1B68A

Apolipoprotein e4 (apoe4), 22k fragment
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
140
structure length
138
Chain Sequence
b'GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of the N-terminal domain of apolipoprotein E4 with heparin.
pubmed doi rcsb
molecule keywords APOLIPOPROTEIN E
source organism Homo sapiens
molecule tags Lipid transport
total genus 66
structure length 138
sequence length 140
ec nomenclature
pdb deposition date 1999-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1b68A00
3S84A 1GS9A 1LS4A 1NFNA 1EQ1A 1AEPA 1YA9A 1NFOA 1LE2A 1LPEA 3R2PA 1EA8A 1BZ4A 1H7IA 1OR3A 1B68A 1LE4A 1OR2A 2KC3A
chains in the Genus database with same CATH superfamily
1Z63A 4XEFA 5E33A 3EG9B 3DZAA 2R25A 3HKKA 1VYIA 2J7PA 3O10A 3RIPA 4BG0A 1QZXA 3EZIA 5CI8A 3WAQA 3FHDA 4EWCA 1FMVA 1V4AA 2CYDA 1OKKD 2J9VA 3W8HA 5HSWA 5EHHA 3KH2A 3WG7C 4QI2A 1BDJB 4AE4B 4C3DA 2HJ3A 1CPRA 1TQGA 4CBEA 4E7SA 2LP4A 1U89A 4G7OF 2OJED 2EILC 5TJ5E 1YYXA 1I5NA 3TQOA 1RKEB 3AG1C 3KL4A 4MTOA 3E70C 1S7ZA 5L0DA 1YZCA 2CW0F 2RD9A 3JRMO 1A0BA 4G78A 3DKAA 4D4NA 3PDMP 2HV7A 4U5FE 4YL3A 1WWPA 2XLEA 4IGGA 2CNWD 3NYMA 2XL8A 3KMIA 3UGOA 2WZFA 2ZPAA 4PK4A 2MYSA 2Q9CA 5L0GA 1GM5A 5L0CA 1QVXA 2Q3TA 2YLGA 2L6FA 1ZHTA 2UUIA 2GAQA 4CS7A 1G4US 2DB4A 2XLVA 3QW0A 4XPWA 2VCBA 4YN0B 4J7YA 4BPMA 3O55A 3DJNB 4G0HA 3TD7A 3ZWIA 4EBKA 3CQZA 1CGNA 5KYYB 3NYLA 4DRIB 4U5DE 1SZIA 4CDAA 1BZ4A 3S27A 3LNMB 1ZW3A 2IXNA 2IXPA 2OQMA 4IWBA 5A6KA 4OIPF 4N6CA 4U9DA 2P7VA 4EHPA 1ST6A 4JTDB 1NSGB 1RKCA 1HW2A 3BRJA 3B71A 1NU9C 1MQVA 3QTHA 4MS2A 3U3BA 3DMDA 4FESA 3VRCA 4XEKA 1OCRC 2Q9AA 2HFIA 3FDQA 4OIOF 3O39A 1N1CA 2P6VA 3FMSA 1Z5ZA 3MFNA 2A1DD 1D1AA 4UDVA 2EIMC 5BQIA 2WL8A 2B0HA 3AGTA 3U2MA 4X0RA 3VF0A 5E3CA 2Y3HA 1T6QA 3B0VC 2IYLD 1H9GA 3NYJA 4DBRA 3JZ0A 1ZHWA 3LEOA 3UMIA 3EFOB 3U8VA 4FWVA 4LACB 4CS8C 3EZHA 4OIQF 4M63A 3C18A 2V3CC 3EHNA 2D5RB 3QVYA 3SEOA 2YKZA 3W4YA 1MNEA 1LI7A 4YT5A 5A6BD 3H65A 3IEEA 1M56C 2R7VA 2R05A 2XM4A 2YZSA 3C63A 2A0BA 1G4WR 3AG4C 4EKWA 2VB6A 2H7VC 2NSGA 2OOCA 3CSKA 3QVZA 4ZLCA 5HV9A 5EK0A 1ZU5A 4JW1A 4LDQA 4EUKB 1VYKA 3N2ZB 4XLNF 3MYFA 1MMAA 1PD1A 2A0UA 3V7OA 5AC4A 1UFBA 1ORSC 4YK5A 3ATPA 1T5OA 4NTFA 2PFDA 3UMKA 4CDVA 4O79A 3MLGA 5COMA 3AQBA 1LE2A 2LCHA 3HNIA 1EKYA 2EPOA 1OKKA 3F46A 2R03A 2R7SA 1YAUO 5A6AA 4IB4A 2P0NA 1QPUA 4MVUA 4NY3A 2OG2A 3NMJA 1OQCA 1E2XA 3F47A 1GS9A 2HKVA 4CIHA 1W2WA 2KSFA 5L0IA 1A7VA 4MVSA 5F5HA 3U9JA 2MHRA 2BL2A 3B0PA 2FAPB 1NG1A 2ZXOA 3NDBB 3T4RA 3B9QA 3JT1A 3JTLO 2EPKX 3QMKA 3U5SA 3VM6A 2YL3A 1T01A 4K7BA 4BJ6C 3LS0A 1S05A 3S0XA 2EIJC 3NRHA 5BUOA 1Q0MA 2A6HF 3RW0A 2Z15A 2XLWA 2R7OA 4J7TA 5KYWB 3PCVA 1HMOA 3ZTZA 2R7XA 2AU5A 4JC7A 2LIGA 4Z9HA 3EGDB 1EA8A 1M2VB 3U3FA 1A7EA 3EJNA 2I15A 1Y6DA 2L9JA 3I5PA 4C7OB 1YA7O 4BJ6A 4BEMJ 2QTVA 4L6RA 3K6BA 1LE4A 3DM5A 3NMKA 1ZW2A 2OEXA 3ABKC 4XWJA 5B3IA 1OCCC 4E0IA 3ZSUA 1Q0DA 2ASRA 1NFNA 1RMVA 3QW1A 3SXMA 3DD7A 4N4WA 1TKNA 3C8GD 3DI5A 4NTAA 2W4MA 4JIOA 5COGA 3Q6NA 1I4YA 3U9MA 1NU7D 3RH3A 4AX2A 4E7ZA 3EH1A 4YT2A 3C62A 5AC5A 4CX9A 3DAGA 1ZVZA 2ZXWC 3V5YA 4G7ZF 1OXKA 1TR2A 2J9BA 1HY5A 2YL0A 2WB7A 1Z7Qc 1Q0GA 3EG9A 2ETSA 4XPXA 4HE8D 5JUAA 1CPQA 4P9TA 1WN0A 1D0XA 2JD3A 4Q7CA 2V26A 2I8BA 2J45A 2X0CA 2J46A 1OR3A 1B68A 2ZXPA 4I44A 1OR2A 1Q0KA 3L0IA 1RCPA 4AE4A 3ZQVA 3UGPA 3JSEO 3B29A 4ONSA 3G4ZA 5FZTA 3W2WA 4CIPA 2QLAA 2C03A 2XSEA 1ZHYA 4YL1A 3RVYA 2KNHA 4K1OA 3SZRA 4C3BA 2ZXRA 1T6IA 1JAFA 1RKEA 2VH3A 4IAOA 3T6JA 5A6BA 4LDRA 2AVKA 2Y3GA 5JS5A 3RF3A 3C8ZA 1VB5A 2R7QA 1L3PA 4JTAB 4IRUA 3UR3C 5F5FA 2H7OA 2ICWG 2R02A 3MX3A 2HZ8A 1LIHA 1G5ZA 2C04A 2WZGA 3OWTA 2YEVA 2QY9A 5L0JA 2G3VA 1QQ3A 1C17M 1MNDA 2GWWA 4P9FA 2LFDA 3SNHA 3CAXA 5DLJA 1E83A 2DI3A 4D4XA 4LLEA 3NMIA 3T9OA 4OD4A 2Q00A 2W9YA 4P6IC 4Z9IA 1MMGA 2IXOA 4R32A 1YARO 2WVNA 3TULA 3DWWA 4XLPF 1T9KA 5KYYA 3ZTMA 1AEPA 2KK1A 3VAYA 1APCA 3IQCA 4ULVA 4JCHA 2A68F 2PF4E 1Z23A 5D91A 1HMDA 2XXAB 3HNJA 3GODA 2W4BA 1NZEA 4XTKA 3V5XA 3NG1A 4JEAA 1CGOA 2QE9A 4J30B 4LDKA 1E86A 2J7PD 2VCAA 4MTGA 1FFHA 4IARA 4CSAC 1TWHA 2KYHA 2ZD9A 4NCQA 4XQ1A 3TJ5A 3UMHA 2LSEA 2H8AA 5COFA 3JSZA 3ZQYA 1V55C 1VK5A 2L6GA 3HNKA 2Q7RA 1YYJA 1IW7F 3I4UA 3SYNA 4GQHA 1GGQA 3ZC4A 4CJGA 4YT8A 2YRFA 4HFFB 4NTBA 4O6MA 1LS4A 4DOZA 2XL6A 3C8GB 3AJMA 3EFOA 3EHMA 4RD9A 2HJMA 2LFFA 3PMRA 4CSAA 4F4BA 1RJ9B 5GPGB 3CZ6A 4CS8A 5B1AC 3W2VA 4U5BE 2YQYA 1KNYA 1A41A 1GQAA 5K0IA 3LLKA 2HSBA 2KQ9A 1R5ID 1YA9A 3T6GB 1NFOA 2HMQA 5DQTA 1OXBA 4A4AA 4HFKB 4KNWA 1BBHA 1LS1A 3L8JA 3Q7GA 3DM9B 1AVOB 5JRAA 4JRZA 2TMVP 4CJOA 2LQGA 2Y39A 2XS8A 2XLDA 3Q6MA 1ZHXA 2MWQA 4JE9A 2R7WA 1BR4A 3L8IA 4J32B 4N06A 5BQGA 1D0ZA 1PD0A 4I3MA 1VTMP 1FMWA 2KGOA 5T1DB 4MW3A 3HTKC 4JKVA 3L1MA 2HUJA 4WGYA 3X2QC 1Z6AA 2P1AA 3I5QA 4OINF 2XS1A 1SF8A 2AWYA 1HE9A 3K1HA 2NUPB 3LUTB 2IM8A 4W8KA 5BQHA 5KYUB 4JJFA 4YJWA 1FFTC 1YDIA 1JPJA 4O6YA 3RVZA 1VOMA 1ORYA 1WASA 2OJQA 1HW1A 1QKRA 1U6HA 2CNWA 3EGXB 3FAPB 2YL7A 3HLZA 4YL0A 3C7JA 3DE8A 1HE1A 3UNGC 1WATA 3AG2C 3NKEA 4MTFA 3OA1A 1JMWA 5E2QA 2WZLA 5JVEA 4MVRA 3ITFA 3AG3C 4Q5SF 2IXMA 3BEHA 2J8WA 4EBBA 1MMNA 2CGEA 2WVOA 3TOLA 4GEHA 1WOLA 5KYXB 2R9RB 3KYIA 5A69A 1V54C 2IOQA 3S84A 1UG7A 1EI7A 5DS5A 2NUTB 5KYNA 3PHF2 2G3KA 3JYHA 1JR8A 2XLMA 2E87A 2PP4A 4JCZA 5KYWA 1QLEC 1R4TA 3IPMO 3WODF 1V74B 3WHNA 3EGDA 1XZQA 3GEEA 1M2VA 2LK4A 2UUHA 2XLHA 1TWAA 2Y69C 1WGWA 2L81A 2L6HA 1JOGA 4QI0A 4WABA 1OW8A 4JURI 3ZG1A 1Y4CA 4EBJA 5A6JA 2GFHA 2GA0A 1M6TA 3JRTA 2PX3A 2EPLX 4ZLDA 2DYRC 2VASA 3N0TA 3K33A 4CS9C 3RQFA 2IBFA 3EH2A 4PJLA 2H7BA 3GORA 2R7RA 4GYTA 1TFOB 2VCCA 1J8MF 3FOOA 4KNVA 4IAQA 5DVWA 1CGME 2D4UA 5E3AA 3S9OA 1XZPA 2XM0A 2BE5F 3RKOF 1LVKA 3M4BA 4MVQA 3SXKA 4DBQA 3GWLA 2HMZA 1NLXA 4WGZA 3RQGA 3KPHA 1K04A 2Y3DA 1L7CA 1PCXA 2YLDA 2PNOA 3ZDLA 4BJ1A 4H4KC 4CS9A 3LJBA 1D1CA 5D92A 3FXHA 3LLIA 3S90A 1O5HA 1O87A 3DJUB 2YHSA 4LERA 5JP7A 3RYLA 3SXZA 2KW3C 2L7AA 1NBBA 2OEVA 4I1OB 3SP1A 5JSLA 3IQ5A 3US6A 3MBGA 4B6IA 2YWAA 1H9TA 2F22A 3NKDA 1YZAA 2DGJA 4E18A 4G7HF 1M2OA 1YJGA 4PR9A 3R7CA 4XPYA 3FAJA 5L0HA 3IQ6A 1KU2A 1TFKB 1FTSA 2EPMX 3HJCA 2LD6A 3RFYA 1YVIA 3U8PA 3MYIA 4C3EA 1WTYA 3ECSA 4JVSA 4AL0A 4C7OA 4A2NB 1I4ZA 3RQEA 2M64A 3B0UX 2KJGA 3KKBA 1AUEA 2BC5A 3LESA 3TOMA 3DAFA 4MW8A 4BJ5C 1YLMA 2NG1A 2JX0A 1ZHZA 256BA 3L34A 4H54A 4BJTA 2PBEA 1FR0A 1EQ1A 2J9UA 3S29A 5DS4A 1VLSA 1VMAA 2QUPA 3HNLA 1ZZPA 3IQTA 3X1OA 2G62A 3KYJA 1D0YA 4I1MA 4O6NA 4DJ9A 3G4XA 1SYQA 3H2UA 3GM1A 3K66A 1ZU4A 3GM3A 3GWNA 3ZVRA 4BJ5A 2DYSC 4YT4A 2OKUA 4MNDA 2OCCC 3EQLF 5T3TA 5JT4A 1C03A 3H2VA 2W45A 4ER9A 1FNTc 1SR2A 3N24A 3K1IC 3Q7LA 3FOPA 1TWCA 4DRJB 3LNRA 4BEJA 2QNLA 2P61A 3ABMC 4FX5A 4DRHB 2XXAA 2AWCA 3CEXA 1OW6A 2OU6A 4U5GA 1U0BB 3IHUA 2PX0A 2FGYA 3LS1A 1J8YF 2GDCA 1LKXA 2NPUA 3E9VA 4JJGA 4Z9JA 5IY5C 2CDQA 1SMYF 4KBLA 4Q4ZF 3J06A 2Y3BA 3AOUA 3K1IA 4PJNA 4JEBA 3K7DA 1DOWA 3JCUQ 4ANJA 1MMDA 1QSPA 2HSQA 3FVYA 1LPEA 1OW7A 3R2PA 2JPUA 3A9CA 5AGFA 3C8GA 1IZMA 1K05A 1JRAA 1OCZC 2HV6A 2Q4FA 5CIVA 4XEVA 4KI2A 2CCYA 1D1BA 1G8XA 2VC9A 1RJ9A 1ZYRF 4K0DA 2J0XA 1OCOC 1H7IA 4W8PA 2YLIA 4KC9A 3T6BA 4N6HA 2EIKC 2KC3A 3V5ZA 3QZCA 2R7UA 1TWGA 4YWQA 3SXYA 4PFPA 4JTCB 4PJMA 4AL1A 3AGUA 5FCLA 3G50A 2WVQA 4E0HA 2XRHA 4MQ9F 3GEIA 3LEVA 4HEAJ 2AP3A 2X51A 4PFOA 2J0WA 3TJ6A 2EINC 2FFHA 5F28E 5CI9A 1C02A 1BR2A 1Z3IX 1VLTA 2NSFA 2Q9BA 4MVZA 4U5CE 2O9XA 4U9EA 4OIRF 3W8IA 3ZIBA 2EPNA 2HS5A 4DVYP 2J9WA 4OD5A 3GEHA 2A6EF 3M15A 4AK9A 3M79A 4E17A 1KTMA 3O6XA 3A11A 4O7GA 5B1BC 5KYUA 2NUPA 3GM2A 1PV3A 4PJJA 1E85A 3LAYA 1RXQA 2R7TA 2XL4A 4U5HA 2RSEB 3EGXA 3GANA 4FAPB 2M4EA 3DE9A 4MVOA 4LLCA 3OEOA 4ULWA 1T6UA 2B0JA 3U2LA 3U0CA 3POVA 1M57C 3EPVA 1F1MA 1E84A 1JPNA 3M4CA 3ABLC 5T3WA 5KYXA 4PACA 4RDAA 5L0FA 4NQFA 4JZAA 4DXWA 2YL1A 1O3UA 4NC3A 4CDYA 2NUTA 1LI5A 1ORJA 3TK0A 4WJ0A 5B3SC 3JYYA 1XWJA 1BR1A 2YVKA 4RBNA 5DQZA 4EIYA 5EGYA 5L3VA 3ASNC 4IJJA 4MVMA 4DVZA 1H6GA 5L3QA 1FAPB 1DOVA 3ASOC 4QDLA 3S28A 1K40A 3AQCA 3M1CB 1Q0FA 1LM3B 4U5EE 3VYWA 2XLOA 5JLIA 5DS6A 3DXJF 1A7DA 2A69F
chains in the Genus database with same CATH topology
3S84A 1GS9A 1LS4A 1NFNA 1EQ1A 1AEPA 1YA9A 1NFOA 1LE2A 1LPEA 3R2PA 1EA8A 1BZ4A 1H7IA 1OR3A 1B68A 1LE4A 1OR2A 2KC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S84 A;  1GS9 A;  1LS4 A;  1NFN A;  1EQ1 A;  1AEP A;  1YA9 A;  1NFO A;  1LE2 A;  1LPE A;  3R2P A;  1EA8 A;  1BZ4 A;  1H7I A;  1OR3 A;  1B68 A;  1LE4 A;  1OR2 A;  2KC3 A; 
#chains in the Genus database with same CATH topology
 1Z63 A;  4XEF A;  5E33 A;  3EG9 B;  3DZA A;  2R25 A;  3HKK A;  1VYI A;  2J7P A;  3O10 A;  3RIP A;  4BG0 A;  1QZX A;  3EZI A;  5CI8 A;  3WAQ A;  3FHD A;  4EWC A;  1FMV A;  1V4A A;  2CYD A;  1OKK D;  2J9V A;  3W8H A;  5HSW A;  5EHH A;  3KH2 A;  3WG7 C;  4QI2 A;  1BDJ B;  4AE4 B;  4C3D A;  2HJ3 A;  1CPR A;  1TQG A;  4CBE A;  4E7S A;  2LP4 A;  1U89 A;  4G7O F;  2OJE D;  2EIL C;  5TJ5 E;  1YYX A;  1I5N A;  3TQO A;  1RKE B;  3AG1 C;  3KL4 A;  4MTO A;  3E70 C;  1S7Z A;  5L0D A;  1YZC A;  2CW0 F;  2RD9 A;  3JRM O;  1A0B A;  4G78 A;  3DKA A;  4D4N A;  3PDM P;  2HV7 A;  4U5F E;  4YL3 A;  1WWP A;  2XLE A;  4IGG A;  2CNW D;  3NYM A;  2XL8 A;  3KMI A;  3UGO A;  2WZF A;  2ZPA A;  4PK4 A;  2MYS A;  2Q9C A;  5L0G A;  1GM5 A;  5L0C A;  1QVX A;  2Q3T A;  2YLG A;  2L6F A;  1ZHT A;  2UUI A;  2GAQ A;  4CS7 A;  1G4U S;  2DB4 A;  2XLV A;  3QW0 A;  4XPW A;  2VCB A;  4YN0 B;  4J7Y A;  4BPM A;  3O55 A;  3DJN B;  4G0H A;  3TD7 A;  3ZWI A;  4EBK A;  3CQZ A;  1CGN A;  5KYY B;  3NYL A;  4DRI B;  4U5D E;  1SZI A;  4CDA A;  1BZ4 A;  3S27 A;  3LNM B;  1ZW3 A;  2IXN A;  2IXP A;  2OQM A;  4IWB A;  5A6K A;  4OIP F;  4N6C A;  4U9D A;  2P7V A;  4EHP A;  1ST6 A;  4JTD B;  1NSG B;  1RKC A;  1HW2 A;  3BRJ A;  3B71 A;  1NU9 C;  1MQV A;  3QTH A;  4MS2 A;  3U3B A;  3DMD A;  4FES A;  3VRC A;  4XEK A;  1OCR C;  2Q9A A;  2HFI A;  3FDQ A;  4OIO F;  3O39 A;  1N1C A;  2P6V A;  3FMS A;  1Z5Z A;  3MFN A;  2A1D D;  1D1A A;  4UDV A;  2EIM C;  5BQI A;  2WL8 A;  2B0H A;  3AGT A;  3U2M A;  4X0R A;  3VF0 A;  5E3C A;  2Y3H A;  1T6Q A;  3B0V C;  2IYL D;  1H9G A;  3NYJ A;  4DBR A;  3JZ0 A;  1ZHW A;  3LEO A;  3UMI A;  3EFO B;  3U8V A;  4FWV A;  4LAC B;  4CS8 C;  3EZH A;  4OIQ F;  4M63 A;  3C18 A;  2V3C C;  3EHN A;  2D5R B;  3QVY A;  3SEO A;  2YKZ A;  3W4Y A;  1MNE A;  1LI7 A;  4YT5 A;  5A6B D;  3H65 A;  3IEE A;  1M56 C;  2R7V A;  2R05 A;  2XM4 A;  2YZS A;  3C63 A;  2A0B A;  1G4W R;  3AG4 C;  4EKW A;  2VB6 A;  2H7V C;  2NSG A;  2OOC A;  3CSK A;  3QVZ A;  4ZLC A;  5HV9 A;  5EK0 A;  1ZU5 A;  4JW1 A;  4LDQ A;  4EUK B;  1VYK A;  3N2Z B;  4XLN F;  3MYF A;  1MMA A;  1PD1 A;  2A0U A;  3V7O A;  5AC4 A;  1UFB A;  1ORS C;  4YK5 A;  3ATP A;  1T5O A;  4NTF A;  2PFD A;  3UMK A;  4CDV A;  4O79 A;  3MLG A;  5COM A;  3AQB A;  1LE2 A;  2LCH A;  3HNI A;  1EKY A;  2EPO A;  1OKK A;  3F46 A;  2R03 A;  2R7S A;  1YAU O;  5A6A A;  4IB4 A;  2P0N A;  1QPU A;  4MVU A;  4NY3 A;  2OG2 A;  3NMJ A;  1OQC A;  1E2X A;  3F47 A;  1GS9 A;  2HKV A;  4CIH A;  1W2W A;  2KSF A;  5L0I A;  1A7V A;  4MVS A;  5F5H A;  3U9J A;  2MHR A;  2BL2 A;  3B0P A;  2FAP B;  1NG1 A;  2ZXO A;  3NDB B;  3T4R A;  3B9Q A;  3JT1 A;  3JTL O;  2EPK X;  3QMK A;  3U5S A;  3VM6 A;  2YL3 A;  1T01 A;  4K7B A;  4BJ6 C;  3LS0 A;  1S05 A;  3S0X A;  2EIJ C;  3NRH A;  5BUO A;  1Q0M A;  2A6H F;  3RW0 A;  2Z15 A;  2XLW A;  2R7O A;  4J7T A;  5KYW B;  3PCV A;  1HMO A;  3ZTZ A;  2R7X A;  2AU5 A;  4JC7 A;  2LIG A;  4Z9H A;  3EGD B;  1EA8 A;  1M2V B;  3U3F A;  1A7E A;  3EJN A;  2I15 A;  1Y6D A;  2L9J A;  3I5P A;  4C7O B;  1YA7 O;  4BJ6 A;  4BEM J;  2QTV A;  4L6R A;  3K6B A;  1LE4 A;  3DM5 A;  3NMK A;  1ZW2 A;  2OEX A;  3ABK C;  4XWJ A;  5B3I A;  1OCC C;  4E0I A;  3ZSU A;  1Q0D A;  2ASR A;  1NFN A;  1RMV A;  3QW1 A;  3SXM A;  3DD7 A;  4N4W A;  1TKN A;  3C8G D;  3DI5 A;  4NTA A;  2W4M A;  4JIO A;  5COG A;  3Q6N A;  1I4Y A;  3U9M A;  1NU7 D;  3RH3 A;  4AX2 A;  4E7Z A;  3EH1 A;  4YT2 A;  3C62 A;  5AC5 A;  4CX9 A;  3DAG A;  1ZVZ A;  2ZXW C;  3V5Y A;  4G7Z F;  1OXK A;  1TR2 A;  2J9B A;  1HY5 A;  2YL0 A;  2WB7 A;  1Z7Q c;  1Q0G A;  3EG9 A;  2ETS A;  4XPX A;  4HE8 D;  5JUA A;  1CPQ A;  4P9T A;  1WN0 A;  1D0X A;  2JD3 A;  4Q7C A;  2V26 A;  2I8B A;  2J45 A;  2X0C A;  2J46 A;  1OR3 A;  1B68 A;  2ZXP A;  4I44 A;  1OR2 A;  1Q0K A;  3L0I A;  1RCP A;  4AE4 A;  3ZQV A;  3UGP A;  3JSE O;  3B29 A;  4ONS A;  3G4Z A;  5FZT A;  3W2W A;  4CIP A;  2QLA A;  2C03 A;  2XSE A;  1ZHY A;  4YL1 A;  3RVY A;  2KNH A;  4K1O A;  3SZR A;  4C3B A;  2ZXR A;  1T6I A;  1JAF A;  1RKE A;  2VH3 A;  4IAO A;  3T6J A;  5A6B A;  4LDR A;  2AVK A;  2Y3G A;  5JS5 A;  3RF3 A;  3C8Z A;  1VB5 A;  2R7Q A;  1L3P A;  4JTA B;  4IRU A;  3UR3 C;  5F5F A;  2H7O A;  2ICW G;  2R02 A;  3MX3 A;  2HZ8 A;  1LIH A;  1G5Z A;  2C04 A;  2WZG A;  3OWT A;  2YEV A;  2QY9 A;  5L0J A;  2G3V A;  1QQ3 A;  1C17 M;  1MND A;  2GWW A;  4P9F A;  2LFD A;  3SNH A;  3CAX A;  5DLJ A;  1E83 A;  2DI3 A;  4D4X A;  4LLE A;  3NMI A;  3T9O A;  4OD4 A;  2Q00 A;  2W9Y A;  4P6I C;  4Z9I A;  1MMG A;  2IXO A;  4R32 A;  1YAR O;  2WVN A;  3TUL A;  3DWW A;  4XLP F;  1T9K A;  5KYY A;  3ZTM A;  1AEP A;  2KK1 A;  3VAY A;  1APC A;  3IQC A;  4ULV A;  4JCH A;  2A68 F;  2PF4 E;  1Z23 A;  5D91 A;  1HMD A;  2XXA B;  3HNJ A;  3GOD A;  2W4B A;  1NZE A;  4XTK A;  3V5X A;  3NG1 A;  4JEA A;  1CGO A;  2QE9 A;  4J30 B;  4LDK A;  1E86 A;  2J7P D;  2VCA A;  4MTG A;  1FFH A;  4IAR A;  4CSA C;  1TWH A;  2KYH A;  2ZD9 A;  4NCQ A;  4XQ1 A;  3TJ5 A;  3UMH A;  2LSE A;  2H8A A;  5COF A;  3JSZ A;  3ZQY A;  1V55 C;  1VK5 A;  2L6G A;  3HNK A;  2Q7R A;  1YYJ A;  1IW7 F;  3I4U A;  3SYN A;  4GQH A;  1GGQ A;  3ZC4 A;  4CJG A;  4YT8 A;  2YRF A;  4HFF B;  4NTB A;  4O6M A;  1LS4 A;  4DOZ A;  2XL6 A;  3C8G B;  3AJM A;  3EFO A;  3EHM A;  4RD9 A;  2HJM A;  2LFF A;  3PMR A;  4CSA A;  4F4B A;  1RJ9 B;  5GPG B;  3CZ6 A;  4CS8 A;  5B1A C;  3W2V A;  4U5B E;  2YQY A;  1KNY A;  1A41 A;  1GQA A;  5K0I A;  3LLK A;  2HSB A;  2KQ9 A;  1R5I D;  1YA9 A;  3T6G B;  1NFO A;  2HMQ A;  5DQT A;  1OXB A;  4A4A A;  4HFK B;  4KNW A;  1BBH A;  1LS1 A;  3L8J A;  3Q7G A;  3DM9 B;  1AVO B;  5JRA A;  4JRZ A;  2TMV P;  4CJO A;  2LQG A;  2Y39 A;  2XS8 A;  2XLD A;  3Q6M A;  1ZHX A;  2MWQ A;  4JE9 A;  2R7W A;  1BR4 A;  3L8I A;  4J32 B;  4N06 A;  5BQG A;  1D0Z A;  1PD0 A;  4I3M A;  1VTM P;  1FMW A;  2KGO A;  5T1D B;  4MW3 A;  3HTK C;  4JKV A;  3L1M A;  2HUJ A;  4WGY A;  3X2Q C;  1Z6A A;  2P1A A;  3I5Q A;  4OIN F;  2XS1 A;  1SF8 A;  2AWY A;  1HE9 A;  3K1H A;  2NUP B;  3LUT B;  2IM8 A;  4W8K A;  5BQH A;  5KYU B;  4JJF A;  4YJW A;  1FFT C;  1YDI A;  1JPJ A;  4O6Y A;  3RVZ A;  1VOM A;  1ORY A;  1WAS A;  2OJQ A;  1HW1 A;  1QKR A;  1U6H A;  2CNW A;  3EGX B;  3FAP B;  2YL7 A;  3HLZ A;  4YL0 A;  3C7J A;  3DE8 A;  1HE1 A;  3UNG C;  1WAT A;  3AG2 C;  3NKE A;  4MTF A;  3OA1 A;  1JMW A;  5E2Q A;  2WZL A;  5JVE A;  4MVR A;  3ITF A;  3AG3 C;  4Q5S F;  2IXM A;  3BEH A;  2J8W A;  4EBB A;  1MMN A;  2CGE A;  2WVO A;  3TOL A;  4GEH A;  1WOL A;  5KYX B;  2R9R B;  3KYI A;  5A69 A;  1V54 C;  2IOQ A;  3S84 A;  1UG7 A;  1EI7 A;  5DS5 A;  2NUT B;  5KYN A;  3PHF 2;  2G3K A;  3JYH A;  1JR8 A;  2XLM A;  2E87 A;  2PP4 A;  4JCZ A;  5KYW A;  1QLE C;  1R4T A;  3IPM O;  3WOD F;  1V74 B;  3WHN A;  3EGD A;  1XZQ A;  3GEE A;  1M2V A;  2LK4 A;  2UUH A;  2XLH A;  1TWA A;  2Y69 C;  1WGW A;  2L81 A;  2L6H A;  1JOG A;  4QI0 A;  4WAB A;  1OW8 A;  4JUR I;  3ZG1 A;  1Y4C A;  4EBJ A;  5A6J A;  2GFH A;  2GA0 A;  1M6T A;  3JRT A;  2PX3 A;  2EPL X;  4ZLD A;  2DYR C;  2VAS A;  3N0T A;  3K33 A;  4CS9 C;  3RQF A;  2IBF A;  3EH2 A;  4PJL A;  2H7B A;  3GOR A;  2R7R A;  4GYT A;  1TFO B;  2VCC A;  1J8M F;  3FOO A;  4KNV A;  4IAQ A;  5DVW A;  1CGM E;  2D4U A;  5E3A A;  3S9O A;  1XZP A;  2XM0 A;  2BE5 F;  3RKO F;  1LVK A;  3M4B A;  4MVQ A;  3SXK A;  4DBQ A;  3GWL A;  2HMZ A;  1NLX A;  4WGZ A;  3RQG A;  3KPH A;  1K04 A;  2Y3D A;  1L7C A;  1PCX A;  2YLD A;  2PNO A;  3ZDL A;  4BJ1 A;  4H4K C;  4CS9 A;  3LJB A;  1D1C A;  5D92 A;  3FXH A;  3LLI A;  3S90 A;  1O5H A;  1O87 A;  3DJU B;  2YHS A;  4LER A;  5JP7 A;  3RYL A;  3SXZ A;  2KW3 C;  2L7A A;  1NBB A;  2OEV A;  4I1O B;  3SP1 A;  5JSL A;  3IQ5 A;  3US6 A;  3MBG A;  4B6I A;  2YWA A;  1H9T A;  2F22 A;  3NKD A;  1YZA A;  2DGJ A;  4E18 A;  4G7H F;  1M2O A;  1YJG A;  4PR9 A;  3R7C A;  4XPY A;  3FAJ A;  5L0H A;  3IQ6 A;  1KU2 A;  1TFK B;  1FTS A;  2EPM X;  3HJC A;  2LD6 A;  3RFY A;  1YVI A;  3U8P A;  3MYI A;  4C3E A;  1WTY A;  3ECS A;  4JVS A;  4AL0 A;  4C7O A;  4A2N B;  1I4Z A;  3RQE A;  2M64 A;  3B0U X;  2KJG A;  3KKB A;  1AUE A;  2BC5 A;  3LES A;  3TOM A;  3DAF A;  4MW8 A;  4BJ5 C;  1YLM A;  2NG1 A;  2JX0 A;  1ZHZ A;  256B A;  3L34 A;  4H54 A;  4BJT A;  2PBE A;  1FR0 A;  1EQ1 A;  2J9U A;  3S29 A;  5DS4 A;  1VLS A;  1VMA A;  2QUP A;  3HNL A;  1ZZP A;  3IQT A;  3X1O A;  2G62 A;  3KYJ A;  1D0Y A;  4I1M A;  4O6N A;  4DJ9 A;  3G4X A;  1SYQ A;  3H2U A;  3GM1 A;  3K66 A;  1ZU4 A;  3GM3 A;  3GWN A;  3ZVR A;  4BJ5 A;  2DYS C;  4YT4 A;  2OKU A;  4MND A;  2OCC C;  3EQL F;  5T3T A;  5JT4 A;  1C03 A;  3H2V A;  2W45 A;  4ER9 A;  1FNT c;  1SR2 A;  3N24 A;  3K1I C;  3Q7L A;  3FOP A;  1TWC A;  4DRJ B;  3LNR A;  4BEJ A;  2QNL A;  2P61 A;  3ABM C;  4FX5 A;  4DRH B;  2XXA A;  2AWC A;  3CEX A;  1OW6 A;  2OU6 A;  4U5G A;  1U0B B;  3IHU A;  2PX0 A;  2FGY A;  3LS1 A;  1J8Y F;  2GDC A;  1LKX A;  2NPU A;  3E9V A;  4JJG A;  4Z9J A;  5IY5 C;  2CDQ A;  1SMY F;  4KBL A;  4Q4Z F;  3J06 A;  2Y3B A;  3AOU A;  3K1I A;  4PJN A;  4JEB A;  3K7D A;  1DOW A;  3JCU Q;  4ANJ A;  1MMD A;  1QSP A;  2HSQ A;  3FVY A;  1LPE A;  1OW7 A;  3R2P A;  2JPU A;  3A9C A;  5AGF A;  3C8G A;  1IZM A;  1K05 A;  1JRA A;  1OCZ C;  2HV6 A;  2Q4F A;  5CIV A;  4XEV A;  4KI2 A;  2CCY A;  1D1B A;  1G8X A;  2VC9 A;  1RJ9 A;  1ZYR F;  4K0D A;  2J0X A;  1OCO C;  1H7I A;  4W8P A;  2YLI A;  4KC9 A;  3T6B A;  4N6H A;  2EIK C;  2KC3 A;  3V5Z A;  3QZC A;  2R7U A;  1TWG A;  4YWQ A;  3SXY A;  4PFP A;  4JTC B;  4PJM A;  4AL1 A;  3AGU A;  5FCL A;  3G50 A;  2WVQ A;  4E0H A;  2XRH A;  4MQ9 F;  3GEI A;  3LEV A;  4HEA J;  2AP3 A;  2X51 A;  4PFO A;  2J0W A;  3TJ6 A;  2EIN C;  2FFH A;  5F28 E;  5CI9 A;  1C02 A;  1BR2 A;  1Z3I X;  1VLT A;  2NSF A;  2Q9B A;  4MVZ A;  4U5C E;  2O9X A;  4U9E A;  4OIR F;  3W8I A;  3ZIB A;  2EPN A;  2HS5 A;  4DVY P;  2J9W A;  4OD5 A;  3GEH A;  2A6E F;  3M15 A;  4AK9 A;  3M79 A;  4E17 A;  1KTM A;  3O6X A;  3A11 A;  4O7G A;  5B1B C;  5KYU A;  2NUP A;  3GM2 A;  1PV3 A;  4PJJ A;  1E85 A;  3LAY A;  1RXQ A;  2R7T A;  2XL4 A;  4U5H A;  2RSE B;  3EGX A;  3GAN A;  4FAP B;  2M4E A;  3DE9 A;  4MVO A;  4LLC A;  3OEO A;  4ULW A;  1T6U A;  2B0J A;  3U2L A;  3U0C A;  3POV A;  1M57 C;  3EPV A;  1F1M A;  1E84 A;  1JPN A;  3M4C A;  3ABL C;  5T3W A;  5KYX A;  4PAC A;  4RDA A;  5L0F A;  4NQF A;  4JZA A;  4DXW A;  2YL1 A;  1O3U A;  4NC3 A;  4CDY A;  2NUT A;  1LI5 A;  1ORJ A;  3TK0 A;  4WJ0 A;  5B3S C;  3JYY A;  1XWJ A;  1BR1 A;  2YVK A;  4RBN A;  5DQZ A;  4EIY A;  5EGY A;  5L3V A;  3ASN C;  4IJJ A;  4MVM A;  4DVZ A;  1H6G A;  5L3Q A;  1FAP B;  1DOV A;  3ASO C;  4QDL A;  3S28 A;  1K40 A;  3AQC A;  3M1C B;  1Q0F A;  1LM3 B;  4U5E E;  3VYW A;  2XLO A;  5JLI A;  5DS6 A;  3DXJ F;  1A7D A;  2A69 F; 
#chains in the Genus database with same CATH homology
 3S84 A;  1GS9 A;  1LS4 A;  1NFN A;  1EQ1 A;  1AEP A;  1YA9 A;  1NFO A;  1LE2 A;  1LPE A;  3R2P A;  1EA8 A;  1BZ4 A;  1H7I A;  1OR3 A;  1B68 A;  1LE4 A;  1OR2 A;  2KC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...