1B68A

Apolipoprotein e4 (apoe4), 22k fragment
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
140
structure length
138
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of the N-terminal domain of apolipoprotein E4 with heparin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
molecule keywords APOLIPOPROTEIN E
total genus 66
structure length 138
sequence length 140
ec nomenclature
pdb deposition date 1999-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1b68A00
1H7IA 1OR3A 1BZ4A 1LE4A 1NFOA 1B68A 1LS4A 1GS9A 2KC3A 1NFNA 1OR2A 3S84A 1EA8A 1AEPA 1LPEA 1LE2A 1EQ1A 3R2PA 1YA9A
chains in the Genus database with same CATH superfamily
2OOCA 4J32B 5KYXA 1K05A 2L6FA 3JRMO 1NBBA 2F22A 1WN0A 4DVZA 4JEBA 5KYYA 1D1BA 2Y39A 2L6GA 1TWCA 4MS2A 1PD0A 3UNGC 5D91A 4CS7A 3M4BA 3VYWA 4U5HA 1HE9A 3Q6NA 1YDIA 1WWPA 3CEXA 3M4CA 1T6IA 5KYUA 3GANA 1YJGA 4FESA 4KNWA 1A41A 3W2VA 5IY5C 1C02A 4E0IA 5L3QA 2J8WA 3FAPB 2MWQA 3JZ0A 2GFHA 3AG3C 1XZPA 3RQFA 4N6HA 1RKEA 1PCXA 1A0BA 2OJQA 3AGUA 2RSEB 1YZAA 3EFOA 3FOPA 1FAPB 4PFOA 1ST6A 2XLEA 4MVOA 3S9OA 4ER9A 3LAYA 1QQ3A 3TJ5A 4PFPA 5L0CA 2M64A 3RF3A 4C3EA 3SXZA 1Q0FA 2EIKC 1I4YA 3VAYA 1ZHXA 1MNEA 1YARO 2A68F 1MMDA 3EHNA 1RKEB 1MMNA 3EFOB 3HNJA 3IQTA 4JE9A 4OD4A 4M63A 3NMIA 2DB4A 4RDAA 3ZDLA 4BG0A 2L81A 4IB4A 3T6BA 3ZTZA 4LDKA 2G62A 5D92A 2L9JA 4IARA 4JW1A 2R7RA 3M15A 4NTBA 3DXJF 4WJ0A 3T4RA 1KU2A 2IM8A 2M4EA 4OIPF 3AJMA 1O87A 1O5HA 5L3VA 1CGNA 3DMDA 4YK5A 2P1AA 1LIHA 1TQGA 3JCUQ 4LACB 5E2QA 4DBRA 2YRFA 4BPMA 5A6BD 3HNKA 3DJNB 3C62A 3CZ6A 4BJTA 2XRHA 4MTGA 3E70C 4BJ5A 4BEJA 1BDJB 3HJCA 3MLGA 4J7YA 3W8HA 5CIVA 1BR4A 3LS1A 4JCHA 4OINF 5DS6A 3UGOA 4YJWA 2HUJA 3U8PA 3B0UX 2YEVA 3EG9B 4MVQA 4W8KA 1G4WR 1QVXA 1TFKB 1ZU5A 3DE9A 1VB5A 1QPUA 2OEXA 2XL4A 3B29A 2CCYA 3U0CA 1SZIA 3DAGA 3DJUB 1A7EA 1UG7A 2EILC 3AG4C 3LUTB 3NMJA 4YN0B 5T1DB 3WG7C 3JSEO 5AC5A 2R02A 2QY9A 3AG1C 3TQOA 1QZXA 2LP4A 1KTMA 3LLIA 2J7PA 4FWVA 1A7VA 5KYNA 4I44A 3LESA 4N6CA 1ZHTA 5JSLA 4CDYA 2WZGA 1RCPA 2PX3A 2UUHA 2A69F 5JT4A 3BRJA 3CQZA 4YL0A 4GEHA 1MMAA 5F5FA 3ASNC 4CDAA 3JSZA 4GQHA 4YT8A 3K1HA 1EA8A 1FMVA 5JRAA 4CBEA 3KPHA 3JTLO 4NCQA 4Q4ZF 3AQBA 2YZSA 2ZXRA 4XTKA 2IXMA 4C7OB 2B0HA 4CJOA 1MMGA 5E3AA 4KNVA 4W8PA 3C63A 1WTYA 5L0HA 3U9MA 5AGFA 4JZAA 3AG2C 2J9BA 4PACA 4DJ9A 2R7OA 2MYSA 2LK4A 1D1AA 1SF8A 2OEVA 1W2WA 4JTAB 2IOQA 1OW7A 2ZD9A 5DQTA 1WATA 1D0ZA 3NRHA 3K1IA 2NUTA 4JTCB 1NU7D 1GQAA 2CNWD 4Z9IA 2X0CA 5COFA 3W4YA 3ZC4A 3QW1A 2NPUA 2OQMA 1VLSA 4P6IC 1Q0KA 4FAPB 3V5XA 5L0DA 1EQ1A 3FMSA 1L3PA 2R7SA 1Z3IX 3DM5A 4PR9A 4J7TA 4RBNA 5KYWB 2IXOA 3NYJA 3BEHA 1T6UA 2W45A 2LQGA 5F5HA 3FDQA 1ZU4A 1OXKA 1NLXA 4G7OF 3RW0A 1Z5ZA 4U5BE 2XLVA 3HTKC 3LLKA 1JMWA 1ZVZA 2R9RB 1OCOC 2VCCA 1YA9A 2E87A 2R7VA 1YA7O 2W4MA 2J9UA 2HJ3A 1H6GA 3UMKA 4CS9C 4H54A 1IZMA 3W8IA 4JJFA 1ZHYA 3ABLC 1RJ9A 2CYDA 3A11A 3AOUA 3B71A 3EH2A 2GDCA 2OG2A 4FX5A 1CGME 1AUEA 1S05A 4HFKB 4MVSA 1FFHA 2LFFA 5A6KA 1KNYA 1Z6AA 3EGDB 4IRUA 3K33A 1E84A 1BBHA 4G7HF 2A1DD 4ZLDA 1OQCA 2WB7A 2P0NA 1BR2A 1HE1A 3RQEA 1LS4A 4WABA 3U2MA 3NDBB 3US6A 4CSAA 1E2XA 3JYHA 1C17M 4XWJA 4RD9A 1C03A 3F47A 2A6HF 4XEVA 5EHHA 3SXKA 4IGGA 1TR2A 4MVRA 1Y6DA 2DYSC 2FAPB 5T3TA 1TWHA 2YL1A 4PJLA 4PJMA 4U5FE 4DVYP 3LNMB 5K0IA 4G7ZF 2YLIA 2BE5F 2EPNA 3IQ6A 2YLGA 2LCHA 3NKEA 5COGA 4EWCA 4HEAJ 3K6BA 1TWAA 4MW3A 4ANJA 3CAXA 4OIQF 4JJGA 1SYQA 1U89A 1XWJA 2WZLA 3EHMA 2GAQA 1Z23A 3FOOA 1O3UA 1LKXA 4I1OB 5TJ5E 3RYLA 3MBGA 3MYIA 4JRZA 4AE4B 3QW0A 4XPWA 4E17A 3DWWA 4L6RA 2QE9A 3RVYA 4CX9A 1JOGA 4AL1A 3Q7LA 4BJ1A 2YQYA 3L8JA 5L0FA 2Q9BA 3QTHA 2XLDA 5BQIA 2KJGA 4LDRA 5JVEA 2HV6A 1NU9C 1FFTC 2L6HA 2XLMA 3O10A 2CGEA 4XEFA 4C3DA 3QZCA 2JX0A 4KC9A 3NYLA 3RKOF 2A0BA 3DM9B 3JYYA 3ZWIA 4D4XA 3FHDA 4AK9A 4YL1A 4DRHB 1FR0A 3H65A 3KYIA 2BL2A 2J7PD 3EGXB 1FTSA 2RD9A 3QVYA 2AU5A 3RQGA 1YZCA 4A2NB 4ZLCA 2OKUA 4BJ5C 2YHSA 5L0JA 1VTMP 4I1MA 1OW6A 2VCAA 4NC3A 1H7IA 4CS9A 3B0VC 3B0PA 3O39A 4X0RA 1GGQA 2R7XA 4C3BA 4ULWA 2JD3A 3M1CB 2WL8A 4JTDB 2Y3HA 4OIOF 2XM4A 4DOZA 1HMOA 3B9QA 2Y69C 3HNLA 2DGJA 3MFNA 2VH3A 2YLDA 3VRCA 5EGYA 1E85A 5HSWA 4R32A 3RVZA 3JRTA 3POVA 2NUPB 4E18A 1ORYA 2QLAA 2OU6A 4JC7A 4NQFA 1Z7Qc 2PNOA 5DVWA 3IEEA 5L0GA 2IXPA 2ICWG 3ATPA 1OR2A 2DI3A 1VYIA 4JVSA 1YYJA 3J06A 4U5EE 3O55A 4WGYA 4O7GA 2PX0A 3GWLA 1YVIA 2NUPA 2EPLX 2FGYA 2G3KA 3H2UA 5KYUB 2WVOA 1YYXA 2XLOA 3R2PA 3T6JA 1OR3A 1LE4A 2BC5A 1OCCC 2R25A 4PJJA 2Q00A 4LLEA 5DQZA 5FZTA 3M79A 5KYXB 2IBFA 1J8YF 2Q9CA 2VCBA 1IW7F 1CGOA 1QKRA 2KGOA 1GS9A 5KYYB 1HW2A 3RIPA 3QVZA 4CS8C 2Q4FA 256BA 4JIOA 1FMWA 5A6AA 2HV7A 3IQCA 1G8XA 1YLMA 1VOMA 2WVQA 3ABKC 3LS0A 4U9EA 2PP4A 3S27A 2D4UA 5DS5A 3RH3A 1ZW3A 4XPYA 3I5PA 4UDVA 2W9YA 3ABMC 3I5QA 3HNIA 3NYMA 5BQHA 3K66A 2O9XA 2C03A 2ZPAA 3DZAA 2Q7RA 1HMDA 2JPUA 2R7UA 3NG1A 3GORA 4JCZA 1NSGB 3ZIBA 3OWTA 5F28E 4D4NA 3FAJA 3GM1A 2CDQA 3ITFA 4IWBA 4CIHA 1F1MA 2VASA 3U3BA 3VM6A 3AQCA 2G3VA 2R05A 2EIMC 2Y3BA 1R4TA 2YL7A 3A9CA 3EPVA 3HLZA 2V26A 3IHUA 4AL0A 3K1IC 1K04A 2B0JA 2NSGA 4ULVA 1XZQA 2AWYA 2C04A 5E3CA 2ZXWC 1ZHWA 3G4ZA 4EBBA 3C8GB 5BQGA 3V5YA 3PHF2 4Z9HA 2V3CC 3AGTA 4EKWA 1V54C 2GWWA 2P6VA 2YWAA 3GM3A 3JT1A 3OA1A 3X1OA 2H7OA 2Y3GA 3KL4A 3L34A 4E0HA 4LLCA 4A4AA 3S90A 3NMKA 3TK0A 2XS8A 3GEEA 3GODA 2I15A 1TKNA 1ZHZA 2EPKX 1TWGA 1U0BB 3C8GA 3FXHA 4DRJB 3RFYA 3U9JA 1OKKD 4CS8A 2QTVA 1DOVA 2KNHA 4XQ1A 2R7TA 4IAOA 3O6XA 1EKYA 2VC9A 4JURI 4YWQA 1Q0MA 2D5RB 3CSKA 3U3FA 4EBKA 3N2ZB 3PCVA 3MX3A 3DKAA 1CPRA 4P9TA 1RMVA 1VK5A 1ORJA 4DRIB 2R03A 3EG9A 3ZSUA 5B3SC 2HKVA 2KC3A 2KSFA 2UUIA 1WGWA 5DLJA 1S7ZA 4I3MA 3WHNA 1JPNA 1UFBA 2XSEA 3LNRA 3U5SA 2H8AA 4K7BA 1J8MF 4U5DE 1E86A 1B68A 4O6YA 4Q5SF 2A6EF 3DAFA 3G4XA 4XPXA 3EJNA 3WODF 5B1AC 1OKKA 2IXNA 2YL3A 1APCA 2L7AA 4MQ9F 4QDLA 5CI9A 1E83A 3ASOC 4XLNF 1WOLA 1HY5A 2DYRC 3IPMO 1T9KA 3L8IA 5GPGB 3NKDA 2J46A 3C8ZA 4MVZA 1HW1A 3E9VA 3FVYA 2NG1A 3VF0A 4DXWA 4YT4A 2HSQA 1M57C 4O6MA 2H7VC 4B6IA 1MQVA 3PMRA 3ECSA 2PFDA 2YVKA 2EINC 4KBLA 2YL0A 4MVMA 4C7OA 3L1MA 3ZQYA 1Q0DA 4MVUA 3UMHA 4MW8A 2EIJC 1ORSC 5L0IA 2XLWA 1Z63A 3U2LA 3N0TA 4JKVA 5A69A 3H2VA 2ETSA 5FCLA 4EIYA 2I8BA 2OJED 2AP3A 2VB6A 3DD7A 4NTAA 5EK0A 3G50A 3SXMA 3EH1A 5KYWA 1N1CA 5JUAA 3KYJA 1NG1A 3L0IA 4IAQA 2J45A 4O6NA 4AX2A 3V5ZA 4N06A 1U6HA 1V55C 2LIGA 3SYNA 4HFFB 1JRAA 3TD7A 2NUTB 4JEAA 5A6BA 1H9TA 1I4ZA 1M56C 2HZ8A 5B1BC 1LPEA 1V74B 2FFHA 3TOLA 5A6JA 3SEOA 1CPQA 1M6TA 1LM3B 1PV3A 1QSPA 1VLTA 3C18A 3Q6MA 4U5CE 4EBJA 4QI2A 4QI0A 1AEPA 4H4KC 5AC4A 4CJGA 1LI7A 2HMZA 1BZ4A 2LD6A 2IYLD 3ZG1A 2AVKA 2Q3TA 2YKZA 1ZW2A 2QUPA 3EZHA 3GEHA 3IQ5A 1RXQA 3LEOA 4P9FA 2J0WA 1Y4CA 3SZRA 4E7ZA 2R7WA 2KQ9A 2WZFA 4CIPA 2HMQA 1H9GA 3LJBA 1AVOB 2Z15A 4MTOA 2EPOA 4YL3A 3N24A 3I4UA 1G4US 5HV9A 1RJ9B 4BEMJ 1I5NA 3KMIA 2XXAA 1JR8A 4MTFA 4PJNA 3GM2A 3EGDA 3ZTMA 1Q0GA 1SR2A 1JAFA 2WVNA 3S29A 1OXBA 4GYTA 3WAQA 1DOWA 1PD1A 2KYHA 2P7VA 3KH2A 3PDMP 1RKCA 1BR1A 1M2VB 2HSBA 4YT5A 3SP1A 3V7OA 2P61A 4OIRF 2XXAB 1JPJA 3OEOA 1OW8A 1NFNA 5JP7A 3Q7GA 4EHPA 4LDQA 2J9WA 3T9OA 2J9VA 1TFOB 5CI8A 2XM0A 4BJ6A 3X2QC 2MHRA 1ZYRF 4BJ6C 3TJ6A 1T01A 1LS1A 1M2VA 4U9DA 3SXYA 2CNWA 5T3WA 2X51A 3UR3C 2KK1A 2A0UA 2XL8A 5DS4A 3LEVA 2PBEA 5JS5A 4MNDA 1YAUO 1G5ZA 1LI5A 2ZXOA 4Q7CA 3SNHA 5BUOA 1A7DA 2XL6A 1V4AA 1VMAA 3F46A 3C8GD 4AE4A 4LERA 1NZEA 4O79A 1GM5A 1MNDA 3U8VA 1D0XA 1VYKA 2HFIA 2R7QA 3GEIA 3KKBA 2J0XA 3MYFA 3R7CA 1QLEC 4G0HA 4XEKA 4G78A 5JLIA 3C7JA 2AWCA 3UGPA 1SMYF 1WASA 3T6GB 2QNLA 3ZQVA 3TULA 1OCZC 2EPMX 2NSFA 4CSAC 5B3IA 1L7CA 1OCRC 3DE8A 2LSEA 3K7DA 3S84A 2H7BA 4N4WA 3S28A 1LE2A 2HJMA 2W4BA 4ONSA 1ZZPA 4IJJA 2CW0F 4OD5A 3W2WA 4XLPF 2LFDA 4U5GA 1M2OA 2PF4E 3GWNA 4EUKB 2TMVP 4J30B 1D1CA 2GA0A 2HS5A 1T5OA 3EZIA 5E33A 3ZVRA 3EGXA 2Y3DA 4YT2A 1FNTc 1D0YA 1NFOA 1R5ID 4PK4A 1T6QA 3QMKA 3TOMA 4DBQA 4KI2A 4HE8D 4F4BA 4NTFA 2KW3C 4Z9JA 2XLHA 3EQLF 2OCCC 1K40A 2ZXPA 4K0DA 2ASRA 3DI5A 4NY3A 1LVKA 3S0XA 1EI7A 2Q9AA 4K1OA 4WGZA 4CDVA 4E7SA 3HKKA 2XS1A 5COMA 3UMIA
chains in the Genus database with same CATH topology
1H7IA 1OR3A 1BZ4A 1LE4A 1NFOA 1B68A 1LS4A 1GS9A 2KC3A 1NFNA 1OR2A 3S84A 1EA8A 1AEPA 1LPEA 1LE2A 1EQ1A 3R2PA 1YA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7I A;  1OR3 A;  1BZ4 A;  1LE4 A;  1NFO A;  1B68 A;  1LS4 A;  1GS9 A;  2KC3 A;  1NFN A;  1OR2 A;  3S84 A;  1EA8 A;  1AEP A;  1LPE A;  1LE2 A;  1EQ1 A;  3R2P A;  1YA9 A; 
#chains in the Genus database with same CATH topology
 2OOC A;  4J32 B;  5KYX A;  1K05 A;  2L6F A;  3JRM O;  1NBB A;  2F22 A;  1WN0 A;  4DVZ A;  4JEB A;  5KYY A;  1D1B A;  2Y39 A;  2L6G A;  1TWC A;  4MS2 A;  1PD0 A;  3UNG C;  5D91 A;  4CS7 A;  3M4B A;  3VYW A;  4U5H A;  1HE9 A;  3Q6N A;  1YDI A;  1WWP A;  3CEX A;  3M4C A;  1T6I A;  5KYU A;  3GAN A;  1YJG A;  4FES A;  4KNW A;  1A41 A;  3W2V A;  5IY5 C;  1C02 A;  4E0I A;  5L3Q A;  2J8W A;  3FAP B;  2MWQ A;  3JZ0 A;  2GFH A;  3AG3 C;  1XZP A;  3RQF A;  4N6H A;  1RKE A;  1PCX A;  1A0B A;  2OJQ A;  3AGU A;  2RSE B;  1YZA A;  3EFO A;  3FOP A;  1FAP B;  4PFO A;  1ST6 A;  2XLE A;  4MVO A;  3S9O A;  4ER9 A;  3LAY A;  1QQ3 A;  3TJ5 A;  4PFP A;  5L0C A;  2M64 A;  3RF3 A;  4C3E A;  3SXZ A;  1Q0F A;  2EIK C;  1I4Y A;  3VAY A;  1ZHX A;  1MNE A;  1YAR O;  2A68 F;  1MMD A;  3EHN A;  1RKE B;  1MMN A;  3EFO B;  3HNJ A;  3IQT A;  4JE9 A;  4OD4 A;  4M63 A;  3NMI A;  2DB4 A;  4RDA A;  3ZDL A;  4BG0 A;  2L81 A;  4IB4 A;  3T6B A;  3ZTZ A;  4LDK A;  2G62 A;  5D92 A;  2L9J A;  4IAR A;  4JW1 A;  2R7R A;  3M15 A;  4NTB A;  3DXJ F;  4WJ0 A;  3T4R A;  1KU2 A;  2IM8 A;  2M4E A;  4OIP F;  3AJM A;  1O87 A;  1O5H A;  5L3V A;  1CGN A;  3DMD A;  4YK5 A;  2P1A A;  1LIH A;  1TQG A;  3JCU Q;  4LAC B;  5E2Q A;  4DBR A;  2YRF A;  4BPM A;  5A6B D;  3HNK A;  3DJN B;  3C62 A;  3CZ6 A;  4BJT A;  2XRH A;  4MTG A;  3E70 C;  4BJ5 A;  4BEJ A;  1BDJ B;  3HJC A;  3MLG A;  4J7Y A;  3W8H A;  5CIV A;  1BR4 A;  3LS1 A;  4JCH A;  4OIN F;  5DS6 A;  3UGO A;  4YJW A;  2HUJ A;  3U8P A;  3B0U X;  2YEV A;  3EG9 B;  4MVQ A;  4W8K A;  1G4W R;  1QVX A;  1TFK B;  1ZU5 A;  3DE9 A;  1VB5 A;  1QPU A;  2OEX A;  2XL4 A;  3B29 A;  2CCY A;  3U0C A;  1SZI A;  3DAG A;  3DJU B;  1A7E A;  1UG7 A;  2EIL C;  3AG4 C;  3LUT B;  3NMJ A;  4YN0 B;  5T1D B;  3WG7 C;  3JSE O;  5AC5 A;  2R02 A;  2QY9 A;  3AG1 C;  3TQO A;  1QZX A;  2LP4 A;  1KTM A;  3LLI A;  2J7P A;  4FWV A;  1A7V A;  5KYN A;  4I44 A;  3LES A;  4N6C A;  1ZHT A;  5JSL A;  4CDY A;  2WZG A;  1RCP A;  2PX3 A;  2UUH A;  2A69 F;  5JT4 A;  3BRJ A;  3CQZ A;  4YL0 A;  4GEH A;  1MMA A;  5F5F A;  3ASN C;  4CDA A;  3JSZ A;  4GQH A;  4YT8 A;  3K1H A;  1EA8 A;  1FMV A;  5JRA A;  4CBE A;  3KPH A;  3JTL O;  4NCQ A;  4Q4Z F;  3AQB A;  2YZS A;  2ZXR A;  4XTK A;  2IXM A;  4C7O B;  2B0H A;  4CJO A;  1MMG A;  5E3A A;  4KNV A;  4W8P A;  3C63 A;  1WTY A;  5L0H A;  3U9M A;  5AGF A;  4JZA A;  3AG2 C;  2J9B A;  4PAC A;  4DJ9 A;  2R7O A;  2MYS A;  2LK4 A;  1D1A A;  1SF8 A;  2OEV A;  1W2W A;  4JTA B;  2IOQ A;  1OW7 A;  2ZD9 A;  5DQT A;  1WAT A;  1D0Z A;  3NRH A;  3K1I A;  2NUT A;  4JTC B;  1NU7 D;  1GQA A;  2CNW D;  4Z9I A;  2X0C A;  5COF A;  3W4Y A;  3ZC4 A;  3QW1 A;  2NPU A;  2OQM A;  1VLS A;  4P6I C;  1Q0K A;  4FAP B;  3V5X A;  5L0D A;  1EQ1 A;  3FMS A;  1L3P A;  2R7S A;  1Z3I X;  3DM5 A;  4PR9 A;  4J7T A;  4RBN A;  5KYW B;  2IXO A;  3NYJ A;  3BEH A;  1T6U A;  2W45 A;  2LQG A;  5F5H A;  3FDQ A;  1ZU4 A;  1OXK A;  1NLX A;  4G7O F;  3RW0 A;  1Z5Z A;  4U5B E;  2XLV A;  3HTK C;  3LLK A;  1JMW A;  1ZVZ A;  2R9R B;  1OCO C;  2VCC A;  1YA9 A;  2E87 A;  2R7V A;  1YA7 O;  2W4M A;  2J9U A;  2HJ3 A;  1H6G A;  3UMK A;  4CS9 C;  4H54 A;  1IZM A;  3W8I A;  4JJF A;  1ZHY A;  3ABL C;  1RJ9 A;  2CYD A;  3A11 A;  3AOU A;  3B71 A;  3EH2 A;  2GDC A;  2OG2 A;  4FX5 A;  1CGM E;  1AUE A;  1S05 A;  4HFK B;  4MVS A;  1FFH A;  2LFF A;  5A6K A;  1KNY A;  1Z6A A;  3EGD B;  4IRU A;  3K33 A;  1E84 A;  1BBH A;  4G7H F;  2A1D D;  4ZLD A;  1OQC A;  2WB7 A;  2P0N A;  1BR2 A;  1HE1 A;  3RQE A;  1LS4 A;  4WAB A;  3U2M A;  3NDB B;  3US6 A;  4CSA A;  1E2X A;  3JYH A;  1C17 M;  4XWJ A;  4RD9 A;  1C03 A;  3F47 A;  2A6H F;  4XEV A;  5EHH A;  3SXK A;  4IGG A;  1TR2 A;  4MVR A;  1Y6D A;  2DYS C;  2FAP B;  5T3T A;  1TWH A;  2YL1 A;  4PJL A;  4PJM A;  4U5F E;  4DVY P;  3LNM B;  5K0I A;  4G7Z F;  2YLI A;  2BE5 F;  2EPN A;  3IQ6 A;  2YLG A;  2LCH A;  3NKE A;  5COG A;  4EWC A;  4HEA J;  3K6B A;  1TWA A;  4MW3 A;  4ANJ A;  3CAX A;  4OIQ F;  4JJG A;  1SYQ A;  1U89 A;  1XWJ A;  2WZL A;  3EHM A;  2GAQ A;  1Z23 A;  3FOO A;  1O3U A;  1LKX A;  4I1O B;  5TJ5 E;  3RYL A;  3MBG A;  3MYI A;  4JRZ A;  4AE4 B;  3QW0 A;  4XPW A;  4E17 A;  3DWW A;  4L6R A;  2QE9 A;  3RVY A;  4CX9 A;  1JOG A;  4AL1 A;  3Q7L A;  4BJ1 A;  2YQY A;  3L8J A;  5L0F A;  2Q9B A;  3QTH A;  2XLD A;  5BQI A;  2KJG A;  4LDR A;  5JVE A;  2HV6 A;  1NU9 C;  1FFT C;  2L6H A;  2XLM A;  3O10 A;  2CGE A;  4XEF A;  4C3D A;  3QZC A;  2JX0 A;  4KC9 A;  3NYL A;  3RKO F;  2A0B A;  3DM9 B;  3JYY A;  3ZWI A;  4D4X A;  3FHD A;  4AK9 A;  4YL1 A;  4DRH B;  1FR0 A;  3H65 A;  3KYI A;  2BL2 A;  2J7P D;  3EGX B;  1FTS A;  2RD9 A;  3QVY A;  2AU5 A;  3RQG A;  1YZC A;  4A2N B;  4ZLC A;  2OKU A;  4BJ5 C;  2YHS A;  5L0J A;  1VTM P;  4I1M A;  1OW6 A;  2VCA A;  4NC3 A;  1H7I A;  4CS9 A;  3B0V C;  3B0P A;  3O39 A;  4X0R A;  1GGQ A;  2R7X A;  4C3B A;  4ULW A;  2JD3 A;  3M1C B;  2WL8 A;  4JTD B;  2Y3H A;  4OIO F;  2XM4 A;  4DOZ A;  1HMO A;  3B9Q A;  2Y69 C;  3HNL A;  2DGJ A;  3MFN A;  2VH3 A;  2YLD A;  3VRC A;  5EGY A;  1E85 A;  5HSW A;  4R32 A;  3RVZ A;  3JRT A;  3POV A;  2NUP B;  4E18 A;  1ORY A;  2QLA A;  2OU6 A;  4JC7 A;  4NQF A;  1Z7Q c;  2PNO A;  5DVW A;  3IEE A;  5L0G A;  2IXP A;  2ICW G;  3ATP A;  1OR2 A;  2DI3 A;  1VYI A;  4JVS A;  1YYJ A;  3J06 A;  4U5E E;  3O55 A;  4WGY A;  4O7G A;  2PX0 A;  3GWL A;  1YVI A;  2NUP A;  2EPL X;  2FGY A;  2G3K A;  3H2U A;  5KYU B;  2WVO A;  1YYX A;  2XLO A;  3R2P A;  3T6J A;  1OR3 A;  1LE4 A;  2BC5 A;  1OCC C;  2R25 A;  4PJJ A;  2Q00 A;  4LLE A;  5DQZ A;  5FZT A;  3M79 A;  5KYX B;  2IBF A;  1J8Y F;  2Q9C A;  2VCB A;  1IW7 F;  1CGO A;  1QKR A;  2KGO A;  1GS9 A;  5KYY B;  1HW2 A;  3RIP A;  3QVZ A;  4CS8 C;  2Q4F A;  256B A;  4JIO A;  1FMW A;  5A6A A;  2HV7 A;  3IQC A;  1G8X A;  1YLM A;  1VOM A;  2WVQ A;  3ABK C;  3LS0 A;  4U9E A;  2PP4 A;  3S27 A;  2D4U A;  5DS5 A;  3RH3 A;  1ZW3 A;  4XPY A;  3I5P A;  4UDV A;  2W9Y A;  3ABM C;  3I5Q A;  3HNI A;  3NYM A;  5BQH A;  3K66 A;  2O9X A;  2C03 A;  2ZPA A;  3DZA A;  2Q7R A;  1HMD A;  2JPU A;  2R7U A;  3NG1 A;  3GOR A;  4JCZ A;  1NSG B;  3ZIB A;  3OWT A;  5F28 E;  4D4N A;  3FAJ A;  3GM1 A;  2CDQ A;  3ITF A;  4IWB A;  4CIH A;  1F1M A;  2VAS A;  3U3B A;  3VM6 A;  3AQC A;  2G3V A;  2R05 A;  2EIM C;  2Y3B A;  1R4T A;  2YL7 A;  3A9C A;  3EPV A;  3HLZ A;  2V26 A;  3IHU A;  4AL0 A;  3K1I C;  1K04 A;  2B0J A;  2NSG A;  4ULV A;  1XZQ A;  2AWY A;  2C04 A;  5E3C A;  2ZXW C;  1ZHW A;  3G4Z A;  4EBB A;  3C8G B;  5BQG A;  3V5Y A;  3PHF 2;  4Z9H A;  2V3C C;  3AGT A;  4EKW A;  1V54 C;  2GWW A;  2P6V A;  2YWA A;  3GM3 A;  3JT1 A;  3OA1 A;  3X1O A;  2H7O A;  2Y3G A;  3KL4 A;  3L34 A;  4E0H A;  4LLC A;  4A4A A;  3S90 A;  3NMK A;  3TK0 A;  2XS8 A;  3GEE A;  3GOD A;  2I15 A;  1TKN A;  1ZHZ A;  2EPK X;  1TWG A;  1U0B B;  3C8G A;  3FXH A;  4DRJ B;  3RFY A;  3U9J A;  1OKK D;  4CS8 A;  2QTV A;  1DOV A;  2KNH A;  4XQ1 A;  2R7T A;  4IAO A;  3O6X A;  1EKY A;  2VC9 A;  4JUR I;  4YWQ A;  1Q0M A;  2D5R B;  3CSK A;  3U3F A;  4EBK A;  3N2Z B;  3PCV A;  3MX3 A;  3DKA A;  1CPR A;  4P9T A;  1RMV A;  1VK5 A;  1ORJ A;  4DRI B;  2R03 A;  3EG9 A;  3ZSU A;  5B3S C;  2HKV A;  2KC3 A;  2KSF A;  2UUI A;  1WGW A;  5DLJ A;  1S7Z A;  4I3M A;  3WHN A;  1JPN A;  1UFB A;  2XSE A;  3LNR A;  3U5S A;  2H8A A;  4K7B A;  1J8M F;  4U5D E;  1E86 A;  1B68 A;  4O6Y A;  4Q5S F;  2A6E F;  3DAF A;  3G4X A;  4XPX A;  3EJN A;  3WOD F;  5B1A C;  1OKK A;  2IXN A;  2YL3 A;  1APC A;  2L7A A;  4MQ9 F;  4QDL A;  5CI9 A;  1E83 A;  3ASO C;  4XLN F;  1WOL A;  1HY5 A;  2DYR C;  3IPM O;  1T9K A;  3L8I A;  5GPG B;  3NKD A;  2J46 A;  3C8Z A;  4MVZ A;  1HW1 A;  3E9V A;  3FVY A;  2NG1 A;  3VF0 A;  4DXW A;  4YT4 A;  2HSQ A;  1M57 C;  4O6M A;  2H7V C;  4B6I A;  1MQV A;  3PMR A;  3ECS A;  2PFD A;  2YVK A;  2EIN C;  4KBL A;  2YL0 A;  4MVM A;  4C7O A;  3L1M A;  3ZQY A;  1Q0D A;  4MVU A;  3UMH A;  4MW8 A;  2EIJ C;  1ORS C;  5L0I A;  2XLW A;  1Z63 A;  3U2L A;  3N0T A;  4JKV A;  5A69 A;  3H2V A;  2ETS A;  5FCL A;  4EIY A;  2I8B A;  2OJE D;  2AP3 A;  2VB6 A;  3DD7 A;  4NTA A;  5EK0 A;  3G50 A;  3SXM A;  3EH1 A;  5KYW A;  1N1C A;  5JUA A;  3KYJ A;  1NG1 A;  3L0I A;  4IAQ A;  2J45 A;  4O6N A;  4AX2 A;  3V5Z A;  4N06 A;  1U6H A;  1V55 C;  2LIG A;  3SYN A;  4HFF B;  1JRA A;  3TD7 A;  2NUT B;  4JEA A;  5A6B A;  1H9T A;  1I4Z A;  1M56 C;  2HZ8 A;  5B1B C;  1LPE A;  1V74 B;  2FFH A;  3TOL A;  5A6J A;  3SEO A;  1CPQ A;  1M6T A;  1LM3 B;  1PV3 A;  1QSP A;  1VLT A;  3C18 A;  3Q6M A;  4U5C E;  4EBJ A;  4QI2 A;  4QI0 A;  1AEP A;  4H4K C;  5AC4 A;  4CJG A;  1LI7 A;  2HMZ A;  1BZ4 A;  2LD6 A;  2IYL D;  3ZG1 A;  2AVK A;  2Q3T A;  2YKZ A;  1ZW2 A;  2QUP A;  3EZH A;  3GEH A;  3IQ5 A;  1RXQ A;  3LEO A;  4P9F A;  2J0W A;  1Y4C A;  3SZR A;  4E7Z A;  2R7W A;  2KQ9 A;  2WZF A;  4CIP A;  2HMQ A;  1H9G A;  3LJB A;  1AVO B;  2Z15 A;  4MTO A;  2EPO A;  4YL3 A;  3N24 A;  3I4U A;  1G4U S;  5HV9 A;  1RJ9 B;  4BEM J;  1I5N A;  3KMI A;  2XXA A;  1JR8 A;  4MTF A;  4PJN A;  3GM2 A;  3EGD A;  3ZTM A;  1Q0G A;  1SR2 A;  1JAF A;  2WVN A;  3S29 A;  1OXB A;  4GYT A;  3WAQ A;  1DOW A;  1PD1 A;  2KYH A;  2P7V A;  3KH2 A;  3PDM P;  1RKC A;  1BR1 A;  1M2V B;  2HSB A;  4YT5 A;  3SP1 A;  3V7O A;  2P61 A;  4OIR F;  2XXA B;  1JPJ A;  3OEO A;  1OW8 A;  1NFN A;  5JP7 A;  3Q7G A;  4EHP A;  4LDQ A;  2J9W A;  3T9O A;  2J9V A;  1TFO B;  5CI8 A;  2XM0 A;  4BJ6 A;  3X2Q C;  2MHR A;  1ZYR F;  4BJ6 C;  3TJ6 A;  1T01 A;  1LS1 A;  1M2V A;  4U9D A;  3SXY A;  2CNW A;  5T3W A;  2X51 A;  3UR3 C;  2KK1 A;  2A0U A;  2XL8 A;  5DS4 A;  3LEV A;  2PBE A;  5JS5 A;  4MND A;  1YAU O;  1G5Z A;  1LI5 A;  2ZXO A;  4Q7C A;  3SNH A;  5BUO A;  1A7D A;  2XL6 A;  1V4A A;  1VMA A;  3F46 A;  3C8G D;  4AE4 A;  4LER A;  1NZE A;  4O79 A;  1GM5 A;  1MND A;  3U8V A;  1D0X A;  1VYK A;  2HFI A;  2R7Q A;  3GEI A;  3KKB A;  2J0X A;  3MYF A;  3R7C A;  1QLE C;  4G0H A;  4XEK A;  4G78 A;  5JLI A;  3C7J A;  2AWC A;  3UGP A;  1SMY F;  1WAS A;  3T6G B;  2QNL A;  3ZQV A;  3TUL A;  1OCZ C;  2EPM X;  2NSF A;  4CSA C;  5B3I A;  1L7C A;  1OCR C;  3DE8 A;  2LSE A;  3K7D A;  3S84 A;  2H7B A;  4N4W A;  3S28 A;  1LE2 A;  2HJM A;  2W4B A;  4ONS A;  1ZZP A;  4IJJ A;  2CW0 F;  4OD5 A;  3W2W A;  4XLP F;  2LFD A;  4U5G A;  1M2O A;  2PF4 E;  3GWN A;  4EUK B;  2TMV P;  4J30 B;  1D1C A;  2GA0 A;  2HS5 A;  1T5O A;  3EZI A;  5E33 A;  3ZVR A;  3EGX A;  2Y3D A;  4YT2 A;  1FNT c;  1D0Y A;  1NFO A;  1R5I D;  4PK4 A;  1T6Q A;  3QMK A;  3TOM A;  4DBQ A;  4KI2 A;  4HE8 D;  4F4B A;  4NTF A;  2KW3 C;  4Z9J A;  2XLH A;  3EQL F;  2OCC C;  1K40 A;  2ZXP A;  4K0D A;  2ASR A;  3DI5 A;  4NY3 A;  1LVK A;  3S0X A;  1EI7 A;  2Q9A A;  4K1O A;  4WGZ A;  4CDV A;  4E7S A;  3HKK A;  2XS1 A;  5COM A;  3UMI A; 
#chains in the Genus database with same CATH homology
 1H7I A;  1OR3 A;  1BZ4 A;  1LE4 A;  1NFO A;  1B68 A;  1LS4 A;  1GS9 A;  2KC3 A;  1NFN A;  1OR2 A;  3S84 A;  1EA8 A;  1AEP A;  1LPE A;  1LE2 A;  1EQ1 A;  3R2P A;  1YA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...