQF A;  5K0I A;  2CW0 F;  5KYY A;  3V5Z A;  1ZW3 A;  4EUK B;  4O6N A;  1TWA A;  3KPH A;  3SXZ A;  1L3P A;  1TWG A;  4N6H A;  5EK0 A;  2HZ8 A;  4OIP F;  4D4X A;  4CSA C;  4OIQ F;  1YZA A;  1SR2 A;  3L1M A;  3B0U X;  2ETS A;  3TUL A;  2I15 A;  5DVW A;  2ASR A;  1NFO A;  2P61 A;  4EKW A;  2QLA A;  4PJJ A;  1AUE A;  1VYK A;  2OG2 A;  1ORS C;  1OW8 A;  4YJW A;  2KNH A;  4ZLC A;  1A0B A;  3HNJ A;  1NG1 A;  2XS8 A;  5L0H A;  1YLM A;  2R02 A;  1HMD A;  3W8H A;  3HNL A;  3SP1 A;  3CZ6 A;  1NLX A;  1APC A;  2D5R B;  3W2V A;  3X1O A;  2HMZ A;  3KMI A;  4C3E A;  2C04 A;  4MVU A;  4U5E E;  1CGM E;  3UMK A;  3RIP A;  1VMA A;  3EHN A;  3HNI A;  3ASN C;  4IWB A;  3ZTM A;  3EQL F;  1HE1 A;  3HLZ A;  1OXK A;  4IAQ A;  3C8Z A;  2P6V A;  3LS1 A;  4YK5 A;  2A68 F;  2IXO A;  2XLO A;  2EPM X;  3SYN A;  1R5I D;  2VCA A;  1RKE A;  2W9Y A;  3W4Y A;  1U6H A;  4J30 B;  3DAF A;  4PK4 A;  5E3C A;  5L0C A;  1TKN A;  2XLW A;  1YAU O;  4IJJ A;  1EA8 A;  1Q0D A;  3KL4 A;  2R7R A;  1JPJ A;  4MTG A;  1FNT c;  2H7O A;  1FFT C;  2UUI A;  1ZU4 A;  2XL8 A;  3U2M A;  1ZVZ A;  2XRH A;  2A6E F;  2ZXO A;  1V74 B;  1SMY F;  1FMW A;  3DD7 A;  1MMA A;  1TR2 A;  3GOR A;  4RBN A;  3J06 A;  3H65 A;  1Y4C A;  3GOD A;  4MVR A;  1VB5 A;  4Z9H A;  2HMQ A;  2J9V A;  4BJ5 C;  2A69 F;  3NDB B;  1YA7 O;  4M63 A;  2R7Q A;  4OIN F;  4AE4 A;  5HV9 A;  2IYL D;  2YL7 A;  4I44 A;  3T6G B;  4C7O B;  3MLG A;  2YLG A;  1J8Y F;  1A7E A;  1OKK A;  2XM0 A;  3DAG A;  3ECS A;  4JIO A;  5E33 A;  2NUT A;  3ZG1 A;  3X2Q C;  4GQH A;  3FDQ A;  4OIO F;  1Q0F A;  2CGE A;  5DS4 A;  2Q9A A;  2MYS A;  3TOM A;  3ITF A;  2YHS A;  2YL1 A;  3ABL C;  2OEX A;  1T6U A;  3QW0 A;  1SZI A;  3FVY A;  3V7O A;  3K1I A;  1AEP A;  1MQV A;  4XPY A;  3C8G A;  1WOL A;  1U89 A;  3UR3 C;  2HFI A;  1A7D A;  1NBB A;  2IXN A;  3AGU A;  3QMK A;  4J32 B;  3UNG C;  1JPN A;  4DXW A;  3FMS A;  2R7U A;  3IQT A;  1R4T A;  2NSF A;  1KNY A;  1J8M F;  3C7J A;  4U9D A;  1H9G A;  4LDK A;  3RFY A;  4UDV A;  3B0V C;  1DOV A;  3SNH A;  2L6G A;  1ZU5 A;  3B71 A;  3GAN A;  4IAO A;  2R7V A;  1FTS A;  3N0T A;  3EGX A;  3G50 A;  1CPQ A;  3CAX A;  3HJC A;  2E87 A;  3M4B A;  2L6F A;  3B0P A;  4E7S A;  2KJG A;  2LK4 A;  4NC3 A;  5A6B A;  1RMV A;  4U9E A;  1RJ9 A;  2H8A A;  2R25 A;  3M4C A;  2L6H A;  4PFO A;  2X0C A;  4DRH B;  1MNE A;  3C8G D;  5A6K A;  2C03 A;  4MQ9 F;  3NRH A;  3CSK A;  4MVO A;  4C3B A;  2YKZ A;  4U5C E;  3WHN A;  3LEV A;  5T1D B;  3IQ6 A;  2QUP A;  2HSQ A;  5T3T A;  1S7Z A;  4E7Z A;  2XXA B;  4NTF A;  4O7G A;  2R7T A;  1D1B A;  2AVK A;  4O79 A;  1RCP A;  3SEO A;  2Y39 A;  4YL3 A;  1BR2 A;  1WN0 A;  3Q6N A;  1Q0M A;  1C03 A;  4JJG A;  2YVK A;  1LI7 A;  3EGX B;  1D0Y A;  1LVK A;  3AG3 C;  2VB6 A;  3AJM A;  4BEM J;  5KYU B;  4MVM A;  3IEE A;  3K1I C;  4MTF A;  3EH1 A;  2XLH A;  4YL1 A;  4CX9 A;  4LLC A;  2BL2 A;  2HKV A;  3FAJ A;  3S84 A;  3U9J A;  2QE9 A;  3F46 A;  1A7V A;  3Q7G A;  5KYX A;  2R05 A;  1YVI A;  2YL0 A;  1Q0K A;  4N6C A;  5D92 A;  2M64 A;  3RQG A;  3FHD A;  2WB7 A;  4Q4Z F;  1GS9 A;  3US6 A;  1NZE A;  3WOD F;  1FR0 A;  3NMJ A;  2NPU A;  4A2N B;  4BEJ A;  5FCL A;  2L81 A;  5AC4 A;  2HS5 A;  2OKU A;  3L0I A;  4JEB A;  1LKX A;  3S90 A;  3RVZ A;  3ZWI A;  2J9W A;  2AU5 A;  3AQC A;  3TJ5 A;  3U9M A;  3JTL O;  4CIP A;  3RKO F;  4DBR A;  2EPO A;  2P1A A;  4JKV A;  2QTV A;  1GGQ A;  2WZF A;  4LLE A;  4JJF A;  1EKY A;  4QI2 A;  4XPX A;  1BDJ B;  1WTY A;  3TOL A;  3NYL A;  2WVQ A;  2EPL X;  3JYH A;  2R7W A;  1D1A A;  4XPW A;  1QKR A;  4LDR A;  5A6J A;  5L0I A;  5L3V A;  4AK9 A;  3ZSU A;  3AQB A;  2R03 A;  4YL0 A;  5D91 A;  4G78 A;  1MMN A;  1V4A A;  3VF0 A;  3HNK A;  3KKB A;  4B6I A;  4X0R A;  3MYF A;  4LDQ A;  4XEK A;  5EGY A;  4CJG A;  1PD0 A;  2DB4 A;  2HJ3 A;  4JRZ A;  1QVX A;  3IQC A;  4P9F A;  3U5S A;  5JS5 A;  4BJ1 A;  3DJU B;  2DI3 A;  2FAP B;  2XS1 A;  1ST6 A;  3DM9 B;  3ZQY A;  3GEH A;  4BPM A;  4CDV A;  1LE2 A;  3DKA A;  4CIH A;  4RDA A;  3W8I A;  5KYY B;  1MND A;  3IPM O;  3RVY A;  4CDA A;  2G62 A;  3U3F A;  3U8V A;  3CEX A;  2R7S A;  2OCC C;  1OXB A;  3MFN A;  4JUR I;  1VTM P;  2ICW G;  3FAP B;  5F5H A;  3O39 A;  2QY9 A;  3K1H A;  1JAF A;  1S05 A;  2PNO A;  3ZQV A;  4U5G A;  1IW7 F;  1SYQ A;  4DOZ A;  4HFF B;  2H7B A;  4FX5 A;  4BJT A;  1NU7 D;  1HY5 A;  4D4N A;  5EHH A;  3JRM O;  3RQE A;  5KYN A;  4K7B A;  5B3I A;  2TMV P;  4P9T A;  3FOO A;  2KC3 A;  4H4K C;  4ER9 A;  1FAP B;  1ORJ A;  1ZHX A;  3T9O A;  2A6H F;  2J45 A;  5HSW A;  1QZX A;  3M1C B;  5F28 E;  3UMI A;  4CS9 A;  1T9K A;  1EQ1 A;  1QQ3 A;  3EG9 A;  4EBJ A;  4XQ1 A;  3GWL A;  3O10 A;  1HMO A;  3HTK C;  1LE4 A;  2J9U A;  5AGF A;  2NSG A;  5JUA A;  1F1M A;  5L3Q A;  3POV A;  1YAR O;  2CCY A;  3O6X A;  2ZXP A;  5JLI A;  1RKE B;  1M6T A;  1ZHW A;  2ZXW C;  4OD4 A;  2KGO A;  3RH3 A;  3V5X A;  4IAR A;  3LLI A;  3CQZ A;  4JC7 A;  4HFK B;  3DM5 A;  1Z3I X;  2AWC A;  3I5Q A;  2PP4 A;  1OR3 A;  4KNV A;  3S27 A;  4H54 A;  3AG4 C;  4PAC A;  2KW3 C;  2QNL A;  4EBK A;  1ZW2 A;  1G4W R;  4PR9 A;  3R2P A;  1OR2 A;  1YA9 A;  2DYR C;  2ZD9 A;  4ZLD A;  2W4M A;  4U5B E;  5JRA A;  3K66 A;  4CS7 A;  2YLI A;  5L0J A;  1QSP A;  2P7V A;  5CI9 A;  2WVN A;  3AG1 C;  5JP7 A;  3G4X A;  2KSF A;  4XTK A;  2DGJ A;  2IM8 A;  4MVZ A;  4DVY P;  1OKK D;  3JSE O;  3UGP A;  4AE4 B;  1Z7Q c;  2GDC A;  4G7Z F;  2VAS A;  4GYT A;  3T6J A;  3AOU A;  1QPU A;  3LJB A;  1OCC C;  3TQO A;  4CS9 C;  2LQG A;  1O5H A;  2NUT B;  3EFO A;  4PJM A;  2J46 A;  1IZM A;  2VH3 A;  5AC5 A;  2Q4F A;  3BRJ A;  3C18 A;  2Y3H A;  4MW8 A;  1PV3 A;  1XWJ A;  2W45 A;  1L7C A;  4BG0 A;  1ORY A;  1GM5 A;  1YZC A;  2OOC A;  4ULV A;  2IXP A;  1LS4 A;  4LAC B;  1O3U A;  5KYW A;  1ZZP A;  4XWJ A;  2V26 A;  3C8G B;  3E70 C;  4BJ6 A;  1G5Z A;  1BR4 A;  3K6B A;  3VAY A;  2EIN C;  2O9X A;  2IXM A;  1JMW A;  2XSE A;  3ABM C;  1OW6 A;  2HV6 A;  3G4Z A;  3MX3 A;  2PF4 E;  2Q7R A;  4AL0 A;  5A6A A;  1Y6D A;  1LI5 A;  5CIV A;  2J0X A;  4JVS A;  4K1O A;  3UGO A;  1QLE C;  3A11 A;  3RF3 A;  5A6B D;  2LFD A;  3C63 A;  3NKD A;  3RW0 A;  3DXJ F;  1N1C A;  1V55 C;  1M2V A;  1M57 C;  2Q9B A;  1VOM A;  3PDM P;  3EFO B;  1H6G A;  5BQH A;  3LS0 A;  3JSZ A;  1RKC A;  4K0D A;  4JTD B;  1MMG A;  1NU9 C;  1RJ9 B;  2EIJ C;  4PJN A;  2A0U A;  4W8K A;  3A9C A;  4CS8 A;  5L0F A;  4QI0 A;  4O6Y A;  1OQC A;  2BC5 A;  2Z15 A;  3EZH A;  3GM1 A;  4LER A;  3EGD A;  3PHF 2;  3LNM B;  4NTB A;  3DWW A;  4I3M A;  4P6I C;  1Z6A A;  4KBL A;  4ULW A;  3C62 A;  2A1D D;  2GFH A;  2OEV A;  4KC9 A;  4OIR F;  1H9T A;  1CPR A;  4G7H F;  4Q5S F;  4EIY A;  1K40 A;  4L6R A;  3JRT A;  4E0I A;  5JVE A;  2ZXR A;  4IRU A;  4U5D E;  2H7V C;  4E18 A;  4JW1 A;  3QZC A;  1CGN A;  3V5Y A;  5BQI A;  1VLS A;  3B9Q A;  4I1M A;  4JCZ A;  4N4W A;  3EH2 A;  2J8W A;  1JRA A;  1I4Y A;  1WAS A;  3LUT B;  5DQZ A;  1B68 A;  5DLJ A;  1KU2 A;  4BJ6 C;  3ATP A;  2R7X A;  3I5P A;  4GEH A;  4MVS A;  2HUJ A;  1WGW A;  3NG1 A;  4Z9I A;  1WAT A;  2F22 A;  1G4U S;  3GWN A;  3DZA A;  4YT5 A;  4Q7C A;  1OW7 A;  2GA0 A;  3QTH A;  5COG A;  2BE5 F;  2XLM A;  1YJG A;  3JT1 A;  3K7D A;  1YDI A;  4A4A A;  2DYS C;  4XEF A;  2WZL A;  4YT8 A;  3M79 A;  3L8J A;  4XEV A;  1JOG A;  4DJ9 A;  2FGY A;  2PX0 A;  1G8X A;  1LM3 B;  1TWC A;  2Q00 A;  4ANJ A;  3N2Z B;  3U2L A;  3R7C A;  1XZQ A;  1LS1 A;  2JD3 A;  5T3W A;  5E3A A;  1K04 A;  1BBH A;  1E2X A;  4DBQ A;  3FXH A;  2HJM A;  3ASO C;  4MTO A;  4RD9 A;  4C3D A;  4AL1 A;  3MYI A;  5L0G A;  2B0H A;  3L8I A;  2Q3T A;  1NSG B;  3ZIB A;  2NUP A;  3LNR A;  4JCH A;  3OEO A;  5L0D A;  3N24 A;  3Q7L A;  2G3V A;  3SXK A;  3UMH A;  5COF A;  4YT4 A;  3GM2 A;  2YRF A;  3LEO A;  4JZA A;  2WL8 A;  2HSB A;  1D1C A;  2LD6 A;  4PJL A;  1MMD A;  3WAQ A;  2YEV A;  4MW3 A;  5FZT A;  1EI7 A;  4BJ5 A;  3NYM A;  3DE9 A;  3L34 A;  1Q0G A;  4G0H A; 
#chains in the Genus database with same CATH homology
 3US6 A;  3KYI A;  1FR0 A;  4PAC A;  3IQT A;  4EUK B;  1WN0 A;  1QSP A;  1Y6D A;  3U3B A;  1C03 A;  1OXB A;  1OXK A;  2LCH A;  1BDJ B;  1SR2 A;  3KYJ A;  2LP4 A;  2A0B A;  4G78 A;  2R25 A;  2LD6 A;  1C02 A;  1TQG A;  2Q4F A;  3MYF A;  1A0B A;  1YVI A;  1I5N A;  2OOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...