2XLMA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous recombinant native with bound no
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
127
structure length
127
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 50
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xlmA00
1NBBA 2XLDA 3HNKA 3QVYA 4CJGA 4D4XA 256BA 2XLEA 5JSLA 4WGYA 1JAFA 4CDYA 1M6TA 1CPRA 2QLAA 5JRAA 3M15A 4ULVA 1GQAA 2YL0A 1BBHA 2CCYA 2XLHA 3QW0A 4JEAA 3C63A 4ER9A 1E86A 4IARA 2YL3A 2J8WA 3NMIA 4CJOA 4N6HA 2XM0A 3QVZA 5JP7A 4NC3A 3NMJA 2XLMA 2XLWA 4CDVA 2YLIA 3DE9A 3NMKA 3TOMA 4N4WA 4CDAA 3ZTZA 5JS5A 4D4NA 2YL1A 2XM4A 5JLIA 3HNLA 4CIPA 1E83A 1LM3B 3M4BA 2YKZA 4WGZA 3TOLA 1MQVA 1EKYA 1RCPA 1YYXA 3M79A 4L6RA 4CX9A 4EIYA 4IB4A 1CPQA 1APCA 1QQ3A 2YLGA 3IQ5A 1S05A 3IQ6A 2XLOA 3HNIA 3M4CA 1YZCA 2YL7A 1E84A 3ZTMA 3FOPA 3U8PA 2BC5A 3FOOA 4JKVA 3ZWIA 1YYJA 2J9BA 1A7VA 1YZAA 1CGNA 1QPUA 4IAQA 3VRCA 4U9EA 3QW1A 5B3IA 5JVEA 1CGOA 4JEBA 2YLDA 4U9DA 1E85A 4JE9A 3ZQVA 5AGFA 5JT4A 2XL6A 3DE8A 3C62A 5JUAA 3L1MA 2XLVA 3HNJA 2XL8A 3ZQYA
chains in the Genus database with same CATH superfamily
2XLDA 1XWJA 4P6IC 1H7IA 2Q9CA 4IWBA 3T6GB 4CJGA 5L0CA 2J7PD 4I1MA 2A6HF 4DRIB 4OIOF 5IY5C 4HE8D 4BPMA 3S84A 3DI5A 2YVKA 4U5CE 3K1IC 3IHUA 4NQFA 256BA 2XLEA 2B0JA 5JSLA 2J9WA 1A0BA 5FZTA 1VOMA 2QY9A 4PFOA 5A69A 2VH3A 1NSGB 4J30B 4DJ9A 2JD3A 3DM9B 3EZIA 5JRAA 1L7CA 1K40A 3M15A 1OXKA 4JTCB 5KYXB 4ULVA 3SNHA 1MNEA 4DVYP 1FFTC 3HTKC 1ZW3A 4PR9A 3LS0A 2XLHA 1YA7O 3H65A 1WTYA 3QW0A 4JEAA 3ZC4A 3C63A 1PD1A 1FR0A 1LVKA 2GDCA 4ER9A 3TK0A 4IARA 3GM1A 3T6BA 1BR4A 2J8WA 4FAPB 3K66A 3LEOA 2P0NA 4XPXA 3V7OA 1H9TA 3WHNA 3MYFA 4IGGA 2X0CA 3LESA 4YL3A 2HUJA 2OQMA 3IPMO 3IQCA 4U5EE 2Y3BA 3ITFA 2XLMA 4NTAA 4NY3A 3O39A 3NKEA 1YA9A 1M57C 1PD0A 4ANJA 3ABMC 3S90A 2L7AA 4JTDB 2NSGA 4XWJA 3U2MA 1Z5ZA 3U2LA 1R4TA 2HJ3A 3AQCA 3ZTZA 4E17A 1WOLA 4K0DA 2LIGA 3EH1A 3Q6NA 2VCAA 5CI9A 2Q7RA 3HNLA 3RVZA 4LERA 4PACA 3S9OA 5JLIA 4MTGA 2EPLX 3U3FA 2XSEA 2XS8A 5KYYB 3SEOA 1VYIA 2YKZA 3DAGA 5HSWA 4WGZA 3DZAA 2OEXA 4PJNA 4YT2A 5L0DA 1U0BB 1EKYA 5DQZA 3GEIA 1NU9C 3KKBA 2X51A 4CS8C 3UR3C 4DRJB 2R05A 4EIYA 1OR2A 1VLSA 1XZPA 4OD4A 2YLGA 4JC7A 5DS4A 1FAPB 3UGPA 5D92A 3LS1A 3WODF 4XEVA 2KSFA 1MMGA 2XLOA 3GANA 1UG7A 5COGA 3RW0A 5CIVA 4OIPF 3LEVA 4FX5A 4YJWA 4JCZA 1BR1A 3AG2C 3GEHA 3M4CA 3V5ZA 1YAUO 1BZ4A 1C17M 2H7VC 3FOPA 1E84A 1PV3A 3B29A 2IXNA 1J8MF 3FOOA 3IQTA 3U9MA 2I8BA 1YYJA 2E87A 2BE5F 5B1BC 4A2NB 1YZAA 1WN0A 2Y39A 1L3PA 5COFA 2NUTB 3C8GD 5EHHA 2CYDA 1M2VA 2EINC 2L6GA 3NYLA 3MFNA 1I5NA 3SYNA 3LLKA 2PBEA 4JRZA 3VRCA 3W8HA 1IW7F 1ORSC 4DVZA 1G5ZA 1FMVA 1OCOC 1T01A 3K33A 3QW1A 3U5SA 5B3IA 5A6AA 5K0IA 1ORYA 2HZ8A 2NUPA 4MW3A 2YLDA 1OKKD 1DOWA 3AOUA 1F1MA 2FFHA 4DRHB 1E85A 2XXAB 1EA8A 4BJ6C 3ZQVA 2R7QA 2HSQA 4G7ZF 4LLCA 1WWPA 1VYKA 1V54C 3EHNA 2KYHA 3DE8A 4EHPA 2ASRA 3LJBA 3JRMO 3EGXB 1FNTc 1YARO 2XLVA 2MWQA 3U8VA 3ZVRA 4KNVA 3VAYA 2GFHA 2IXMA 3E70C 4NTBA 4CS7A 3PDMP 2W9YA 2OCCC 2Y3HA 1HE1A 3HNKA 3RFYA 3TJ6A 3ABLC 3K1IA 3Q7GA 4DXWA 2RSEB 2AWCA 1Q0KA 1K04A 1TFOB 1T6IA 2WZFA 1NFOA 4MQ9F 4XLPF 1JAFA 1J8YF 3PMRA 4G7OF 1KU2A 3RKOF 3LLIA 1LE2A 3RQEA 2W4BA 4BEJA 1KTMA 2QLAA 1ZHTA 1ZU5A 3RVYA 1PCXA 1Q0DA 2AVKA 2I15A 4CSAC 2DYRC 3OEOA 1VK5A 1VB5A 2ETSA 3BEHA 1AUEA 3O55A 2CCYA 1OCRC 4NTFA 4YL1A 3VF0A 1D1BA 4C3BA 5KYYA 2DGJA 4C7OA 2J0XA 5CI8A 3L34A 5KYWB 3SZRA 2WVOA 1E86A 1ZVZA 2YL3A 4X0RA 2H7OA 3ABKC 3NMIA 4BEMJ 3O10A 3RQGA 3DM5A 4N6HA 5KYUA 1HW1A 2A0BA 2D5RB 2QNLA 2XM0A 3EJNA 3G50A 3UNGC 1Q0FA 3CZ6A 1FMWA 5KYNA 1XZQA 3I5QA 2VB6A 1RKEA 2VC9A 2YLIA 3A11A 1N1CA 1I4ZA 4EKWA 2KJGA 3WAQA 5DS5A 1QZXA 4N4WA 2CGEA 3SXZA 3UMIA 4CDAA 1T5OA 4Q4ZF 3FMSA 4MVSA 4D4NA 5FCLA 1CGME 2LK4A 2AP3A 2P61A 3EQLF 4CIPA 1E83A 4LDKA 2EPMX 3MBGA 1LKXA 2NUTA 3C8ZA 1TWCA 2CNWA 1NFNA 3M4BA 3GM3A 4YN0B 3PHF2 4MW8A 2KGOA 3FAPB 3L8IA 4P9FA 4JVSA 4U5GA 3I5PA 2LCHA 5TJ5E 1D0YA 1V74B 5DQTA 1YYXA 2EPOA 2MHRA 1MMAA 2OG2A 2R9RB 3I4UA 3OWTA 3KYJA 4IB4A 1APCA 3IQ5A 3GM2A 1LI7A 2XXAA 1NU7D 3IQ6A 3CQZA 4K1OA 4PJLA 1JMWA 1BR2A 4JZAA 4YWQA 4PK4A 4JJFA 2A68F 3SP1A 4E18A 2YL7A 4G0HA 4KNWA 5A6JA 2JX0A 1GM5A 4CS9C 1ZHZA 2L6FA 3DD7A 3HJCA 3U8PA 2R7TA 4MS2A 3N24A 1RKCA 1R5ID 4XTKA 4XEFA 5E3AA 3JYYA 3ZWIA 1Q0MA 4C3DA 2KNHA 3G4XA 1CGNA 2FAPB 4MTFA 4KI2A 4IAQA 1VLTA 1WGWA 2P6VA 2W4MA 2WZGA 2UUHA 4IAOA 2G62A 1FFHA 1M56C 5DS6A 3K1HA 4BJ6A 5JVEA 4JEBA 3W8IA 3KMIA 3V5YA 1ZZPA 4ZLDA 4U9DA 2J9UA 1C02A 1TFKB 5T3TA 3AQBA 2YQYA 5AGFA 3MX3A 4BG0A 1JOGA 3FVYA 4N06A 3M1CB 2LP4A 5B1AC 5A6BD 1WASA 1KNYA 1A7EA 5JUAA 3L1MA 2LFDA 1NZEA 3FXHA 4U5DE 3U3BA 4E0HA 2EPNA 4Z9IA 4UDVA 3T6JA 2PNOA 2XL8A 2A0UA 4BJ5C 4ONSA 2R7WA 2KQ9A 2Q9BA 3W2WA 3QVYA 3T9OA 4OINF 5L0JA 1YLMA 4J7YA 3RYLA 1RJ9B 4KC9A 4D4XA 5F28E 2A1DD 4JJGA 4AE4B 1V4AA 4O6YA 1SZIA 2TMVP 2HV7A 5F5FA 3S28A 1AVOB 4WGYA 2PP4A 4U5FE 1OW6A 5F5HA 4CSAA 1O87A 3GWNA 2R25A 3K7DA 2DB4A 5E2QA 4O7GA 2AWYA 4F4BA 2IOQA 2KK1A 3L8JA 3ZG1A 4CBEA 5A6BA 5BQHA 2ZD9A 3CEXA 4MVOA 1GQAA 4BJTA 2YL0A 4W8PA 5KYXA 2V3CC 2ZXPA 4WJ0A 2F22A 1SF8A 1LPEA 1C03A 1TKNA 3EH2A 2OEVA 4XPWA 5A6KA 2EIMC 3JCUQ 3CSKA 3OA1A 1I4YA 4Q7CA 4E0IA 4DBQA 3HLZA 3R2PA 1Y6DA 1TQGA 2RD9A 3DWWA 3Q7LA 3QMKA 3SXKA 3NDBB 1G4US 2QE9A 2DYSC 2PFDA 2ZXRA 2J45A 3QVZA 5JP7A 4NC3A 1OCCC 3X2QC 1TWGA 2KC3A 3TJ5A 4CDVA 1YDIA 2R7RA 2L6HA 2V26A 2WB7A 3DJNB 3NMKA 4LDQA 1OKKA 1RXQA 3Q6MA 1SR2A 2R7XA 3H2UA 4YK5A 5JS5A 4O6MA 1D0ZA 2LFFA 1JPJA 2OOCA 3EG9B 2YL1A 5COMA 1QSPA 5GPGB 4AL0A 4QI0A 1LM3B 3RQFA 3ZIBA 3GORA 4LACB 3S29A 1Y4CA 3CAXA 1MQVA 1V55C 2Q4FA 4HFFB 3US6A 1RCPA 2IYLD 2R02A 1A7DA 2HMZA 2IM8A 3E9VA 4L6RA 3KYIA 1Q0GA 3QTHA 3SXYA 3U9JA 1YVIA 3B0VC 1QVXA 3SXMA 3VM6A 1QQ3A 1QKRA 2HV6A 3UMHA 1S05A 4JURI 4CS9A 2M64A 1HW2A 3HNIA 1JPNA 2HKVA 2PX0A 2VCCA 3K6BA 1VTMP 2A69F 3NRHA 1Z6AA 4YL0A 3V5XA 5L0GA 2KW3C 4MVMA 3ZSUA 1Z3IX 2HJMA 4CIHA 4P9TA 4JKVA 3IEEA 2J9BA 4PJJA 1FTSA 2IXPA 2LSEA 4BJ1A 4A4AA 1W2WA 4U5HA 2DI3A 4EWCA 3KH2A 2CDQA 4MVUA 1SYQA 1QPUA 3RH3A 4CS8A 4RBNA 4O79A 5B3SC 3EPVA 3AGTA 1RJ9A 1G4WR 1Z63A 1ORJA 3LNRA 1WATA 2NUPB 1O3UA 5DLJA 3C18A 4AE4A 4DOZA 2GA0A 3AJMA 3C8GB 4OIQF 1B68A 1M2OA 3JSZA 4U5BE 4Z9HA 4MVQA 3T4RA 4JE9A 3ZDLA 2L81A 4FWVA 3LNMB 4O6NA 1HY5A 3GWLA 4JIOA 4N6CA 4OIRF 4J32B 2C03A 2J7PA 1HE9A 4HFKB 3JRTA 1DOVA 1SMYF 3AG3C 2AU5A 1MMDA 3J06A 4Z9JA 3EGXA 4MNDA 5BQGA 3DXJF 4BJ5A 3DJUB 1OW8A 1G8XA 2QUPA 3ASOC 3DAFA 3EFOB 3HNJA 3NG1A 3S0XA 2OU6A 2P1AA 4MVZA 1A41A 2R03A 1ZHWA 2W45A 4I3MA 4G7HF 2XRHA 3EGDB 4WABA 1Z7Qc 1NBBA 4DBRA 4YT8A 1TR2A 1T9KA 2J0WA 2P7VA 1D0XA 2WZLA 5L0IA 5L3VA 3B0PA 3TQOA 2H7BA 5L0FA 2IBFA 2R7UA 3PCVA 4EUKB 3FDQA 1BDJB 4YT5A 4GYTA 4PFPA 1OQCA 4Q5SF 2Z15A 3JYHA 1Z23A 3RIPA 4CDYA 4XLNF 1M6TA 1EI7A 1O5HA 2C04A 3KPHA 3N2ZB 2OJQA 4KBLA 1CPRA 2NSFA 3UMKA 1H6GA 2A6EF 5L3QA 4JW1A 1ST6A 2CW0F 4JTAB 3TULA 3LUTB 3EG9A 1ZHXA 3AGUA 1MMNA 5EK0A 2R7SA 2Q3TA 2VASA 1BBHA 4PJMA 1LS1A 4C7OB 3HKKA 2G3KA 3C7JA 1ZHYA 5E33A 3VYWA 5KYWA 1T6QA 3S27A 3W4YA 2R7VA 2ZXOA 3U0CA 4CJOA 5KYUB 3R7CA 2VCBA 3NKDA 1NLXA 2WVQA 4K7BA 1MNDA 1TWAA 3F47A 1GGQA 2B0HA 1RKEB 1GS9A 2HSBA 2OJED 2Y3DA 3NMJA 4ULWA 1U89A 1HMDA 2PX3A 2H8AA 2Q9AA 2XLWA 3NYMA 3QZCA 4QDLA 3WG7C 3DE9A 4R32A 4H4KC 3TOMA 2J9VA 2D4UA 2MYSA 2Y3GA 3EHMA 1JRAA 1JR8A 4I44A 3ASNC 4W8KA 3JZ0A 1S7ZA 1OR3A 4RDAA 3JSEO 3X1OA 1EQ1A 2XM4A 3A9CA 3NYJA 2EPKX 1E2XA 1LS4A 4H54A 4IRUA 4LDRA 4XPYA 1RMVA 3MYIA 4J7TA 3H2VA 1IZMA 1OCZC 3N0TA 4MTOA 4XQ1A 3KL4A 4FESA 3RF3A 5HV9A 1ZW2A 4EBJA 4E7SA 3M79A 3F46A 1H9GA 4CX9A 3POVA 5BUOA 1CPQA 3DMDA 1OXBA 3TD7A 2JPUA 3C8GA 2J46A 3LAYA 2PF4E 4XEKA 4EBKA 3MLGA 2XL4A 2EILC 2WVNA 3GODA 4GEHA 4RD9A 2LD6A 3TOLA 3B71A 2QTVA 4AX2A 2FGYA 2ZXWC 1YZCA 1D1AA 3B0UX 1OW7A 3ZTMA 2YWAA 3L0IA 4MVRA 2O9XA 1AEPA 2BC5A 2YEVA 3JTLO 4I1OB 4LLEA 4G78A 3EFOA 4M63A 1A7VA 1K05A 2G3VA 1LE4A 4QI2A 3ECSA 4AK9A 1HMOA 5EGYA 4E7ZA 1LI5A 2XS1A 3EGDA 5DVWA 2IXOA 1T6UA 5E3CA 2EIJC 4U9EA 1U6HA 4GQHA 4B6IA 2BL2A 1TWHA 4AL1A 5L0HA 2GWWA 3GEEA 1CGOA 4HEAJ 2YHSA 2ICWG 2R7OA 4JCHA 4YT4A 3EZHA 2HS5A 1QLEC 1D1CA 2M4EA 2NPUA 2OKUA 3AG4C 4IJJA 2ZPAA 2HFIA 2YZSA 3FHDA 2EIKC 2Q00A 4EBBA 5JT4A 5BQIA 2XL6A 2UUIA 2CNWD 2NG1A 2LQGA 1UFBA 2Y69C 3C62A 5T3WA 4ZLCA 3AG1C 3B9QA 1ZU4A 2HMQA 5AC5A 4NCQA 2L9JA 1VMAA 5T1DB 3UGOA 2WL8A 2YRFA 1NG1A 5D91A 3G4ZA 1LIHA 3BRJA 2GAQA 3JT1A 4OD5A 3DKAA 3FAJA 3O6XA 3ZQYA 3W2VA 4C3EA 1M2VB 5AC4A 1ZYRF 3ATPA 1YJGA
chains in the Genus database with same CATH topology
1NBBA 2XLDA 3HNKA 3QVYA 4CJGA 4D4XA 256BA 2XLEA 5JSLA 4WGYA 1JAFA 4CDYA 1M6TA 1CPRA 2QLAA 5JRAA 3M15A 4ULVA 1GQAA 2YL0A 1BBHA 2CCYA 2XLHA 3QW0A 4JEAA 3C63A 4ER9A 1E86A 4IARA 2YL3A 2J8WA 3NMIA 4CJOA 4N6HA 2XM0A 3QVZA 5JP7A 4NC3A 3NMJA 2XLMA 2XLWA 4CDVA 2YLIA 3DE9A 3NMKA 3TOMA 4N4WA 4CDAA 3ZTZA 5JS5A 4D4NA 2YL1A 2XM4A 5JLIA 3HNLA 4CIPA 1E83A 1LM3B 3M4BA 2YKZA 4WGZA 3TOLA 1MQVA 1EKYA 1RCPA 1YYXA 3M79A 4L6RA 4CX9A 4EIYA 4IB4A 1CPQA 1APCA 1QQ3A 2YLGA 3IQ5A 1S05A 3IQ6A 2XLOA 3HNIA 3M4CA 1YZCA 2YL7A 1E84A 3ZTMA 3FOPA 3U8PA 2BC5A 3FOOA 4JKVA 3ZWIA 1YYJA 2J9BA 1A7VA 1YZAA 1CGNA 1QPUA 4IAQA 3VRCA 4U9EA 3QW1A 5B3IA 5JVEA 1CGOA 4JEBA 2YLDA 4U9DA 1E85A 4JE9A 3ZQVA 5AGFA 5JT4A 2XL6A 3DE8A 3C62A 5JUAA 3L1MA 2XLVA 3HNJA 2XL8A 3ZQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NBB A;  2XLD A;  3HNK A;  3QVY A;  4CJG A;  4D4X A;  256B A;  2XLE A;  5JSL A;  4WGY A;  1JAF A;  4CDY A;  1M6T A;  1CPR A;  2QLA A;  5JRA A;  3M15 A;  4ULV A;  1GQA A;  2YL0 A;  1BBH A;  2CCY A;  2XLH A;  3QW0 A;  4JEA A;  3C63 A;  4ER9 A;  1E86 A;  4IAR A;  2YL3 A;  2J8W A;  3NMI A;  4CJO A;  4N6H A;  2XM0 A;  3QVZ A;  5JP7 A;  4NC3 A;  3NMJ A;  2XLM A;  2XLW A;  4CDV A;  2YLI A;  3DE9 A;  3NMK A;  3TOM A;  4N4W A;  4CDA A;  3ZTZ A;  5JS5 A;  4D4N A;  2YL1 A;  2XM4 A;  5JLI A;  3HNL A;  4CIP A;  1E83 A;  1LM3 B;  3M4B A;  2YKZ A;  4WGZ A;  3TOL A;  1MQV A;  1EKY A;  1RCP A;  1YYX A;  3M79 A;  4L6R A;  4CX9 A;  4EIY A;  4IB4 A;  1CPQ A;  1APC A;  1QQ3 A;  2YLG A;  3IQ5 A;  1S05 A;  3IQ6 A;  2XLO A;  3HNI A;  3M4C A;  1YZC A;  2YL7 A;  1E84 A;  3ZTM A;  3FOP A;  3U8P A;  2BC5 A;  3FOO A;  4JKV A;  3ZWI A;  1YYJ A;  2J9B A;  1A7V A;  1YZA A;  1CGN A;  1QPU A;  4IAQ A;  3VRC A;  4U9E A;  3QW1 A;  5B3I A;  5JVE A;  1CGO A;  4JEB A;  2YLD A;  4U9D A;  1E85 A;  4JE9 A;  3ZQV A;  5AGF A;  5JT4 A;  2XL6 A;  3DE8 A;  3C62 A;  5JUA A;  3L1M A;  2XLV A;  3HNJ A;  2XL8 A;  3ZQY A; 
#chains in the Genus database with same CATH topology
 2XLD A;  1XWJ A;  4P6I C;  1H7I A;  2Q9C A;  4IWB A;  3T6G B;  4CJG A;  5L0C A;  2J7P D;  4I1M A;  2A6H F;  4DRI B;  4OIO F;  5IY5 C;  4HE8 D;  4BPM A;  3S84 A;  3DI5 A;  2YVK A;  4U5C E;  3K1I C;  3IHU A;  4NQF A;  256B A;  2XLE A;  2B0J A;  5JSL A;  2J9W A;  1A0B A;  5FZT A;  1VOM A;  2QY9 A;  4PFO A;  5A69 A;  2VH3 A;  1NSG B;  4J30 B;  4DJ9 A;  2JD3 A;  3DM9 B;  3EZI A;  5JRA A;  1L7C A;  1K40 A;  3M15 A;  1OXK A;  4JTC B;  5KYX B;  4ULV A;  3SNH A;  1MNE A;  4DVY P;  1FFT C;  3HTK C;  1ZW3 A;  4PR9 A;  3LS0 A;  2XLH A;  1YA7 O;  3H65 A;  1WTY A;  3QW0 A;  4JEA A;  3ZC4 A;  3C63 A;  1PD1 A;  1FR0 A;  1LVK A;  2GDC A;  4ER9 A;  3TK0 A;  4IAR A;  3GM1 A;  3T6B A;  1BR4 A;  2J8W A;  4FAP B;  3K66 A;  3LEO A;  2P0N A;  4XPX A;  3V7O A;  1H9T A;  3WHN A;  3MYF A;  4IGG A;  2X0C A;  3LES A;  4YL3 A;  2HUJ A;  2OQM A;  3IPM O;  3IQC A;  4U5E E;  2Y3B A;  3ITF A;  2XLM A;  4NTA A;  4NY3 A;  3O39 A;  3NKE A;  1YA9 A;  1M57 C;  1PD0 A;  4ANJ A;  3ABM C;  3S90 A;  2L7A A;  4JTD B;  2NSG A;  4XWJ A;  3U2M A;  1Z5Z A;  3U2L A;  1R4T A;  2HJ3 A;  3AQC A;  3ZTZ A;  4E17 A;  1WOL A;  4K0D A;  2LIG A;  3EH1 A;  3Q6N A;  2VCA A;  5CI9 A;  2Q7R A;  3HNL A;  3RVZ A;  4LER A;  4PAC A;  3S9O A;  5JLI A;  4MTG A;  2EPL X;  3U3F A;  2XSE A;  2XS8 A;  5KYY B;  3SEO A;  1VYI A;  2YKZ A;  3DAG A;  5HSW A;  4WGZ A;  3DZA A;  2OEX A;  4PJN A;  4YT2 A;  5L0D A;  1U0B B;  1EKY A;  5DQZ A;  3GEI A;  1NU9 C;  3KKB A;  2X51 A;  4CS8 C;  3UR3 C;  4DRJ B;  2R05 A;  4EIY A;  1OR2 A;  1VLS A;  1XZP A;  4OD4 A;  2YLG A;  4JC7 A;  5DS4 A;  1FAP B;  3UGP A;  5D92 A;  3LS1 A;  3WOD F;  4XEV A;  2KSF A;  1MMG A;  2XLO A;  3GAN A;  1UG7 A;  5COG A;  3RW0 A;  5CIV A;  4OIP F;  3LEV A;  4FX5 A;  4YJW A;  4JCZ A;  1BR1 A;  3AG2 C;  3GEH A;  3M4C A;  3V5Z A;  1YAU O;  1BZ4 A;  1C17 M;  2H7V C;  3FOP A;  1E84 A;  1PV3 A;  3B29 A;  2IXN A;  1J8M F;  3FOO A;  3IQT A;  3U9M A;  2I8B A;  1YYJ A;  2E87 A;  2BE5 F;  5B1B C;  4A2N B;  1YZA A;  1WN0 A;  2Y39 A;  1L3P A;  5COF A;  2NUT B;  3C8G D;  5EHH A;  2CYD A;  1M2V A;  2EIN C;  2L6G A;  3NYL A;  3MFN A;  1I5N A;  3SYN A;  3LLK A;  2PBE A;  4JRZ A;  3VRC A;  3W8H A;  1IW7 F;  1ORS C;  4DVZ A;  1G5Z A;  1FMV A;  1OCO C;  1T01 A;  3K33 A;  3QW1 A;  3U5S A;  5B3I A;  5A6A A;  5K0I A;  1ORY A;  2HZ8 A;  2NUP A;  4MW3 A;  2YLD A;  1OKK D;  1DOW A;  3AOU A;  1F1M A;  2FFH A;  4DRH B;  1E85 A;  2XXA B;  1EA8 A;  4BJ6 C;  3ZQV A;  2R7Q A;  2HSQ A;  4G7Z F;  4LLC A;  1WWP A;  1VYK A;  1V54 C;  3EHN A;  2KYH A;  3DE8 A;  4EHP A;  2ASR A;  3LJB A;  3JRM O;  3EGX B;  1FNT c;  1YAR O;  2XLV A;  2MWQ A;  3U8V A;  3ZVR A;  4KNV A;  3VAY A;  2GFH A;  2IXM A;  3E70 C;  4NTB A;  4CS7 A;  3PDM P;  2W9Y A;  2OCC C;  2Y3H A;  1HE1 A;  3HNK A;  3RFY A;  3TJ6 A;  3ABL C;  3K1I A;  3Q7G A;  4DXW A;  2RSE B;  2AWC A;  1Q0K A;  1K04 A;  1TFO B;  1T6I A;  2WZF A;  1NFO A;  4MQ9 F;  4XLP F;  1JAF A;  1J8Y F;  3PMR A;  4G7O F;  1KU2 A;  3RKO F;  3LLI A;  1LE2 A;  3RQE A;  2W4B A;  4BEJ A;  1KTM A;  2QLA A;  1ZHT A;  1ZU5 A;  3RVY A;  1PCX A;  1Q0D A;  2AVK A;  2I15 A;  4CSA C;  2DYR C;  3OEO A;  1VK5 A;  1VB5 A;  2ETS A;  3BEH A;  1AUE A;  3O55 A;  2CCY A;  1OCR C;  4NTF A;  4YL1 A;  3VF0 A;  1D1B A;  4C3B A;  5KYY A;  2DGJ A;  4C7O A;  2J0X A;  5CI8 A;  3L34 A;  5KYW B;  3SZR A;  2WVO A;  1E86 A;  1ZVZ A;  2YL3 A;  4X0R A;  2H7O A;  3ABK C;  3NMI A;  4BEM J;  3O10 A;  3RQG A;  3DM5 A;  4N6H A;  5KYU A;  1HW1 A;  2A0B A;  2D5R B;  2QNL A;  2XM0 A;  3EJN A;  3G50 A;  3UNG C;  1Q0F A;  3CZ6 A;  1FMW A;  5KYN A;  1XZQ A;  3I5Q A;  2VB6 A;  1RKE A;  2VC9 A;  2YLI A;  3A11 A;  1N1C A;  1I4Z A;  4EKW A;  2KJG A;  3WAQ A;  5DS5 A;  1QZX A;  4N4W A;  2CGE A;  3SXZ A;  3UMI A;  4CDA A;  1T5O A;  4Q4Z F;  3FMS A;  4MVS A;  4D4N A;  5FCL A;  1CGM E;  2LK4 A;  2AP3 A;  2P61 A;  3EQL F;  4CIP A;  1E83 A;  4LDK A;  2EPM X;  3MBG A;  1LKX A;  2NUT A;  3C8Z A;  1TWC A;  2CNW A;  1NFN A;  3M4B A;  3GM3 A;  4YN0 B;  3PHF 2;  4MW8 A;  2KGO A;  3FAP B;  3L8I A;  4P9F A;  4JVS A;  4U5G A;  3I5P A;  2LCH A;  5TJ5 E;  1D0Y A;  1V74 B;  5DQT A;  1YYX A;  2EPO A;  2MHR A;  1MMA A;  2OG2 A;  2R9R B;  3I4U A;  3OWT A;  3KYJ A;  4IB4 A;  1APC A;  3IQ5 A;  3GM2 A;  1LI7 A;  2XXA A;  1NU7 D;  3IQ6 A;  3CQZ A;  4K1O A;  4PJL A;  1JMW A;  1BR2 A;  4JZA A;  4YWQ A;  4PK4 A;  4JJF A;  2A68 F;  3SP1 A;  4E18 A;  2YL7 A;  4G0H A;  4KNW A;  5A6J A;  2JX0 A;  1GM5 A;  4CS9 C;  1ZHZ A;  2L6F A;  3DD7 A;  3HJC A;  3U8P A;  2R7T A;  4MS2 A;  3N24 A;  1RKC A;  1R5I D;  4XTK A;  4XEF A;  5E3A A;  3JYY A;  3ZWI A;  1Q0M A;  4C3D A;  2KNH A;  3G4X A;  1CGN A;  2FAP B;  4MTF A;  4KI2 A;  4IAQ A;  1VLT A;  1WGW A;  2P6V A;  2W4M A;  2WZG A;  2UUH A;  4IAO A;  2G62 A;  1FFH A;  1M56 C;  5DS6 A;  3K1H A;  4BJ6 A;  5JVE A;  4JEB A;  3W8I A;  3KMI A;  3V5Y A;  1ZZP A;  4ZLD A;  4U9D A;  2J9U A;  1C02 A;  1TFK B;  5T3T A;  3AQB A;  2YQY A;  5AGF A;  3MX3 A;  4BG0 A;  1JOG A;  3FVY A;  4N06 A;  3M1C B;  2LP4 A;  5B1A C;  5A6B D;  1WAS A;  1KNY A;  1A7E A;  5JUA A;  3L1M A;  2LFD A;  1NZE A;  3FXH A;  4U5D E;  3U3B A;  4E0H A;  2EPN A;  4Z9I A;  4UDV A;  3T6J A;  2PNO A;  2XL8 A;  2A0U A;  4BJ5 C;  4ONS A;  2R7W A;  2KQ9 A;  2Q9B A;  3W2W A;  3QVY A;  3T9O A;  4OIN F;  5L0J A;  1YLM A;  4J7Y A;  3RYL A;  1RJ9 B;  4KC9 A;  4D4X A;  5F28 E;  2A1D D;  4JJG A;  4AE4 B;  1V4A A;  4O6Y A;  1SZI A;  2TMV P;  2HV7 A;  5F5F A;  3S28 A;  1AVO B;  4WGY A;  2PP4 A;  4U5F E;  1OW6 A;  5F5H A;  4CSA A;  1O87 A;  3GWN A;  2R25 A;  3K7D A;  2DB4 A;  5E2Q A;  4O7G A;  2AWY A;  4F4B A;  2IOQ A;  2KK1 A;  3L8J A;  3ZG1 A;  4CBE A;  5A6B A;  5BQH A;  2ZD9 A;  3CEX A;  4MVO A;  1GQA A;  4BJT A;  2YL0 A;  4W8P A;  5KYX A;  2V3C C;  2ZXP A;  4WJ0 A;  2F22 A;  1SF8 A;  1LPE A;  1C03 A;  1TKN A;  3EH2 A;  2OEV A;  4XPW A;  5A6K A;  2EIM C;  3JCU Q;  3CSK A;  3OA1 A;  1I4Y A;  4Q7C A;  4E0I A;  4DBQ A;  3HLZ A;  3R2P A;  1Y6D A;  1TQG A;  2RD9 A;  3DWW A;  3Q7L A;  3QMK A;  3SXK A;  3NDB B;  1G4U S;  2QE9 A;  2DYS C;  2PFD A;  2ZXR A;  2J45 A;  3QVZ A;  5JP7 A;  4NC3 A;  1OCC C;  3X2Q C;  1TWG A;  2KC3 A;  3TJ5 A;  4CDV A;  1YDI A;  2R7R A;  2L6H A;  2V26 A;  2WB7 A;  3DJN B;  3NMK A;  4LDQ A;  1OKK A;  1RXQ A;  3Q6M A;  1SR2 A;  2R7X A;  3H2U A;  4YK5 A;  5JS5 A;  4O6M A;  1D0Z A;  2LFF A;  1JPJ A;  2OOC A;  3EG9 B;  2YL1 A;  5COM A;  1QSP A;  5GPG B;  4AL0 A;  4QI0 A;  1LM3 B;  3RQF A;  3ZIB A;  3GOR A;  4LAC B;  3S29 A;  1Y4C A;  3CAX A;  1MQV A;  1V55 C;  2Q4F A;  4HFF B;  3US6 A;  1RCP A;  2IYL D;  2R02 A;  1A7D A;  2HMZ A;  2IM8 A;  3E9V A;  4L6R A;  3KYI A;  1Q0G A;  3QTH A;  3SXY A;  3U9J A;  1YVI A;  3B0V C;  1QVX A;  3SXM A;  3VM6 A;  1QQ3 A;  1QKR A;  2HV6 A;  3UMH A;  1S05 A;  4JUR I;  4CS9 A;  2M64 A;  1HW2 A;  3HNI A;  1JPN A;  2HKV A;  2PX0 A;  2VCC A;  3K6B A;  1VTM P;  2A69 F;  3NRH A;  1Z6A A;  4YL0 A;  3V5X A;  5L0G A;  2KW3 C;  4MVM A;  3ZSU A;  1Z3I X;  2HJM A;  4CIH A;  4P9T A;  4JKV A;  3IEE A;  2J9B A;  4PJJ A;  1FTS A;  2IXP A;  2LSE A;  4BJ1 A;  4A4A A;  1W2W A;  4U5H A;  2DI3 A;  4EWC A;  3KH2 A;  2CDQ A;  4MVU A;  1SYQ A;  1QPU A;  3RH3 A;  4CS8 A;  4RBN A;  4O79 A;  5B3S C;  3EPV A;  3AGT A;  1RJ9 A;  1G4W R;  1Z63 A;  1ORJ A;  3LNR A;  1WAT A;  2NUP B;  1O3U A;  5DLJ A;  3C18 A;  4AE4 A;  4DOZ A;  2GA0 A;  3AJM A;  3C8G B;  4OIQ F;  1B68 A;  1M2O A;  3JSZ A;  4U5B E;  4Z9H A;  4MVQ A;  3T4R A;  4JE9 A;  3ZDL A;  2L81 A;  4FWV A;  3LNM B;  4O6N A;  1HY5 A;  3GWL A;  4JIO A;  4N6C A;  4OIR F;  4J32 B;  2C03 A;  2J7P A;  1HE9 A;  4HFK B;  3JRT A;  1DOV A;  1SMY F;  3AG3 C;  2AU5 A;  1MMD A;  3J06 A;  4Z9J A;  3EGX A;  4MND A;  5BQG A;  3DXJ F;  4BJ5 A;  3DJU B;  1OW8 A;  1G8X A;  2QUP A;  3ASO C;  3DAF A;  3EFO B;  3HNJ A;  3NG1 A;  3S0X A;  2OU6 A;  2P1A A;  4MVZ A;  1A41 A;  2R03 A;  1ZHW A;  2W45 A;  4I3M A;  4G7H F;  2XRH A;  3EGD B;  4WAB A;  1Z7Q c;  1NBB A;  4DBR A;  4YT8 A;  1TR2 A;  1T9K A;  2J0W A;  2P7V A;  1D0X A;  2WZL A;  5L0I A;  5L3V A;  3B0P A;  3TQO A;  2H7B A;  5L0F A;  2IBF A;  2R7U A;  3PCV A;  4EUK B;  3FDQ A;  1BDJ B;  4YT5 A;  4GYT A;  4PFP A;  1OQC A;  4Q5S F;  2Z15 A;  3JYH A;  1Z23 A;  3RIP A;  4CDY A;  4XLN F;  1M6T A;  1EI7 A;  1O5H A;  2C04 A;  3KPH A;  3N2Z B;  2OJQ A;  4KBL A;  1CPR A;  2NSF A;  3UMK A;  1H6G A;  2A6E F;  5L3Q A;  4JW1 A;  1ST6 A;  2CW0 F;  4JTA B;  3TUL A;  3LUT B;  3EG9 A;  1ZHX A;  3AGU A;  1MMN A;  5EK0 A;  2R7S A;  2Q3T A;  2VAS A;  1BBH A;  4PJM A;  1LS1 A;  4C7O B;  3HKK A;  2G3K A;  3C7J A;  1ZHY A;  5E33 A;  3VYW A;  5KYW A;  1T6Q A;  3S27 A;  3W4Y A;  2R7V A;  2ZXO A;  3U0C A;  4CJO A;  5KYU B;  3R7C A;  2VCB A;  3NKD A;  1NLX A;  2WVQ A;  4K7B A;  1MND A;  1TWA A;  3F47 A;  1GGQ A;  2B0H A;  1RKE B;  1GS9 A;  2HSB A;  2OJE D;  2Y3D A;  3NMJ A;  4ULW A;  1U89 A;  1HMD A;  2PX3 A;  2H8A A;  2Q9A A;  2XLW A;  3NYM A;  3QZC A;  4QDL A;  3WG7 C;  3DE9 A;  4R32 A;  4H4K C;  3TOM A;  2J9V A;  2D4U A;  2MYS A;  2Y3G A;  3EHM A;  1JRA A;  1JR8 A;  4I44 A;  3ASN C;  4W8K A;  3JZ0 A;  1S7Z A;  1OR3 A;  4RDA A;  3JSE O;  3X1O A;  1EQ1 A;  2XM4 A;  3A9C A;  3NYJ A;  2EPK X;  1E2X A;  1LS4 A;  4H54 A;  4IRU A;  4LDR A;  4XPY A;  1RMV A;  3MYI A;  4J7T A;  3H2V A;  1IZM A;  1OCZ C;  3N0T A;  4MTO A;  4XQ1 A;  3KL4 A;  4FES A;  3RF3 A;  5HV9 A;  1ZW2 A;  4EBJ A;  4E7S A;  3M79 A;  3F46 A;  1H9G A;  4CX9 A;  3POV A;  5BUO A;  1CPQ A;  3DMD A;  1OXB A;  3TD7 A;  2JPU A;  3C8G A;  2J46 A;  3LAY A;  2PF4 E;  4XEK A;  4EBK A;  3MLG A;  2XL4 A;  2EIL C;  2WVN A;  3GOD A;  4GEH A;  4RD9 A;  2LD6 A;  3TOL A;  3B71 A;  2QTV A;  4AX2 A;  2FGY A;  2ZXW C;  1YZC A;  1D1A A;  3B0U X;  1OW7 A;  3ZTM A;  2YWA A;  3L0I A;  4MVR A;  2O9X A;  1AEP A;  2BC5 A;  2YEV A;  3JTL O;  4I1O B;  4LLE A;  4G78 A;  3EFO A;  4M63 A;  1A7V A;  1K05 A;  2G3V A;  1LE4 A;  4QI2 A;  3ECS A;  4AK9 A;  1HMO A;  5EGY A;  4E7Z A;  1LI5 A;  2XS1 A;  3EGD A;  5DVW A;  2IXO A;  1T6U A;  5E3C A;  2EIJ C;  4U9E A;  1U6H A;  4GQH A;  4B6I A;  2BL2 A;  1TWH A;  4AL1 A;  5L0H A;  2GWW A;  3GEE A;  1CGO A;  4HEA J;  2YHS A;  2ICW G;  2R7O A;  4JCH A;  4YT4 A;  3EZH A;  2HS5 A;  1QLE C;  1D1C A;  2M4E A;  2NPU A;  2OKU A;  3AG4 C;  4IJJ A;  2ZPA A;  2HFI A;  2YZS A;  3FHD A;  2EIK C;  2Q00 A;  4EBB A;  5JT4 A;  5BQI A;  2XL6 A;  2UUI A;  2CNW D;  2NG1 A;  2LQG A;  1UFB A;  2Y69 C;  3C62 A;  5T3W A;  4ZLC A;  3AG1 C;  3B9Q A;  1ZU4 A;  2HMQ A;  5AC5 A;  4NCQ A;  2L9J A;  1VMA A;  5T1D B;  3UGO A;  2WL8 A;  2YRF A;  1NG1 A;  5D91 A;  3G4Z A;  1LIH A;  3BRJ A;  2GAQ A;  3JT1 A;  4OD5 A;  3DKA A;  3FAJ A;  3O6X A;  3ZQY A;  3W2V A;  4C3E A;  1M2V B;  5AC4 A;  1ZYR F;  3ATP A;  1YJG A; 
#chains in the Genus database with same CATH homology
 1NBB A;  2XLD A;  3HNK A;  3QVY A;  4CJG A;  4D4X A;  256B A;  2XLE A;  5JSL A;  4WGY A;  1JAF A;  4CDY A;  1M6T A;  1CPR A;  2QLA A;  5JRA A;  3M15 A;  4ULV A;  1GQA A;  2YL0 A;  1BBH A;  2CCY A;  2XLH A;  3QW0 A;  4JEA A;  3C63 A;  4ER9 A;  1E86 A;  4IAR A;  2YL3 A;  2J8W A;  3NMI A;  4CJO A;  4N6H A;  2XM0 A;  3QVZ A;  5JP7 A;  4NC3 A;  3NMJ A;  2XLM A;  2XLW A;  4CDV A;  2YLI A;  3DE9 A;  3NMK A;  3TOM A;  4N4W A;  4CDA A;  3ZTZ A;  5JS5 A;  4D4N A;  2YL1 A;  2XM4 A;  5JLI A;  3HNL A;  4CIP A;  1E83 A;  1LM3 B;  3M4B A;  2YKZ A;  4WGZ A;  3TOL A;  1MQV A;  1EKY A;  1RCP A;  1YYX A;  3M79 A;  4L6R A;  4CX9 A;  4EIY A;  4IB4 A;  1CPQ A;  1APC A;  1QQ3 A;  2YLG A;  3IQ5 A;  1S05 A;  3IQ6 A;  2XLO A;  3HNI A;  3M4C A;  1YZC A;  2YL7 A;  1E84 A;  3ZTM A;  3FOP A;  3U8P A;  2BC5 A;  3FOO A;  4JKV A;  3ZWI A;  1YYJ A;  2J9B A;  1A7V A;  1YZA A;  1CGN A;  1QPU A;  4IAQ A;  3VRC A;  4U9E A;  3QW1 A;  5B3I A;  5JVE A;  1CGO A;  4JEB A;  2YLD A;  4U9D A;  1E85 A;  4JE9 A;  3ZQV A;  5AGF A;  5JT4 A;  2XL6 A;  3DE8 A;  3C62 A;  5JUA A;  3L1M A;  2XLV A;  3HNJ A;  2XL8 A;  3ZQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...