1B68A

Apolipoprotein e4 (apoe4), 22k fragment
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
140
structure length
138
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of the N-terminal domain of apolipoprotein E4 with heparin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
molecule keywords APOLIPOPROTEIN E
total genus 66
structure length 138
sequence length 140
ec nomenclature
pdb deposition date 1999-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1b68A00
1EA8A 1AEPA 1OR3A 1BZ4A 1LE2A 1H7IA 1GS9A 1LS4A 1YA9A 3S84A 1EQ1A 1LPEA 2KC3A 1NFNA 3R2PA 1LE4A 1NFOA 1B68A 1OR2A
chains in the Genus database with same CATH superfamily
4PFOA 3FAPB 4MTFA 1FAPB 2XLEA 4JIOA 4EHPA 2CW0F 2WB7A 1AVOB 3EFOB 4MVRA 4G7ZF 3G50A 4E17A 1R4TA 3L8IA 4WGZA 1JAFA 3WAQA 2OEXA 3C7JA 4ZLCA 3C62A 1ORSC 4MS2A 3C8GA 4AX2A 3VRCA 2ICWG 4BPMA 3PMRA 1S05A 1YYXA 3H2VA 5L0GA 3SYNA 4JURI 1NU7D 3G4ZA 4JTDB 4Q7CA 4G0HA 3TQOA 2EPMX 3EZHA 4EBJA 3OWTA 1H6GA 1MMGA 4LDQA 4O7GA 3FAJA 2XM0A 2Q4FA 4G78A 4LLEA 1HE1A 2FFHA 4FAPB 1NFOA 5L0JA 1JRAA 1ZYRF 2CNWD 3V5ZA 2Z15A 5A6AA 4C3EA 1MMNA 1LS4A 4ULVA 4XEFA 3ZVRA 3EGXA 1A7EA 3DXJF 4ONSA 2EPNA 2XLWA 4I1MA 4KNWA 3WG7C 1NZEA 2HV7A 1WN0A 3US6A 1FMVA 3DMDA 1LKXA 5COMA 1WASA 1VOMA 2YQYA 2EIMC 4JKVA 3SEOA 3MYIA 5T1DB 1ZHYA 2QE9A 2YL1A 4QI2A 3U8VA 4IJJA 2EINC 2WVQA 3E9VA 2BL2A 3NMKA 3V7OA 1ZHZA 4PJLA 4BEJA 1OW7A 2HZ8A 1T9KA 5F5FA 1HW2A 1FFHA 4LLCA 2VCCA 5A6KA 5JSLA 3PCVA 2AP3A 2Y3GA 1Q0KA 4B6IA 2WZFA 4EBKA 4K7BA 3QVYA 3S84A 3M79A 1JOGA 3N24A 3KH2A 3UGOA 1HMOA 3WHNA 4E0HA 5JLIA 1OQCA 1O5HA 2HMZA 2NUPA 3NMIA 1WWPA 4X0RA 1OCRC 5CIVA 1O3UA 3AOUA 3NKEA 5EHHA 1Q0DA 2O9XA 4GEHA 5KYXA 1YDIA 5JVEA 5KYXB 3F47A 1NBBA 3EFOA 3L8JA 1M2VB 2EIJC 1KU2A 3POVA 3S27A 2IXOA 3VM6A 2UUHA 3CQZA 1TWCA 2YRFA 4XPXA 2A6EF 2KC3A 4KC9A 4MVSA 1YLMA 1YZCA 2LIGA 3G4XA 3LJBA 4YL0A 5KYYA 1E86A 2L9JA 2OG2A 3ABMC 1ZVZA 3KKBA 1A41A 4RD9A 3UMIA 4FWVA 4NTBA 1K05A 5B1BC 2Q9AA 3KPHA 3X1OA 1CGME 1A7VA 4A2NB 5B3SC 5E2QA 4DRHB 4DVZA 5BUOA 4MQ9F 3DAGA 3DM5A 2OU6A 1AEPA 2JD3A 1BZ4A 3AQCA 1RJ9A 3BRJA 3UR3C 2CDQA 5JP7A 3ITFA 3I5QA 2L6FA 4CS9A 5L0DA 3PHF2 3S0XA 2XXAA 1IZMA 1G4WR 2B0HA 4O6YA 4RBNA 3T6GB 1Z6AA 4ULWA 3K1IA 4DVYP 4BJ6C 3CAXA 2R7VA 1WATA 2BE5F 2YL3A 1FFTC 2KYHA 4AL1A 2XSEA 1HMDA 1FTSA 1CPRA 4IAQA 3B29A 3DWWA 2KGOA 5D92A 3LS1A 3B0UX 1LM3B 3ABLC 2IYLD 3C8ZA 4CJOA 4G7HF 1Q0FA 1ZHTA 2YHSA 1RJ9B 2HSQA 3DE8A 1LIHA 1N1CA 1JPJA 1M6TA 1XWJA 4WABA 2AWYA 1IW7F 2DYRC 2XLMA 3SZRA 5JT4A 3RFYA 1PD0A 4XLPF 2CNWA 1Y4CA 2OEVA 1D1CA 1JMWA 3O39A 2KNHA 2IOQA 2J45A 1MNEA 1WOLA 2Y39A 4CJGA 1L3PA 2TMVP 5AGFA 5E33A 1EA8A 2WZGA 3RQFA 2EILC 1RKEB 2CYDA 4MNDA 4IWBA 3DE9A 2OOCA 2ZXRA 4U5DE 4BJ1A 5T3TA 1OR3A 1SMYF 2J8WA 3ABKC 3H2UA 4EBBA 2J7PA 3A9CA 1YZAA 1VLSA 4LDKA 3DI5A 1YA7O 2ZXWC 1Z7Qc 3TD7A 5F5HA 3KYIA 1MNDA 2KJGA 4EKWA 2EPLX 2VCBA 1OR2A 2YLDA 4FESA 2WVOA 3SP1A 4CIPA 3JRTA 2HJMA 1EQ1A 1TFKB 2ZXPA 1KTMA 4EWCA 1YYJA 5DS5A 3K1HA 2NSGA 4YT2A 1A0BA 3ZG1A 1CGNA 4YK5A 1Z63A 4OIQF 2VB6A 4W8PA 3M1CB 1I5NA 2XL4A 3AGTA 2HMQA 3DD7A 3ASNC 4P9TA 1HE9A 3FHDA 3S28A 4E7SA 4KBLA 1J8MF 2WZLA 3Q6NA 4N06A 2AU5A 5D91A 1QSPA 4BJ5A 1T01A 4NCQA 1OXKA 3MX3A 3NKDA 3RH3A 2YWAA 2R7TA 3HTKC 1TKNA 1LE4A 4PFPA 5COFA 4A4AA 1SZIA 2W4MA 5AC4A 4O6MA 3BEHA 3IEEA 3JYYA 1SR2A 1RKEA 3HNJA 3L1MA 3LUTB 3U9JA 3AG3C 3AG1C 4CDVA 1GGQA 2J9UA 1JR8A 2WVNA 4XPWA 3IPMO 2VCAA 3U2LA 3ZSUA 2A0BA 1G5ZA 3HLZA 4YT8A 3I5PA 2DI3A 5IY5C 4HE8D 1M57C 3LEVA 3U8PA 3CZ6A 1H9GA 1K04A 4XQ1A 3SXZA 3JTLO 3MFNA 4DBQA 2X51A 4PR9A 2P1AA 3I4UA 3Q7GA 1MMDA 2J9VA 1LE2A 3PDMP 2PX0A 3NMJA 1F1MA 1Z23A 2DGJA 4U5EE 2PF4E 3QTHA 5B1AC 5AC5A 1FNTc 3NYMA 1OKKD 4JVSA 4WGYA 4CDAA 2QLAA 3SXMA 3T9OA 3ZWIA 2OJED 3S9OA 2V3CC 2G3KA 3DZAA 1BR1A 1QVXA 1G8XA 3GEEA 1HY5A 2J46A 3KL4A 3LEOA 3MBGA 1Z3IX 3T6BA 4JCHA 3JRMO 2P7VA 2ASRA 4BG0A 2NUTB 2GA0A 3F46A 1VYKA 3GM2A 3NRHA 3TJ6A 1BR2A 4JW1A 2I8BA 1RXQA 2HKVA 2LFFA 2R7QA 3AG4C 4HFFB 5A6BA 1E84A 2R02A 3N2ZB 4JJGA 4U5CE 4CSAC 1D0ZA 1H7IA 3M15A 1LVKA 1OXBA 4MVQA 4NTAA 1V55C 3OA1A 3UNGC 3V5YA 1EKYA 3W4YA 2YEVA 3DJUB 5TJ5E 4IGGA 2R7OA 1QKRA 1V74B 3K7DA 3R2PA 1NSGB 4J7YA 2CGEA 2R7SA 2VC9A 4Q5SF 2IBFA 3KYJA 1TR2A 3IQ6A 3ZDLA 1APCA 4E18A 1Y6DA 1CPQA 2GFHA 4YWQA 4NY3A 3RW0A 4R32A 1TFOB 3U0CA 4N6HA 4U5HA 2L7AA 4CS9C 1PV3A 2ZXOA 2OCCC 3EH2A 4IARA 3ECSA 4U9DA 5L3QA 1RMVA 1ZU4A 3L0IA 1OCOC 2ZPAA 1TWHA 2R05A 3U5SA 2Q7RA 2OQMA 3C63A 4F4BA 3SXKA 1LI7A 3C18A 2H8AA 3LAYA 4JEAA 5JS5A 2FAPB 3FOPA 5HV9A 5L3VA 4OIOF 1DOWA 1XZPA 5KYUA 3M4BA 4OD4A 4PJJA 1BBHA 3M4CA 3U2MA 2XS1A 2J9BA 5L0IA 2A6HF 4CS8A 2EPKX 3ZQVA 1SYQA 2JPUA 1LI5A 2Q00A 4MW8A 4YL3A 5T3WA 4UDVA 2EIKC 3GM3A 2R7UA 2YVKA 4WJ0A 5KYUB 3JCUQ 4LACB 4M63A 1I4YA 1NU9C 2PNOA 2QUPA 5JRAA 2NSFA 4U5GA 2LCHA 4LDRA 3B9QA 1C02A 4GQHA 5HSWA 5CI8A 2GAQA 1S7ZA 4NQFA 1GQAA 4G7OF 1FR0A 1QPUA 3VF0A 1M2VA 1NLXA 2G3VA 1D0XA 2YL0A 2H7VC 4J7TA 5DQTA 2XS8A 4OIPF 2BC5A 2W45A 4I1OB 2D5RB 2XL6A 2YLIA 3B0PA 2DB4A 2OKUA 4Q4ZF 3TJ5A 3GWLA 2Y69C 4Z9HA 4CBEA 1BR4A 1VB5A 1YARO 1ZHWA 2XLVA 4IB4A 1ORJA 3ATPA 1GS9A 3GODA 2HJ3A 4OD5A 5L0FA 2HS5A 4MTOA 5F28E 2E87A 3QVZA 3TOLA 2H7OA 2RSEB 3MYFA 5DVWA 2NG1A 3RQEA 5BQGA 3RVYA 3UMHA 4BEMJ 4MVMA 2M64A 4CS8C 1D1BA 2XM4A 2PFDA 1QQ3A 2YKZA 3JSEO 1KNYA 5COGA 2X0CA 4N4WA 3J06A 2VH3A 4XEKA 1QLEC 3L34A 4PJNA 3DJNB 5K0IA 4P9FA 1YVIA 1ZW2A 2XLOA 4ANJA 1L7CA 4C7OA 1J8YF 3IQ5A 3AGUA 1MQVA 2XRHA 1U89A 1Q0MA 4GYTA 5E3AA 1MMAA 3W8HA 3X2QC 2ZD9A 2J0XA 2UUIA 2A68F 3NG1A 3VAYA 4BJ5C 1PD1A 4DBRA 5DS6A 3T4RA 5DS4A 3B71A 4DRIB 4I44A 4K0DA 2A69F 2W9YA 3U3FA 2HV6A 2C04A 3DAFA 3V5XA 1I4ZA 1OCZC 256BA 1GM5A 2FGYA 2GDCA 4DOZA 4C3BA 2AVKA 2I15A 4MTGA 3SXYA 1YAUO 5A6BD 3WODF 2Q9CA 2R9RB 3GWNA 4U5FE 4YN0B 5DQZA 1LPEA 4DJ9A 5L0CA 4MVUA 1HW1A 4OIRF 2LSEA 1YJGA 5L0HA 2GWWA 2MYSA 3HNIA 4OINF 4E7ZA 3QW0A 3E70C 2P0NA 3GORA 2D4UA 4KNVA 3HKKA 2XLDA 3FMSA 2XXAB 3HNKA 2OJQA 1OKKA 3Q7LA 2G62A 3H65A 4YT4A 1TWGA 1ST6A 4AK9A 4XTKA 3T6JA 3SNHA 4D4XA 4FX5A 4PJMA 3A11A 3RQGA 2PX3A 2A1DD 4JEBA 4AE4A 4JZAA 4KI2A 3HNLA 3OEOA 4H54A 5E3CA 3TULA 3AQBA 3S90A 1DOVA 1Z5ZA 3FXHA 2XLHA 3GM1A 4U9EA 5FZTA 3ASOC 3JSZA 2WL8A 4PK4A 3UGPA 2R7RA 2MHRA 2LD6A 1E83A 3ZC4A 1OW8A 4I3MA 3IQTA 2B0JA 5KYWA 5BQHA 4J32B 4NC3A 3W2VA 4C7OB 3C8GD 2R03A 4IRUA 3Q6MA 1B68A 3DM9B 3NDBB 2YLGA 3UMKA 3KMIA 4XEVA 3RIPA 3ZTMA 4CIHA 3GEHA 4JRZA 2F22A 3S29A 4JTCB 5A6JA 3GANA 1D1AA 2EPOA 3CEXA 1A7DA 1TWAA 2PBEA 2QTVA 4CS7A 4XPYA 2P6VA 2HFIA 3EGDB 4QDLA 1PCXA 2AWCA 4XWJA 2Y3HA 4JCZA 5KYWB 4JTAB 3K6BA 1NFNA 4CSAA 2QNLA 1JPNA 2RD9A 3ZTZA 2VASA 3EJNA 4RDAA 3R7CA 2J0WA 3GEIA 3ZQYA 1R5ID 2ETSA 3ZIBA 1LS1A 2HUJA 1CGOA 2KQ9A 1AUEA 2C03A 1SF8A 1VLTA 4D4NA 4ZLDA 3FVYA 2Y3DA 1WGWA 4CX9A 1TQGA 1OCCC 2Q3TA 1OW6A 3EHNA 5A69A 3NYLA 4XLNF 3CSKA 1D0YA 3K66A 1XZQA 3O6XA 2NPUA 3EGXB 2LP4A 3LNRA 3NYJA 3O55A 2Y3BA 4PACA 3TOMA 3JT1A 4MVOA 1M2OA 4JJFA 4JE9A 4HFKB 4NTFA 4AL0A 4MVZA 4Z9JA 4C3DA 1VYIA 4O79A 1VMAA 3DKAA 3EZIA 3HJCA 1BDJB 4HEAJ 4YT5A 4CDYA 4ER9A 1EI7A 4YJWA 2CCYA 2NUTA 3JYHA 3QZCA 1E85A 1ZZPA 2JX0A 1T6UA 2V26A 2KK1A 3K1IC 5FCLA 2L81A 5EGYA 1UFBA 2LK4A 3EHMA 4E0IA 4EUKB 1W2WA 3LS0A 5B3IA 1U0BB 2H7BA 2L6GA 2MWQA 1NG1A 3JZ0A 3C8GB 1FMWA 1K40A 3RKOF 2QY9A 2PP4A 2LFDA 4EIYA 4BJTA 5CI9A 3AJMA 2R7XA 4MW3A 3RF3A 1G4US 1Q0GA 3LLKA 3AG2C 5KYYB 1RCPA 1UG7A 1T6QA 1E2XA 1QZXA 2J7PD 4LERA 2DYSC 1V4AA 4L6RA 3EQLF 1WTYA 4H4KC 4DRJB 2KSFA 1YA9A 5KYNA 1ORYA 3EGDA 5DLJA 2YL7A 3FOOA 1O87A 4N6CA 4BJ6A 2P61A 1ZU5A 2W4BA 3LLIA 4AE4B 3N0TA 2Q9BA 2J9WA 2IXPA 3EG9B 3K33A 4QI0A 3RYLA 4JC7A 4K1OA 5GPGB 1C17M 4U5BE 3U9MA 2LQGA 3U3BA 1T6IA 3IQCA 2R25A 5EK0A 4J30B 5BQIA 2IM8A 2R7WA 4W8KA 2XL8A 2L6HA 3EH1A 3IHUA 4O6NA 3RVZA 1V54C 2M4EA 3LESA 2IXMA 3FDQA 1T5OA 3O10A 3EG9A 3B0VC 4IAOA 3MLGA 2YZSA 3EPVA 3VYWA 1U6HA 1ZW3A 3LNMB 4YL1A 3QW1A 1RKCA 1H9TA 1C03A 1M56C 4P6IC 3TK0A 5JUAA 3QMKA 2KW3C 1ZHXA 2NUPB 4Z9IA 2HSBA 3W2WA 3W8IA 2IXNA 2A0UA 1VTMP 1VK5A 4DXWA
chains in the Genus database with same CATH topology
1EA8A 1AEPA 1OR3A 1BZ4A 1LE2A 1H7IA 1GS9A 1LS4A 1YA9A 3S84A 1EQ1A 1LPEA 2KC3A 1NFNA 3R2PA 1LE4A 1NFOA 1B68A 1OR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EA8 A;  1AEP A;  1OR3 A;  1BZ4 A;  1LE2 A;  1H7I A;  1GS9 A;  1LS4 A;  1YA9 A;  3S84 A;  1EQ1 A;  1LPE A;  2KC3 A;  1NFN A;  3R2P A;  1LE4 A;  1NFO A;  1B68 A;  1OR2 A; 
#chains in the Genus database with same CATH topology
 4PFO A;  3FAP B;  4MTF A;  1FAP B;  2XLE A;  4JIO A;  4EHP A;  2CW0 F;  2WB7 A;  1AVO B;  3EFO B;  4MVR A;  4G7Z F;  3G50 A;  4E17 A;  1R4T A;  3L8I A;  4WGZ A;  1JAF A;  3WAQ A;  2OEX A;  3C7J A;  4ZLC A;  3C62 A;  1ORS C;  4MS2 A;  3C8G A;  4AX2 A;  3VRC A;  2ICW G;  4BPM A;  3PMR A;  1S05 A;  1YYX A;  3H2V A;  5L0G A;  3SYN A;  4JUR I;  1NU7 D;  3G4Z A;  4JTD B;  4Q7C A;  4G0H A;  3TQO A;  2EPM X;  3EZH A;  4EBJ A;  3OWT A;  1H6G A;  1MMG A;  4LDQ A;  4O7G A;  3FAJ A;  2XM0 A;  2Q4F A;  4G78 A;  4LLE A;  1HE1 A;  2FFH A;  4FAP B;  1NFO A;  5L0J A;  1JRA A;  1ZYR F;  2CNW D;  3V5Z A;  2Z15 A;  5A6A A;  4C3E A;  1MMN A;  1LS4 A;  4ULV A;  4XEF A;  3ZVR A;  3EGX A;  1A7E A;  3DXJ F;  4ONS A;  2EPN A;  2XLW A;  4I1M A;  4KNW A;  3WG7 C;  1NZE A;  2HV7 A;  1WN0 A;  3US6 A;  1FMV A;  3DMD A;  1LKX A;  5COM A;  1WAS A;  1VOM A;  2YQY A;  2EIM C;  4JKV A;  3SEO A;  3MYI A;  5T1D B;  1ZHY A;  2QE9 A;  2YL1 A;  4QI2 A;  3U8V A;  4IJJ A;  2EIN C;  2WVQ A;  3E9V A;  2BL2 A;  3NMK A;  3V7O A;  1ZHZ A;  4PJL A;  4BEJ A;  1OW7 A;  2HZ8 A;  1T9K A;  5F5F A;  1HW2 A;  1FFH A;  4LLC A;  2VCC A;  5A6K A;  5JSL A;  3PCV A;  2AP3 A;  2Y3G A;  1Q0K A;  4B6I A;  2WZF A;  4EBK A;  4K7B A;  3QVY A;  3S84 A;  3M79 A;  1JOG A;  3N24 A;  3KH2 A;  3UGO A;  1HMO A;  3WHN A;  4E0H A;  5JLI A;  1OQC A;  1O5H A;  2HMZ A;  2NUP A;  3NMI A;  1WWP A;  4X0R A;  1OCR C;  5CIV A;  1O3U A;  3AOU A;  3NKE A;  5EHH A;  1Q0D A;  2O9X A;  4GEH A;  5KYX A;  1YDI A;  5JVE A;  5KYX B;  3F47 A;  1NBB A;  3EFO A;  3L8J A;  1M2V B;  2EIJ C;  1KU2 A;  3POV A;  3S27 A;  2IXO A;  3VM6 A;  2UUH A;  3CQZ A;  1TWC A;  2YRF A;  4XPX A;  2A6E F;  2KC3 A;  4KC9 A;  4MVS A;  1YLM A;  1YZC A;  2LIG A;  3G4X A;  3LJB A;  4YL0 A;  5KYY A;  1E86 A;  2L9J A;  2OG2 A;  3ABM C;  1ZVZ A;  3KKB A;  1A41 A;  4RD9 A;  3UMI A;  4FWV A;  4NTB A;  1K05 A;  5B1B C;  2Q9A A;  3KPH A;  3X1O A;  1CGM E;  1A7V A;  4A2N B;  5B3S C;  5E2Q A;  4DRH B;  4DVZ A;  5BUO A;  4MQ9 F;  3DAG A;  3DM5 A;  2OU6 A;  1AEP A;  2JD3 A;  1BZ4 A;  3AQC A;  1RJ9 A;  3BRJ A;  3UR3 C;  2CDQ A;  5JP7 A;  3ITF A;  3I5Q A;  2L6F A;  4CS9 A;  5L0D A;  3PHF 2;  3S0X A;  2XXA A;  1IZM A;  1G4W R;  2B0H A;  4O6Y A;  4RBN A;  3T6G B;  1Z6A A;  4ULW A;  3K1I A;  4DVY P;  4BJ6 C;  3CAX A;  2R7V A;  1WAT A;  2BE5 F;  2YL3 A;  1FFT C;  2KYH A;  4AL1 A;  2XSE A;  1HMD A;  1FTS A;  1CPR A;  4IAQ A;  3B29 A;  3DWW A;  2KGO A;  5D92 A;  3LS1 A;  3B0U X;  1LM3 B;  3ABL C;  2IYL D;  3C8Z A;  4CJO A;  4G7H F;  1Q0F A;  1ZHT A;  2YHS A;  1RJ9 B;  2HSQ A;  3DE8 A;  1LIH A;  1N1C A;  1JPJ A;  1M6T A;  1XWJ A;  4WAB A;  2AWY A;  1IW7 F;  2DYR C;  2XLM A;  3SZR A;  5JT4 A;  3RFY A;  1PD0 A;  4XLP F;  2CNW A;  1Y4C A;  2OEV A;  1D1C A;  1JMW A;  3O39 A;  2KNH A;  2IOQ A;  2J45 A;  1MNE A;  1WOL A;  2Y39 A;  4CJG A;  1L3P A;  2TMV P;  5AGF A;  5E33 A;  1EA8 A;  2WZG A;  3RQF A;  2EIL C;  1RKE B;  2CYD A;  4MND A;  4IWB A;  3DE9 A;  2OOC A;  2ZXR A;  4U5D E;  4BJ1 A;  5T3T A;  1OR3 A;  1SMY F;  2J8W A;  3ABK C;  3H2U A;  4EBB A;  2J7P A;  3A9C A;  1YZA A;  1VLS A;  4LDK A;  3DI5 A;  1YA7 O;  2ZXW C;  1Z7Q c;  3TD7 A;  5F5H A;  3KYI A;  1MND A;  2KJG A;  4EKW A;  2EPL X;  2VCB A;  1OR2 A;  2YLD A;  4FES A;  2WVO A;  3SP1 A;  4CIP A;  3JRT A;  2HJM A;  1EQ1 A;  1TFK B;  2ZXP A;  1KTM A;  4EWC A;  1YYJ A;  5DS5 A;  3K1H A;  2NSG A;  4YT2 A;  1A0B A;  3ZG1 A;  1CGN A;  4YK5 A;  1Z63 A;  4OIQ F;  2VB6 A;  4W8P A;  3M1C B;  1I5N A;  2XL4 A;  3AGT A;  2HMQ A;  3DD7 A;  3ASN C;  4P9T A;  1HE9 A;  3FHD A;  3S28 A;  4E7S A;  4KBL A;  1J8M F;  2WZL A;  3Q6N A;  4N06 A;  2AU5 A;  5D91 A;  1QSP A;  4BJ5 A;  1T01 A;  4NCQ A;  1OXK A;  3MX3 A;  3NKD A;  3RH3 A;  2YWA A;  2R7T A;  3HTK C;  1TKN A;  1LE4 A;  4PFP A;  5COF A;  4A4A A;  1SZI A;  2W4M A;  5AC4 A;  4O6M A;  3BEH A;  3IEE A;  3JYY A;  1SR2 A;  1RKE A;  3HNJ A;  3L1M A;  3LUT B;  3U9J A;  3AG3 C;  3AG1 C;  4CDV A;  1GGQ A;  2J9U A;  1JR8 A;  2WVN A;  4XPW A;  3IPM O;  2VCA A;  3U2L A;  3ZSU A;  2A0B A;  1G5Z A;  3HLZ A;  4YT8 A;  3I5P A;  2DI3 A;  5IY5 C;  4HE8 D;  1M57 C;  3LEV A;  3U8P A;  3CZ6 A;  1H9G A;  1K04 A;  4XQ1 A;  3SXZ A;  3JTL O;  3MFN A;  4DBQ A;  2X51 A;  4PR9 A;  2P1A A;  3I4U A;  3Q7G A;  1MMD A;  2J9V A;  1LE2 A;  3PDM P;  2PX0 A;  3NMJ A;  1F1M A;  1Z23 A;  2DGJ A;  4U5E E;  2PF4 E;  3QTH A;  5B1A C;  5AC5 A;  1FNT c;  3NYM A;  1OKK D;  4JVS A;  4WGY A;  4CDA A;  2QLA A;  3SXM A;  3T9O A;  3ZWI A;  2OJE D;  3S9O A;  2V3C C;  2G3K A;  3DZA A;  1BR1 A;  1QVX A;  1G8X A;  3GEE A;  1HY5 A;  2J46 A;  3KL4 A;  3LEO A;  3MBG A;  1Z3I X;  3T6B A;  4JCH A;  3JRM O;  2P7V A;  2ASR A;  4BG0 A;  2NUT B;  2GA0 A;  3F46 A;  1VYK A;  3GM2 A;  3NRH A;  3TJ6 A;  1BR2 A;  4JW1 A;  2I8B A;  1RXQ A;  2HKV A;  2LFF A;  2R7Q A;  3AG4 C;  4HFF B;  5A6B A;  1E84 A;  2R02 A;  3N2Z B;  4JJG A;  4U5C E;  4CSA C;  1D0Z A;  1H7I A;  3M15 A;  1LVK A;  1OXB A;  4MVQ A;  4NTA A;  1V55 C;  3OA1 A;  3UNG C;  3V5Y A;  1EKY A;  3W4Y A;  2YEV A;  3DJU B;  5TJ5 E;  4IGG A;  2R7O A;  1QKR A;  1V74 B;  3K7D A;  3R2P A;  1NSG B;  4J7Y A;  2CGE A;  2R7S A;  2VC9 A;  4Q5S F;  2IBF A;  3KYJ A;  1TR2 A;  3IQ6 A;  3ZDL A;  1APC A;  4E18 A;  1Y6D A;  1CPQ A;  2GFH A;  4YWQ A;  4NY3 A;  3RW0 A;  4R32 A;  1TFO B;  3U0C A;  4N6H A;  4U5H A;  2L7A A;  4CS9 C;  1PV3 A;  2ZXO A;  2OCC C;  3EH2 A;  4IAR A;  3ECS A;  4U9D A;  5L3Q A;  1RMV A;  1ZU4 A;  3L0I A;  1OCO C;  2ZPA A;  1TWH A;  2R05 A;  3U5S A;  2Q7R A;  2OQM A;  3C63 A;  4F4B A;  3SXK A;  1LI7 A;  3C18 A;  2H8A A;  3LAY A;  4JEA A;  5JS5 A;  2FAP B;  3FOP A;  5HV9 A;  5L3V A;  4OIO F;  1DOW A;  1XZP A;  5KYU A;  3M4B A;  4OD4 A;  4PJJ A;  1BBH A;  3M4C A;  3U2M A;  2XS1 A;  2J9B A;  5L0I A;  2A6H F;  4CS8 A;  2EPK X;  3ZQV A;  1SYQ A;  2JPU A;  1LI5 A;  2Q00 A;  4MW8 A;  4YL3 A;  5T3W A;  4UDV A;  2EIK C;  3GM3 A;  2R7U A;  2YVK A;  4WJ0 A;  5KYU B;  3JCU Q;  4LAC B;  4M63 A;  1I4Y A;  1NU9 C;  2PNO A;  2QUP A;  5JRA A;  2NSF A;  4U5G A;  2LCH A;  4LDR A;  3B9Q A;  1C02 A;  4GQH A;  5HSW A;  5CI8 A;  2GAQ A;  1S7Z A;  4NQF A;  1GQA A;  4G7O F;  1FR0 A;  1QPU A;  3VF0 A;  1M2V A;  1NLX A;  2G3V A;  1D0X A;  2YL0 A;  2H7V C;  4J7T A;  5DQT A;  2XS8 A;  4OIP F;  2BC5 A;  2W45 A;  4I1O B;  2D5R B;  2XL6 A;  2YLI A;  3B0P A;  2DB4 A;  2OKU A;  4Q4Z F;  3TJ5 A;  3GWL A;  2Y69 C;  4Z9H A;  4CBE A;  1BR4 A;  1VB5 A;  1YAR O;  1ZHW A;  2XLV A;  4IB4 A;  1ORJ A;  3ATP A;  1GS9 A;  3GOD A;  2HJ3 A;  4OD5 A;  5L0F A;  2HS5 A;  4MTO A;  5F28 E;  2E87 A;  3QVZ A;  3TOL A;  2H7O A;  2RSE B;  3MYF A;  5DVW A;  2NG1 A;  3RQE A;  5BQG A;  3RVY A;  3UMH A;  4BEM J;  4MVM A;  2M64 A;  4CS8 C;  1D1B A;  2XM4 A;  2PFD A;  1QQ3 A;  2YKZ A;  3JSE O;  1KNY A;  5COG A;  2X0C A;  4N4W A;  3J06 A;  2VH3 A;  4XEK A;  1QLE C;  3L34 A;  4PJN A;  3DJN B;  5K0I A;  4P9F A;  1YVI A;  1ZW2 A;  2XLO A;  4ANJ A;  1L7C A;  4C7O A;  1J8Y F;  3IQ5 A;  3AGU A;  1MQV A;  2XRH A;  1U89 A;  1Q0M A;  4GYT A;  5E3A A;  1MMA A;  3W8H A;  3X2Q C;  2ZD9 A;  2J0X A;  2UUI A;  2A68 F;  3NG1 A;  3VAY A;  4BJ5 C;  1PD1 A;  4DBR A;  5DS6 A;  3T4R A;  5DS4 A;  3B71 A;  4DRI B;  4I44 A;  4K0D A;  2A69 F;  2W9Y A;  3U3F A;  2HV6 A;  2C04 A;  3DAF A;  3V5X A;  1I4Z A;  1OCZ C;  256B A;  1GM5 A;  2FGY A;  2GDC A;  4DOZ A;  4C3B A;  2AVK A;  2I15 A;  4MTG A;  3SXY A;  1YAU O;  5A6B D;  3WOD F;  2Q9C A;  2R9R B;  3GWN A;  4U5F E;  4YN0 B;  5DQZ A;  1LPE A;  4DJ9 A;  5L0C A;  4MVU A;  1HW1 A;  4OIR F;  2LSE A;  1YJG A;  5L0H A;  2GWW A;  2MYS A;  3HNI A;  4OIN F;  4E7Z A;  3QW0 A;  3E70 C;  2P0N A;  3GOR A;  2D4U A;  4KNV A;  3HKK A;  2XLD A;  3FMS A;  2XXA B;  3HNK A;  2OJQ A;  1OKK A;  3Q7L A;  2G62 A;  3H65 A;  4YT4 A;  1TWG A;  1ST6 A;  4AK9 A;  4XTK A;  3T6J A;  3SNH A;  4D4X A;  4FX5 A;  4PJM A;  3A11 A;  3RQG A;  2PX3 A;  2A1D D;  4JEB A;  4AE4 A;  4JZA A;  4KI2 A;  3HNL A;  3OEO A;  4H54 A;  5E3C A;  3TUL A;  3AQB A;  3S90 A;  1DOV A;  1Z5Z A;  3FXH A;  2XLH A;  3GM1 A;  4U9E A;  5FZT A;  3ASO C;  3JSZ A;  2WL8 A;  4PK4 A;  3UGP A;  2R7R A;  2MHR A;  2LD6 A;  1E83 A;  3ZC4 A;  1OW8 A;  4I3M A;  3IQT A;  2B0J A;  5KYW A;  5BQH A;  4J32 B;  4NC3 A;  3W2V A;  4C7O B;  3C8G D;  2R03 A;  4IRU A;  3Q6M A;  1B68 A;  3DM9 B;  3NDB B;  2YLG A;  3UMK A;  3KMI A;  4XEV A;  3RIP A;  3ZTM A;  4CIH A;  3GEH A;  4JRZ A;  2F22 A;  3S29 A;  4JTC B;  5A6J A;  3GAN A;  1D1A A;  2EPO A;  3CEX A;  1A7D A;  1TWA A;  2PBE A;  2QTV A;  4CS7 A;  4XPY A;  2P6V A;  2HFI A;  3EGD B;  4QDL A;  1PCX A;  2AWC A;  4XWJ A;  2Y3H A;  4JCZ A;  5KYW B;  4JTA B;  3K6B A;  1NFN A;  4CSA A;  2QNL A;  1JPN A;  2RD9 A;  3ZTZ A;  2VAS A;  3EJN A;  4RDA A;  3R7C A;  2J0W A;  3GEI A;  3ZQY A;  1R5I D;  2ETS A;  3ZIB A;  1LS1 A;  2HUJ A;  1CGO A;  2KQ9 A;  1AUE A;  2C03 A;  1SF8 A;  1VLT A;  4D4N A;  4ZLD A;  3FVY A;  2Y3D A;  1WGW A;  4CX9 A;  1TQG A;  1OCC C;  2Q3T A;  1OW6 A;  3EHN A;  5A69 A;  3NYL A;  4XLN F;  3CSK A;  1D0Y A;  3K66 A;  1XZQ A;  3O6X A;  2NPU A;  3EGX B;  2LP4 A;  3LNR A;  3NYJ A;  3O55 A;  2Y3B A;  4PAC A;  3TOM A;  3JT1 A;  4MVO A;  1M2O A;  4JJF A;  4JE9 A;  4HFK B;  4NTF A;  4AL0 A;  4MVZ A;  4Z9J A;  4C3D A;  1VYI A;  4O79 A;  1VMA A;  3DKA A;  3EZI A;  3HJC A;  1BDJ B;  4HEA J;  4YT5 A;  4CDY A;  4ER9 A;  1EI7 A;  4YJW A;  2CCY A;  2NUT A;  3JYH A;  3QZC A;  1E85 A;  1ZZP A;  2JX0 A;  1T6U A;  2V26 A;  2KK1 A;  3K1I C;  5FCL A;  2L81 A;  5EGY A;  1UFB A;  2LK4 A;  3EHM A;  4E0I A;  4EUK B;  1W2W A;  3LS0 A;  5B3I A;  1U0B B;  2H7B A;  2L6G A;  2MWQ A;  1NG1 A;  3JZ0 A;  3C8G B;  1FMW A;  1K40 A;  3RKO F;  2QY9 A;  2PP4 A;  2LFD A;  4EIY A;  4BJT A;  5CI9 A;  3AJM A;  2R7X A;  4MW3 A;  3RF3 A;  1G4U S;  1Q0G A;  3LLK A;  3AG2 C;  5KYY B;  1RCP A;  1UG7 A;  1T6Q A;  1E2X A;  1QZX A;  2J7P D;  4LER A;  2DYS C;  1V4A A;  4L6R A;  3EQL F;  1WTY A;  4H4K C;  4DRJ B;  2KSF A;  1YA9 A;  5KYN A;  1ORY A;  3EGD A;  5DLJ A;  2YL7 A;  3FOO A;  1O87 A;  4N6C A;  4BJ6 A;  2P61 A;  1ZU5 A;  2W4B A;  3LLI A;  4AE4 B;  3N0T A;  2Q9B A;  2J9W A;  2IXP A;  3EG9 B;  3K33 A;  4QI0 A;  3RYL A;  4JC7 A;  4K1O A;  5GPG B;  1C17 M;  4U5B E;  3U9M A;  2LQG A;  3U3B A;  1T6I A;  3IQC A;  2R25 A;  5EK0 A;  4J30 B;  5BQI A;  2IM8 A;  2R7W A;  4W8K A;  2XL8 A;  2L6H A;  3EH1 A;  3IHU A;  4O6N A;  3RVZ A;  1V54 C;  2M4E A;  3LES A;  2IXM A;  3FDQ A;  1T5O A;  3O10 A;  3EG9 A;  3B0V C;  4IAO A;  3MLG A;  2YZS A;  3EPV A;  3VYW A;  1U6H A;  1ZW3 A;  3LNM B;  4YL1 A;  3QW1 A;  1RKC A;  1H9T A;  1C03 A;  1M56 C;  4P6I C;  3TK0 A;  5JUA A;  3QMK A;  2KW3 C;  1ZHX A;  2NUP B;  4Z9I A;  2HSB A;  3W2W A;  3W8I A;  2IXN A;  2A0U A;  1VTM P;  1VK5 A;  4DXW A; 
#chains in the Genus database with same CATH homology
 1EA8 A;  1AEP A;  1OR3 A;  1BZ4 A;  1LE2 A;  1H7I A;  1GS9 A;  1LS4 A;  1YA9 A;  3S84 A;  1EQ1 A;  1LPE A;  2KC3 A;  1NFN A;  3R2P A;  1LE4 A;  1NFO A;  1B68 A;  1OR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...