1C03A

Crystal structure of ypd1p (triclinic form)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
167
structure length
163
Chain Sequence
STIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDEDDEEIKIKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords HYPOTHETICAL PROTEIN YDL235C
publication title Insights into eukaryotic multistep phosphorelay signal transduction revealed by the crystal structure of Ypd1p from Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 62
structure length 163
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1c03A00
1C02A 3US6A 4EUKB 1BDJB 2Q4FA 2A0BA 1YVIA 4PACA 1SR2A 1C03A 1A0BA 2LD6A 2LCHA 1WN0A 3KYJA 1TQGA 3IQTA 3U3BA 2OOCA 1OXKA 4G78A 1OXBA 3KYIA 2LP4A 1I5NA 3MYFA 1Y6DA 2R25A 1FR0A 1QSPA
chains in the Genus database with same CATH superfamily
3TOMA 3UGPA 4JURI 2G62A 1BR1A 4CX9A 3QMKA 3I4UA 5L0CA 1BDJB 2XSEA 3I5PA 2WVOA 2NUTA 1CPRA 3TK0A 1M2VA 3B0VC 2J8WA 3H65A 3UMKA 2HJ3A 5L3QA 4Q4ZF 3L34A 2DYSC 3MBGA 4JVSA 1FTSA 1WTYA 1JPNA 3BEHA 3VRCA 4DRJB 1V55C 3GM3A 2IYLD 4U5FE 4C7OA 1H6GA 3K33A 4I3MA 3LAYA 1O3UA 4EBBA 3O6XA 4JCZA 4PK4A 4XTKA 5DS6A 1OXKA 3DE8A 1Z5ZA 1H9GA 2Q9AA 4U9DA 3WG7C 5FZTA 3POVA 3JT1A 2Y3HA 3HNKA 4NTAA 2LIGA 2YZSA 2L6GA 3U2MA 2XS1A 4YT4A 2PBEA 3SXKA 2IM8A 3EZIA 3DMDA 2JX0A 2DYRC 4YL1A 3RH3A 1CGME 3K7DA 2W4BA 4IGGA 2KSFA 3NYLA 5E3AA 4MVMA 3V7OA 1MMGA 2G3KA 2J45A 3LUTB 1ORJA 1SR2A 1U89A 2LQGA 2LD6A 2Q7RA 2GWWA 3UNGC 3Q7GA 4H4KC 4YN0B 5F28E 2IXPA 3EGXB 1AVOB 1NFNA 1K04A 4AL0A 1MMAA 1NBBA 3GEEA 3LLIA 2PX0A 2XL4A 5EGYA 3DD7A 2DI3A 3Q6NA 5DLJA 3O39A 2LP4A 1OKKD 4MVQA 3EPVA 2GA0A 4W8PA 2H8AA 1FR0A 1A41A 2NPUA 3RIPA 1ZHXA 4QDLA 2ASRA 3QW0A 4JIOA 3SNHA 1APCA 3SXYA 3ZQVA 3C8ZA 3TOLA 1N1CA 2E87A 3OWTA 4YT2A 4RD9A 4CSAA 3EH2A 4PACA 1ORYA 2I8BA 2Y3BA 4MW3A 1A0BA 4L6RA 1OW7A 4FESA 4O6MA 5T1DB 2XLOA 2L6FA 3ZQYA 5DS4A 3HKKA 4JEBA 4U5BE 4ZLDA 1NG1A 3CEXA 3N2ZB 4I44A 1QVXA 1D0ZA 4LLCA 4U5HA 3NMIA 1QZXA 1SZIA 1VLSA 1AUEA 5A69A 2L81A 3Q6MA 4YL0A 5KYWB 3DM9B 3L8IA 1JPJA 2R25A 1VK5A 1O87A 2IXOA 4KNVA 1L3PA 2W45A 3RQEA 1LS1A 2P6VA 4MW8A 4K0DA 3ZSUA 1CGNA 4J7TA 1H9TA 3ZTMA 3NKEA 4EHPA 2W9YA 3O55A 2J7PA 3UR3C 1E83A 1LI5A 2QY9A 1JR8A 5B3IA 2L9JA 1YDIA 4JRZA 5EK0A 2O9XA 2L6HA 2YKZA 4MTFA 2B0JA 5A6BA 4OD4A 1CPQA 4CIHA 4QI2A 3LS0A 1E2XA 3FXHA 4DBRA 1Z63A 5L0FA 2R7QA 1VLTA 4U5EE 4CS8A 3EGDA 2Y39A 4JTDB 3WHNA 4BPMA 3S84A 2FFHA 3E9VA 5HV9A 3ABLC 1WASA 2EIKC 3DWWA 1LVKA 1FMVA 2LFFA 2HKVA 2OEVA 3JRMO 3KMIA 1ZYRF 3QVYA 3K1IA 3T6JA 1S7ZA 2Q9CA 2WZFA 3HLZA 3KKBA 3IQCA 3RQGA 3GANA 4CDAA 2KQ9A 5TJ5E 1RJ9B 1VB5A 2BE5F 4P6IC 1GGQA 2Y3GA 1VTMP 1Z3IX 2J0WA 4EBJA 3B0UX 3W8IA 3EH1A 3RQFA 1SF8A 5L0JA 2YL3A 4MVRA 5CI8A 4Z9HA 1BBHA 1E86A 3GODA 1L7CA 4DJ9A 2NUPB 2RD9A 256BA 3EQLF 3K6BA 2YQYA 3PMRA 3T6GB 3PHF2 3SP1A 5JT4A 3DI5A 2YLIA 2V26A 1OCCC 1HMDA 2AVKA 1JMWA 3Q7LA 5DVWA 4YWQA 1O5HA 4MNDA 4JE9A 1VMAA 4WGYA 1YZCA 3S28A 4MVOA 1KNYA 2M4EA 2XRHA 5AGFA 2R7RA 2CDQA 3B29A 1Z7Qc 2ICWG 4HEAJ 2QLAA 2XL8A 3TJ5A 4GYTA 3GM1A 3OA1A 1JOGA 1HE9A 2YRFA 3K1IC 2R7XA 4CS9C 3M79A 3G4ZA 3EHNA 4XEKA 3R2PA 3FAJA 4A2NB 2R02A 4G0HA 1J8YF 1Q0FA 3NMKA 5T3WA 3SYNA 5DQZA 3U8VA 4BJ6C 5DS5A 4DOZA 2VCCA 2R7WA 4G7HF 1B68A 4XWJA 3U3BA 3TD7A 3TJ6A 1G4WR 2F22A 2WVQA 2EINC 3EG9A 1Z6AA 2NUTB 1M2VB 2ZXWC 3EJNA 2D4UA 1HY5A 4JC7A 3HNJA 3JZ0A 4O6YA 3LEVA 2YHSA 3ASNC 5L3VA 2JPUA 2KK1A 4E7ZA 2A0UA 1C02A 1ZW2A 4C7OB 3US6A 1MNDA 3MX3A 3U0CA 3EG9B 4RBNA 5B3SC 2DB4A 4NY3A 3AG2C 1WOLA 2X51A 3AG1C 4ULWA 4CBEA 5AC5A 3NRHA 4D4XA 3GWLA 3UMHA 1LE2A 4DVYP 1V74B 2L7AA 1KU2A 3G50A 5BUOA 2QTVA 4XEFA 2CNWA 3DAGA 3C63A 3LNMB 3ZG1A 2QUPA 3ABKC 3FAPB 1VYKA 3S27A 4Q7CA 1XZQA 3VM6A 1FFHA 1EA8A 3DAFA 4PR9A 5E2QA 5F5HA 4JEAA 4AK9A 4K1OA 2M64A 3AGTA 3FVYA 2EPNA 3B9QA 1MMDA 1ZHZA 4WJ0A 4I1OB 3SEOA 3U5SA 4G7OF 4N06A 4JZAA 1WGWA 3M4BA 4F4BA 4E17A 5BQHA 1YJGA 1XZPA 2AWYA 2YLDA 2R7TA 2Q00A 2R7VA 1MQVA 4MVUA 3U2LA 1G5ZA 1FMWA 1T6IA 2J7PD 1T6QA 4QI0A 5D91A 2FAPB 1GQAA 1TWHA 4DRHB 5F5FA 2YEVA 1ZVZA 2EPMX 4JJFA 5A6BD 1MNEA 4E18A 5HSWA 4LACB 1TWCA 3JSZA 4JW1A 3JTLO 3O10A 4JKVA 4IWBA 5COFA 4YT5A 2LSEA 3F46A 4CIPA 4IB4A 1OQCA 3AOUA 3H2UA 4HE8D 1YLMA 2W4MA 3WAQA 4XQ1A 3L0IA 3X2QC 2KW3C 2VB6A 5L0IA 4U5CE 1W2WA 1RXQA 1I5NA 2J9WA 3DJNB 1CGOA 3S90A 4ANJA 3CZ6A 4A4AA 1ZU4A 2PX3A 3VYWA 2H7OA 1UG7A 4JJGA 4MVZA 4C3BA 2A1DD 1PV3A 2NG1A 4LERA 1SYQA 3PCVA 3IHUA 2NSGA 3ZVRA 3QTHA 5IY5C 3NDBB 1DOWA 1ORSC 4PJNA 3U9MA 4EKWA 2XS8A 4YL3A 3NMJA 1ZW3A 1ZZPA 3J06A 2PNOA 1M56C 1RKCA 4DRIB 1RKEA 1WN0A 1RCPA 3NKDA 3RKOF 1YYXA 4PFPA 2HMZA 2XLVA 3AQBA 4LDQA 3AG4C 1VOMA 3B0PA 1M6TA 4Z9JA 5B1BC 3RF3A 5L0DA 1LS4A 3ITFA 4DBQA 3W2WA 2OEXA 3NYJA 2P1AA 2XLEA 5BQGA 2MYSA 4DXWA 5KYYA 3EHMA 3SXZA 4CJGA 1RKEB 3CSKA 5JLIA 4CS9A 1S05A 2OJED 3GWNA 5CI9A 1YAUO 3C18A 4XEVA 3G4XA 3IQ5A 4BJTA 2A0BA 4BJ6A 3EGDB 2QE9A 3EFOA 4NTFA 4E7SA 3RYLA 4MTOA 4AE4A 2HSBA 2P7VA 4LDKA 3JRTA 3UMIA 1IW7F 1QKRA 2EIJC 5KYYB 1LPEA 2ZXRA 3AGUA 1G8XA 1J8MF 1H7IA 3ZC4A 5D92A 1OW6A 1M2OA 4KC9A 4K7BA 2OQMA 3U9JA 5BQIA 1HE1A 1I4ZA 1TFOB 4N6HA 5T3TA 2RSEB 1U0BB 1D1CA 4C3DA 3S0XA 1BR2A 1T9KA 2YVKA 2BC5A 1YYJA 2AU5A 3GEHA 3DE9A 3QZCA 3T6BA 4XPXA 4EWCA 3MFNA 2XLDA 3ECSA 5A6KA 3PDMP 4BJ5C 2KYHA 1AEPA 1RMVA 2YL0A 2XXAA 1TFKB 2XLHA 2J0XA 3HTKC 3EZHA 4IJJA 3S9OA 3C8GA 1D1AA 3SXMA 3V5YA 4EUKB 2OG2A 1TKNA 2Z15A 2HV6A 5JSLA 3V5XA 4NCQA 3KPHA 1HMOA 4D4NA 2ZXOA 1WATA 1QLEC 5B1AC 2A68F 3C62A 2G3VA 3TQOA 1JAFA 3VF0A 3KYJA 1HW1A 5GPGB 4Q5SF 4OIRF 3AJMA 4PJLA 3IQTA 1I4YA 2WZGA 3K66A 1LKXA 4MTGA 4KI2A 3C8GB 2CNWD 2R7SA 2HZ8A 2R7UA 2LFDA 2HFIA 3GORA 2OKUA 4OIQF 1PD1A 4R32A 1OXBA 4E0IA 4N4WA 5JRAA 4BJ1A 3M4CA 2WL8A 3LLKA 4NC3A 1G4US 3UGOA 1Y6DA 4XPYA 1NU9C 4YK5A 3JSEO 2EIMC 4B6IA 4FX5A 4C3EA 4CS7A 5KYNA 5KYXA 1PD0A 1OW8A 1A7VA 3T9OA 1F1MA 4AL1A 5DQTA 1NFOA 2GDCA 1BZ4A 1ZHYA 3M1CB 1A7EA 3ZIBA 5JS5A 1LM3B 1OCOC 2MWQA 1V4AA 2C04A 1BR4A 2HV7A 2EPLX 2PFDA 3CAXA 4KNWA 2CGEA 3W2VA 1FNTc 1R4TA 2Y3DA 4ER9A 4H54A 1GS9A 1QPUA 3FOPA 1YARO 2VCAA 2X0CA 3X1OA 4LDRA 5KYXB 2HJMA 2VH3A 5A6AA 1HW2A 2IOQA 4OIOF 1TWGA 2HSQA 2Q3TA 2PF4E 1NLXA 3LNRA 4PJJA 2CYDA 3BRJA 4MS2A 1WWPA 5KYUA 3CQZA 3ZWIA 3U3FA 1TWAA 2P61A 2NSFA 1NZEA 4M63A 4EBKA 2P0NA 5FCLA 1T5OA 1EKYA 2A69F 2J46A 3R7CA 3FOOA 2KGOA 1FFTC 3I5QA 3EGXA 1FAPB 3C7JA 4P9FA 5K0IA 3LEOA 2KC3A 2MHRA 4PFOA 4U9EA 2ZD9A 4HFFB 2IBFA 3ASOC 3MLGA 3SZRA 4NTBA 4DVZA 1QQ3A 4U5DE 4BG0A 1D0XA 1EQ1A 3RVZA 5KYUB 2Y69C 4PJMA 2WZLA 3RVYA 3LESA 2V3CC 1GM5A 2HUJA 3ATPA 1C03A 4ONSA 4O79A 5EHHA 2AP3A 2H7VC 4GQHA 1V54C 3GM2A 4YT8A 4ZLCA 1NU7D 2XL6A 2YL7A 3RW0A 3L1MA 4IRUA 3NYMA 1Q0DA 4UDVA 1XWJA 1JRAA 2YL1A 4JTCB 4MQ9F 2KJGA 3FDQA 5AC4A 2VASA 4KBLA 3KH2A 2H7BA 3B71A 3ZDLA 1R5ID 5A6JA 1T6UA 4E0HA 5JP7A 3TULA 4OIPF 2XM4A 5CIVA 1ZHTA 2R9RB 4CJOA 3KL4A 2BL2A 5KYWA 1YA7O 4GEHA 1DOVA 1OCZC 3IPMO 4Z9IA 2A6EF 2HMQA 2XLWA 2IXNA 5COMA 2ETSA 1TQGA 3LS1A 1C17M 4J7YA 2C03A 4LLEA 2UUIA 2HS5A 4G78A 1OKKA 2UUHA 4IAOA 3W8HA 4BJ5A 3KYIA 1YZAA 3DM5A 1D0YA 1OR2A 2GAQA 1LE4A 1Q0KA 3HNLA 1E85A 4U5GA 4P9TA 5L0HA 1OR3A 1YA9A 3N24A 1EI7A 1QSPA 2VCBA 4EIYA 4BEMJ 2EPKX 2TMVP 1ST6A 2WB7A 3QW1A 2OJQA 1TR2A 3AG3C 1Q0MA 3ABMC 3A9CA 2IXMA 3AQCA 3M15A 3VAYA 4CDVA 1D1BA 2R7OA 3C8GD 2CCYA 3GEIA 2DGJA 1T01A 3RFYA 1YVIA 2EPOA 3IQ6A 4RDAA 1IZMA 2XLMA 1M57C 1OCRC 2R05A 2VC9A 4JTAB 2LCHA 3QVZA 4FAPB 4OD5A 2FGYA 1RJ9A 1LIHA 2PP4A 3FHDA 2J9UA 4ULVA 4CDYA 5COGA 3WODF 3NG1A 4J30B 4CSAC 4FWVA 4WABA 3JYYA 4IAQA 4XLPF 1Q0GA 4O6NA 4O7GA 2I15A 4G7ZF 3EFOB 4N6CA 3HNIA 3U8PA 1ZU5A 4AE4B 4IARA 4JCHA 3E70C 3IEEA 3JYHA 3T4RA 2Q9BA 1LI7A 2YLGA 1KTMA 2GFHA 4XLNF 2WVNA 2NUPA 5E3CA 3W4YA 3DZAA 4HFKB 4XPWA 2CW0F 2Q4FA 3K1HA 3S29A 4J32B 2YWAA 1A7DA 3H2VA 1UFBA 2ZXPA 3FMSA 1K40A 3F47A 2A6HF 3L8JA 2OCCC 3LJBA 2D5RB 4YJWA 2QNLA 1Z23A 5L0GA 1MMNA 3OEOA 1K05A 4AX2A 1SMYF 4BEJA 1NSGB 2R03A 2ZPAA 3HJCA 4I1MA 2J9VA 2KNHA 1E84A 4X0RA 4NQFA 2OOCA 3JCUQ 2J9BA 4W8KA 2JD3A 5E33A 1VYIA 3ZTZA 1Y4CA 2XXAB 3N0TA 5JVEA 3V5ZA 4OINF 2LK4A 3MYIA 1PCXA 4MVSA 3MYFA 2OU6A 2XM0A 3DXJF 2EILC 2B0HA 2AWCA 3DKAA 3DJUB 5JUAA 4WGZA 4CS8C 1ZHWA 3A11A 1U6HA
chains in the Genus database with same CATH topology
1C02A 3US6A 4EUKB 1BDJB 2Q4FA 2A0BA 1YVIA 4PACA 1SR2A 1C03A 1A0BA 2LD6A 2LCHA 1WN0A 3KYJA 1TQGA 3IQTA 3U3BA 2OOCA 1OXKA 4G78A 1OXBA 3KYIA 2LP4A 1I5NA 3MYFA 1Y6DA 2R25A 1FR0A 1QSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C02 A;  3US6 A;  4EUK B;  1BDJ B;  2Q4F A;  2A0B A;  1YVI A;  4PAC A;  1SR2 A;  1C03 A;  1A0B A;  2LD6 A;  2LCH A;  1WN0 A;  3KYJ A;  1TQG A;  3IQT A;  3U3B A;  2OOC A;  1OXK A;  4G78 A;  1OXB A;  3KYI A;  2LP4 A;  1I5N A;  3MYF A;  1Y6D A;  2R25 A;  1FR0 A;  1QSP A; 
#chains in the Genus database with same CATH topology
 3TOM A;  3UGP A;  4JUR I;  2G62 A;  1BR1 A;  4CX9 A;  3QMK A;  3I4U A;  5L0C A;  1BDJ B;  2XSE A;  3I5P A;  2WVO A;  2NUT A;  1CPR A;  3TK0 A;  1M2V A;  3B0V C;  2J8W A;  3H65 A;  3UMK A;  2HJ3 A;  5L3Q A;  4Q4Z F;  3L34 A;  2DYS C;  3MBG A;  4JVS A;  1FTS A;  1WTY A;  1JPN A;  3BEH A;  3VRC A;  4DRJ B;  1V55 C;  3GM3 A;  2IYL D;  4U5F E;  4C7O A;  1H6G A;  3K33 A;  4I3M A;  3LAY A;  1O3U A;  4EBB A;  3O6X A;  4JCZ A;  4PK4 A;  4XTK A;  5DS6 A;  1OXK A;  3DE8 A;  1Z5Z A;  1H9G A;  2Q9A A;  4U9D A;  3WG7 C;  5FZT A;  3POV A;  3JT1 A;  2Y3H A;  3HNK A;  4NTA A;  2LIG A;  2YZS A;  2L6G A;  3U2M A;  2XS1 A;  4YT4 A;  2PBE A;  3SXK A;  2IM8 A;  3EZI A;  3DMD A;  2JX0 A;  2DYR C;  4YL1 A;  3RH3 A;  1CGM E;  3K7D A;  2W4B A;  4IGG A;  2KSF A;  3NYL A;  5E3A A;  4MVM A;  3V7O A;  1MMG A;  2G3K A;  2J45 A;  3LUT B;  1ORJ A;  1SR2 A;  1U89 A;  2LQG A;  2LD6 A;  2Q7R A;  2GWW A;  3UNG C;  3Q7G A;  4H4K C;  4YN0 B;  5F28 E;  2IXP A;  3EGX B;  1AVO B;  1NFN A;  1K04 A;  4AL0 A;  1MMA A;  1NBB A;  3GEE A;  3LLI A;  2PX0 A;  2XL4 A;  5EGY A;  3DD7 A;  2DI3 A;  3Q6N A;  5DLJ A;  3O39 A;  2LP4 A;  1OKK D;  4MVQ A;  3EPV A;  2GA0 A;  4W8P A;  2H8A A;  1FR0 A;  1A41 A;  2NPU A;  3RIP A;  1ZHX A;  4QDL A;  2ASR A;  3QW0 A;  4JIO A;  3SNH A;  1APC A;  3SXY A;  3ZQV A;  3C8Z A;  3TOL A;  1N1C A;  2E87 A;  3OWT A;  4YT2 A;  4RD9 A;  4CSA A;  3EH2 A;  4PAC A;  1ORY A;  2I8B A;  2Y3B A;  4MW3 A;  1A0B A;  4L6R A;  1OW7 A;  4FES A;  4O6M A;  5T1D B;  2XLO A;  2L6F A;  3ZQY A;  5DS4 A;  3HKK A;  4JEB A;  4U5B E;  4ZLD A;  1NG1 A;  3CEX A;  3N2Z B;  4I44 A;  1QVX A;  1D0Z A;  4LLC A;  4U5H A;  3NMI A;  1QZX A;  1SZI A;  1VLS A;  1AUE A;  5A69 A;  2L81 A;  3Q6M A;  4YL0 A;  5KYW B;  3DM9 B;  3L8I A;  1JPJ A;  2R25 A;  1VK5 A;  1O87 A;  2IXO A;  4KNV A;  1L3P A;  2W45 A;  3RQE A;  1LS1 A;  2P6V A;  4MW8 A;  4K0D A;  3ZSU A;  1CGN A;  4J7T A;  1H9T A;  3ZTM A;  3NKE A;  4EHP A;  2W9Y A;  3O55 A;  2J7P A;  3UR3 C;  1E83 A;  1LI5 A;  2QY9 A;  1JR8 A;  5B3I A;  2L9J A;  1YDI A;  4JRZ A;  5EK0 A;  2O9X A;  2L6H A;  2YKZ A;  4MTF A;  2B0J A;  5A6B A;  4OD4 A;  1CPQ A;  4CIH A;  4QI2 A;  3LS0 A;  1E2X A;  3FXH A;  4DBR A;  1Z63 A;  5L0F A;  2R7Q A;  1VLT A;  4U5E E;  4CS8 A;  3EGD A;  2Y39 A;  4JTD B;  3WHN A;  4BPM A;  3S84 A;  2FFH A;  3E9V A;  5HV9 A;  3ABL C;  1WAS A;  2EIK C;  3DWW A;  1LVK A;  1FMV A;  2LFF A;  2HKV A;  2OEV A;  3JRM O;  3KMI A;  1ZYR F;  3QVY A;  3K1I A;  3T6J A;  1S7Z A;  2Q9C A;  2WZF A;  3HLZ A;  3KKB A;  3IQC A;  3RQG A;  3GAN A;  4CDA A;  2KQ9 A;  5TJ5 E;  1RJ9 B;  1VB5 A;  2BE5 F;  4P6I C;  1GGQ A;  2Y3G A;  1VTM P;  1Z3I X;  2J0W A;  4EBJ A;  3B0U X;  3W8I A;  3EH1 A;  3RQF A;  1SF8 A;  5L0J A;  2YL3 A;  4MVR A;  5CI8 A;  4Z9H A;  1BBH A;  1E86 A;  3GOD A;  1L7C A;  4DJ9 A;  2NUP B;  2RD9 A;  256B A;  3EQL F;  3K6B A;  2YQY A;  3PMR A;  3T6G B;  3PHF 2;  3SP1 A;  5JT4 A;  3DI5 A;  2YLI A;  2V26 A;  1OCC C;  1HMD A;  2AVK A;  1JMW A;  3Q7L A;  5DVW A;  4YWQ A;  1O5H A;  4MND A;  4JE9 A;  1VMA A;  4WGY A;  1YZC A;  3S28 A;  4MVO A;  1KNY A;  2M4E A;  2XRH A;  5AGF A;  2R7R A;  2CDQ A;  3B29 A;  1Z7Q c;  2ICW G;  4HEA J;  2QLA A;  2XL8 A;  3TJ5 A;  4GYT A;  3GM1 A;  3OA1 A;  1JOG A;  1HE9 A;  2YRF A;  3K1I C;  2R7X A;  4CS9 C;  3M79 A;  3G4Z A;  3EHN A;  4XEK A;  3R2P A;  3FAJ A;  4A2N B;  2R02 A;  4G0H A;  1J8Y F;  1Q0F A;  3NMK A;  5T3W A;  3SYN A;  5DQZ A;  3U8V A;  4BJ6 C;  5DS5 A;  4DOZ A;  2VCC A;  2R7W A;  4G7H F;  1B68 A;  4XWJ A;  3U3B A;  3TD7 A;  3TJ6 A;  1G4W R;  2F22 A;  2WVQ A;  2EIN C;  3EG9 A;  1Z6A A;  2NUT B;  1M2V B;  2ZXW C;  3EJN A;  2D4U A;  1HY5 A;  4JC7 A;  3HNJ A;  3JZ0 A;  4O6Y A;  3LEV A;  2YHS A;  3ASN C;  5L3V A;  2JPU A;  2KK1 A;  4E7Z A;  2A0U A;  1C02 A;  1ZW2 A;  4C7O B;  3US6 A;  1MND A;  3MX3 A;  3U0C A;  3EG9 B;  4RBN A;  5B3S C;  2DB4 A;  4NY3 A;  3AG2 C;  1WOL A;  2X51 A;  3AG1 C;  4ULW A;  4CBE A;  5AC5 A;  3NRH A;  4D4X A;  3GWL A;  3UMH A;  1LE2 A;  4DVY P;  1V74 B;  2L7A A;  1KU2 A;  3G50 A;  5BUO A;  2QTV A;  4XEF A;  2CNW A;  3DAG A;  3C63 A;  3LNM B;  3ZG1 A;  2QUP A;  3ABK C;  3FAP B;  1VYK A;  3S27 A;  4Q7C A;  1XZQ A;  3VM6 A;  1FFH A;  1EA8 A;  3DAF A;  4PR9 A;  5E2Q A;  5F5H A;  4JEA A;  4AK9 A;  4K1O A;  2M64 A;  3AGT A;  3FVY A;  2EPN A;  3B9Q A;  1MMD A;  1ZHZ A;  4WJ0 A;  4I1O B;  3SEO A;  3U5S A;  4G7O F;  4N06 A;  4JZA A;  1WGW A;  3M4B A;  4F4B A;  4E17 A;  5BQH A;  1YJG A;  1XZP A;  2AWY A;  2YLD A;  2R7T A;  2Q00 A;  2R7V A;  1MQV A;  4MVU A;  3U2L A;  1G5Z A;  1FMW A;  1T6I A;  2J7P D;  1T6Q A;  4QI0 A;  5D91 A;  2FAP B;  1GQA A;  1TWH A;  4DRH B;  5F5F A;  2YEV A;  1ZVZ A;  2EPM X;  4JJF A;  5A6B D;  1MNE A;  4E18 A;  5HSW A;  4LAC B;  1TWC A;  3JSZ A;  4JW1 A;  3JTL O;  3O10 A;  4JKV A;  4IWB A;  5COF A;  4YT5 A;  2LSE A;  3F46 A;  4CIP A;  4IB4 A;  1OQC A;  3AOU A;  3H2U A;  4HE8 D;  1YLM A;  2W4M A;  3WAQ A;  4XQ1 A;  3L0I A;  3X2Q C;  2KW3 C;  2VB6 A;  5L0I A;  4U5C E;  1W2W A;  1RXQ A;  1I5N A;  2J9W A;  3DJN B;  1CGO A;  3S90 A;  4ANJ A;  3CZ6 A;  4A4A A;  1ZU4 A;  2PX3 A;  3VYW A;  2H7O A;  1UG7 A;  4JJG A;  4MVZ A;  4C3B A;  2A1D D;  1PV3 A;  2NG1 A;  4LER A;  1SYQ A;  3PCV A;  3IHU A;  2NSG A;  3ZVR A;  3QTH A;  5IY5 C;  3NDB B;  1DOW A;  1ORS C;  4PJN A;  3U9M A;  4EKW A;  2XS8 A;  4YL3 A;  3NMJ A;  1ZW3 A;  1ZZP A;  3J06 A;  2PNO A;  1M56 C;  1RKC A;  4DRI B;  1RKE A;  1WN0 A;  1RCP A;  3NKD A;  3RKO F;  1YYX A;  4PFP A;  2HMZ A;  2XLV A;  3AQB A;  4LDQ A;  3AG4 C;  1VOM A;  3B0P A;  1M6T A;  4Z9J A;  5B1B C;  3RF3 A;  5L0D A;  1LS4 A;  3ITF A;  4DBQ A;  3W2W A;  2OEX A;  3NYJ A;  2P1A A;  2XLE A;  5BQG A;  2MYS A;  4DXW A;  5KYY A;  3EHM A;  3SXZ A;  4CJG A;  1RKE B;  3CSK A;  5JLI A;  4CS9 A;  1S05 A;  2OJE D;  3GWN A;  5CI9 A;  1YAU O;  3C18 A;  4XEV A;  3G4X A;  3IQ5 A;  4BJT A;  2A0B A;  4BJ6 A;  3EGD B;  2QE9 A;  3EFO A;  4NTF A;  4E7S A;  3RYL A;  4MTO A;  4AE4 A;  2HSB A;  2P7V A;  4LDK A;  3JRT A;  3UMI A;  1IW7 F;  1QKR A;  2EIJ C;  5KYY B;  1LPE A;  2ZXR A;  3AGU A;  1G8X A;  1J8M F;  1H7I A;  3ZC4 A;  5D92 A;  1OW6 A;  1M2O A;  4KC9 A;  4K7B A;  2OQM A;  3U9J A;  5BQI A;  1HE1 A;  1I4Z A;  1TFO B;  4N6H A;  5T3T A;  2RSE B;  1U0B B;  1D1C A;  4C3D A;  3S0X A;  1BR2 A;  1T9K A;  2YVK A;  2BC5 A;  1YYJ A;  2AU5 A;  3GEH A;  3DE9 A;  3QZC A;  3T6B A;  4XPX A;  4EWC A;  3MFN A;  2XLD A;  3ECS A;  5A6K A;  3PDM P;  4BJ5 C;  2KYH A;  1AEP A;  1RMV A;  2YL0 A;  2XXA A;  1TFK B;  2XLH A;  2J0X A;  3HTK C;  3EZH A;  4IJJ A;  3S9O A;  3C8G A;  1D1A A;  3SXM A;  3V5Y A;  4EUK B;  2OG2 A;  1TKN A;  2Z15 A;  2HV6 A;  5JSL A;  3V5X A;  4NCQ A;  3KPH A;  1HMO A;  4D4N A;  2ZXO A;  1WAT A;  1QLE C;  5B1A C;  2A68 F;  3C62 A;  2G3V A;  3TQO A;  1JAF A;  3VF0 A;  3KYJ A;  1HW1 A;  5GPG B;  4Q5S F;  4OIR F;  3AJM A;  4PJL A;  3IQT A;  1I4Y A;  2WZG A;  3K66 A;  1LKX A;  4MTG A;  4KI2 A;  3C8G B;  2CNW D;  2R7S A;  2HZ8 A;  2R7U A;  2LFD A;  2HFI A;  3GOR A;  2OKU A;  4OIQ F;  1PD1 A;  4R32 A;  1OXB A;  4E0I A;  4N4W A;  5JRA A;  4BJ1 A;  3M4C A;  2WL8 A;  3LLK A;  4NC3 A;  1G4U S;  3UGO A;  1Y6D A;  4XPY A;  1NU9 C;  4YK5 A;  3JSE O;  2EIM C;  4B6I A;  4FX5 A;  4C3E A;  4CS7 A;  5KYN A;  5KYX A;  1PD0 A;  1OW8 A;  1A7V A;  3T9O A;  1F1M A;  4AL1 A;  5DQT A;  1NFO A;  2GDC A;  1BZ4 A;  1ZHY A;  3M1C B;  1A7E A;  3ZIB A;  5JS5 A;  1LM3 B;  1OCO C;  2MWQ A;  1V4A A;  2C04 A;  1BR4 A;  2HV7 A;  2EPL X;  2PFD A;  3CAX A;  4KNW A;  2CGE A;  3W2V A;  1FNT c;  1R4T A;  2Y3D A;  4ER9 A;  4H54 A;  1GS9 A;  1QPU A;  3FOP A;  1YAR O;  2VCA A;  2X0C A;  3X1O A;  4LDR A;  5KYX B;  2HJM A;  2VH3 A;  5A6A A;  1HW2 A;  2IOQ A;  4OIO F;  1TWG A;  2HSQ A;  2Q3T A;  2PF4 E;  1NLX A;  3LNR A;  4PJJ A;  2CYD A;  3BRJ A;  4MS2 A;  1WWP A;  5KYU A;  3CQZ A;  3ZWI A;  3U3F A;  1TWA A;  2P61 A;  2NSF A;  1NZE A;  4M63 A;  4EBK A;  2P0N A;  5FCL A;  1T5O A;  1EKY A;  2A69 F;  2J46 A;  3R7C A;  3FOO A;  2KGO A;  1FFT C;  3I5Q A;  3EGX A;  1FAP B;  3C7J A;  4P9F A;  5K0I A;  3LEO A;  2KC3 A;  2MHR A;  4PFO A;  4U9E A;  2ZD9 A;  4HFF B;  2IBF A;  3ASO C;  3MLG A;  3SZR A;  4NTB A;  4DVZ A;  1QQ3 A;  4U5D E;  4BG0 A;  1D0X A;  1EQ1 A;  3RVZ A;  5KYU B;  2Y69 C;  4PJM A;  2WZL A;  3RVY A;  3LES A;  2V3C C;  1GM5 A;  2HUJ A;  3ATP A;  1C03 A;  4ONS A;  4O79 A;  5EHH A;  2AP3 A;  2H7V C;  4GQH A;  1V54 C;  3GM2 A;  4YT8 A;  4ZLC A;  1NU7 D;  2XL6 A;  2YL7 A;  3RW0 A;  3L1M A;  4IRU A;  3NYM A;  1Q0D A;  4UDV A;  1XWJ A;  1JRA A;  2YL1 A;  4JTC B;  4MQ9 F;  2KJG A;  3FDQ A;  5AC4 A;  2VAS A;  4KBL A;  3KH2 A;  2H7B A;  3B71 A;  3ZDL A;  1R5I D;  5A6J A;  1T6U A;  4E0H A;  5JP7 A;  3TUL A;  4OIP F;  2XM4 A;  5CIV A;  1ZHT A;  2R9R B;  4CJO A;  3KL4 A;  2BL2 A;  5KYW A;  1YA7 O;  4GEH A;  1DOV A;  1OCZ C;  3IPM O;  4Z9I A;  2A6E F;  2HMQ A;  2XLW A;  2IXN A;  5COM A;  2ETS A;  1TQG A;  3LS1 A;  1C17 M;  4J7Y A;  2C03 A;  4LLE A;  2UUI A;  2HS5 A;  4G78 A;  1OKK A;  2UUH A;  4IAO A;  3W8H A;  4BJ5 A;  3KYI A;  1YZA A;  3DM5 A;  1D0Y A;  1OR2 A;  2GAQ A;  1LE4 A;  1Q0K A;  3HNL A;  1E85 A;  4U5G A;  4P9T A;  5L0H A;  1OR3 A;  1YA9 A;  3N24 A;  1EI7 A;  1QSP A;  2VCB A;  4EIY A;  4BEM J;  2EPK X;  2TMV P;  1ST6 A;  2WB7 A;  3QW1 A;  2OJQ A;  1TR2 A;  3AG3 C;  1Q0M A;  3ABM C;  3A9C A;  2IXM A;  3AQC A;  3M15 A;  3VAY A;  4CDV A;  1D1B A;  2R7O A;  3C8G D;  2CCY A;  3GEI A;  2DGJ A;  1T01 A;  3RFY A;  1YVI A;  2EPO A;  3IQ6 A;  4RDA A;  1IZM A;  2XLM A;  1M57 C;  1OCR C;  2R05 A;  2VC9 A;  4JTA B;  2LCH A;  3QVZ A;  4FAP B;  4OD5 A;  2FGY A;  1RJ9 A;  1LIH A;  2PP4 A;  3FHD A;  2J9U A;  4ULV A;  4CDY A;  5COG A;  3WOD F;  3NG1 A;  4J30 B;  4CSA C;  4FWV A;  4WAB A;  3JYY A;  4IAQ A;  4XLP F;  1Q0G A;  4O6N A;  4O7G A;  2I15 A;  4G7Z F;  3EFO B;  4N6C A;  3HNI A;  3U8P A;  1ZU5 A;  4AE4 B;  4IAR A;  4JCH A;  3E70 C;  3IEE A;  3JYH A;  3T4R A;  2Q9B A;  1LI7 A;  2YLG A;  1KTM A;  2GFH A;  4XLN F;  2WVN A;  2NUP A;  5E3C A;  3W4Y A;  3DZA A;  4HFK B;  4XPW A;  2CW0 F;  2Q4F A;  3K1H A;  3S29 A;  4J32 B;  2YWA A;  1A7D A;  3H2V A;  1UFB A;  2ZXP A;  3FMS A;  1K40 A;  3F47 A;  2A6H F;  3L8J A;  2OCC C;  3LJB A;  2D5R B;  4YJW A;  2QNL A;  1Z23 A;  5L0G A;  1MMN A;  3OEO A;  1K05 A;  4AX2 A;  1SMY F;  4BEJ A;  1NSG B;  2R03 A;  2ZPA A;  3HJC A;  4I1M A;  2J9V A;  2KNH A;  1E84 A;  4X0R A;  4NQF A;  2OOC A;  3JCU Q;  2J9B A;  4W8K A;  2JD3 A;  5E33 A;  1VYI A;  3ZTZ A;  1Y4C A;  2XXA B;  3N0T A;  5JVE A;  3V5Z A;  4OIN F;  2LK4 A;  3MYI A;  1PCX A;  4MVS A;  3MYF A;  2OU6 A;  2XM0 A;  3DXJ F;  2EIL C;  2B0H A;  2AWC A;  3DKA A;  3DJU B;  5JUA A;  4WGZ A;  4CS8 C;  1ZHW A;  3A11 A;  1U6H A; 
#chains in the Genus database with same CATH homology
 1C02 A;  3US6 A;  4EUK B;  1BDJ B;  2Q4F A;  2A0B A;  1YVI A;  4PAC A;  1SR2 A;  1C03 A;  1A0B A;  2LD6 A;  2LCH A;  1WN0 A;  3KYJ A;  1TQG A;  3IQT A;  3U3B A;  2OOC A;  1OXK A;  4G78 A;  1OXB A;  3KYI A;  2LP4 A;  1I5N A;  3MYF A;  1Y6D A;  2R25 A;  1FR0 A;  1QSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...