1B68A

Apolipoprotein e4 (apoe4), 22k fragment
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
140
structure length
138
Chain Sequence
b'GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN E
molecule tags Lipid transport
source organism Homo sapiens
publication title Interaction of the N-terminal domain of apolipoprotein E4 with heparin.
pubmed doi rcsb
total genus 66
structure length 138
sequence length 140
ec nomenclature
pdb deposition date 1999-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1b68A00
2KC3A 1LPEA 1H7IA 1OR3A 1YA9A 3R2PA 1LS4A 1NFNA 1EQ1A 1GS9A 3S84A 1B68A 1NFOA 1LE4A 1BZ4A 1LE2A 1AEPA 1EA8A 1OR2A
chains in the Genus database with same CATH superfamily
4IGGA 3DAGA 4E17A 4YL0A 1KU2A 2OKUA 2CCYA 5D91A 3JRMO 2Q3TA 3GODA 5DVWA 2WVOA 3TK0A 1D0ZA 3T6GB 2JD3A 3R2PA 1VMAA 2W45A 4A4AA 2RD9A 1CGOA 2YWAA 2A0UA 3O55A 3US6A 4YL3A 3R7CA 2A6EF 4QI2A 3AQBA 4W8KA 4JJFA 1BR4A 4A2NB 1V55C 4Z9HA 1VOMA 3U9JA 4DBRA 4EIYA 2HSQA 5KYUB 2C03A 4U5GA 4E7ZA 5DS6A 3LESA 2NUTB 2LIGA 2WB7A 2XS1A 4PJLA 4DRHB 5KYYA 2R7TA 4IWBA 3TJ6A 1V4AA 2XM4A 4MTFA 2OJQA 5BUOA 2WVQA 2J9BA 3B71A 4EBBA 1TQGA 4AX2A 3V5ZA 3DE8A 3ZQYA 4EWCA 3LJBA 4YT4A 3EQLF 3VRCA 1BR1A 2YL7A 3GM1A 1HMOA 4MVOA 3S0XA 3C62A 1R4TA 1ZYRF 2Y69C 1G4WR 4QDLA 3N0TA 2CDQA 5AC5A 4E7SA 4G7ZF 3VF0A 4C7OB 4FAPB 3MYIA 2P0NA 3EJNA 5L0JA 3KMIA 3VYWA 4LACB 5E33A 3I4UA 3KKBA 4XPXA 3LNRA 3EGXA 1WATA 3ATPA 2KNHA 4O6YA 4G7HF 2R7WA 1Z3IX 3TQOA 2AVKA 2L6FA 5CI9A 1T6QA 2R7OA 3TOMA 2LSEA 2IXNA 1JR8A 3ZDLA 1MMGA 2XM0A 4D4NA 3GANA 1T01A 3RIPA 5BQHA 3PHF2 3NDBB 4LDQA 2G3VA 1KNYA 1SYQA 2A69F 4N06A 3AQCA 4PJJA 3FAPB 1Q0GA 1ZZPA 3FXHA 4WGYA 2E87A 3UMKA 3M4BA 3VM6A 2EIKC 4JIOA 1HE9A 2HJ3A 3RVYA 4CJGA 1TWCA 5JS5A 1FMWA 4P6IC 4XPYA 1T5OA 1ZW3A 3ABKC 4XLNF 3K7DA 1C03A 3S28A 3TULA 4ZLDA 5KYYB 1WWPA 4I1OB 3W4YA 1VB5A 2D4UA 2XL8A 5F28E 3RF3A 4DJ9A 1J8YF 2EPMX 3DWWA 5L0GA 1HE1A 1TWGA 3DAFA 1A7EA 2IXMA 1D0XA 4LDRA 3I5QA 1F1MA 3L8IA 4BEJA 1Q0DA 2J9WA 4Z9IA 2XL6A 1VK5A 1LVKA 1ZW2A 2OQMA 2VCCA 4NY3A 1Z5ZA 3KYIA 4RDAA 2VASA 3OWTA 1J8MF 4MVUA 4JC7A 3RQFA 2Q9AA 3M15A 3PMRA 2KQ9A 4BJ1A 4Q5SF 2LD6A 1T6IA 3C8GD 3EHNA 3M79A 1U89A 1Q0KA 5TJ5E 1OW7A 3EPVA 3RW0A 4PFPA 4RD9A 3JSZA 3IHUA 5KYWA 2J9VA 1OCZC 4I44A 1TWHA 4UDVA 3K33A 2EPKX 4LDKA 4MQ9F 5CI8A 4LLCA 1QVXA 1Q0MA 2A1DD 4MW8A 4C7OA 5BQIA 5COGA 2YQYA 4BPMA 4OIQF 1LI7A 2O9XA 1H9GA 3PDMP 4JEBA 2W4BA 2FFHA 1OCRC 4U5BE 3UR3C 4WABA 2HV7A 3AOUA 3GEIA 5JSLA 1NLXA 3C8GA 3T9OA 3T4RA 4PACA 1Z6AA 2OEVA 4JJGA 2XXAB 2WZLA 4IAQA 3L1MA 3KH2A 4L6RA 3AG2C 4NCQA 3C18A 1PCXA 2J45A 4IRUA 4X0RA 3U8PA 3UGOA 1MMNA 5FZTA 4HFFB 1ST6A 4CJOA 3DM5A 4AE4B 4DOZA 2CYDA 3E9VA 2NUPB 1NZEA 2CNWA 2MWQA 4OIPF 2HSBA 3UMIA 3TJ5A 3JSEO 2XLHA 4XWJA 2IYLD 3L34A 2X51A 2AWCA 5F5FA 1OW6A 2KK1A 2WL8A 3W8HA 3X1OA 4XQ1A 4CBEA 3U2MA 1ZVZA 4MVSA 5JP7A 3NMIA 4ONSA 2EILC 3RQEA 2Q9CA 3IEEA 3L8JA 1Z23A 2DYRC 1M6TA 2GWWA 1OKKD 3JTLO 3QZCA 1FFTC 5DS4A 1I4ZA 3N2ZB 1NG1A 2Y3HA 4U5FE 5A6BD 3E70C 2CNWD 2GFHA 3G4ZA 1GQAA 2VCAA 4DRIB 3JT1A 1XWJA 4JCZA 1CGME 3ZIBA 2HFIA 3TOLA 1LE4A 3QVYA 3X2QC 3IPMO 4H4KC 4JCHA 4J7YA 1FR0A 2XS8A 3A11A 3F46A 4NQFA 1NU7D 2DI3A 2KJGA 4NTBA 4HFKB 1WN0A 4AL1A 1I5NA 4YL1A 3UMHA 1HY5A 2VH3A 3BEHA 1GM5A 1C02A 4CDVA 3Q7GA 2OOCA 2IOQA 4J30B 5A6AA 1ZHWA 3HNJA 3QW0A 3NYJA 5L3QA 3S90A 3IQTA 1E2XA 3ASNC 4CDAA 3ZTZA 4YWQA 4YT2A 1G8XA 3K1HA 4D4XA 2NSFA 3SZRA 4BJ5A 1O3UA 3MFNA 3DI5A 1B68A 2YLGA 3EH2A 3IQ6A 1SMYF 1MQVA 2HJMA 2HZ8A 3JZ0A 4JTDB 4O6MA 1YA9A 4EBJA 2GA0A 3LUTB 3ZVRA 3LLIA 2J0XA 1A7VA 1NBBA 1RXQA 2Q9BA 4P9FA 1E85A 1V54C 2YRFA 3EZIA 3MYFA 1YA7O 3U3FA 2YKZA 1JAFA 3QMKA 1D1AA 1VLTA 2XLEA 4YT8A 1HW2A 2YL3A 3ZTMA 2LFDA 1YVIA 2RSEB 4XEFA 3WG7C 1QZXA 4E18A 4JW1A 3DM9B 3GM3A 3NRHA 1ORYA 3RVZA 1OR2A 4EHPA 3C63A 3J06A 1D1BA 1YARO 3UGPA 3U5SA 1M2VA 2J7PA 4J32B 1M56C 3WHNA 1E83A 2IXPA 1RMVA 1K05A 1L3PA 2TMVP 3A9CA 4E0HA 3GM2A 4KNWA 4DBQA 5E3AA 2B0JA 1OW8A 2IM8A 2JPUA 1L7CA 5L0DA 1TR2A 4EKWA 3U8VA 1ZHYA 2EIMC 5JT4A 2AP3A 2NSGA 3GWLA 2H8AA 2WZFA 1ZHXA 1ZHZA 2L7AA 1FAPB 2OJED 1O87A 5KYNA 1RKEB 4G7OF 3S29A 2HV6A 2AU5A 4CDYA 2ICWG 1CPQA 2XSEA 2Q00A 4N6HA 1ZU4A 5T3WA 3KYJA 3ABMC 1Y4CA 1NFNA 5KYWB 1PD1A 3GORA 1NFOA 2VCBA 3T6JA 1MNDA 3FAJA 4H54A 1LE2A 1EI7A 2DYSC 3AG1C 1PD0A 3FDQA 1A7DA 2G62A 2V26A 5DLJA 3U2LA 4OD5A 2J0WA 4CSAC 3ZG1A 2ETSA 3NYMA 1SR2A 4FWVA 1T6UA 4XPWA 3DE9A 4DVZA 1OCOC 1SZIA 2LP4A 3S27A 1R5ID 2WZGA 4AL0A 3HKKA 1YDIA 2EIJC 2ZPAA 3ZSUA 4HEAJ 1LS1A 3T6BA 4CS7A 3SXYA 4W8PA 4Q4ZF 3JYHA 3RQGA 3W2WA 4HE8D 3DD7A 2I15A 4M63A 3NYLA 5FCLA 2NG1A 3Q6NA 3I5PA 1BDJB 2R7VA 3S84A 1LM3B 2R25A 3NG1A 3IQ5A 1C17M 2HKVA 2Y3BA 4PR9A 1S05A 4PJNA 3DKAA 1YLMA 5EHHA 1RCPA 3QW1A 5COMA 3B29A 2VC9A 4CS9A 1M2VB 5AGFA 2R7UA 3O6XA 3B0PA 2GAQA 2YHSA 3AGUA 3Q6MA 5A6KA 4N6CA 4K7BA 1FFHA 1YZCA 1MMAA 4LLEA 3EGDA 5A6BA 1ORJA 2PNOA 3GEHA 4J7TA 4R32A 4CSAA 1TKNA 3SNHA 2PFDA 1CPRA 3CAXA 3NMJA 4Z9JA 4MW3A 5DQTA 2HMZA 2BE5F 3EZHA 3H2UA 3HLZA 1Q0FA 3LEVA 3SEOA 3EGXB 1IZMA 2R02A 1YAUO 1SF8A 1WTYA 4JTAB 3MX3A 2YZSA 4YN0B 1PV3A 1VTMP 1U0BB 4U5HA 1GS9A 4JEAA 1AUEA 1QKRA 1DOWA 2H7OA 5KYXA 2A6HF 2HUJA 1NSGB 2ZXRA 4GQHA 4I3MA 3FMSA 4MVMA 5HSWA 2KGOA 4NTFA 1FNTc 1VYIA 4JRZA 2MYSA 1H6GA 4XEKA 1E84A 2EPOA 1M2OA 1DOVA 1EA8A 5L0HA 5L0FA 4G0HA 2Y3GA 4FESA 5JVEA 3ECSA 4KNVA 1E86A 1QQ3A 2QUPA 2OU6A 3DMDA 1FTSA 2ASRA 1RJ9A 2LFFA 2LK4A 4MTGA 3CZ6A 2A0BA 1K04A 4PFOA 5IY5C 1ZHTA 3CSKA 3HNLA 4IB4A 2A68F 3Q7LA 3NKEA 3B0VC 3BRJA 3C7JA 1N1CA 4XTKA 1W2WA 2LQGA 4O79A 4CS8A 4U9DA 5E3CA 4BJTA 2IXOA 2KSFA 3C8GB 4KC9A 3WODF 3EH1A 2KW3C 4RBNA 3EFOB 4OIRF 3H65A 4CS9C 1JOGA 1CGNA 3M1CB 2DB4A 1D1CA 2LCHA 3S9OA 2XRHA 2YL1A 3FHDA 2ZD9A 2OEXA 5L0CA 3G4XA 2CW0F 2J7PD 4JZAA 1JMWA 4U5EE 3DXJF 3EFOA 4B6IA 4OINF 2MHRA 2XLMA 4GYTA 1MMDA 3WAQA 2Y39A 5E2QA 4P9TA 4E0IA 4XLPF 1OR3A 2YEVA 5CIVA 3HNIA 3MBGA 1QSPA 4MS2A 4JTCB 4IAOA 3SXKA 4JURI 3AGTA 5AC4A 1MNEA 2Q4FA 5KYUA 3UNGC 1BZ4A 4QI0A 2XLWA 4K1OA 4CX9A 1RJ9B 3KPHA 4WGZA 1LI5A 5B1AC 5BQGA 5T3TA 1YJGA 3GEEA 2P7VA 3NKDA 2I8BA 1WOLA 2H7BA 5JRAA 2XXAA 3RFYA 2QLAA 3AG4C 4AK9A 5L3VA 4U5CE 2KC3A 4JKVA 3RKOF 1XZPA 3K1IC 2L6HA 3U0CA 2Z15A 1A41A 3LLKA 3LNMB 2ZXPA 4JVSA 3SYNA 3FOPA 1LIHA 2QNLA 1M57C 3W8IA 1A0BA 4O7GA 4BJ5C 5L0IA 2F22A 2Y3DA 5A69A 3N24A 4CIHA 1AEPA 2P1AA 5JUAA 3LS1A 4BJ6A 4DRJB 2W4MA 3ITFA 4U9EA 2WVNA 2V3CC 3O10A 1GGQA 3W2VA 1Z63A 2XLOA 3H2VA 4YT5A 4JE9A 1QPUA 3K6BA 4GEHA 2KYHA 3K66A 3M4CA 2M4EA 1XZQA 2NPUA 2OCCC 5K0IA 4ANJA 3OA1A 3JYYA 1H7IA 1ORSC 2XLDA 2HMQA 2IBFA 4KBLA 1FMVA 2PX3A 2PX0A 2ZXWC 3TD7A 1YYJA 2FGYA 4AE4A 4OD4A 1U6HA 2YLIA 3LAYA 1D0YA 1OXKA 3CQZA 3JRTA 3V5XA 3VAYA 4BEMJ 4FX5A 2YLDA 4OIOF 2PF4E 1O5HA 3SXMA 2D5RB 1G4US 3AJMA 1LPEA 1QLEC 2M64A 4C3EA 5B3SC 1EKYA 3U3BA 3ASOC 3SXZA 5A6JA 3EG9B 1HMDA 1VYKA 3F47A 2EINC 1V74B 2J46A 2PP4A 1RKEA 3FVYA 4I1MA 4DVYP 1H9TA 4NC3A 1IW7F 4MVZA 5GPGB 3U9MA 1NU9C 4XEVA 1Z7Qc 1APCA 1YYXA 3ZC4A 2W9YA 4N4WA 3POVA 4IJJA 2X0CA 3K1IA 2PBEA 5DS5A 2JX0A 4O6NA 5B3IA 2EPLX 1T9KA 1YZAA 4EUKB 1LS4A 3DJUB 3V7OA 2NUPA 2BL2A 3IQCA 3O39A 1OKKA 2UUIA 1RKCA 3DJNB 3GWNA 3HNKA 3L0IA 3ZQVA 3QVZA 5EGYA 1OCCC 1Y6DA 3G50A 2HS5A 1UG7A 2L9JA 2BC5A 2R05A 3C8ZA 5F5HA 5B1BC 1OXBA 4C3DA 2Q7RA 4MNDA 4MTOA 4MVQA 3RH3A 3HTKC 5JLIA 4U5DE 2QE9A 1UFBA 2FAPB 3EHMA 5COFA 4BG0A 2R9RB 1I4YA 4BJ6C 4DXWA 2G3KA 1LKXA 2XLVA 2P61A 2VB6A 5T1DB 1TWAA 4YK5A 5EK0A 2L81A 3KL4A 3FOOA 3SP1A 4MVRA 2P6VA 3B9QA 1WASA 2GDCA 2CGEA 4ER9A 2AWYA 3LS0A 1G5ZA 4ULVA 4KI2A 3B0UX 1JRAA 3DZAA 4EBKA 3V5YA 2QTVA 4CIPA 4Q7CA 1AVOB 1S7ZA 2R7SA 2NUTA 4CS8C 3CEXA 2EPNA 2ZXOA 3RYLA 4YJWA 2B0HA 1JPNA 2DGJA 256BA 3HJCA 3PCVA 5HV9A 3ABLC 1BBHA 1TFOB 2C04A 2OG2A 1K40A 4G78A 1KTMA 1WGWA 3AG3C 3ZWIA 5DQZA 2R03A 3EGDB 2XL4A 3NMKA 3JCUQ 3LEOA 4C3BA 4ULWA 3MLGA 1ZU5A 4LERA 3OEOA 1VLSA 2J9UA 4ZLCA 4F4BA 1BR2A 4IARA 3QTHA 1EQ1A 2YL0A 1OQCA 5KYXB 1HW1A 3EG9A 1JPJA 2R7QA 4K0DA 2H7VC 4PJMA 2YVKA 5D92A 4PK4A 2J8WA 2R7XA 1TFKB 4WJ0A 2QY9A 2R7RA 2L6GA 2UUHA 4NTAA
chains in the Genus database with same CATH topology
2KC3A 1LPEA 1H7IA 1OR3A 1YA9A 3R2PA 1LS4A 1NFNA 1EQ1A 1GS9A 3S84A 1B68A 1NFOA 1LE4A 1BZ4A 1LE2A 1AEPA 1EA8A 1OR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KC3 A;  1LPE A;  1H7I A;  1OR3 A;  1YA9 A;  3R2P A;  1LS4 A;  1NFN A;  1EQ1 A;  1GS9 A;  3S84 A;  1B68 A;  1NFO A;  1LE4 A;  1BZ4 A;  1LE2 A;  1AEP A;  1EA8 A;  1OR2 A; 
#chains in the Genus database with same CATH topology
 4IGG A;  3DAG A;  4E17 A;  4YL0 A;  1KU2 A;  2OKU A;  2CCY A;  5D91 A;  3JRM O;  2Q3T A;  3GOD A;  5DVW A;  2WVO A;  3TK0 A;  1D0Z A;  3T6G B;  2JD3 A;  3R2P A;  1VMA A;  2W45 A;  4A4A A;  2RD9 A;  1CGO A;  2YWA A;  2A0U A;  3O55 A;  3US6 A;  4YL3 A;  3R7C A;  2A6E F;  4QI2 A;  3AQB A;  4W8K A;  4JJF A;  1BR4 A;  4A2N B;  1V55 C;  4Z9H A;  1VOM A;  3U9J A;  4DBR A;  4EIY A;  2HSQ A;  5KYU B;  2C03 A;  4U5G A;  4E7Z A;  5DS6 A;  3LES A;  2NUT B;  2LIG A;  2WB7 A;  2XS1 A;  4PJL A;  4DRH B;  5KYY A;  2R7T A;  4IWB A;  3TJ6 A;  1V4A A;  2XM4 A;  4MTF A;  2OJQ A;  5BUO A;  2WVQ A;  2J9B A;  3B71 A;  4EBB A;  1TQG A;  4AX2 A;  3V5Z A;  3DE8 A;  3ZQY A;  4EWC A;  3LJB A;  4YT4 A;  3EQL F;  3VRC A;  1BR1 A;  2YL7 A;  3GM1 A;  1HMO A;  4MVO A;  3S0X A;  3C62 A;  1R4T A;  1ZYR F;  2Y69 C;  1G4W R;  4QDL A;  3N0T A;  2CDQ A;  5AC5 A;  4E7S A;  4G7Z F;  3VF0 A;  4C7O B;  4FAP B;  3MYI A;  2P0N A;  3EJN A;  5L0J A;  3KMI A;  3VYW A;  4LAC B;  5E33 A;  3I4U A;  3KKB A;  4XPX A;  3LNR A;  3EGX A;  1WAT A;  3ATP A;  2KNH A;  4O6Y A;  4G7H F;  2R7W A;  1Z3I X;  3TQO A;  2AVK A;  2L6F A;  5CI9 A;  1T6Q A;  2R7O A;  3TOM A;  2LSE A;  2IXN A;  1JR8 A;  3ZDL A;  1MMG A;  2XM0 A;  4D4N A;  3GAN A;  1T01 A;  3RIP A;  5BQH A;  3PHF 2;  3NDB B;  4LDQ A;  2G3V A;  1KNY A;  1SYQ A;  2A69 F;  4N06 A;  3AQC A;  4PJJ A;  3FAP B;  1Q0G A;  1ZZP A;  3FXH A;  4WGY A;  2E87 A;  3UMK A;  3M4B A;  3VM6 A;  2EIK C;  4JIO A;  1HE9 A;  2HJ3 A;  3RVY A;  4CJG A;  1TWC A;  5JS5 A;  1FMW A;  4P6I C;  4XPY A;  1T5O A;  1ZW3 A;  3ABK C;  4XLN F;  3K7D A;  1C03 A;  3S28 A;  3TUL A;  4ZLD A;  5KYY B;  1WWP A;  4I1O B;  3W4Y A;  1VB5 A;  2D4U A;  2XL8 A;  5F28 E;  3RF3 A;  4DJ9 A;  1J8Y F;  2EPM X;  3DWW A;  5L0G A;  1HE1 A;  1TWG A;  3DAF A;  1A7E A;  2IXM A;  1D0X A;  4LDR A;  3I5Q A;  1F1M A;  3L8I A;  4BEJ A;  1Q0D A;  2J9W A;  4Z9I A;  2XL6 A;  1VK5 A;  1LVK A;  1ZW2 A;  2OQM A;  2VCC A;  4NY3 A;  1Z5Z A;  3KYI A;  4RDA A;  2VAS A;  3OWT A;  1J8M F;  4MVU A;  4JC7 A;  3RQF A;  2Q9A A;  3M15 A;  3PMR A;  2KQ9 A;  4BJ1 A;  4Q5S F;  2LD6 A;  1T6I A;  3C8G D;  3EHN A;  3M79 A;  1U89 A;  1Q0K A;  5TJ5 E;  1OW7 A;  3EPV A;  3RW0 A;  4PFP A;  4RD9 A;  3JSZ A;  3IHU A;  5KYW A;  2J9V A;  1OCZ C;  4I44 A;  1TWH A;  4UDV A;  3K33 A;  2EPK X;  4LDK A;  4MQ9 F;  5CI8 A;  4LLC A;  1QVX A;  1Q0M A;  2A1D D;  4MW8 A;  4C7O A;  5BQI A;  5COG A;  2YQY A;  4BPM A;  4OIQ F;  1LI7 A;  2O9X A;  1H9G A;  3PDM P;  4JEB A;  2W4B A;  2FFH A;  1OCR C;  4U5B E;  3UR3 C;  4WAB A;  2HV7 A;  3AOU A;  3GEI A;  5JSL A;  1NLX A;  3C8G A;  3T9O A;  3T4R A;  4PAC A;  1Z6A A;  2OEV A;  4JJG A;  2XXA B;  2WZL A;  4IAQ A;  3L1M A;  3KH2 A;  4L6R A;  3AG2 C;  4NCQ A;  3C18 A;  1PCX A;  2J45 A;  4IRU A;  4X0R A;  3U8P A;  3UGO A;  1MMN A;  5FZT A;  4HFF B;  1ST6 A;  4CJO A;  3DM5 A;  4AE4 B;  4DOZ A;  2CYD A;  3E9V A;  2NUP B;  1NZE A;  2CNW A;  2MWQ A;  4OIP F;  2HSB A;  3UMI A;  3TJ5 A;  3JSE O;  2XLH A;  4XWJ A;  2IYL D;  3L34 A;  2X51 A;  2AWC A;  5F5F A;  1OW6 A;  2KK1 A;  2WL8 A;  3W8H A;  3X1O A;  4XQ1 A;  4CBE A;  3U2M A;  1ZVZ A;  4MVS A;  5JP7 A;  3NMI A;  4ONS A;  2EIL C;  3RQE A;  2Q9C A;  3IEE A;  3L8J A;  1Z23 A;  2DYR C;  1M6T A;  2GWW A;  1OKK D;  3JTL O;  3QZC A;  1FFT C;  5DS4 A;  1I4Z A;  3N2Z B;  1NG1 A;  2Y3H A;  4U5F E;  5A6B D;  3E70 C;  2CNW D;  2GFH A;  3G4Z A;  1GQA A;  2VCA A;  4DRI B;  3JT1 A;  1XWJ A;  4JCZ A;  1CGM E;  3ZIB A;  2HFI A;  3TOL A;  1LE4 A;  3QVY A;  3X2Q C;  3IPM O;  4H4K C;  4JCH A;  4J7Y A;  1FR0 A;  2XS8 A;  3A11 A;  3F46 A;  4NQF A;  1NU7 D;  2DI3 A;  2KJG A;  4NTB A;  4HFK B;  1WN0 A;  4AL1 A;  1I5N A;  4YL1 A;  3UMH A;  1HY5 A;  2VH3 A;  3BEH A;  1GM5 A;  1C02 A;  4CDV A;  3Q7G A;  2OOC A;  2IOQ A;  4J30 B;  5A6A A;  1ZHW A;  3HNJ A;  3QW0 A;  3NYJ A;  5L3Q A;  3S90 A;  3IQT A;  1E2X A;  3ASN C;  4CDA A;  3ZTZ A;  4YWQ A;  4YT2 A;  1G8X A;  3K1H A;  4D4X A;  2NSF A;  3SZR A;  4BJ5 A;  1O3U A;  3MFN A;  3DI5 A;  1B68 A;  2YLG A;  3EH2 A;  3IQ6 A;  1SMY F;  1MQV A;  2HJM A;  2HZ8 A;  3JZ0 A;  4JTD B;  4O6M A;  1YA9 A;  4EBJ A;  2GA0 A;  3LUT B;  3ZVR A;  3LLI A;  2J0X A;  1A7V A;  1NBB A;  1RXQ A;  2Q9B A;  4P9F A;  1E85 A;  1V54 C;  2YRF A;  3EZI A;  3MYF A;  1YA7 O;  3U3F A;  2YKZ A;  1JAF A;  3QMK A;  1D1A A;  1VLT A;  2XLE A;  4YT8 A;  1HW2 A;  2YL3 A;  3ZTM A;  2LFD A;  1YVI A;  2RSE B;  4XEF A;  3WG7 C;  1QZX A;  4E18 A;  4JW1 A;  3DM9 B;  3GM3 A;  3NRH A;  1ORY A;  3RVZ A;  1OR2 A;  4EHP A;  3C63 A;  3J06 A;  1D1B A;  1YAR O;  3UGP A;  3U5S A;  1M2V A;  2J7P A;  4J32 B;  1M56 C;  3WHN A;  1E83 A;  2IXP A;  1RMV A;  1K05 A;  1L3P A;  2TMV P;  3A9C A;  4E0H A;  3GM2 A;  4KNW A;  4DBQ A;  5E3A A;  2B0J A;  1OW8 A;  2IM8 A;  2JPU A;  1L7C A;  5L0D A;  1TR2 A;  4EKW A;  3U8V A;  1ZHY A;  2EIM C;  5JT4 A;  2AP3 A;  2NSG A;  3GWL A;  2H8A A;  2WZF A;  1ZHX A;  1ZHZ A;  2L7A A;  1FAP B;  2OJE D;  1O87 A;  5KYN A;  1RKE B;  4G7O F;  3S29 A;  2HV6 A;  2AU5 A;  4CDY A;  2ICW G;  1CPQ A;  2XSE A;  2Q00 A;  4N6H A;  1ZU4 A;  5T3W A;  3KYJ A;  3ABM C;  1Y4C A;  1NFN A;  5KYW B;  1PD1 A;  3GOR A;  1NFO A;  2VCB A;  3T6J A;  1MND A;  3FAJ A;  4H54 A;  1LE2 A;  1EI7 A;  2DYS C;  3AG1 C;  1PD0 A;  3FDQ A;  1A7D A;  2G62 A;  2V26 A;  5DLJ A;  3U2L A;  4OD5 A;  2J0W A;  4CSA C;  3ZG1 A;  2ETS A;  3NYM A;  1SR2 A;  4FWV A;  1T6U A;  4XPW A;  3DE9 A;  4DVZ A;  1OCO C;  1SZI A;  2LP4 A;  3S27 A;  1R5I D;  2WZG A;  4AL0 A;  3HKK A;  1YDI A;  2EIJ C;  2ZPA A;  3ZSU A;  4HEA J;  1LS1 A;  3T6B A;  4CS7 A;  3SXY A;  4W8P A;  4Q4Z F;  3JYH A;  3RQG A;  3W2W A;  4HE8 D;  3DD7 A;  2I15 A;  4M63 A;  3NYL A;  5FCL A;  2NG1 A;  3Q6N A;  3I5P A;  1BDJ B;  2R7V A;  3S84 A;  1LM3 B;  2R25 A;  3NG1 A;  3IQ5 A;  1C17 M;  2HKV A;  2Y3B A;  4PR9 A;  1S05 A;  4PJN A;  3DKA A;  1YLM A;  5EHH A;  1RCP A;  3QW1 A;  5COM A;  3B29 A;  2VC9 A;  4CS9 A;  1M2V B;  5AGF A;  2R7U A;  3O6X A;  3B0P A;  2GAQ A;  2YHS A;  3AGU A;  3Q6M A;  5A6K A;  4N6C A;  4K7B A;  1FFH A;  1YZC A;  1MMA A;  4LLE A;  3EGD A;  5A6B A;  1ORJ A;  2PNO A;  3GEH A;  4J7T A;  4R32 A;  4CSA A;  1TKN A;  3SNH A;  2PFD A;  1CPR A;  3CAX A;  3NMJ A;  4Z9J A;  4MW3 A;  5DQT A;  2HMZ A;  2BE5 F;  3EZH A;  3H2U A;  3HLZ A;  1Q0F A;  3LEV A;  3SEO A;  3EGX B;  1IZM A;  2R02 A;  1YAU O;  1SF8 A;  1WTY A;  4JTA B;  3MX3 A;  2YZS A;  4YN0 B;  1PV3 A;  1VTM P;  1U0B B;  4U5H A;  1GS9 A;  4JEA A;  1AUE A;  1QKR A;  1DOW A;  2H7O A;  5KYX A;  2A6H F;  2HUJ A;  1NSG B;  2ZXR A;  4GQH A;  4I3M A;  3FMS A;  4MVM A;  5HSW A;  2KGO A;  4NTF A;  1FNT c;  1VYI A;  4JRZ A;  2MYS A;  1H6G A;  4XEK A;  1E84 A;  2EPO A;  1M2O A;  1DOV A;  1EA8 A;  5L0H A;  5L0F A;  4G0H A;  2Y3G A;  4FES A;  5JVE A;  3ECS A;  4KNV A;  1E86 A;  1QQ3 A;  2QUP A;  2OU6 A;  3DMD A;  1FTS A;  2ASR A;  1RJ9 A;  2LFF A;  2LK4 A;  4MTG A;  3CZ6 A;  2A0B A;  1K04 A;  4PFO A;  5IY5 C;  1ZHT A;  3CSK A;  3HNL A;  4IB4 A;  2A68 F;  3Q7L A;  3NKE A;  3B0V C;  3BRJ A;  3C7J A;  1N1C A;  4XTK A;  1W2W A;  2LQG A;  4O79 A;  4CS8 A;  4U9D A;  5E3C A;  4BJT A;  2IXO A;  2KSF A;  3C8G B;  4KC9 A;  3WOD F;  3EH1 A;  2KW3 C;  4RBN A;  3EFO B;  4OIR F;  3H65 A;  4CS9 C;  1JOG A;  1CGN A;  3M1C B;  2DB4 A;  1D1C A;  2LCH A;  3S9O A;  2XRH A;  2YL1 A;  3FHD A;  2ZD9 A;  2OEX A;  5L0C A;  3G4X A;  2CW0 F;  2J7P D;  4JZA A;  1JMW A;  4U5E E;  3DXJ F;  3EFO A;  4B6I A;  4OIN F;  2MHR A;  2XLM A;  4GYT A;  1MMD A;  3WAQ A;  2Y39 A;  5E2Q A;  4P9T A;  4E0I A;  4XLP F;  1OR3 A;  2YEV A;  5CIV A;  3HNI A;  3MBG A;  1QSP A;  4MS2 A;  4JTC B;  4IAO A;  3SXK A;  4JUR I;  3AGT A;  5AC4 A;  1MNE A;  2Q4F A;  5KYU A;  3UNG C;  1BZ4 A;  4QI0 A;  2XLW A;  4K1O A;  4CX9 A;  1RJ9 B;  3KPH A;  4WGZ A;  1LI5 A;  5B1A C;  5BQG A;  5T3T A;  1YJG A;  3GEE A;  2P7V A;  3NKD A;  2I8B A;  1WOL A;  2H7B A;  5JRA A;  2XXA A;  3RFY A;  2QLA A;  3AG4 C;  4AK9 A;  5L3V A;  4U5C E;  2KC3 A;  4JKV A;  3RKO F;  1XZP A;  3K1I C;  2L6H A;  3U0C A;  2Z15 A;  1A41 A;  3LLK A;  3LNM B;  2ZXP A;  4JVS A;  3SYN A;  3FOP A;  1LIH A;  2QNL A;  1M57 C;  3W8I A;  1A0B A;  4O7G A;  4BJ5 C;  5L0I A;  2F22 A;  2Y3D A;  5A69 A;  3N24 A;  4CIH A;  1AEP A;  2P1A A;  5JUA A;  3LS1 A;  4BJ6 A;  4DRJ B;  2W4M A;  3ITF A;  4U9E A;  2WVN A;  2V3C C;  3O10 A;  1GGQ A;  3W2V A;  1Z63 A;  2XLO A;  3H2V A;  4YT5 A;  4JE9 A;  1QPU A;  3K6B A;  4GEH A;  2KYH A;  3K66 A;  3M4C A;  2M4E A;  1XZQ A;  2NPU A;  2OCC C;  5K0I A;  4ANJ A;  3OA1 A;  3JYY A;  1H7I A;  1ORS C;  2XLD A;  2HMQ A;  2IBF A;  4KBL A;  1FMV A;  2PX3 A;  2PX0 A;  2ZXW C;  3TD7 A;  1YYJ A;  2FGY A;  4AE4 A;  4OD4 A;  1U6H A;  2YLI A;  3LAY A;  1D0Y A;  1OXK A;  3CQZ A;  3JRT A;  3V5X A;  3VAY A;  4BEM J;  4FX5 A;  2YLD A;  4OIO F;  2PF4 E;  1O5H A;  3SXM A;  2D5R B;  1G4U S;  3AJM A;  1LPE A;  1QLE C;  2M64 A;  4C3E A;  5B3S C;  1EKY A;  3U3B A;  3ASO C;  3SXZ A;  5A6J A;  3EG9 B;  1HMD A;  1VYK A;  3F47 A;  2EIN C;  1V74 B;  2J46 A;  2PP4 A;  1RKE A;  3FVY A;  4I1M A;  4DVY P;  1H9T A;  4NC3 A;  1IW7 F;  4MVZ A;  5GPG B;  3U9M A;  1NU9 C;  4XEV A;  1Z7Q c;  1APC A;  1YYX A;  3ZC4 A;  2W9Y A;  4N4W A;  3POV A;  4IJJ A;  2X0C A;  3K1I A;  2PBE A;  5DS5 A;  2JX0 A;  4O6N A;  5B3I A;  2EPL X;  1T9K A;  1YZA A;  4EUK B;  1LS4 A;  3DJU B;  3V7O A;  2NUP A;  2BL2 A;  3IQC A;  3O39 A;  1OKK A;  2UUI A;  1RKC A;  3DJN B;  3GWN A;  3HNK A;  3L0I A;  3ZQV A;  3QVZ A;  5EGY A;  1OCC C;  1Y6D A;  3G50 A;  2HS5 A;  1UG7 A;  2L9J A;  2BC5 A;  2R05 A;  3C8Z A;  5F5H A;  5B1B C;  1OXB A;  4C3D A;  2Q7R A;  4MND A;  4MTO A;  4MVQ A;  3RH3 A;  3HTK C;  5JLI A;  4U5D E;  2QE9 A;  1UFB A;  2FAP B;  3EHM A;  5COF A;  4BG0 A;  2R9R B;  1I4Y A;  4BJ6 C;  4DXW A;  2G3K A;  1LKX A;  2XLV A;  2P61 A;  2VB6 A;  5T1D B;  1TWA A;  4YK5 A;  5EK0 A;  2L81 A;  3KL4 A;  3FOO A;  3SP1 A;  4MVR A;  2P6V A;  3B9Q A;  1WAS A;  2GDC A;  2CGE A;  4ER9 A;  2AWY A;  3LS0 A;  1G5Z A;  4ULV A;  4KI2 A;  3B0U X;  1JRA A;  3DZA A;  4EBK A;  3V5Y A;  2QTV A;  4CIP A;  4Q7C A;  1AVO B;  1S7Z A;  2R7S A;  2NUT A;  4CS8 C;  3CEX A;  2EPN A;  2ZXO A;  3RYL A;  4YJW A;  2B0H A;  1JPN A;  2DGJ A;  256B A;  3HJC A;  3PCV A;  5HV9 A;  3ABL C;  1BBH A;  1TFO B;  2C04 A;  2OG2 A;  1K40 A;  4G78 A;  1KTM A;  1WGW A;  3AG3 C;  3ZWI A;  5DQZ A;  2R03 A;  3EGD B;  2XL4 A;  3NMK A;  3JCU Q;  3LEO A;  4C3B A;  4ULW A;  3MLG A;  1ZU5 A;  4LER A;  3OEO A;  1VLS A;  2J9U A;  4ZLC A;  4F4B A;  1BR2 A;  4IAR A;  3QTH A;  1EQ1 A;  2YL0 A;  1OQC A;  5KYX B;  1HW1 A;  3EG9 A;  1JPJ A;  2R7Q A;  4K0D A;  2H7V C;  4PJM A;  2YVK A;  5D92 A;  4PK4 A;  2J8W A;  2R7X A;  1TFK B;  4WJ0 A;  2QY9 A;  2R7R A;  2L6G A;  2UUH A;  4NTA A; 
#chains in the Genus database with same CATH homology
 2KC3 A;  1LPE A;  1H7I A;  1OR3 A;  1YA9 A;  3R2P A;  1LS4 A;  1NFN A;  1EQ1 A;  1GS9 A;  3S84 A;  1B68 A;  1NFO A;  1LE4 A;  1BZ4 A;  1LE2 A;  1AEP A;  1EA8 A;  1OR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...