1B68A

Apolipoprotein e4 (apoe4), 22k fragment
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
140
structure length
138
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN E
publication title Interaction of the N-terminal domain of apolipoprotein E4 with heparin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
total genus 66
structure length 138
sequence length 140
ec nomenclature
pdb deposition date 1999-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1b68A00
3S84A 1LE2A 1OR3A 1LE4A 1EQ1A 1OR2A 1EA8A 1BZ4A 1AEPA 1B68A 1LPEA 1NFOA 1GS9A 3R2PA 1YA9A 1H7IA 2KC3A 1LS4A 1NFNA
chains in the Genus database with same CATH superfamily
1YYJA 1ZW3A 2XL4A 4DRJB 4IJJA 3HNIA 1TFOB 3QMKA 1V54C 1R4TA 1Z3IX 1OXBA 2M64A 1YJGA 2ZXRA 2R02A 2ASRA 2HMZA 3O6XA 2KSFA 5COMA 2XLVA 3O39A 1QSPA 4CBEA 2AWCA 4YL0A 2IM8A 2ZXPA 3J06A 2PP4A 2Z15A 3EGXB 3GM1A 1O5HA 4YL1A 3AG2C 3GWLA 4YJWA 4W8PA 2W4BA 2YEVA 3EG9A 5FZTA 3V5XA 4MVSA 4ONSA 3NKDA 2R7UA 2BC5A 2AU5A 1E2XA 4G7OF 2BE5F 2WB7A 2NUTB 3G4XA 4G7ZF 4P9TA 4CS8A 1T6UA 1L3PA 3AGUA 4H54A 3ZTMA 4YWQA 1O3UA 3WODF 3C8ZA 1FR0A 1D1AA 4EBBA 4CDYA 4OIRF 2HMQA 2IXOA 4CIHA 3FDQA 3EH1A 1NBBA 1K04A 2UUIA 4BJ6C 3BRJA 2VASA 5JLIA 1OKKA 2PBEA 2RD9A 3TD7A 4P9FA 4ANJA 1RXQA 5GPGB 4G7HF 4FWVA 5JSLA 1JAFA 2L7AA 4XTKA 1WATA 1FMVA 1ZHWA 4AE4A 4KNWA 3K7DA 2PFDA 2EIMC 4EIYA 5BUOA 1SZIA 2YL0A 2H8AA 3T6JA 1HMDA 3U2MA 3NG1A 4ULWA 4KNVA 4O6YA 4BJ5A 4Q4ZF 2EIKC 2TMVP 5KYWA 4LACB 4C3BA 3UGOA 3S29A 4JURI 1M6TA 4U5CE 1UG7A 2HFIA 2Q00A 2HSQA 4BJ5C 1ZW2A 3LNRA 1YZCA 1T9KA 3ZG1A 3MFNA 4DRHB 4GYTA 5JS5A 2W9YA 1D0XA 2OOCA 5CI9A 2V3CC 2IXMA 4J7YA 3PHF2 5E3AA 3DE8A 1A7EA 3DWWA 4RD9A 2R7RA 4LERA 3AJMA 4E17A 4UDVA 3EPVA 1T6IA 2X51A 3CSKA 1ZZPA 2D4UA 2Y3HA 2YLGA 5KYUB 1GM5A 2DB4A 3EGXA 1DOWA 1Q0GA 5JRAA 2MHRA 3K6BA 4NTAA 5BQHA 4DVYP 2J8WA 3L8JA 3AQBA 2R7WA 1FFHA 2OJED 3KL4A 2R03A 4C7OB 1Z23A 2HJMA 4XWJA 2HZ8A 4DBQA 3NRHA 2NUTA 2R7SA 4JEAA 3H2UA 4EHPA 1V4AA 4XEFA 1IW7F 1YLMA 1IZMA 3I4UA 4JTDB 4Z9IA 5E2QA 3HKKA 4CDVA 1VLTA 1BDJB 3DJUB 4IARA 3U8VA 3V5YA 2R7TA 1NU9C 2A0BA 4A2NB 2MYSA 4MNDA 1KNYA 2FGYA 3DAFA 4JTAB 2J7PD 1LS1A 4XEVA 1SMYF 1TWHA 2B0HA 4BJTA 3HNKA 3DZAA 5D91A 3B0PA 1OR2A 2EIJC 3ZVRA 4U9EA 4XLPF 3TK0A 1G4WR 1Y6DA 2G3VA 1VB5A 2J9BA 2LK4A 5D92A 4E7SA 1R5ID 5EK0A 4WGYA 1H9TA 1LIHA 3I5QA 2V26A 3MX3A 2DI3A 2QY9A 3LUTB 5COGA 3S27A 3US6A 4HEAJ 3RF3A 2Q7RA 3ZSUA 4W8KA 4MTGA 1FMWA 3W8HA 4FESA 3OA1A 4BG0A 3NMJA 4KBLA 3E70C 4LLCA 3FHDA 2J46A 4OIPF 1M2OA 2L6FA 1I4ZA 3CQZA 2OEXA 4YN0B 5A6BD 3C18A 3LLIA 2MWQA 1A7DA 4U5GA 2ZXWC 4MVRA 1OW6A 3UNGC 1WGWA 1BZ4A 1PD1A 4YT5A 4Q7CA 1XZQA 3L8IA 3MLGA 2C03A 3VRCA 1AEPA 2WZFA 3AGTA 2W4MA 1SF8A 4XQ1A 3W4YA 4EBKA 4JKVA 4GEHA 5KYUA 4JTCB 3L0IA 3RQFA 2OQMA 2P61A 4O6MA 2OJQA 4PK4A 4U5EE 3U9JA 2LP4A 3HNLA 3NYLA 1BBHA 2KK1A 2A6HF 3N24A 4K0DA 3B29A 4NY3A 3POVA 1Y4CA 1MMGA 3SYNA 1ZU5A 4GQHA 4E18A 1Z5ZA 2HV6A 1E86A 1TWAA 2EPMX 4LLEA 2YL3A 1QQ3A 3JSZA 1AVOB 4MVZA 2CYDA 4CJOA 2DYRC 4KI2A 3QVZA 1SYQA 2AWYA 2IXNA 2PX3A 4K1OA 4OIQF 1RMVA 2YL1A 2XRHA 3ABLC 3NKEA 2JPUA 1T01A 3W2WA 2KW3C 1OW7A 4MS2A 1OCZC 2WZLA 3DM9B 5KYNA 3K1HA 1Q0DA 5AGFA 3RH3A 2XLDA 3RW0A 2UUHA 2G3KA 1A0BA 3AG1C 5JUAA 1TWGA 2XLHA 3JSEO 2Y3DA 4G78A 1CGOA 1E84A 2J7PA 2A6EF 2VB6A 2XS8A 2ZD9A 1LS4A 5T3TA 1YA7O 3PMRA 3W2VA 4ULVA 1HW2A 1SR2A 3RQGA 1MNEA 3M1CB 1FNTc 2YRFA 2ICWG 1MMDA 2QTVA 3Q7GA 3F47A 2D5RB 1NLXA 3ATPA 2R05A 3EZIA 3GWNA 3HJCA 3JRMO 4X0RA 5CI8A 4CS8C 1RJ9B 1V55C 1M56C 4ZLDA 3Q6NA 4HFKB 3KKBA 3SNHA 5KYXA 3ASNC 2NG1A 5BQIA 3HNJA 1E83A 2FFHA 3RYLA 2XM4A 1FTSA 4PJLA 3ABMC 4DXWA 3IQTA 3PCVA 1ZU4A 3ASOC 2LIGA 4AL1A 5JVEA 1D1BA 1WOLA 3K1IA 1ORYA 3LEVA 4AK9A 3UGPA 3WAQA 4JC7A 1VYIA 3SP1A 4D4XA 3NMKA 1LM3B 1Q0KA 1EI7A 4OD4A 5DS4A 3U5SA 5A6BA 2R7QA 1HMOA 1I5NA 1M2VB 4CJGA 2ZXOA 2Q9AA 1A41A 3LNMB 1BR1A 2OG2A 3G4ZA 5T1DB 1A7VA 1JRAA 1Q0MA 4OIOF 3MYFA 1YARO 1I4YA 2CNWD 2H7VC 5KYYB 3BEHA 4I3MA 1MMAA 1LKXA 1NG1A 3LESA 3TJ5A 4E0HA 3FOOA 2Y39A 5EHHA 1LI5A 3F46A 1K05A 3N0TA 4K7BA 2XL8A 3NYMA 1GQAA 2YLIA 1AUEA 3U3FA 4IB4A 4MQ9F 1FAPB 2J9UA 5L0HA 1WN0A 2CCYA 1MMNA 5K0IA 5L0DA 2L81A 3LS1A 1T6QA 2M4EA 1DOVA 1NFOA 1U89A 1VK5A 1G4US 3M79A 3SXKA 4QI0A 3R7CA 3DM5A 4A4AA 5E3CA 4YL3A 3LLKA 4JEBA 4AL0A 2Y3BA 2QLAA 3M4BA 4C3DA 1D0YA 3M15A 2XL6A 3UR3C 3CZ6A 4N6HA 2YHSA 4XEKA 2RSEB 4DBRA 2QUPA 3FOPA 4WJ0A 3L1MA 3U0CA 4C7OA 4Q5SF 3T9OA 3EQLF 2HV7A 2PF4E 3ITFA 1QLEC 1PD0A 5L0IA 4PR9A 5F5FA 1BR4A 3TQOA 3UMIA 1TKNA 3KH2A 3QW0A 2LFDA 2PX0A 2Y69C 4HFFB 4O6NA 1CGME 1RJ9A 4WGZA 4CSAA 5DS5A 3GM2A 3MYIA 1EQ1A 3B71A 1EA8A 1JPNA 3DJNB 1RKEB 3GORA 3ZQVA 4BJ1A 1PV3A 3L34A 3X2QC 1E85A 4ER9A 5JT4A 2EILC 2OU6A 4CSAC 3GM3A 1B68A 1CPRA 2OEVA 4O79A 1YA9A 3LS0A 3A9CA 2LCHA 4MW3A 4YT2A 3C63A 2YLDA 1BR2A 4L6RA 2A69F 4I44A 4NTBA 5L0JA 4YT8A 2FAPB 2WVQA 1MQVA 3FAJA 3GANA 2R7OA 3TULA 1S05A 1ZHYA 1M2VA 2X0CA 5EGYA 2HKVA 1G8XA 2W45A 3NDBB 1VTMP 1QPUA 2HS5A 3JCUQ 4BEJA 1GGQA 2L6GA 4U5FE 4DOZA 1EKYA 1CGNA 3MBGA 1TFKB 5KYXB 1F1MA 1RKCA 4J30B 1LE4A 5L0GA 5KYYA 4JRZA 4CS9A 2YVKA 4YT4A 1YYXA 1CPQA 2A68F 4PJJA 5B3IA 5DVWA 4IAOA 3ZDLA 5L0CA 3VYWA 4LDKA 3K33A 4H4KC 3R2PA 4CS9C 3IHUA 1H7IA 2VCAA 3HTKC 2YWAA 4JCHA 2CNWA 1HW1A 3DXJF 2LSEA 4N06A 2AP3A 2NSFA 2XS1A 4MW8A 1OCRC 1QVXA 2J9WA 2KJGA 3DKAA 1C17M 2F22A 4EKWA 2A1DD 2JD3A 3B0VC 2HSBA 3AOUA 2PNOA 3EHMA 1TQGA 1QKRA 2IOQA 4U5BE 3GEEA 2CDQA 5L3VA 2H7OA 2KYHA 2YL7A 3H2VA 1WASA 1N1CA 3RVYA 1T5OA 1TWCA 3JZ0A 2GDCA 3QW1A 3RFYA 5F28E 4WABA 5DQZA 2R7VA 3JYYA 5A69A 1VYKA 1ZHZA 5A6AA 2GFHA 1V74B 2I8BA 4LDRA 4OD5A 3ZQYA 1TR2A 1RKEA 2DGJA 5BQGA 3CEXA 4NTFA 3ZTZA 1VOMA 4CS7A 2ETSA 4N4WA 5AC5A 1O87A 1OXKA 3E9VA 3DMDA 3IPMO 4YK5A 3KYIA 3N2ZB 1Z6AA 3FXHA 2KQ9A 3M4CA 3VF0A 3U3BA 1U0BB 2EPNA 4IGGA 2P1AA 3Q6MA 3UMHA 2Y3GA 4BPMA 2P7VA 2J0XA 1JOGA 2O9XA 3O55A 1FFTC 3EZHA 1NSGB 4PJMA 3CAXA 3T6BA 3EH2A 3U9MA 3RQEA 3JRTA 3QZCA 4E7ZA 3O10A 1WTYA 3LEOA 5A6JA 2WL8A 2VCBA 4FAPB 4MVMA 3FMSA 3T4RA 1JMWA 4RBNA 2DYSC 4EUKB 1OQCA 1OCOC 4O7GA 2GAQA 2ZPAA 3U2LA 3S90A 2VCCA 2XXAB 2NSGA 3H65A 1GS9A 2QNLA 4BJ6A 1JR8A 1YZAA 2AVKA 2R9RB 3C62A 3SEOA 1VMAA 3ZWIA 1W2WA 1ZVZA 2EPLX 4JJGA 4QDLA 4R32A 4KC9A 2NPUA 2H7BA 3SXYA 4DVZA 5COFA 2KNHA 4D4NA 3SZRA 4ZLCA 5B3SC 2CW0F 3UMKA 3RKOF 1D0ZA 3JTLO 4P6IC 4U9DA 1ZHXA 2LD6A 3A11A 3AQCA 3K1IC 3LJBA 1LE2A 3VM6A 3AG3C 2WVOA 3FVYA 5TJ5E 5FCLA 2P0NA 4RDAA 1JPJA 1QZXA 4I1OB 1M57C 2Q4FA 4JJFA 3ECSA 2KGOA 4XPXA 2E87A 4NC3A 3PDMP 2XLMA 5CIVA 2YZSA 3IQ6A 3OEOA 3I5PA 4CDAA 5E33A 1KTMA 4F4BA 4EBJA 3EFOB 1XZPA 4HE8D 1H9GA 2C04A 3U8PA 1LPEA 1PCXA 3ZIBA 4MTOA 3G50A 5DS6A 3SXZA 5HV9A 2WZGA 2J45A 4PJNA 2KC3A 2NUPB 1J8MF 1ZYRF 3C8GD 3HLZA 4M63A 2JX0A 3W8IA 2G62A 3IQ5A 2HJ3A 3OWTA 2OCCC 4JW1A 3V7OA 2OKUA 4BEMJ 1APCA 1NZEA 3KYJA 5DLJA 2YQYA 3EGDB 4CX9A 4AX2A 4OINF 256BA 2B0JA 3JT1A 3C8GB 2XLWA 3IEEA 3KPHA 4JCZA 4IWBA 3NMIA 3FAPB 2IXPA 3V5ZA 2P6VA 3S28A 2EPKX 2IYLD 3GEIA 3JYHA 1HE1A 3T6GB 1LVKA 1KU2A 1C02A 3TOLA 5T3WA 3WHNA 1MNDA 4PFPA 2LQGA 2L9JA 3X1OA 3DD7A 4JE9A 2EINC 4MVUA 1UFBA 2QE9A 2XXAA 3S9OA 3ZC4A 5L0FA 2J0WA 3DE9A 5JP7A 2VC9A 3C7JA 2L6HA 4EWCA 4J32B 4MVQA 1YVIA 1D1CA 1NFNA 3DI5A 4JVSA 2Q3TA 4XPWA 2XM0A 4JZAA 5B1BC 3TJ6A 1YDIA 4FX5A 1C03A 4U5DE 2GWWA 1G5ZA 2XSEA 1Q0FA 1L7CA 3EHNA 1J8YF 1OR3A 4IAQA 1U6HA 1H6GA 2GA0A 4NQFA 4PACA 5IY5C 3KMIA 3LAYA 4DRIB 3B0UX 2IBFA 4C3EA 4DJ9A 3EG9B 2I15A 1OCCC 2LFFA 2R25A 1VLSA 1NU7D 2VH3A 3Q7LA 3RIPA 1OKKD 3EJNA 4U5HA 4CIPA 3DAGA 4Z9JA 4G0HA 4B6IA 3EFOA 4N6CA 1RCPA 4J7TA 4Z9HA 1ST6A 5A6KA 2XLEA 4IRUA 2YKZA 1HE9A 2CGEA 2NUPA 5HSWA 3WG7C 3AG4C 4QI2A 1LI7A 3VAYA 2A0UA 3S0XA 1ORJA 3S84A 4I1MA 1YAUO 1HY5A 5L3QA 5AC4A 3QVYA 1OW8A 3EGDA 5F5HA 4AE4B 3IQCA 1ZHTA 5B1AC 5DQTA 1ORSC 1S7ZA 3B9QA 2J9VA 2WVNA 1K40A 3C8GA 3QTHA 2R7XA 2XLOA 5KYWB 2Q9BA 4E0IA 1Z63A 3GEHA 2HUJA 2BL2A 4LDQA 4PFOA 2EPOA 4MVOA 3SXMA 1XWJA 3TOMA 3GODA 3NYJA 3RVZA 4JIOA 1Z7Qc 2Q9CA 4XLNF 4MTFA 3ABKC 3K66A 1WWPA 4NCQA 4XPYA
chains in the Genus database with same CATH topology
3S84A 1LE2A 1OR3A 1LE4A 1EQ1A 1OR2A 1EA8A 1BZ4A 1AEPA 1B68A 1LPEA 1NFOA 1GS9A 3R2PA 1YA9A 1H7IA 2KC3A 1LS4A 1NFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S84 A;  1LE2 A;  1OR3 A;  1LE4 A;  1EQ1 A;  1OR2 A;  1EA8 A;  1BZ4 A;  1AEP A;  1B68 A;  1LPE A;  1NFO A;  1GS9 A;  3R2P A;  1YA9 A;  1H7I A;  2KC3 A;  1LS4 A;  1NFN A; 
#chains in the Genus database with same CATH topology
 1YYJ A;  1ZW3 A;  2XL4 A;  4DRJ B;  4IJJ A;  3HNI A;  1TFO B;  3QMK A;  1V54 C;  1R4T A;  1Z3I X;  1OXB A;  2M64 A;  1YJG A;  2ZXR A;  2R02 A;  2ASR A;  2HMZ A;  3O6X A;  2KSF A;  5COM A;  2XLV A;  3O39 A;  1QSP A;  4CBE A;  2AWC A;  4YL0 A;  2IM8 A;  2ZXP A;  3J06 A;  2PP4 A;  2Z15 A;  3EGX B;  3GM1 A;  1O5H A;  4YL1 A;  3AG2 C;  3GWL A;  4YJW A;  4W8P A;  2W4B A;  2YEV A;  3EG9 A;  5FZT A;  3V5X A;  4MVS A;  4ONS A;  3NKD A;  2R7U A;  2BC5 A;  2AU5 A;  1E2X A;  4G7O F;  2BE5 F;  2WB7 A;  2NUT B;  3G4X A;  4G7Z F;  4P9T A;  4CS8 A;  1T6U A;  1L3P A;  3AGU A;  4H54 A;  3ZTM A;  4YWQ A;  1O3U A;  3WOD F;  3C8Z A;  1FR0 A;  1D1A A;  4EBB A;  4CDY A;  4OIR F;  2HMQ A;  2IXO A;  4CIH A;  3FDQ A;  3EH1 A;  1NBB A;  1K04 A;  2UUI A;  4BJ6 C;  3BRJ A;  2VAS A;  5JLI A;  1OKK A;  2PBE A;  2RD9 A;  3TD7 A;  4P9F A;  4ANJ A;  1RXQ A;  5GPG B;  4G7H F;  4FWV A;  5JSL A;  1JAF A;  2L7A A;  4XTK A;  1WAT A;  1FMV A;  1ZHW A;  4AE4 A;  4KNW A;  3K7D A;  2PFD A;  2EIM C;  4EIY A;  5BUO A;  1SZI A;  2YL0 A;  2H8A A;  3T6J A;  1HMD A;  3U2M A;  3NG1 A;  4ULW A;  4KNV A;  4O6Y A;  4BJ5 A;  4Q4Z F;  2EIK C;  2TMV P;  5KYW A;  4LAC B;  4C3B A;  3UGO A;  3S29 A;  4JUR I;  1M6T A;  4U5C E;  1UG7 A;  2HFI A;  2Q00 A;  2HSQ A;  4BJ5 C;  1ZW2 A;  3LNR A;  1YZC A;  1T9K A;  3ZG1 A;  3MFN A;  4DRH B;  4GYT A;  5JS5 A;  2W9Y A;  1D0X A;  2OOC A;  5CI9 A;  2V3C C;  2IXM A;  4J7Y A;  3PHF 2;  5E3A A;  3DE8 A;  1A7E A;  3DWW A;  4RD9 A;  2R7R A;  4LER A;  3AJM A;  4E17 A;  4UDV A;  3EPV A;  1T6I A;  2X51 A;  3CSK A;  1ZZP A;  2D4U A;  2Y3H A;  2YLG A;  5KYU B;  1GM5 A;  2DB4 A;  3EGX A;  1DOW A;  1Q0G A;  5JRA A;  2MHR A;  3K6B A;  4NTA A;  5BQH A;  4DVY P;  2J8W A;  3L8J A;  3AQB A;  2R7W A;  1FFH A;  2OJE D;  3KL4 A;  2R03 A;  4C7O B;  1Z23 A;  2HJM A;  4XWJ A;  2HZ8 A;  4DBQ A;  3NRH A;  2NUT A;  2R7S A;  4JEA A;  3H2U A;  4EHP A;  1V4A A;  4XEF A;  1IW7 F;  1YLM A;  1IZM A;  3I4U A;  4JTD B;  4Z9I A;  5E2Q A;  3HKK A;  4CDV A;  1VLT A;  1BDJ B;  3DJU B;  4IAR A;  3U8V A;  3V5Y A;  2R7T A;  1NU9 C;  2A0B A;  4A2N B;  2MYS A;  4MND A;  1KNY A;  2FGY A;  3DAF A;  4JTA B;  2J7P D;  1LS1 A;  4XEV A;  1SMY F;  1TWH A;  2B0H A;  4BJT A;  3HNK A;  3DZA A;  5D91 A;  3B0P A;  1OR2 A;  2EIJ C;  3ZVR A;  4U9E A;  4XLP F;  3TK0 A;  1G4W R;  1Y6D A;  2G3V A;  1VB5 A;  2J9B A;  2LK4 A;  5D92 A;  4E7S A;  1R5I D;  5EK0 A;  4WGY A;  1H9T A;  1LIH A;  3I5Q A;  2V26 A;  3MX3 A;  2DI3 A;  2QY9 A;  3LUT B;  5COG A;  3S27 A;  3US6 A;  4HEA J;  3RF3 A;  2Q7R A;  3ZSU A;  4W8K A;  4MTG A;  1FMW A;  3W8H A;  4FES A;  3OA1 A;  4BG0 A;  3NMJ A;  4KBL A;  3E70 C;  4LLC A;  3FHD A;  2J46 A;  4OIP F;  1M2O A;  2L6F A;  1I4Z A;  3CQZ A;  2OEX A;  4YN0 B;  5A6B D;  3C18 A;  3LLI A;  2MWQ A;  1A7D A;  4U5G A;  2ZXW C;  4MVR A;  1OW6 A;  3UNG C;  1WGW A;  1BZ4 A;  1PD1 A;  4YT5 A;  4Q7C A;  1XZQ A;  3L8I A;  3MLG A;  2C03 A;  3VRC A;  1AEP A;  2WZF A;  3AGT A;  2W4M A;  1SF8 A;  4XQ1 A;  3W4Y A;  4EBK A;  4JKV A;  4GEH A;  5KYU A;  4JTC B;  3L0I A;  3RQF A;  2OQM A;  2P61 A;  4O6M A;  2OJQ A;  4PK4 A;  4U5E E;  3U9J A;  2LP4 A;  3HNL A;  3NYL A;  1BBH A;  2KK1 A;  2A6H F;  3N24 A;  4K0D A;  3B29 A;  4NY3 A;  3POV A;  1Y4C A;  1MMG A;  3SYN A;  1ZU5 A;  4GQH A;  4E18 A;  1Z5Z A;  2HV6 A;  1E86 A;  1TWA A;  2EPM X;  4LLE A;  2YL3 A;  1QQ3 A;  3JSZ A;  1AVO B;  4MVZ A;  2CYD A;  4CJO A;  2DYR C;  4KI2 A;  3QVZ A;  1SYQ A;  2AWY A;  2IXN A;  2PX3 A;  4K1O A;  4OIQ F;  1RMV A;  2YL1 A;  2XRH A;  3ABL C;  3NKE A;  2JPU A;  1T01 A;  3W2W A;  2KW3 C;  1OW7 A;  4MS2 A;  1OCZ C;  2WZL A;  3DM9 B;  5KYN A;  3K1H A;  1Q0D A;  5AGF A;  3RH3 A;  2XLD A;  3RW0 A;  2UUH A;  2G3K A;  1A0B A;  3AG1 C;  5JUA A;  1TWG A;  2XLH A;  3JSE O;  2Y3D A;  4G78 A;  1CGO A;  1E84 A;  2J7P A;  2A6E F;  2VB6 A;  2XS8 A;  2ZD9 A;  1LS4 A;  5T3T A;  1YA7 O;  3PMR A;  3W2V A;  4ULV A;  1HW2 A;  1SR2 A;  3RQG A;  1MNE A;  3M1C B;  1FNT c;  2YRF A;  2ICW G;  1MMD A;  2QTV A;  3Q7G A;  3F47 A;  2D5R B;  1NLX A;  3ATP A;  2R05 A;  3EZI A;  3GWN A;  3HJC A;  3JRM O;  4X0R A;  5CI8 A;  4CS8 C;  1RJ9 B;  1V55 C;  1M56 C;  4ZLD A;  3Q6N A;  4HFK B;  3KKB A;  3SNH A;  5KYX A;  3ASN C;  2NG1 A;  5BQI A;  3HNJ A;  1E83 A;  2FFH A;  3RYL A;  2XM4 A;  1FTS A;  4PJL A;  3ABM C;  4DXW A;  3IQT A;  3PCV A;  1ZU4 A;  3ASO C;  2LIG A;  4AL1 A;  5JVE A;  1D1B A;  1WOL A;  3K1I A;  1ORY A;  3LEV A;  4AK9 A;  3UGP A;  3WAQ A;  4JC7 A;  1VYI A;  3SP1 A;  4D4X A;  3NMK A;  1LM3 B;  1Q0K A;  1EI7 A;  4OD4 A;  5DS4 A;  3U5S A;  5A6B A;  2R7Q A;  1HMO A;  1I5N A;  1M2V B;  4CJG A;  2ZXO A;  2Q9A A;  1A41 A;  3LNM B;  1BR1 A;  2OG2 A;  3G4Z A;  5T1D B;  1A7V A;  1JRA A;  1Q0M A;  4OIO F;  3MYF A;  1YAR O;  1I4Y A;  2CNW D;  2H7V C;  5KYY B;  3BEH A;  4I3M A;  1MMA A;  1LKX A;  1NG1 A;  3LES A;  3TJ5 A;  4E0H A;  3FOO A;  2Y39 A;  5EHH A;  1LI5 A;  3F46 A;  1K05 A;  3N0T A;  4K7B A;  2XL8 A;  3NYM A;  1GQA A;  2YLI A;  1AUE A;  3U3F A;  4IB4 A;  4MQ9 F;  1FAP B;  2J9U A;  5L0H A;  1WN0 A;  2CCY A;  1MMN A;  5K0I A;  5L0D A;  2L81 A;  3LS1 A;  1T6Q A;  2M4E A;  1DOV A;  1NFO A;  1U89 A;  1VK5 A;  1G4U S;  3M79 A;  3SXK A;  4QI0 A;  3R7C A;  3DM5 A;  4A4A A;  5E3C A;  4YL3 A;  3LLK A;  4JEB A;  4AL0 A;  2Y3B A;  2QLA A;  3M4B A;  4C3D A;  1D0Y A;  3M15 A;  2XL6 A;  3UR3 C;  3CZ6 A;  4N6H A;  2YHS A;  4XEK A;  2RSE B;  4DBR A;  2QUP A;  3FOP A;  4WJ0 A;  3L1M A;  3U0C A;  4C7O A;  4Q5S F;  3T9O A;  3EQL F;  2HV7 A;  2PF4 E;  3ITF A;  1QLE C;  1PD0 A;  5L0I A;  4PR9 A;  5F5F A;  1BR4 A;  3TQO A;  3UMI A;  1TKN A;  3KH2 A;  3QW0 A;  2LFD A;  2PX0 A;  2Y69 C;  4HFF B;  4O6N A;  1CGM E;  1RJ9 A;  4WGZ A;  4CSA A;  5DS5 A;  3GM2 A;  3MYI A;  1EQ1 A;  3B71 A;  1EA8 A;  1JPN A;  3DJN B;  1RKE B;  3GOR A;  3ZQV A;  4BJ1 A;  1PV3 A;  3L34 A;  3X2Q C;  1E85 A;  4ER9 A;  5JT4 A;  2EIL C;  2OU6 A;  4CSA C;  3GM3 A;  1B68 A;  1CPR A;  2OEV A;  4O79 A;  1YA9 A;  3LS0 A;  3A9C A;  2LCH A;  4MW3 A;  4YT2 A;  3C63 A;  2YLD A;  1BR2 A;  4L6R A;  2A69 F;  4I44 A;  4NTB A;  5L0J A;  4YT8 A;  2FAP B;  2WVQ A;  1MQV A;  3FAJ A;  3GAN A;  2R7O A;  3TUL A;  1S05 A;  1ZHY A;  1M2V A;  2X0C A;  5EGY A;  2HKV A;  1G8X A;  2W45 A;  3NDB B;  1VTM P;  1QPU A;  2HS5 A;  3JCU Q;  4BEJ A;  1GGQ A;  2L6G A;  4U5F E;  4DOZ A;  1EKY A;  1CGN A;  3MBG A;  1TFK B;  5KYX B;  1F1M A;  1RKC A;  4J30 B;  1LE4 A;  5L0G A;  5KYY A;  4JRZ A;  4CS9 A;  2YVK A;  4YT4 A;  1YYX A;  1CPQ A;  2A68 F;  4PJJ A;  5B3I A;  5DVW A;  4IAO A;  3ZDL A;  5L0C A;  3VYW A;  4LDK A;  3K33 A;  4H4K C;  3R2P A;  4CS9 C;  3IHU A;  1H7I A;  2VCA A;  3HTK C;  2YWA A;  4JCH A;  2CNW A;  1HW1 A;  3DXJ F;  2LSE A;  4N06 A;  2AP3 A;  2NSF A;  2XS1 A;  4MW8 A;  1OCR C;  1QVX A;  2J9W A;  2KJG A;  3DKA A;  1C17 M;  2F22 A;  4EKW A;  2A1D D;  2JD3 A;  3B0V C;  2HSB A;  3AOU A;  2PNO A;  3EHM A;  1TQG A;  1QKR A;  2IOQ A;  4U5B E;  3GEE A;  2CDQ A;  5L3V A;  2H7O A;  2KYH A;  2YL7 A;  3H2V A;  1WAS A;  1N1C A;  3RVY A;  1T5O A;  1TWC A;  3JZ0 A;  2GDC A;  3QW1 A;  3RFY A;  5F28 E;  4WAB A;  5DQZ A;  2R7V A;  3JYY A;  5A69 A;  1VYK A;  1ZHZ A;  5A6A A;  2GFH A;  1V74 B;  2I8B A;  4LDR A;  4OD5 A;  3ZQY A;  1TR2 A;  1RKE A;  2DGJ A;  5BQG A;  3CEX A;  4NTF A;  3ZTZ A;  1VOM A;  4CS7 A;  2ETS A;  4N4W A;  5AC5 A;  1O87 A;  1OXK A;  3E9V A;  3DMD A;  3IPM O;  4YK5 A;  3KYI A;  3N2Z B;  1Z6A A;  3FXH A;  2KQ9 A;  3M4C A;  3VF0 A;  3U3B A;  1U0B B;  2EPN A;  4IGG A;  2P1A A;  3Q6M A;  3UMH A;  2Y3G A;  4BPM A;  2P7V A;  2J0X A;  1JOG A;  2O9X A;  3O55 A;  1FFT C;  3EZH A;  1NSG B;  4PJM A;  3CAX A;  3T6B A;  3EH2 A;  3U9M A;  3RQE A;  3JRT A;  3QZC A;  4E7Z A;  3O10 A;  1WTY A;  3LEO A;  5A6J A;  2WL8 A;  2VCB A;  4FAP B;  4MVM A;  3FMS A;  3T4R A;  1JMW A;  4RBN A;  2DYS C;  4EUK B;  1OQC A;  1OCO C;  4O7G A;  2GAQ A;  2ZPA A;  3U2L A;  3S90 A;  2VCC A;  2XXA B;  2NSG A;  3H65 A;  1GS9 A;  2QNL A;  4BJ6 A;  1JR8 A;  1YZA A;  2AVK A;  2R9R B;  3C62 A;  3SEO A;  1VMA A;  3ZWI A;  1W2W A;  1ZVZ A;  2EPL X;  4JJG A;  4QDL A;  4R32 A;  4KC9 A;  2NPU A;  2H7B A;  3SXY A;  4DVZ A;  5COF A;  2KNH A;  4D4N A;  3SZR A;  4ZLC A;  5B3S C;  2CW0 F;  3UMK A;  3RKO F;  1D0Z A;  3JTL O;  4P6I C;  4U9D A;  1ZHX A;  2LD6 A;  3A11 A;  3AQC A;  3K1I C;  3LJB A;  1LE2 A;  3VM6 A;  3AG3 C;  2WVO A;  3FVY A;  5TJ5 E;  5FCL A;  2P0N A;  4RDA A;  1JPJ A;  1QZX A;  4I1O B;  1M57 C;  2Q4F A;  4JJF A;  3ECS A;  2KGO A;  4XPX A;  2E87 A;  4NC3 A;  3PDM P;  2XLM A;  5CIV A;  2YZS A;  3IQ6 A;  3OEO A;  3I5P A;  4CDA A;  5E33 A;  1KTM A;  4F4B A;  4EBJ A;  3EFO B;  1XZP A;  4HE8 D;  1H9G A;  2C04 A;  3U8P A;  1LPE A;  1PCX A;  3ZIB A;  4MTO A;  3G50 A;  5DS6 A;  3SXZ A;  5HV9 A;  2WZG A;  2J45 A;  4PJN A;  2KC3 A;  2NUP B;  1J8M F;  1ZYR F;  3C8G D;  3HLZ A;  4M63 A;  2JX0 A;  3W8I A;  2G62 A;  3IQ5 A;  2HJ3 A;  3OWT A;  2OCC C;  4JW1 A;  3V7O A;  2OKU A;  4BEM J;  1APC A;  1NZE A;  3KYJ A;  5DLJ A;  2YQY A;  3EGD B;  4CX9 A;  4AX2 A;  4OIN F;  256B A;  2B0J A;  3JT1 A;  3C8G B;  2XLW A;  3IEE A;  3KPH A;  4JCZ A;  4IWB A;  3NMI A;  3FAP B;  2IXP A;  3V5Z A;  2P6V A;  3S28 A;  2EPK X;  2IYL D;  3GEI A;  3JYH A;  1HE1 A;  3T6G B;  1LVK A;  1KU2 A;  1C02 A;  3TOL A;  5T3W A;  3WHN A;  1MND A;  4PFP A;  2LQG A;  2L9J A;  3X1O A;  3DD7 A;  4JE9 A;  2EIN C;  4MVU A;  1UFB A;  2QE9 A;  2XXA A;  3S9O A;  3ZC4 A;  5L0F A;  2J0W A;  3DE9 A;  5JP7 A;  2VC9 A;  3C7J A;  2L6H A;  4EWC A;  4J32 B;  4MVQ A;  1YVI A;  1D1C A;  1NFN A;  3DI5 A;  4JVS A;  2Q3T A;  4XPW A;  2XM0 A;  4JZA A;  5B1B C;  3TJ6 A;  1YDI A;  4FX5 A;  1C03 A;  4U5D E;  2GWW A;  1G5Z A;  2XSE A;  1Q0F A;  1L7C A;  3EHN A;  1J8Y F;  1OR3 A;  4IAQ A;  1U6H A;  1H6G A;  2GA0 A;  4NQF A;  4PAC A;  5IY5 C;  3KMI A;  3LAY A;  4DRI B;  3B0U X;  2IBF A;  4C3E A;  4DJ9 A;  3EG9 B;  2I15 A;  1OCC C;  2LFF A;  2R25 A;  1VLS A;  1NU7 D;  2VH3 A;  3Q7L A;  3RIP A;  1OKK D;  3EJN A;  4U5H A;  4CIP A;  3DAG A;  4Z9J A;  4G0H A;  4B6I A;  3EFO A;  4N6C A;  1RCP A;  4J7T A;  4Z9H A;  1ST6 A;  5A6K A;  2XLE A;  4IRU A;  2YKZ A;  1HE9 A;  2CGE A;  2NUP A;  5HSW A;  3WG7 C;  3AG4 C;  4QI2 A;  1LI7 A;  3VAY A;  2A0U A;  3S0X A;  1ORJ A;  3S84 A;  4I1M A;  1YAU O;  1HY5 A;  5L3Q A;  5AC4 A;  3QVY A;  1OW8 A;  3EGD A;  5F5H A;  4AE4 B;  3IQC A;  1ZHT A;  5B1A C;  5DQT A;  1ORS C;  1S7Z A;  3B9Q A;  2J9V A;  2WVN A;  1K40 A;  3C8G A;  3QTH A;  2R7X A;  2XLO A;  5KYW B;  2Q9B A;  4E0I A;  1Z63 A;  3GEH A;  2HUJ A;  2BL2 A;  4LDQ A;  4PFO A;  2EPO A;  4MVO A;  3SXM A;  1XWJ A;  3TOM A;  3GOD A;  3NYJ A;  3RVZ A;  4JIO A;  1Z7Q c;  2Q9C A;  4XLN F;  4MTF A;  3ABK C;  3K66 A;  1WWP A;  4NCQ A;  4XPY A; 
#chains in the Genus database with same CATH homology
 3S84 A;  1LE2 A;  1OR3 A;  1LE4 A;  1EQ1 A;  1OR2 A;  1EA8 A;  1BZ4 A;  1AEP A;  1B68 A;  1LPE A;  1NFO A;  1GS9 A;  3R2P A;  1YA9 A;  1H7I A;  2KC3 A;  1LS4 A;  1NFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...