1B68A

Apolipoprotein e4 (apoe4), 22k fragment
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
140
structure length
138
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords APOLIPOPROTEIN E
publication title Interaction of the N-terminal domain of apolipoprotein E4 with heparin.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 138
sequence length 140
ec nomenclature
pdb deposition date 1999-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1b68A00
1NFOA 1GS9A 3R2PA 1BZ4A 1LE4A 1EA8A 1AEPA 1LS4A 1EQ1A 1B68A 1LE2A 1OR3A 1LPEA 1OR2A 1YA9A 1H7IA 2KC3A 1NFNA 3S84A
chains in the Genus database with same CATH superfamily
2EINC 4YT4A 1LI7A 3R2PA 4MVQA 2J8WA 5KYYA 4XQ1A 4CSAC 2MHRA 3Q7LA 1LE4A 2Y3GA 1LS4A 1NLXA 2DGJA 4R32A 4BJTA 4XPWA 1LM3B 3AQCA 3UMKA 5T3WA 3EQLF 3W4YA 4HEAJ 2J9UA 3O10A 4BG0A 1OCRC 1NBBA 3DZAA 4IGGA 2CNWD 1H9TA 2VH3A 2Y3HA 2R9RB 5KYXA 3DAGA 3RVYA 3B29A 2IBFA 4AK9A 2LQGA 4EBJA 5BQIA 1VMAA 2KC3A 3EG9A 1VYIA 2H7OA 1FAPB 3NKEA 2H7BA 2XXAB 1IW7F 4W8PA 3AQBA 1U0BB 4DOZA 4JIOA 5KYNA 3NDBB 3I5QA 3CAXA 2A69F 3EHNA 5COFA 1TKNA 1M2VA 4Z9HA 3LLKA 3TJ6A 4OIOF 4LACB 1LIHA 3U3FA 2EPOA 1IZMA 5KYUA 3CEXA 2JPUA 1O3UA 4JTDB 2IXPA 1E2XA 3JSZA 3K1IA 4CDVA 1APCA 1T5OA 1B68A 3HNJA 3U3BA 3S0XA 3S27A 1QSPA 1CPQA 4J7TA 2EPLX 3KKBA 4K7BA 3U2MA 5L3VA 4GQHA 1J8YF 2RSEB 3GM3A 2L7AA 2ZD9A 4IJJA 4YN0B 1VOMA 3FAPB 3AOUA 2HS5A 2HSBA 1OCOC 1WATA 1WGWA 4F4BA 3K66A 1UFBA 1E84A 3M79A 4JJGA 2ETSA 4KNVA 2X0CA 2WVOA 3HKKA 4JE9A 2GDCA 3C7JA 4C3EA 1CGME 1G4US 1Z63A 3S84A 3JTLO 1BBHA 2AU5A 5A6KA 2X51A 1Z7Qc 5KYWB 1XZPA 4JEAA 4Q5SF 2QLAA 2XLOA 4KC9A 1VB5A 2KYHA 2EIJC 4I3MA 4YJWA 2OEXA 4OIQF 4K1OA 2YVKA 4RDAA 1PD0A 4JEBA 2OEVA 4XEFA 5JVEA 5A6AA 5AGFA 1ZHZA 2IM8A 3I5PA 3ZDLA 3DMDA 3FVYA 3IQCA 1RCPA 3OEOA 5JLIA 1CPRA 2BE5F 3N24A 2J7PD 3LEOA 3W8HA 4EWCA 2PBEA 4EBBA 2JD3A 2F22A 2IYLD 2L9JA 3T6GB 4NTBA 3GORA 1OQCA 1I4ZA 4DBQA 2GA0A 5AC5A 5B1AC 2YL3A 4U5BE 1XWJA 4DVZA 4C7OA 2P0NA 4W8KA 3EGXA 1RXQA 4CX9A 3TULA 1WWPA 4XPYA 3ZQYA 3U8VA 4AE4A 2TMVP 2NUPB 2HJ3A 1L7CA 2UUIA 1M6TA 2WZLA 3MBGA 1FMVA 1WN0A 4JVSA 2IOQA 4ONSA 3X1OA 4E7ZA 3B71A 1JPJA 3L34A 3J06A 2ASRA 1HY5A 3AG3C 5CI8A 4AL1A 1QPUA 4BPMA 5F28E 4DXWA 4QI2A 2XM0A 3EGXB 3KMIA 3W8IA 1F1MA 4FX5A 1OR2A 5L0HA 3SZRA 3NMIA 4DVYP 2P1AA 3POVA 2C04A 3FDQA 2CCYA 2Q3TA 3FMSA 3FHDA 2HFIA 4MVRA 4OD4A 3DXJF 1BR1A 3W2VA 4LDRA 4XTKA 2KW3C 2EPKX 3LS1A 1SZIA 1TWGA 1MNDA 3HNLA 3LUTB 3N0TA 1TFKB 2D5RB 1ZZPA 1Z23A 3HJCA 4CIPA 1U89A 3ZQVA 2V3CC 1FFTC 2LCHA 4BJ5A 2VC9A 1OCCC 2W45A 2WVQA 1JR8A 3GEHA 5BQGA 1C17M 3NYLA 1MNEA 3V5YA 3EZIA 4O79A 2EILC 4J32B 2QE9A 3ECSA 3IEEA 3Q7GA 1WASA 3S29A 3US6A 4E17A 3KYIA 4CIHA 4EBKA 2XLDA 3B0PA 1A7EA 2HZ8A 4U5CE 5GPGB 1ZHYA 3MX3A 4OIPF 3SNHA 1E85A 3DE9A 3UGPA 2QNLA 2GFHA 2YLDA 1TWAA 4IB4A 1M2OA 1ZU5A 3R7CA 4JTCB 3V5XA 4I44A 3ZVRA 4CBEA 1I4YA 2PNOA 3EGDB 4JC7A 4E0IA 5EHHA 3GWNA 3DKAA 1Q0MA 1YVIA 2W4MA 2XL6A 4YT5A 2ZXWC 2CW0F 4MS2A 4FAPB 3GEEA 3KH2A 3SXZA 2J9VA 2XLHA 2WZFA 1MMNA 1RKEB 2OJQA 3ASNC 3N2ZB 2Y3DA 3M1CB 1MMGA 2EIKC 1MQVA 2J9WA 1HW2A 2KSFA 2Q9AA 1W2WA 3NRHA 2YL0A 2VB6A 3GANA 1YDIA 2R03A 3FOOA 4H4KC 3MYIA 3CZ6A 4IARA 3TOMA 4CS9C 2XXAA 4P6IC 2PX3A 4FWVA 1S7ZA 3DI5A 1ZVZA 1FTSA 3VAYA 4GEHA 2J45A 2RD9A 2OKUA 4G7HF 3RQFA 4CS8A 2V26A 2J7PA 1YYXA 2XM4A 3NMJA 4J7YA 3U9MA 3L8JA 1LKXA 1ZHWA 3KPHA 3WAQA 4CS8C 4U5DE 3RW0A 1FFHA 2NG1A 5L0GA 2A6HF 3EZHA 1V54C 1G8XA 1U6HA 1S05A 3B0UX 3Q6MA 2YKZA 5EK0A 3SP1A 4Z9IA 4I1MA 3OA1A 2QTVA 3RQGA 5DLJA 2XLVA 3T4RA 3OWTA 4D4XA 4JKVA 1SR2A 5E2QA 1VLSA 2KJGA 3SXMA 3U5SA 5L0JA 2Y39A 4MVUA 4HFKB 2A0UA 3PMRA 1A0BA 1OR3A 2YZSA 3W2WA 3ZTMA 4CJOA 4GYTA 3DM9B 2AWYA 4XPXA 4MTFA 1TWCA 2IXOA 5KYWA 5D91A 4NCQA 4P9FA 5JP7A 2L81A 3MLGA 3ABMC 3C62A 2J0XA 4IAOA 2R25A 1V55C 5TJ5E 2OG2A 1FNTc 1T6UA 1QQ3A 1RJ9B 4XWJA 1YAUO 1JMWA 4JCHA 3U9JA 4BJ5C 4G0HA 1Z6AA 4IWBA 2Q4FA 1NFOA 1QZXA 1GS9A 3IQ5A 5BQHA 3ABLC 4U9EA 2KNHA 2XL8A 4PFOA 4YT2A 3LJBA 2PP4A 3HNIA 4C3BA 2L6GA 3C8ZA 5F5FA 1UG7A 3QMKA 4N6HA 3DE8A 4KBLA 2CYDA 3G4ZA 4LERA 2AVKA 2A1DD 2XLMA 4MNDA 3RKOF 1M56C 3FXHA 3LEVA 2Q00A 2OJED 3GM1A 3A11A 3NKDA 5DS6A 2IXMA 2NUPA 2XLWA 3PCVA 3KYJA 4LLEA 4N06A 3ZIBA 3EH2A 4PJJA 3ATPA 3SXKA 5K0IA 3NMKA 3UGOA 4MVSA 1HMOA 1Y6DA 2AP3A 3QVZA 3RIPA 3T9OA 2I15A 1TQGA 2ZXPA 1NG1A 3K1HA 3LLIA 1EA8A 5E33A 4YT8A 5L0CA 3UNGC 4MVMA 5EGYA 4PR9A 4NY3A 3SXYA 4C3DA 2R7OA 4CSAA 2OU6A 1ORYA 3AGUA 4AX2A 4B6IA 1JPNA 2ICWG 5D92A 3U8PA 3RYLA 3LESA 2OOCA 2HJMA 1E86A 2LD6A 4EUKB 2H8AA 2YWAA 3H65A 4CS7A 3DJNB 4Q4ZF 5A6JA 3UR3C 1Z3IX 3S9OA 2LP4A 3GM2A 3S28A 3RF3A 4WGYA 2R7WA 1YYJA 2G62A 2OQMA 2O9XA 3H2UA 1WTYA 1I5NA 2GWWA 2XLEA 2W4BA 2Z15A 2I8BA 4PFPA 5B1BC 3VRCA 1AUEA 2EPMX 1CGOA 4BJ6A 4ZLCA 2H7VC 3K1IC 3ABKC 1EKYA 5B3IA 1D0XA 4P9TA 3AGTA 3WG7C 3K7DA 4MVZA 4HE8D 1SYQA 3IQ6A 2G3KA 4FESA 4G7OF 1EQ1A 2ZXRA 1BR4A 2DYSC 2LFFA 3GODA 3K33A 2MWQA 2QUPA 3EGDA 3HTKC 4A2NB 5JRAA 2HV6A 2BL2A 2NSGA 1AVOB 4BEJA 1LI5A 1NU9C 1QLEC 1C03A 4PJLA 3F47A 4EHPA 1YA9A 1DOWA 3M4BA 3VYWA 1Y4CA 1MMAA 5A6BD 3M4CA 3QW1A 3SEOA 1KU2A 2WVNA 1LVKA 1MMDA 1RKEA 3DWWA 5T1DB 3E9VA 2M4EA 1JAFA 3DAFA 4U5FE 4AL0A 1D0YA 5DQZA 1YLMA 1O5HA 4LLCA 4OD5A 2R7RA 2LIGA 1A7VA 2NPUA 3C18A 3Q6NA 4JURI 1QVXA 3C8GA 4UDVA 1NU7D 5AC4A 2XS8A 3FOPA 5CI9A 2NSFA 5L3QA 2ZPAA 5JT4A 3G4XA 3U2LA 4LDQA 2EIMC 1QKRA 3E70C 3T6BA 2W9YA 1Q0FA 1M57C 5L0IA 1YJGA 3T6JA 1YA7O 4ULWA 3O6XA 1EI7A 3ZWIA 4U5HA 2HKVA 1VK5A 3C8GB 2PFDA 1OKKA 1ZHTA 1LPEA 3UMIA 1HE1A 4JTAB 5DS5A 4MTGA 1ZW2A 3JYYA 4YL1A 5L0DA 2FGYA 2HMQA 2PF4E 1T6QA 4PJMA 3PDMP 1NSGB 3B0VC 1K04A 3JRMO 3QW0A 1V4AA 1FMWA 5DQTA 3DD7A 2YQYA 5A69A 5F5HA 3FAJA 3S90A 3RFYA 1DOVA 1OCZC 4NQFA 2DB4A 2WB7A 3JCUQ 2OCCC 3VM6A 2KGOA 1BZ4A 1PV3A 3AJMA 2YL1A 4EKWA 2YLGA 3QZCA 1O87A 4KI2A 2HV7A 1R4TA 2LSEA 4JJFA 4XLPF 4M63A 2J9BA 1OXBA 1Q0DA 2CGEA 1ORSC 2FAPB 2PX0A 3DM5A 4XEVA 3X2QC 2C03A 1YZCA 2HUJA 1XZQA 4DJ9A 2YL7A 1RJ9A 4X0RA 5KYYB 2FFHA 2MYSA 2D4UA 3GWLA 256BA 1H7IA 1D1BA 2AWCA 3H2VA 3I4UA 3C8GD 3MFNA 1OW6A 4IAQA 2R7TA 1OW7A 3ZG1A 5T3TA 2E87A 4WJ0A 4MW3A 4BJ6C 4LDKA 4BEMJ 3JRTA 1H6GA 5KYXB 1A7DA 4XEKA 1PD1A 2YHSA 4HFFB 2KK1A 2YRFA 3GEIA 4WABA 1JOGA 1R5ID 4ER9A 3PHF2 1SMYF 4ZLDA 3EG9B 1HMDA 1OKKD 1GGQA 4JZAA 1TWHA 3TJ5A 2M64A 5E3AA 3EFOA 2NUTA 3EH1A 1L3PA 1M2VB 5COMA 4A4AA 3KL4A 4YL0A 4DRJB 2IXNA 1Q0GA 5KYUB 1G4WR 1G5ZA 1OXKA 2LK4A 3ASOC 2XL4A 1VLTA 2VCCA 3BEHA 3O39A 2Y69C 3RQEA 3HLZA 5E3CA 3LS0A 1T9KA 1YARO 2P7VA 4E0HA 3CSKA 4O6MA 4XLNF 5IY5C 3TQOA 3EFOB 2KQ9A 5A6BA 2NUTB 4Z9JA 3IPMO 3V7OA 4CJGA 1RKCA 1YZAA 4J30B 4DRHB 2JX0A 2Y3BA 1ZHXA 2CDQA 4PACA 1D0ZA 4CDYA 2R02A 2BC5A 3SYNA 4E7SA 2LFDA 1J8MF 1CGNA 2YLIA 1TR2A 1E83A 4IRUA 1ORJA 1WOLA 3RH3A 2G3VA 1OW8A 2R7XA 2DI3A 4YL3A 4CS9A 1KNYA 3K6BA 3JYHA 2R7SA 4PK4A 3C63A 5DVWA 3VF0A 4D4NA 4JCZA 5L0FA 3JSEO 4EIYA 1NZEA 1JRAA 3NYMA 3NG1A 2B0HA 2R7VA 3EJNA 2L6HA 2A0BA 3V5ZA 4O7GA 4PJNA 3HNKA 4CDAA 2J0WA 1ZU4A 1BDJB 2Q9CA 4U5EE 3ZC4A 3BRJA 3IQTA 2YEVA 3JZ0A 4G78A 1HE9A 4U5GA 1ZYRF 4NTFA 4YK5A 5CIVA 1RMVA 4O6YA 4RD9A 4U9DA 4JRZA 1AEPA 1GQAA 5DS4A 1A41A 3QTHA 1K05A 1HW1A 1Z5ZA 2UUHA 2VCBA 1Q0KA 1ZW3A 2EPNA 2XS1A 3M15A 3EPVA 3G50A 1LE2A 2WZGA 3DJUB 3NYJA 5B3SC 4C7OB 2P6VA 5JSLA 2HSQA 1T01A 4ANJA 2P61A 1VTMP 4AE4B 3AG1C 4L6RA 3B9QA 2L6FA 2A6EF 4BJ1A 2CNWA 2GAQA 1V74B 1VYKA 2QY9A 1LS1A 3QVYA 4N4WA 4JW1A 4O6NA 3ZTZA 3AG4C 3TK0A 1H9GA 4G7ZF 1D1AA 1D1CA 4MW8A 5COGA 3AG2C 1ST6A 4NTAA 3WHNA 5BUOA 5HV9A 5JUAA 2B0JA 5HSWA 1C02A 3O55A 4QI0A 3L8IA 3EHMA 3CQZA 4N6CA 4DBRA 4DRIB 3LAYA 2XSEA 3L1MA 5JS5A 3ZSUA 4OINF 1TFOB 2Q7RA 4NC3A 4QDLA 3LNRA 4ULVA 4OIRF 2HMZA 5FZTA 5FCLA 2R7QA 3F46A 4Q7CA 1K40A 1N1CA 2VCAA 2A68F 4YWQA 3U0CA 2VASA 3JT1A 2DYRC 4WGZA 1KTMA 1BR2A 2J46A 3L0IA 4I1OB 3RVZA 4E18A 3TOLA 2R05A 1GM5A 2WL8A 4RBNA 2R7UA 1NFNA 3WODF 2XRHA 3A9CA 4MQ9F 1SF8A 4MVOA 4KNWA 1T6IA 4H54A 1PCXA 2ZXOA 3UMHA 1FR0A 2Q9BA 3LNMB 3ITFA 3MYFA 4MTOA 3IHUA 3TD7A 4K0DA
chains in the Genus database with same CATH topology
1NFOA 1GS9A 3R2PA 1BZ4A 1LE4A 1EA8A 1AEPA 1LS4A 1EQ1A 1B68A 1LE2A 1OR3A 1LPEA 1OR2A 1YA9A 1H7IA 2KC3A 1NFNA 3S84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NFO A;  1GS9 A;  3R2P A;  1BZ4 A;  1LE4 A;  1EA8 A;  1AEP A;  1LS4 A;  1EQ1 A;  1B68 A;  1LE2 A;  1OR3 A;  1LPE A;  1OR2 A;  1YA9 A;  1H7I A;  2KC3 A;  1NFN A;  3S84 A; 
#chains in the Genus database with same CATH topology
 2EIN C;  4YT4 A;  1LI7 A;  3R2P A;  4MVQ A;  2J8W A;  5KYY A;  4XQ1 A;  4CSA C;  2MHR A;  3Q7L A;  1LE4 A;  2Y3G A;  1LS4 A;  1NLX A;  2DGJ A;  4R32 A;  4BJT A;  4XPW A;  1LM3 B;  3AQC A;  3UMK A;  5T3W A;  3EQL F;  3W4Y A;  4HEA J;  2J9U A;  3O10 A;  4BG0 A;  1OCR C;  1NBB A;  3DZA A;  4IGG A;  2CNW D;  1H9T A;  2VH3 A;  2Y3H A;  2R9R B;  5KYX A;  3DAG A;  3RVY A;  3B29 A;  2IBF A;  4AK9 A;  2LQG A;  4EBJ A;  5BQI A;  1VMA A;  2KC3 A;  3EG9 A;  1VYI A;  2H7O A;  1FAP B;  3NKE A;  2H7B A;  2XXA B;  1IW7 F;  4W8P A;  3AQB A;  1U0B B;  4DOZ A;  4JIO A;  5KYN A;  3NDB B;  3I5Q A;  3CAX A;  2A69 F;  3EHN A;  5COF A;  1TKN A;  1M2V A;  4Z9H A;  3LLK A;  3TJ6 A;  4OIO F;  4LAC B;  1LIH A;  3U3F A;  2EPO A;  1IZM A;  5KYU A;  3CEX A;  2JPU A;  1O3U A;  4JTD B;  2IXP A;  1E2X A;  3JSZ A;  3K1I A;  4CDV A;  1APC A;  1T5O A;  1B68 A;  3HNJ A;  3U3B A;  3S0X A;  3S27 A;  1QSP A;  1CPQ A;  4J7T A;  2EPL X;  3KKB A;  4K7B A;  3U2M A;  5L3V A;  4GQH A;  1J8Y F;  2RSE B;  3GM3 A;  2L7A A;  2ZD9 A;  4IJJ A;  4YN0 B;  1VOM A;  3FAP B;  3AOU A;  2HS5 A;  2HSB A;  1OCO C;  1WAT A;  1WGW A;  4F4B A;  3K66 A;  1UFB A;  1E84 A;  3M79 A;  4JJG A;  2ETS A;  4KNV A;  2X0C A;  2WVO A;  3HKK A;  4JE9 A;  2GDC A;  3C7J A;  4C3E A;  1CGM E;  1G4U S;  1Z63 A;  3S84 A;  3JTL O;  1BBH A;  2AU5 A;  5A6K A;  2X51 A;  1Z7Q c;  5KYW B;  1XZP A;  4JEA A;  4Q5S F;  2QLA A;  2XLO A;  4KC9 A;  1VB5 A;  2KYH A;  2EIJ C;  4I3M A;  4YJW A;  2OEX A;  4OIQ F;  4K1O A;  2YVK A;  4RDA A;  1PD0 A;  4JEB A;  2OEV A;  4XEF A;  5JVE A;  5A6A A;  5AGF A;  1ZHZ A;  2IM8 A;  3I5P A;  3ZDL A;  3DMD A;  3FVY A;  3IQC A;  1RCP A;  3OEO A;  5JLI A;  1CPR A;  2BE5 F;  3N24 A;  2J7P D;  3LEO A;  3W8H A;  4EWC A;  2PBE A;  4EBB A;  2JD3 A;  2F22 A;  2IYL D;  2L9J A;  3T6G B;  4NTB A;  3GOR A;  1OQC A;  1I4Z A;  4DBQ A;  2GA0 A;  5AC5 A;  5B1A C;  2YL3 A;  4U5B E;  1XWJ A;  4DVZ A;  4C7O A;  2P0N A;  4W8K A;  3EGX A;  1RXQ A;  4CX9 A;  3TUL A;  1WWP A;  4XPY A;  3ZQY A;  3U8V A;  4AE4 A;  2TMV P;  2NUP B;  2HJ3 A;  1L7C A;  2UUI A;  1M6T A;  2WZL A;  3MBG A;  1FMV A;  1WN0 A;  4JVS A;  2IOQ A;  4ONS A;  3X1O A;  4E7Z A;  3B71 A;  1JPJ A;  3L34 A;  3J06 A;  2ASR A;  1HY5 A;  3AG3 C;  5CI8 A;  4AL1 A;  1QPU A;  4BPM A;  5F28 E;  4DXW A;  4QI2 A;  2XM0 A;  3EGX B;  3KMI A;  3W8I A;  1F1M A;  4FX5 A;  1OR2 A;  5L0H A;  3SZR A;  3NMI A;  4DVY P;  2P1A A;  3POV A;  2C04 A;  3FDQ A;  2CCY A;  2Q3T A;  3FMS A;  3FHD A;  2HFI A;  4MVR A;  4OD4 A;  3DXJ F;  1BR1 A;  3W2V A;  4LDR A;  4XTK A;  2KW3 C;  2EPK X;  3LS1 A;  1SZI A;  1TWG A;  1MND A;  3HNL A;  3LUT B;  3N0T A;  1TFK B;  2D5R B;  1ZZP A;  1Z23 A;  3HJC A;  4CIP A;  1U89 A;  3ZQV A;  2V3C C;  1FFT C;  2LCH A;  4BJ5 A;  2VC9 A;  1OCC C;  2W45 A;  2WVQ A;  1JR8 A;  3GEH A;  5BQG A;  1C17 M;  3NYL A;  1MNE A;  3V5Y A;  3EZI A;  4O79 A;  2EIL C;  4J32 B;  2QE9 A;  3ECS A;  3IEE A;  3Q7G A;  1WAS A;  3S29 A;  3US6 A;  4E17 A;  3KYI A;  4CIH A;  4EBK A;  2XLD A;  3B0P A;  1A7E A;  2HZ8 A;  4U5C E;  5GPG B;  1ZHY A;  3MX3 A;  4OIP F;  3SNH A;  1E85 A;  3DE9 A;  3UGP A;  2QNL A;  2GFH A;  2YLD A;  1TWA A;  4IB4 A;  1M2O A;  1ZU5 A;  3R7C A;  4JTC B;  3V5X A;  4I44 A;  3ZVR A;  4CBE A;  1I4Y A;  2PNO A;  3EGD B;  4JC7 A;  4E0I A;  5EHH A;  3GWN A;  3DKA A;  1Q0M A;  1YVI A;  2W4M A;  2XL6 A;  4YT5 A;  2ZXW C;  2CW0 F;  4MS2 A;  4FAP B;  3GEE A;  3KH2 A;  3SXZ A;  2J9V A;  2XLH A;  2WZF A;  1MMN A;  1RKE B;  2OJQ A;  3ASN C;  3N2Z B;  2Y3D A;  3M1C B;  1MMG A;  2EIK C;  1MQV A;  2J9W A;  1HW2 A;  2KSF A;  2Q9A A;  1W2W A;  3NRH A;  2YL0 A;  2VB6 A;  3GAN A;  1YDI A;  2R03 A;  3FOO A;  4H4K C;  3MYI A;  3CZ6 A;  4IAR A;  3TOM A;  4CS9 C;  2XXA A;  4P6I C;  2PX3 A;  4FWV A;  1S7Z A;  3DI5 A;  1ZVZ A;  1FTS A;  3VAY A;  4GEH A;  2J45 A;  2RD9 A;  2OKU A;  4G7H F;  3RQF A;  4CS8 A;  2V26 A;  2J7P A;  1YYX A;  2XM4 A;  3NMJ A;  4J7Y A;  3U9M A;  3L8J A;  1LKX A;  1ZHW A;  3KPH A;  3WAQ A;  4CS8 C;  4U5D E;  3RW0 A;  1FFH A;  2NG1 A;  5L0G A;  2A6H F;  3EZH A;  1V54 C;  1G8X A;  1U6H A;  1S05 A;  3B0U X;  3Q6M A;  2YKZ A;  5EK0 A;  3SP1 A;  4Z9I A;  4I1M A;  3OA1 A;  2QTV A;  3RQG A;  5DLJ A;  2XLV A;  3T4R A;  3OWT A;  4D4X A;  4JKV A;  1SR2 A;  5E2Q A;  1VLS A;  2KJG A;  3SXM A;  3U5S A;  5L0J A;  2Y39 A;  4MVU A;  4HFK B;  2A0U A;  3PMR A;  1A0B A;  1OR3 A;  2YZS A;  3W2W A;  3ZTM A;  4CJO A;  4GYT A;  3DM9 B;  2AWY A;  4XPX A;  4MTF A;  1TWC A;  2IXO A;  5KYW A;  5D91 A;  4NCQ A;  4P9F A;  5JP7 A;  2L81 A;  3MLG A;  3ABM C;  3C62 A;  2J0X A;  4IAO A;  2R25 A;  1V55 C;  5TJ5 E;  2OG2 A;  1FNT c;  1T6U A;  1QQ3 A;  1RJ9 B;  4XWJ A;  1YAU O;  1JMW A;  4JCH A;  3U9J A;  4BJ5 C;  4G0H A;  1Z6A A;  4IWB A;  2Q4F A;  1NFO A;  1QZX A;  1GS9 A;  3IQ5 A;  5BQH A;  3ABL C;  4U9E A;  2KNH A;  2XL8 A;  4PFO A;  4YT2 A;  3LJB A;  2PP4 A;  3HNI A;  4C3B A;  2L6G A;  3C8Z A;  5F5F A;  1UG7 A;  3QMK A;  4N6H A;  3DE8 A;  4KBL A;  2CYD A;  3G4Z A;  4LER A;  2AVK A;  2A1D D;  2XLM A;  4MND A;  3RKO F;  1M56 C;  3FXH A;  3LEV A;  2Q00 A;  2OJE D;  3GM1 A;  3A11 A;  3NKD A;  5DS6 A;  2IXM A;  2NUP A;  2XLW A;  3PCV A;  3KYJ A;  4LLE A;  4N06 A;  3ZIB A;  3EH2 A;  4PJJ A;  3ATP A;  3SXK A;  5K0I A;  3NMK A;  3UGO A;  4MVS A;  1HMO A;  1Y6D A;  2AP3 A;  3QVZ A;  3RIP A;  3T9O A;  2I15 A;  1TQG A;  2ZXP A;  1NG1 A;  3K1H A;  3LLI A;  1EA8 A;  5E33 A;  4YT8 A;  5L0C A;  3UNG C;  4MVM A;  5EGY A;  4PR9 A;  4NY3 A;  3SXY A;  4C3D A;  2R7O A;  4CSA A;  2OU6 A;  1ORY A;  3AGU A;  4AX2 A;  4B6I A;  1JPN A;  2ICW G;  5D92 A;  3U8P A;  3RYL A;  3LES A;  2OOC A;  2HJM A;  1E86 A;  2LD6 A;  4EUK B;  2H8A A;  2YWA A;  3H65 A;  4CS7 A;  3DJN B;  4Q4Z F;  5A6J A;  3UR3 C;  1Z3I X;  3S9O A;  2LP4 A;  3GM2 A;  3S28 A;  3RF3 A;  4WGY A;  2R7W A;  1YYJ A;  2G62 A;  2OQM A;  2O9X A;  3H2U A;  1WTY A;  1I5N A;  2GWW A;  2XLE A;  2W4B A;  2Z15 A;  2I8B A;  4PFP A;  5B1B C;  3VRC A;  1AUE A;  2EPM X;  1CGO A;  4BJ6 A;  4ZLC A;  2H7V C;  3K1I C;  3ABK C;  1EKY A;  5B3I A;  1D0X A;  4P9T A;  3AGT A;  3WG7 C;  3K7D A;  4MVZ A;  4HE8 D;  1SYQ A;  3IQ6 A;  2G3K A;  4FES A;  4G7O F;  1EQ1 A;  2ZXR A;  1BR4 A;  2DYS C;  2LFF A;  3GOD A;  3K33 A;  2MWQ A;  2QUP A;  3EGD A;  3HTK C;  4A2N B;  5JRA A;  2HV6 A;  2BL2 A;  2NSG A;  1AVO B;  4BEJ A;  1LI5 A;  1NU9 C;  1QLE C;  1C03 A;  4PJL A;  3F47 A;  4EHP A;  1YA9 A;  1DOW A;  3M4B A;  3VYW A;  1Y4C A;  1MMA A;  5A6B D;  3M4C A;  3QW1 A;  3SEO A;  1KU2 A;  2WVN A;  1LVK A;  1MMD A;  1RKE A;  3DWW A;  5T1D B;  3E9V A;  2M4E A;  1JAF A;  3DAF A;  4U5F E;  4AL0 A;  1D0Y A;  5DQZ A;  1YLM A;  1O5H A;  4LLC A;  4OD5 A;  2R7R A;  2LIG A;  1A7V A;  2NPU A;  3C18 A;  3Q6N A;  4JUR I;  1QVX A;  3C8G A;  4UDV A;  1NU7 D;  5AC4 A;  2XS8 A;  3FOP A;  5CI9 A;  2NSF A;  5L3Q A;  2ZPA A;  5JT4 A;  3G4X A;  3U2L A;  4LDQ A;  2EIM C;  1QKR A;  3E70 C;  3T6B A;  2W9Y A;  1Q0F A;  1M57 C;  5L0I A;  1YJG A;  3T6J A;  1YA7 O;  4ULW A;  3O6X A;  1EI7 A;  3ZWI A;  4U5H A;  2HKV A;  1VK5 A;  3C8G B;  2PFD A;  1OKK A;  1ZHT A;  1LPE A;  3UMI A;  1HE1 A;  4JTA B;  5DS5 A;  4MTG A;  1ZW2 A;  3JYY A;  4YL1 A;  5L0D A;  2FGY A;  2HMQ A;  2PF4 E;  1T6Q A;  4PJM A;  3PDM P;  1NSG B;  3B0V C;  1K04 A;  3JRM O;  3QW0 A;  1V4A A;  1FMW A;  5DQT A;  3DD7 A;  2YQY A;  5A69 A;  5F5H A;  3FAJ A;  3S90 A;  3RFY A;  1DOV A;  1OCZ C;  4NQF A;  2DB4 A;  2WB7 A;  3JCU Q;  2OCC C;  3VM6 A;  2KGO A;  1BZ4 A;  1PV3 A;  3AJM A;  2YL1 A;  4EKW A;  2YLG A;  3QZC A;  1O87 A;  4KI2 A;  2HV7 A;  1R4T A;  2LSE A;  4JJF A;  4XLP F;  4M63 A;  2J9B A;  1OXB A;  1Q0D A;  2CGE A;  1ORS C;  2FAP B;  2PX0 A;  3DM5 A;  4XEV A;  3X2Q C;  2C03 A;  1YZC A;  2HUJ A;  1XZQ A;  4DJ9 A;  2YL7 A;  1RJ9 A;  4X0R A;  5KYY B;  2FFH A;  2MYS A;  2D4U A;  3GWL A;  256B A;  1H7I A;  1D1B A;  2AWC A;  3H2V A;  3I4U A;  3C8G D;  3MFN A;  1OW6 A;  4IAQ A;  2R7T A;  1OW7 A;  3ZG1 A;  5T3T A;  2E87 A;  4WJ0 A;  4MW3 A;  4BJ6 C;  4LDK A;  4BEM J;  3JRT A;  1H6G A;  5KYX B;  1A7D A;  4XEK A;  1PD1 A;  2YHS A;  4HFF B;  2KK1 A;  2YRF A;  3GEI A;  4WAB A;  1JOG A;  1R5I D;  4ER9 A;  3PHF 2;  1SMY F;  4ZLD A;  3EG9 B;  1HMD A;  1OKK D;  1GGQ A;  4JZA A;  1TWH A;  3TJ5 A;  2M64 A;  5E3A A;  3EFO A;  2NUT A;  3EH1 A;  1L3P A;  1M2V B;  5COM A;  4A4A A;  3KL4 A;  4YL0 A;  4DRJ B;  2IXN A;  1Q0G A;  5KYU B;  1G4W R;  1G5Z A;  1OXK A;  2LK4 A;  3ASO C;  2XL4 A;  1VLT A;  2VCC A;  3BEH A;  3O39 A;  2Y69 C;  3RQE A;  3HLZ A;  5E3C A;  3LS0 A;  1T9K A;  1YAR O;  2P7V A;  4E0H A;  3CSK A;  4O6M A;  4XLN F;  5IY5 C;  3TQO A;  3EFO B;  2KQ9 A;  5A6B A;  2NUT B;  4Z9J A;  3IPM O;  3V7O A;  4CJG A;  1RKC A;  1YZA A;  4J30 B;  4DRH B;  2JX0 A;  2Y3B A;  1ZHX A;  2CDQ A;  4PAC A;  1D0Z A;  4CDY A;  2R02 A;  2BC5 A;  3SYN A;  4E7S A;  2LFD A;  1J8M F;  1CGN A;  2YLI A;  1TR2 A;  1E83 A;  4IRU A;  1ORJ A;  1WOL A;  3RH3 A;  2G3V A;  1OW8 A;  2R7X A;  2DI3 A;  4YL3 A;  4CS9 A;  1KNY A;  3K6B A;  3JYH A;  2R7S A;  4PK4 A;  3C63 A;  5DVW A;  3VF0 A;  4D4N A;  4JCZ A;  5L0F A;  3JSE O;  4EIY A;  1NZE A;  1JRA A;  3NYM A;  3NG1 A;  2B0H A;  2R7V A;  3EJN A;  2L6H A;  2A0B A;  3V5Z A;  4O7G A;  4PJN A;  3HNK A;  4CDA A;  2J0W A;  1ZU4 A;  1BDJ B;  2Q9C A;  4U5E E;  3ZC4 A;  3BRJ A;  3IQT A;  2YEV A;  3JZ0 A;  4G78 A;  1HE9 A;  4U5G A;  1ZYR F;  4NTF A;  4YK5 A;  5CIV A;  1RMV A;  4O6Y A;  4RD9 A;  4U9D A;  4JRZ A;  1AEP A;  1GQA A;  5DS4 A;  1A41 A;  3QTH A;  1K05 A;  1HW1 A;  1Z5Z A;  2UUH A;  2VCB A;  1Q0K A;  1ZW3 A;  2EPN A;  2XS1 A;  3M15 A;  3EPV A;  3G50 A;  1LE2 A;  2WZG A;  3DJU B;  3NYJ A;  5B3S C;  4C7O B;  2P6V A;  5JSL A;  2HSQ A;  1T01 A;  4ANJ A;  2P61 A;  1VTM P;  4AE4 B;  3AG1 C;  4L6R A;  3B9Q A;  2L6F A;  2A6E F;  4BJ1 A;  2CNW A;  2GAQ A;  1V74 B;  1VYK A;  2QY9 A;  1LS1 A;  3QVY A;  4N4W A;  4JW1 A;  4O6N A;  3ZTZ A;  3AG4 C;  3TK0 A;  1H9G A;  4G7Z F;  1D1A A;  1D1C A;  4MW8 A;  5COG A;  3AG2 C;  1ST6 A;  4NTA A;  3WHN A;  5BUO A;  5HV9 A;  5JUA A;  2B0J A;  5HSW A;  1C02 A;  3O55 A;  4QI0 A;  3L8I A;  3EHM A;  3CQZ A;  4N6C A;  4DBR A;  4DRI B;  3LAY A;  2XSE A;  3L1M A;  5JS5 A;  3ZSU A;  4OIN F;  1TFO B;  2Q7R A;  4NC3 A;  4QDL A;  3LNR A;  4ULV A;  4OIR F;  2HMZ A;  5FZT A;  5FCL A;  2R7Q A;  3F46 A;  4Q7C A;  1K40 A;  1N1C A;  2VCA A;  2A68 F;  4YWQ A;  3U0C A;  2VAS A;  3JT1 A;  2DYR C;  4WGZ A;  1KTM A;  1BR2 A;  2J46 A;  3L0I A;  4I1O B;  3RVZ A;  4E18 A;  3TOL A;  2R05 A;  1GM5 A;  2WL8 A;  4RBN A;  2R7U A;  1NFN A;  3WOD F;  2XRH A;  3A9C A;  4MQ9 F;  1SF8 A;  4MVO A;  4KNW A;  1T6I A;  4H54 A;  1PCX A;  2ZXO A;  3UMH A;  1FR0 A;  2Q9B A;  3LNM B;  3ITF A;  3MYF A;  4MTO A;  3IHU A;  3TD7 A;  4K0D A; 
#chains in the Genus database with same CATH homology
 1NFO A;  1GS9 A;  3R2P A;  1BZ4 A;  1LE4 A;  1EA8 A;  1AEP A;  1LS4 A;  1EQ1 A;  1B68 A;  1LE2 A;  1OR3 A;  1LPE A;  1OR2 A;  1YA9 A;  1H7I A;  2KC3 A;  1NFN A;  3S84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...