2XLMA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous recombinant native with bound no
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
127
structure length
127
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 50
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xlmA00
3ZWIA 1RCPA 4CDAA 3VRCA 3ZTZA 2YL7A 3IQ5A 4IAQA 4JKVA 4N6HA 4CJOA 2XLEA 1YYXA 4CDVA 3QVYA 2XM4A 2XLWA 5JSLA 5JT4A 1JAFA 3FOOA 1M6TA 2QLAA 4CJGA 2BC5A 2XLVA 2YKZA 4U9DA 1CPQA 3IQ6A 3M4BA 4JEAA 1CPRA 1LM3B 1E85A 1CGOA 3FOPA 2XLMA 2YLDA 1A7VA 1QPUA 2XLOA 1APCA 3DE8A 3ZQVA 3QVZA 4L6RA 256BA 3HNKA 3NMJA 3TOMA 3NMIA 4ER9A 4D4XA 1E83A 3L1MA 5AGFA 4CX9A 1QQ3A 2J8WA 2YL1A 1BBHA 1S05A 2XLHA 4IARA 3HNIA 5JUAA 3U8PA 4N4WA 5JVEA 3HNLA 2XM0A 4IB4A 3C62A 3QW1A 3C63A 4D4NA 4JE9A 5JLIA 5JS5A 3M4CA 1YYJA 4EIYA 2XLDA 3QW0A 2CCYA 2J9BA 3TOLA 1NBBA 1CGNA 1YZCA 3NMKA 1EKYA 1YZAA 3HNJA 3ZTMA 1E86A 4WGYA 5B3IA 1E84A 5JRAA 3M79A 4CDYA 1MQVA 4NC3A 4U9EA 3DE9A 2XL8A 4ULVA 5JP7A 2YL3A 4CIPA 3ZQYA 1GQAA 4WGZA 2YLIA 2YLGA 2XL6A 2YL0A 4JEBA 3M15A
chains in the Genus database with same CATH superfamily
5BUOA 4E18A 1B68A 3E9VA 3ZVRA 3MYFA 4CDAA 4PFOA 4N06A 5BQHA 2OOCA 2LSEA 3IQCA 2X0CA 5A6AA 1I5NA 4PACA 4EBJA 4Q7CA 4AL1A 3V7OA 3JT1A 3J06A 5A6KA 2R25A 2HJMA 3US6A 4F4BA 4M63A 1UFBA 3K1HA 5JSLA 4YT8A 1JAFA 1TR2A 4J7TA 5E2QA 3ZSUA 3K6BA 3AQCA 2IYLD 1XZQA 3U2LA 3UNGC 1M6TA 1LI7A 2AWYA 2M4EA 3JCUQ 1OCCC 1YARO 3HKKA 1TWHA 2M64A 1JPJA 2G3VA 3NYJA 4JIOA 4P9FA 3RFYA 3S9OA 4CJGA 5L3QA 2Q9CA 4YL1A 2XLVA 3NYLA 3RIPA 4U9DA 2ZXPA 1NFNA 4YT4A 3LEVA 3M4BA 5DS4A 2KGOA 3PDMP 1LM3B 1E85A 3NRHA 1L3PA 2GAQA 2XLMA 4RD9A 1C17M 3MYIA 4H4KC 4XQ1A 2KYHA 1VYKA 2CW0F 3JZ0A 3O10A 3SEOA 3W8HA 1A7DA 5A6JA 5EHHA 3FVYA 1LS1A 2A6HF 3C8GB 3NKEA 2L7AA 3JYYA 1J8MF 4EBBA 3POVA 3ABKC 1OXKA 3NMJA 3UR3C 3EG9B 2Y3HA 3QMKA 1NZEA 3VF0A 3L1MA 2XXAB 5AGFA 2NUPB 1FMWA 2J8WA 3O6XA 3RYLA 3ZC4A 2J9WA 3B71A 1WOLA 1TWCA 4G7OF 3K1IC 1ZHTA 1LVKA 4ZLDA 2XLHA 2XRHA 3EGXB 3GORA 4ONSA 3W8IA 4K7BA 4XWJA 2ZPAA 5KYUB 4JTDB 1TFOB 3K33A 1T6QA 4N4WA 4OD5A 2G62A 5JVEA 3HNLA 2XM0A 4PJLA 3SZRA 4IB4A 1T5OA 1VMAA 1A0BA 2X51A 3EZHA 3EJNA 3QW1A 2KNHA 4JE9A 3W2VA 2P6VA 5L3VA 3GM3A 1O87A 4JJFA 1ZU5A 4AE4A 2L6HA 2WVNA 1ST6A 1MMGA 2CCYA 2D4UA 1U89A 2J45A 3K1IA 5BQIA 5D91A 1ZHYA 1YZCA 1RMVA 2L81A 3IEEA 4LDQA 1OR2A 4KI2A 1O3UA 3HTKC 3HNJA 4K0DA 2ZXOA 3R2PA 2CNWD 2XL4A 3DJUB 3VAYA 5B3IA 3B29A 4WJ0A 2IXOA 2R7SA 1JRAA 4LLEA 5E3CA 1EI7A 1VOMA 4JCZA 2R7XA 4J30B 1TKNA 4OIPF 1ZHZA 1WGWA 1OKKA 1M2VA 1YDIA 2IM8A 1YVIA 2QNLA 1KTMA 1RKEA 2YRFA 3QTHA 4G0HA 3BRJA 5COFA 3S29A 4BJ1A 3VYWA 1RJ9A 4E7SA 5JP7A 5A6BA 2ETSA 2AU5A 1AVOB 1G5ZA 3DJNB 2W45A 1I4YA 1OKKD 3EFOB 2R02A 2VCAA 1PD1A 2NUTB 1L7CA 3JYHA 2MHRA 1JR8A 4DJ9A 2H8AA 3IQTA 3V5XA 2CYDA 3G50A 2KK1A 2Q9AA 3RQEA 2A0UA 1QVXA 4DBRA 1QKRA 1D0ZA 3H65A 3AG3C 3OEOA 2KQ9A 1WATA 1O5HA 4FX5A 4JEBA 4O6NA 3GEEA 4CS8C 3TD7A 4MVRA 2HUJA 3ATPA 1XWJA 1HW1A 5E3AA 1RCPA 4MS2A 4OIRF 2VB6A 1JPNA 2R7UA 4N6HA 3IQ5A 4CJOA 2LP4A 1V55C 3AG1C 3DKAA 2XLEA 4PR9A 3T6GB 4CBEA 2XM4A 3LNRA 3M1CB 2IXMA 4XEVA 5FCLA 1FNTc 3S27A 3U5SA 3X2QC 2EILC 2V26A 5KYUA 1Z3IX 2QY9A 1ZW2A 3EPVA 2P61A 3FOOA 3SXKA 2ZXRA 3HJCA 4I3MA 2HSBA 3UMHA 1FMVA 2PX0A 1NU9C 2XSEA 4A2NB 1Z23A 4YL3A 1OW7A 1SF8A 1OCOC 3T9OA 4C3EA 4CS8A 4O6MA 2JPUA 3NG1A 3CAXA 3IQ6A 5L0CA 1M2OA 4J32B 2QTVA 3T6BA 3JRMO 4JEAA 1CPRA 2R9RB 3H2UA 4IJJA 1M57C 4WABA 2RSEB 2EPLX 1MMDA 2H7VC 1FAPB 5DVWA 3IPMO 2YLDA 1A7VA 1QPUA 1KU2A 4KNWA 2NSGA 3SXMA 2PFDA 3JSZA 1FFTC 3S0XA 4MTOA 1APCA 1A41A 2DGJA 4XPWA 5B1AC 4JTCB 3V5ZA 2VCCA 4L6RA 4U5BE 2OEXA 3HNKA 3EH1A 1Q0FA 4I1OB 5DS6A 2P7VA 2OU6A 1KNYA 3QZCA 4JURI 4ER9A 4D4XA 2WB7A 3C8ZA 1BDJB 1LE4A 4CX9A 5AC4A 1WWPA 2WVQA 2B0JA 1LE2A 1H9GA 1NFOA 1D1CA 1Y4CA 2Q9BA 1M2VB 1S05A 3AOUA 3C18A 1RKEB 2WZLA 3ABLC 5E33A 3A11A 1RJ9B 3L34A 3CEXA 4XTKA 5F5FA 3I4UA 3EFOA 3SXZA 3MFNA 4QDLA 3FAJA 1MNDA 4BJTA 2P0NA 3NKDA 2NUTA 3WAQA 1NU7D 3C63A 1NG1A 3SP1A 2LFFA 1T6UA 2EINC 2OKUA 1LPEA 5TJ5E 3G4ZA 1YJGA 3Q6MA 4U5DE 3S84A 3CQZA 1E2XA 2EPMX 1YYJA 3LLKA 3UMKA 4C3DA 3I5QA 1RKCA 3TOLA 1CGNA 3EH2A 3RVZA 3L8JA 3UGPA 3GEHA 4LACB 4LERA 4BEJA 3U8VA 1ORSC 4JCHA 4R32A 4MTFA 3DAGA 2YVKA 2R7QA 2EPOA 4DBQA 3EHMA 1SYQA 1WASA 3PHF2 2D5RB 3KKBA 2Q7RA 4MNDA 5K0IA 4BPMA 4WGYA 4JTAB 1E84A 1T6IA 2VASA 4MVMA 4MVZA 4BJ6C 5AC5A 1V4AA 2MYSA 4PJJA 2TMVP 4W8PA 1VLSA 2W9YA 1HE9A 3LESA 4NC3A 3X1OA 4CDYA 1MMAA 4DRJB 3RQGA 1G4WR 5GPGB 3S28A 3SYNA 1FTSA 1G8XA 4Z9IA 4U9EA 5L0JA 2UUIA 2XL8A 4HE8D 2F22A 2A0BA 2FFHA 4X0RA 3F47A 4U5FE 2KC3A 4OIQF 2A68F 3U9MA 5DS5A 4NY3A 1VYIA 1K05A 1JOGA 4YL0A 2CNWA 1Q0GA 5COMA 1EQ1A 2AVKA 3LUTB 1PD0A 1MNEA 3ZG1A 2FAPB 2ICWG 5L0HA 2E87A 1GQAA 1XZPA 3RW0A 3MX3A 4BJ6A 4QI2A 1S7ZA 3B0UX 1JMWA 2LFDA 3UMIA 1SZIA 4KNVA 4ZLCA 3PMRA 2L9JA 4QI0A 2GA0A 3EQLF 1Z6AA 3W4YA 2JD3A 5KYNA 3ZTZA 4IAQA 1TQGA 3LNMB 1Y6DA 5KYXB 3KYJA 4I1MA 4W8KA 4Z9HA 4CDVA 4Q5SF 2XLWA 4JZAA 4BG0A 1ORJA 2PBEA 1G4US 1W2WA 4Z9JA 2VH3A 3L0IA 5JT4A 4UDVA 1VK5A 3SXYA 4OINF 2PNOA 1HY5A 1Q0MA 2R03A 3T4RA 2R7WA 4AL0A 2L6GA 4E7ZA 2BC5A 4HEAJ 2GDCA 2YKZA 4K1OA 4MTGA 4DXWA 1CPQA 4BJ5C 2VCBA 3EHNA 4XLNF 2RD9A 1A7EA 2J7PD 4CIHA 2ZXWC 1CGOA 4U5EE 4P9TA 1U6HA 4JC7A 3S90A 1PV3A 2XLOA 4DRIB 4OIOF 2IXPA 1CGME 2HMZA 4DOZA 3DE8A 3CSKA 4ULWA 1OR3A 4CSAA 2HJ3A 4I44A 3QVZA 4JVSA 2DYRC 3WODF 2YHSA 3KMIA 3NMIA 2J9UA 1OW6A 1E83A 2WVOA 1DOVA 2BE5F 2J9VA 2YL1A 3ASNC 4BJ5A 4DRHB 1M56C 5L0IA 4NTBA 3LAYA 1HMOA 2BL2A 1BBHA 4MQ9F 3NDBB 4N6CA 3RQFA 4LDKA 4LDRA 5B1BC 2A69F 3HNIA 3LS1A 4E17A 5JUAA 1BR4A 2HV6A 2C04A 2EPNA 1D1AA 2W4BA 3T6JA 5HSWA 2EIJC 3RKOF 2Y69C 3U3BA 4GYTA 4DVZA 4U5GA 5COGA 4RBNA 3JRTA 1R4TA 5JLIA 2P1AA 2IXNA 5JS5A 5F28E 3DD7A 1ZHXA 2H7OA 1T01A 2AWCA 3AQBA 3GM2A 3LS0A 4NTAA 2J9BA 1WTYA 3RVYA 2R7VA 2Y3GA 3TJ5A 3FAPB 2KJGA 2MWQA 1Z7Qc 1N1CA 4G7ZF 3DMDA 5A69A 3GODA 5KYXA 1LKXA 2YWAA 3KPHA 3NYMA 1C03A 3ITFA 2HSQA 3EZIA 5DQTA 1E86A 3WHNA 2GWWA 5JRAA 5L0DA 3ECSA 5T1DB 3B9QA 2R7RA 1MQVA 2YQYA 2ASRA 4CS7A 1MMNA 1OQCA 2R7OA 1YAUO 3GEIA 3EGDA 3SNHA 3V5YA 3FDQA 1V74B 2KSFA 3F46A 3L8IA 4ULVA 5EGYA 3DWWA 1U0BB 4B6IA 1T9KA 2R7TA 4AX2A 3G4XA 2HS5A 2DB4A 4O79A 1WN0A 2A6EF 3N0TA 4G78A 1SMYF 2IBFA 2Y3DA 3B0PA 1F1MA 3ZQYA 3CZ6A 2OJED 2A1DD 3LLIA 3ZDLA 3GANA 4IGGA 4OD4A 1GS9A 4FESA 4WGZA 2W4MA 5DLJA 2YLIA 5KYYA 3LEOA 3W2WA 4YT2A 2XS1A 2YL0A 1Z5ZA 1YA7O 4EWCA 1QLEC 2OG2A 2H7BA 2PP4A 4ANJA 3ZWIA 4XPYA 1TWGA 4IAOA 3VRCA 2NSFA 3N2ZB 2YL7A 4JKVA 2OQMA 3FXHA 4IWBA 4C7OA 1YYXA 4EKWA 1ZZPA 4A4AA 1ZU4A 3RF3A 3QVYA 2GFHA 1RXQA 2DYSC 4GEHA 4MW8A 1ORYA 4NQFA 4U5CE 5IY5C 1H6GA 5L0FA 3DZAA 2LCHA 1ZW3A 2I8BA 3MBGA 4YJWA 4MVUA 3AG4C 5B3SC 3N24A 2QLAA 4RDAA 2KW3C 3AJMA 3AGTA 2CGEA 4O6YA 3AG2C 2Y3BA 3TK0A 3LJBA 1OXBA 3DI5A 3KH2A 2C03A 4EUKB 5T3WA 2NG1A 4HFKB 5T3TA 3BEHA 5HV9A 1TFKB 1AUEA 1LIHA 2LQGA 2O9XA 3FOPA 3OA1A 1VTMP 3Q7LA 2CDQA 4FWVA 3VM6A 2J0WA 4JW1A 4C3BA 3FHDA 3ZQVA 5KYWB 1DOWA 1QSPA 1OCZC 2WL8A 5F5HA 1V54C 2OJQA 4BEMJ 3TULA 256BA 2Q3TA 4XEKA 4MW3A 3KYIA 3TOMA 3HLZA 1NLXA 4U5HA 4CSAC 4YN0B 1YA9A 2J0XA 1QQ3A 4EHPA 5DQZA 2Q00A 1H7IA 2J7PA 2Y39A 1J8YF 3RH3A 4JRZA 4MVQA 4EBKA 3UGOA 2WZGA 1VB5A 4MVSA 3PCVA 3EGDB 3DM5A 1D0YA 2L6FA 1HE1A 1IZMA 1D0XA 4IARA 1Q0DA 2OEVA 1H9TA 2XXAA 2UUHA 3DAFA 3U8PA 2HMQA 2G3KA 4YWQA 1QZXA 4H54A 3IHUA 2LD6A 3DXJF 1Q0KA 4XEFA 3C62A 3U2MA 4PJNA 4D4NA 1BR2A 1FFHA 3Q6NA 2QE9A 1EA8A 2HKVA 2NPUA 1LI5A 4LLCA 2FGYA 1ZVZA 1ZHWA 4O7GA 1BR1A 4IRUA 2HFIA 1GM5A 3M4CA 4EIYA 4NTFA 2JX0A 2V3CC 5KYYB 2AP3A 2XLDA 3QW0A 3R7CA 4AK9A 4FAPB 1NSGB 3C7JA 4PK4A 1AEPA 1NBBA 1ZYRF 2YEVA 3E70C 3O39A 4HFFB 1C02A 2HZ8A 2OCCC 4XPXA 5L0GA 1Z63A 1GGQA 3WG7C 1HW2A 3JTLO 3C8GA 3NMKA 2WZFA 1I4ZA 1OW8A 3AGUA 1PCXA 2LK4A 3I5PA 4E0HA 5A6BD 1EKYA 1YZAA 4C7OB 4E0IA 2ZD9A 4XLPF 3OWTA 3FMSA 2LIGA 3EG9A 4NCQA 3ZTMA 2YZSA 4KC9A 3O55A 4CS9C 3Q7GA 2NUPA 3C8GD 1TWAA 2PX3A 1SR2A 3ABMC 4Q4ZF 1IW7F 3TQOA 1HMDA 2I15A 3A9CA 3M79A 2Z15A 3JSEO 3U3FA 3TJ6A 2VC9A 3U0CA 3KL4A 5CI9A 1OCRC 3EGXA 3U9JA 1R5ID 1K04A 5FZTA 2EIKC 3DE9A 3GM1A 3K7DA 3ZIBA 3MLGA 5CIVA 3H2VA 3GWNA 2PF4E 2EPKX 2QUPA 4JJGA 5BQGA 2J46A 2YL3A 4PFPA 4MVOA 2DI3A 2IOQA 2EIMC 2HV7A 5CI8A 1YLMA 5EK0A 1BZ4A 4YT5A 4CIPA 1VLTA 3DM9B 2B0HA 4KBLA 4PJMA 3K66A 4GQHA 1LS4A 4G7HF 3B0VC 5KYWA 4P6IC 2R05A 3GWLA 4CS9A 1FR0A 4J7YA 3ASOC 4YK5A 2YLGA 4DVYP 5D92A 4AE4B 2XL6A 2Q4FA 1D1BA 1K40A 2XS8A 1UG7A 3M15A
chains in the Genus database with same CATH topology
3ZWIA 1RCPA 4CDAA 3VRCA 3ZTZA 2YL7A 3IQ5A 4IAQA 4JKVA 4N6HA 4CJOA 2XLEA 1YYXA 4CDVA 3QVYA 2XM4A 2XLWA 5JSLA 5JT4A 1JAFA 3FOOA 1M6TA 2QLAA 4CJGA 2BC5A 2XLVA 2YKZA 4U9DA 1CPQA 3IQ6A 3M4BA 4JEAA 1CPRA 1LM3B 1E85A 1CGOA 3FOPA 2XLMA 2YLDA 1A7VA 1QPUA 2XLOA 1APCA 3DE8A 3ZQVA 3QVZA 4L6RA 256BA 3HNKA 3NMJA 3TOMA 3NMIA 4ER9A 4D4XA 1E83A 3L1MA 5AGFA 4CX9A 1QQ3A 2J8WA 2YL1A 1BBHA 1S05A 2XLHA 4IARA 3HNIA 5JUAA 3U8PA 4N4WA 5JVEA 3HNLA 2XM0A 4IB4A 3C62A 3QW1A 3C63A 4D4NA 4JE9A 5JLIA 5JS5A 3M4CA 1YYJA 4EIYA 2XLDA 3QW0A 2CCYA 2J9BA 3TOLA 1NBBA 1CGNA 1YZCA 3NMKA 1EKYA 1YZAA 3HNJA 3ZTMA 1E86A 4WGYA 5B3IA 1E84A 5JRAA 3M79A 4CDYA 1MQVA 4NC3A 4U9EA 3DE9A 2XL8A 4ULVA 5JP7A 2YL3A 4CIPA 3ZQYA 1GQAA 4WGZA 2YLIA 2YLGA 2XL6A 2YL0A 4JEBA 3M15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZWI A;  1RCP A;  4CDA A;  3VRC A;  3ZTZ A;  2YL7 A;  3IQ5 A;  4IAQ A;  4JKV A;  4N6H A;  4CJO A;  2XLE A;  1YYX A;  4CDV A;  3QVY A;  2XM4 A;  2XLW A;  5JSL A;  5JT4 A;  1JAF A;  3FOO A;  1M6T A;  2QLA A;  4CJG A;  2BC5 A;  2XLV A;  2YKZ A;  4U9D A;  1CPQ A;  3IQ6 A;  3M4B A;  4JEA A;  1CPR A;  1LM3 B;  1E85 A;  1CGO A;  3FOP A;  2XLM A;  2YLD A;  1A7V A;  1QPU A;  2XLO A;  1APC A;  3DE8 A;  3ZQV A;  3QVZ A;  4L6R A;  256B A;  3HNK A;  3NMJ A;  3TOM A;  3NMI A;  4ER9 A;  4D4X A;  1E83 A;  3L1M A;  5AGF A;  4CX9 A;  1QQ3 A;  2J8W A;  2YL1 A;  1BBH A;  1S05 A;  2XLH A;  4IAR A;  3HNI A;  5JUA A;  3U8P A;  4N4W A;  5JVE A;  3HNL A;  2XM0 A;  4IB4 A;  3C62 A;  3QW1 A;  3C63 A;  4D4N A;  4JE9 A;  5JLI A;  5JS5 A;  3M4C A;  1YYJ A;  4EIY A;  2XLD A;  3QW0 A;  2CCY A;  2J9B A;  3TOL A;  1NBB A;  1CGN A;  1YZC A;  3NMK A;  1EKY A;  1YZA A;  3HNJ A;  3ZTM A;  1E86 A;  4WGY A;  5B3I A;  1E84 A;  5JRA A;  3M79 A;  4CDY A;  1MQV A;  4NC3 A;  4U9E A;  3DE9 A;  2XL8 A;  4ULV A;  5JP7 A;  2YL3 A;  4CIP A;  3ZQY A;  1GQA A;  4WGZ A;  2YLI A;  2YLG A;  2XL6 A;  2YL0 A;  4JEB A;  3M15 A; 
#chains in the Genus database with same CATH topology
 5BUO A;  4E18 A;  1B68 A;  3E9V A;  3ZVR A;  3MYF A;  4CDA A;  4PFO A;  4N06 A;  5BQH A;  2OOC A;  2LSE A;  3IQC A;  2X0C A;  5A6A A;  1I5N A;  4PAC A;  4EBJ A;  4Q7C A;  4AL1 A;  3V7O A;  3JT1 A;  3J06 A;  5A6K A;  2R25 A;  2HJM A;  3US6 A;  4F4B A;  4M63 A;  1UFB A;  3K1H A;  5JSL A;  4YT8 A;  1JAF A;  1TR2 A;  4J7T A;  5E2Q A;  3ZSU A;  3K6B A;  3AQC A;  2IYL D;  1XZQ A;  3U2L A;  3UNG C;  1M6T A;  1LI7 A;  2AWY A;  2M4E A;  3JCU Q;  1OCC C;  1YAR O;  3HKK A;  1TWH A;  2M64 A;  1JPJ A;  2G3V A;  3NYJ A;  4JIO A;  4P9F A;  3RFY A;  3S9O A;  4CJG A;  5L3Q A;  2Q9C A;  4YL1 A;  2XLV A;  3NYL A;  3RIP A;  4U9D A;  2ZXP A;  1NFN A;  4YT4 A;  3LEV A;  3M4B A;  5DS4 A;  2KGO A;  3PDM P;  1LM3 B;  1E85 A;  3NRH A;  1L3P A;  2GAQ A;  2XLM A;  4RD9 A;  1C17 M;  3MYI A;  4H4K C;  4XQ1 A;  2KYH A;  1VYK A;  2CW0 F;  3JZ0 A;  3O10 A;  3SEO A;  3W8H A;  1A7D A;  5A6J A;  5EHH A;  3FVY A;  1LS1 A;  2A6H F;  3C8G B;  3NKE A;  2L7A A;  3JYY A;  1J8M F;  4EBB A;  3POV A;  3ABK C;  1OXK A;  3NMJ A;  3UR3 C;  3EG9 B;  2Y3H A;  3QMK A;  1NZE A;  3VF0 A;  3L1M A;  2XXA B;  5AGF A;  2NUP B;  1FMW A;  2J8W A;  3O6X A;  3RYL A;  3ZC4 A;  2J9W A;  3B71 A;  1WOL A;  1TWC A;  4G7O F;  3K1I C;  1ZHT A;  1LVK A;  4ZLD A;  2XLH A;  2XRH A;  3EGX B;  3GOR A;  4ONS A;  3W8I A;  4K7B A;  4XWJ A;  2ZPA A;  5KYU B;  4JTD B;  1TFO B;  3K33 A;  1T6Q A;  4N4W A;  4OD5 A;  2G62 A;  5JVE A;  3HNL A;  2XM0 A;  4PJL A;  3SZR A;  4IB4 A;  1T5O A;  1VMA A;  1A0B A;  2X51 A;  3EZH A;  3EJN A;  3QW1 A;  2KNH A;  4JE9 A;  3W2V A;  2P6V A;  5L3V A;  3GM3 A;  1O87 A;  4JJF A;  1ZU5 A;  4AE4 A;  2L6H A;  2WVN A;  1ST6 A;  1MMG A;  2CCY A;  2D4U A;  1U89 A;  2J45 A;  3K1I A;  5BQI A;  5D91 A;  1ZHY A;  1YZC A;  1RMV A;  2L81 A;  3IEE A;  4LDQ A;  1OR2 A;  4KI2 A;  1O3U A;  3HTK C;  3HNJ A;  4K0D A;  2ZXO A;  3R2P A;  2CNW D;  2XL4 A;  3DJU B;  3VAY A;  5B3I A;  3B29 A;  4WJ0 A;  2IXO A;  2R7S A;  1JRA A;  4LLE A;  5E3C A;  1EI7 A;  1VOM A;  4JCZ A;  2R7X A;  4J30 B;  1TKN A;  4OIP F;  1ZHZ A;  1WGW A;  1OKK A;  1M2V A;  1YDI A;  2IM8 A;  1YVI A;  2QNL A;  1KTM A;  1RKE A;  2YRF A;  3QTH A;  4G0H A;  3BRJ A;  5COF A;  3S29 A;  4BJ1 A;  3VYW A;  1RJ9 A;  4E7S A;  5JP7 A;  5A6B A;  2ETS A;  2AU5 A;  1AVO B;  1G5Z A;  3DJN B;  2W45 A;  1I4Y A;  1OKK D;  3EFO B;  2R02 A;  2VCA A;  1PD1 A;  2NUT B;  1L7C A;  3JYH A;  2MHR A;  1JR8 A;  4DJ9 A;  2H8A A;  3IQT A;  3V5X A;  2CYD A;  3G50 A;  2KK1 A;  2Q9A A;  3RQE A;  2A0U A;  1QVX A;  4DBR A;  1QKR A;  1D0Z A;  3H65 A;  3AG3 C;  3OEO A;  2KQ9 A;  1WAT A;  1O5H A;  4FX5 A;  4JEB A;  4O6N A;  3GEE A;  4CS8 C;  3TD7 A;  4MVR A;  2HUJ A;  3ATP A;  1XWJ A;  1HW1 A;  5E3A A;  1RCP A;  4MS2 A;  4OIR F;  2VB6 A;  1JPN A;  2R7U A;  4N6H A;  3IQ5 A;  4CJO A;  2LP4 A;  1V55 C;  3AG1 C;  3DKA A;  2XLE A;  4PR9 A;  3T6G B;  4CBE A;  2XM4 A;  3LNR A;  3M1C B;  2IXM A;  4XEV A;  5FCL A;  1FNT c;  3S27 A;  3U5S A;  3X2Q C;  2EIL C;  2V26 A;  5KYU A;  1Z3I X;  2QY9 A;  1ZW2 A;  3EPV A;  2P61 A;  3FOO A;  3SXK A;  2ZXR A;  3HJC A;  4I3M A;  2HSB A;  3UMH A;  1FMV A;  2PX0 A;  1NU9 C;  2XSE A;  4A2N B;  1Z23 A;  4YL3 A;  1OW7 A;  1SF8 A;  1OCO C;  3T9O A;  4C3E A;  4CS8 A;  4O6M A;  2JPU A;  3NG1 A;  3CAX A;  3IQ6 A;  5L0C A;  1M2O A;  4J32 B;  2QTV A;  3T6B A;  3JRM O;  4JEA A;  1CPR A;  2R9R B;  3H2U A;  4IJJ A;  1M57 C;  4WAB A;  2RSE B;  2EPL X;  1MMD A;  2H7V C;  1FAP B;  5DVW A;  3IPM O;  2YLD A;  1A7V A;  1QPU A;  1KU2 A;  4KNW A;  2NSG A;  3SXM A;  2PFD A;  3JSZ A;  1FFT C;  3S0X A;  4MTO A;  1APC A;  1A41 A;  2DGJ A;  4XPW A;  5B1A C;  4JTC B;  3V5Z A;  2VCC A;  4L6R A;  4U5B E;  2OEX A;  3HNK A;  3EH1 A;  1Q0F A;  4I1O B;  5DS6 A;  2P7V A;  2OU6 A;  1KNY A;  3QZC A;  4JUR I;  4ER9 A;  4D4X A;  2WB7 A;  3C8Z A;  1BDJ B;  1LE4 A;  4CX9 A;  5AC4 A;  1WWP A;  2WVQ A;  2B0J A;  1LE2 A;  1H9G A;  1NFO A;  1D1C A;  1Y4C A;  2Q9B A;  1M2V B;  1S05 A;  3AOU A;  3C18 A;  1RKE B;  2WZL A;  3ABL C;  5E33 A;  3A11 A;  1RJ9 B;  3L34 A;  3CEX A;  4XTK A;  5F5F A;  3I4U A;  3EFO A;  3SXZ A;  3MFN A;  4QDL A;  3FAJ A;  1MND A;  4BJT A;  2P0N A;  3NKD A;  2NUT A;  3WAQ A;  1NU7 D;  3C63 A;  1NG1 A;  3SP1 A;  2LFF A;  1T6U A;  2EIN C;  2OKU A;  1LPE A;  5TJ5 E;  3G4Z A;  1YJG A;  3Q6M A;  4U5D E;  3S84 A;  3CQZ A;  1E2X A;  2EPM X;  1YYJ A;  3LLK A;  3UMK A;  4C3D A;  3I5Q A;  1RKC A;  3TOL A;  1CGN A;  3EH2 A;  3RVZ A;  3L8J A;  3UGP A;  3GEH A;  4LAC B;  4LER A;  4BEJ A;  3U8V A;  1ORS C;  4JCH A;  4R32 A;  4MTF A;  3DAG A;  2YVK A;  2R7Q A;  2EPO A;  4DBQ A;  3EHM A;  1SYQ A;  1WAS A;  3PHF 2;  2D5R B;  3KKB A;  2Q7R A;  4MND A;  5K0I A;  4BPM A;  4WGY A;  4JTA B;  1E84 A;  1T6I A;  2VAS A;  4MVM A;  4MVZ A;  4BJ6 C;  5AC5 A;  1V4A A;  2MYS A;  4PJJ A;  2TMV P;  4W8P A;  1VLS A;  2W9Y A;  1HE9 A;  3LES A;  4NC3 A;  3X1O A;  4CDY A;  1MMA A;  4DRJ B;  3RQG A;  1G4W R;  5GPG B;  3S28 A;  3SYN A;  1FTS A;  1G8X A;  4Z9I A;  4U9E A;  5L0J A;  2UUI A;  2XL8 A;  4HE8 D;  2F22 A;  2A0B A;  2FFH A;  4X0R A;  3F47 A;  4U5F E;  2KC3 A;  4OIQ F;  2A68 F;  3U9M A;  5DS5 A;  4NY3 A;  1VYI A;  1K05 A;  1JOG A;  4YL0 A;  2CNW A;  1Q0G A;  5COM A;  1EQ1 A;  2AVK A;  3LUT B;  1PD0 A;  1MNE A;  3ZG1 A;  2FAP B;  2ICW G;  5L0H A;  2E87 A;  1GQA A;  1XZP A;  3RW0 A;  3MX3 A;  4BJ6 A;  4QI2 A;  1S7Z A;  3B0U X;  1JMW A;  2LFD A;  3UMI A;  1SZI A;  4KNV A;  4ZLC A;  3PMR A;  2L9J A;  4QI0 A;  2GA0 A;  3EQL F;  1Z6A A;  3W4Y A;  2JD3 A;  5KYN A;  3ZTZ A;  4IAQ A;  1TQG A;  3LNM B;  1Y6D A;  5KYX B;  3KYJ A;  4I1M A;  4W8K A;  4Z9H A;  4CDV A;  4Q5S F;  2XLW A;  4JZA A;  4BG0 A;  1ORJ A;  2PBE A;  1G4U S;  1W2W A;  4Z9J A;  2VH3 A;  3L0I A;  5JT4 A;  4UDV A;  1VK5 A;  3SXY A;  4OIN F;  2PNO A;  1HY5 A;  1Q0M A;  2R03 A;  3T4R A;  2R7W A;  4AL0 A;  2L6G A;  4E7Z A;  2BC5 A;  4HEA J;  2GDC A;  2YKZ A;  4K1O A;  4MTG A;  4DXW A;  1CPQ A;  4BJ5 C;  2VCB A;  3EHN A;  4XLN F;  2RD9 A;  1A7E A;  2J7P D;  4CIH A;  2ZXW C;  1CGO A;  4U5E E;  4P9T A;  1U6H A;  4JC7 A;  3S90 A;  1PV3 A;  2XLO A;  4DRI B;  4OIO F;  2IXP A;  1CGM E;  2HMZ A;  4DOZ A;  3DE8 A;  3CSK A;  4ULW A;  1OR3 A;  4CSA A;  2HJ3 A;  4I44 A;  3QVZ A;  4JVS A;  2DYR C;  3WOD F;  2YHS A;  3KMI A;  3NMI A;  2J9U A;  1OW6 A;  1E83 A;  2WVO A;  1DOV A;  2BE5 F;  2J9V A;  2YL1 A;  3ASN C;  4BJ5 A;  4DRH B;  1M56 C;  5L0I A;  4NTB A;  3LAY A;  1HMO A;  2BL2 A;  1BBH A;  4MQ9 F;  3NDB B;  4N6C A;  3RQF A;  4LDK A;  4LDR A;  5B1B C;  2A69 F;  3HNI A;  3LS1 A;  4E17 A;  5JUA A;  1BR4 A;  2HV6 A;  2C04 A;  2EPN A;  1D1A A;  2W4B A;  3T6J A;  5HSW A;  2EIJ C;  3RKO F;  2Y69 C;  3U3B A;  4GYT A;  4DVZ A;  4U5G A;  5COG A;  4RBN A;  3JRT A;  1R4T A;  5JLI A;  2P1A A;  2IXN A;  5JS5 A;  5F28 E;  3DD7 A;  1ZHX A;  2H7O A;  1T01 A;  2AWC A;  3AQB A;  3GM2 A;  3LS0 A;  4NTA A;  2J9B A;  1WTY A;  3RVY A;  2R7V A;  2Y3G A;  3TJ5 A;  3FAP B;  2KJG A;  2MWQ A;  1Z7Q c;  1N1C A;  4G7Z F;  3DMD A;  5A69 A;  3GOD A;  5KYX A;  1LKX A;  2YWA A;  3KPH A;  3NYM A;  1C03 A;  3ITF A;  2HSQ A;  3EZI A;  5DQT A;  1E86 A;  3WHN A;  2GWW A;  5JRA A;  5L0D A;  3ECS A;  5T1D B;  3B9Q A;  2R7R A;  1MQV A;  2YQY A;  2ASR A;  4CS7 A;  1MMN A;  1OQC A;  2R7O A;  1YAU O;  3GEI A;  3EGD A;  3SNH A;  3V5Y A;  3FDQ A;  1V74 B;  2KSF A;  3F46 A;  3L8I A;  4ULV A;  5EGY A;  3DWW A;  1U0B B;  4B6I A;  1T9K A;  2R7T A;  4AX2 A;  3G4X A;  2HS5 A;  2DB4 A;  4O79 A;  1WN0 A;  2A6E F;  3N0T A;  4G78 A;  1SMY F;  2IBF A;  2Y3D A;  3B0P A;  1F1M A;  3ZQY A;  3CZ6 A;  2OJE D;  2A1D D;  3LLI A;  3ZDL A;  3GAN A;  4IGG A;  4OD4 A;  1GS9 A;  4FES A;  4WGZ A;  2W4M A;  5DLJ A;  2YLI A;  5KYY A;  3LEO A;  3W2W A;  4YT2 A;  2XS1 A;  2YL0 A;  1Z5Z A;  1YA7 O;  4EWC A;  1QLE C;  2OG2 A;  2H7B A;  2PP4 A;  4ANJ A;  3ZWI A;  4XPY A;  1TWG A;  4IAO A;  3VRC A;  2NSF A;  3N2Z B;  2YL7 A;  4JKV A;  2OQM A;  3FXH A;  4IWB A;  4C7O A;  1YYX A;  4EKW A;  1ZZP A;  4A4A A;  1ZU4 A;  3RF3 A;  3QVY A;  2GFH A;  1RXQ A;  2DYS C;  4GEH A;  4MW8 A;  1ORY A;  4NQF A;  4U5C E;  5IY5 C;  1H6G A;  5L0F A;  3DZA A;  2LCH A;  1ZW3 A;  2I8B A;  3MBG A;  4YJW A;  4MVU A;  3AG4 C;  5B3S C;  3N24 A;  2QLA A;  4RDA A;  2KW3 C;  3AJM A;  3AGT A;  2CGE A;  4O6Y A;  3AG2 C;  2Y3B A;  3TK0 A;  3LJB A;  1OXB A;  3DI5 A;  3KH2 A;  2C03 A;  4EUK B;  5T3W A;  2NG1 A;  4HFK B;  5T3T A;  3BEH A;  5HV9 A;  1TFK B;  1AUE A;  1LIH A;  2LQG A;  2O9X A;  3FOP A;  3OA1 A;  1VTM P;  3Q7L A;  2CDQ A;  4FWV A;  3VM6 A;  2J0W A;  4JW1 A;  4C3B A;  3FHD A;  3ZQV A;  5KYW B;  1DOW A;  1QSP A;  1OCZ C;  2WL8 A;  5F5H A;  1V54 C;  2OJQ A;  4BEM J;  3TUL A;  256B A;  2Q3T A;  4XEK A;  4MW3 A;  3KYI A;  3TOM A;  3HLZ A;  1NLX A;  4U5H A;  4CSA C;  4YN0 B;  1YA9 A;  2J0X A;  1QQ3 A;  4EHP A;  5DQZ A;  2Q00 A;  1H7I A;  2J7P A;  2Y39 A;  1J8Y F;  3RH3 A;  4JRZ A;  4MVQ A;  4EBK A;  3UGO A;  2WZG A;  1VB5 A;  4MVS A;  3PCV A;  3EGD B;  3DM5 A;  1D0Y A;  2L6F A;  1HE1 A;  1IZM A;  1D0X A;  4IAR A;  1Q0D A;  2OEV A;  1H9T A;  2XXA A;  2UUH A;  3DAF A;  3U8P A;  2HMQ A;  2G3K A;  4YWQ A;  1QZX A;  4H54 A;  3IHU A;  2LD6 A;  3DXJ F;  1Q0K A;  4XEF A;  3C62 A;  3U2M A;  4PJN A;  4D4N A;  1BR2 A;  1FFH A;  3Q6N A;  2QE9 A;  1EA8 A;  2HKV A;  2NPU A;  1LI5 A;  4LLC A;  2FGY A;  1ZVZ A;  1ZHW A;  4O7G A;  1BR1 A;  4IRU A;  2HFI A;  1GM5 A;  3M4C A;  4EIY A;  4NTF A;  2JX0 A;  2V3C C;  5KYY B;  2AP3 A;  2XLD A;  3QW0 A;  3R7C A;  4AK9 A;  4FAP B;  1NSG B;  3C7J A;  4PK4 A;  1AEP A;  1NBB A;  1ZYR F;  2YEV A;  3E70 C;  3O39 A;  4HFF B;  1C02 A;  2HZ8 A;  2OCC C;  4XPX A;  5L0G A;  1Z63 A;  1GGQ A;  3WG7 C;  1HW2 A;  3JTL O;  3C8G A;  3NMK A;  2WZF A;  1I4Z A;  1OW8 A;  3AGU A;  1PCX A;  2LK4 A;  3I5P A;  4E0H A;  5A6B D;  1EKY A;  1YZA A;  4C7O B;  4E0I A;  2ZD9 A;  4XLP F;  3OWT A;  3FMS A;  2LIG A;  3EG9 A;  4NCQ A;  3ZTM A;  2YZS A;  4KC9 A;  3O55 A;  4CS9 C;  3Q7G A;  2NUP A;  3C8G D;  1TWA A;  2PX3 A;  1SR2 A;  3ABM C;  4Q4Z F;  1IW7 F;  3TQO A;  1HMD A;  2I15 A;  3A9C A;  3M79 A;  2Z15 A;  3JSE O;  3U3F A;  3TJ6 A;  2VC9 A;  3U0C A;  3KL4 A;  5CI9 A;  1OCR C;  3EGX A;  3U9J A;  1R5I D;  1K04 A;  5FZT A;  2EIK C;  3DE9 A;  3GM1 A;  3K7D A;  3ZIB A;  3MLG A;  5CIV A;  3H2V A;  3GWN A;  2PF4 E;  2EPK X;  2QUP A;  4JJG A;  5BQG A;  2J46 A;  2YL3 A;  4PFP A;  4MVO A;  2DI3 A;  2IOQ A;  2EIM C;  2HV7 A;  5CI8 A;  1YLM A;  5EK0 A;  1BZ4 A;  4YT5 A;  4CIP A;  1VLT A;  3DM9 B;  2B0H A;  4KBL A;  4PJM A;  3K66 A;  4GQH A;  1LS4 A;  4G7H F;  3B0V C;  5KYW A;  4P6I C;  2R05 A;  3GWL A;  4CS9 A;  1FR0 A;  4J7Y A;  3ASO C;  4YK5 A;  2YLG A;  4DVY P;  5D92 A;  4AE4 B;  2XL6 A;  2Q4F A;  1D1B A;  1K40 A;  2XS8 A;  1UG7 A;  3M15 A; 
#chains in the Genus database with same CATH homology
 3ZWI A;  1RCP A;  4CDA A;  3VRC A;  3ZTZ A;  2YL7 A;  3IQ5 A;  4IAQ A;  4JKV A;  4N6H A;  4CJO A;  2XLE A;  1YYX A;  4CDV A;  3QVY A;  2XM4 A;  2XLW A;  5JSL A;  5JT4 A;  1JAF A;  3FOO A;  1M6T A;  2QLA A;  4CJG A;  2BC5 A;  2XLV A;  2YKZ A;  4U9D A;  1CPQ A;  3IQ6 A;  3M4B A;  4JEA A;  1CPR A;  1LM3 B;  1E85 A;  1CGO A;  3FOP A;  2XLM A;  2YLD A;  1A7V A;  1QPU A;  2XLO A;  1APC A;  3DE8 A;  3ZQV A;  3QVZ A;  4L6R A;  256B A;  3HNK A;  3NMJ A;  3TOM A;  3NMI A;  4ER9 A;  4D4X A;  1E83 A;  3L1M A;  5AGF A;  4CX9 A;  1QQ3 A;  2J8W A;  2YL1 A;  1BBH A;  1S05 A;  2XLH A;  4IAR A;  3HNI A;  5JUA A;  3U8P A;  4N4W A;  5JVE A;  3HNL A;  2XM0 A;  4IB4 A;  3C62 A;  3QW1 A;  3C63 A;  4D4N A;  4JE9 A;  5JLI A;  5JS5 A;  3M4C A;  1YYJ A;  4EIY A;  2XLD A;  3QW0 A;  2CCY A;  2J9B A;  3TOL A;  1NBB A;  1CGN A;  1YZC A;  3NMK A;  1EKY A;  1YZA A;  3HNJ A;  3ZTM A;  1E86 A;  4WGY A;  5B3I A;  1E84 A;  5JRA A;  3M79 A;  4CDY A;  1MQV A;  4NC3 A;  4U9E A;  3DE9 A;  2XL8 A;  4ULV A;  5JP7 A;  2YL3 A;  4CIP A;  3ZQY A;  1GQA A;  4WGZ A;  2YLI A;  2YLG A;  2XL6 A;  2YL0 A;  4JEB A;  3M15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...