2XLMA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous recombinant native with bound no
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
127
structure length
127
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
molecule tags Electron transport
source organism Achromobacter xylosoxidans
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
total genus 50
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xlmA00
3HNLA 5JVEA 1YZAA 4CJOA 3IQ5A 1LM3B 3DE8A 1E84A 5B3IA 2XL6A 4JEBA 5JSLA 3TOLA 5AGFA 3L1MA 2YL0A 3QVYA 5JRAA 1A7VA 2J9BA 2XLMA 1CGNA 1APCA 3ZQVA 3U8PA 256BA 3C63A 4U9DA 4ULVA 4CDVA 3ZQYA 1GQAA 4ER9A 5JUAA 3VRCA 3QW1A 4U9EA 4CDAA 4CDYA 3QW0A 2XLOA 1CPRA 3ZTZA 3HNJA 2XL8A 4JEAA 3M79A 4EIYA 2XLWA 2XM0A 3HNIA 4WGZA 2QLAA 2XM4A 2YKZA 2XLDA 5JS5A 1QPUA 1YYJA 3QVZA 4N6HA 1JAFA 1EKYA 1QQ3A 2J8WA 4N4WA 2YLGA 3DE9A 1M6TA 4CX9A 2XLHA 4IARA 4D4XA 3NMIA 2CCYA 2YLDA 1RCPA 4D4NA 4IB4A 2YL3A 1CPQA 1MQVA 2YL7A 1YYXA 3TOMA 5JT4A 3FOOA 4CIPA 4L6RA 1NBBA 4JKVA 1E86A 3M4CA 3M15A 2YL1A 3ZTMA 3ZWIA 2YLIA 4CJGA 5JLIA 4IAQA 1E83A 3M4BA 3NMKA 4WGYA 4JE9A 1CGOA 3FOPA 1BBHA 3C62A 3IQ6A 3NMJA 1S05A 1YZCA 2XLEA 1E85A 3HNKA 5JP7A 2XLVA 4NC3A 2BC5A
chains in the Genus database with same CATH superfamily
4MW3A 2AU5A 4PJMA 4OINF 1ZHYA 4PR9A 3MLGA 4UDVA 4NQFA 4BJ6A 3DAGA 3JRTA 1TQGA 1FFTC 1WN0A 3I5QA 1YZAA 4MTGA 3VAYA 5KYYA 1Z63A 1O5HA 3PCVA 2H8AA 3JYYA 3RW0A 1LM3B 1OKKD 1WTYA 3NYLA 4E0HA 2AP3A 4FX5A 2V3CC 3N2ZB 1JPNA 3RH3A 1NFOA 5AC5A 1OKKA 1D1CA 3TQOA 3S0XA 2CNWD 3QVYA 5JRAA 4MW8A 1A7VA 3NKDA 4CS9C 2Z15A 4G7HF 2HSBA 4BJ6C 1OCCC 1APCA 4MVZA 4XEVA 2EIJC 2R7WA 1SZIA 2UUIA 4YT2A 1JOGA 2IM8A 4LDKA 1TWAA 4U5HA 4ER9A 3GEIA 3CZ6A 4YN0B 2G3VA 3A11A 2ZXOA 2UUHA 5D91A 3QW1A 1FAPB 4U9EA 3SXYA 2GDCA 2X51A 2AWCA 4JW1A 1G5ZA 3TJ6A 5COFA 3BRJA 4NTAA 5A69A 4JEAA 1L3PA 1OCOC 4EKWA 1ORSC 2XM0A 2IYLD 4Z9HA 2PFDA 3LLKA 2J45A 2HMZA 2R02A 4MVMA 3DJUB 1U0BB 2B0HA 2ZXWC 2H7VC 3EZHA 2HS5A 2YKZA 3F47A 3UR3C 1FNTc 1MNDA 3G4XA 3EH2A 5JS5A 3WHNA 4G7OF 4CS7A 4E7SA 2LIGA 3KH2A 3NDBB 1JAFA 4BPMA 2OG2A 3PDMP 1EKYA 3U0CA 3G50A 2OCCC 1ORJA 4BEJA 5F5HA 5DS4A 3S29A 3R7CA 2DB4A 4P6IC 3V5YA 1YA9A 1WGWA 2YQYA 2R7TA 4IARA 2EIKC 2ICWG 2LP4A 2OKUA 1JRAA 4O79A 3U3BA 2XRHA 3RKOF 5HV9A 3LJBA 4OIPF 3CSKA 5KYNA 1NU7D 2XS1A 4AL1A 4MTFA 2J0XA 1M56C 1NZEA 1RCPA 1T5OA 2OU6A 4JCZA 2BL2A 5F28E 4MVRA 2VB6A 2QY9A 5BQGA 1VTMP 1EI7A 1L7CA 4P9FA 1Q0GA 5DVWA 1BR4A 1GS9A 3FOOA 3JCUQ 1ZHWA 3JZ0A 1HW2A 2A6EF 5KYUB 3SP1A 3Q6MA 3B9QA 1M2VA 2Y3HA 3EFOB 4JTCB 4RBNA 3RVZA 2H7BA 3HTKC 2JD3A 3M4CA 3MBGA 3O10A 4BG0A 2J9WA 3M15A 2AWYA 3FVYA 3BEHA 2C03A 2YLIA 3DAFA 3QZCA 4RD9A 4J30B 4CJGA 1YARO 1NLXA 2WB7A 1AUEA 1MMAA 1R5ID 1FFHA 3H65A 1E83A 4YWQA 1G8XA 1K05A 3AG2C 1DOWA 1OXKA 5E3CA 4WGYA 1AEPA 3K1IA 3FOPA 3KL4A 2HV6A 4XLPF 4KI2A 2DYRC 3O39A 5FZTA 3C62A 2W4MA 4RDAA 1T6QA 3RQFA 3TJ5A 5DS5A 1I4ZA 2I15A 1RKEA 2FFHA 2Q9BA 3T6BA 3V5ZA 4YT4A 5EGYA 3DM5A 1RJ9A 2ETSA 1B68A 5JP7A 1UFBA 3K33A 1HMDA 2Y69C 1O87A 4C3DA 2P6VA 4WABA 4AK9A 4BJ5A 3ATPA 3Q7GA 4YT8A 4H4KC 4YL1A 1PD1A 3HNLA 4MQ9F 3TULA 5JVEA 2WVQA 1K04A 5DQZA 1LIHA 4CDAA 4E17A 1OW8A 3B0UX 3T6GB 3LS1A 1BDJB 2A0UA 2QTVA 2E87A 4U5CE 3S90A 2GAQA 2QNLA 1JR8A 4XPWA 2X0CA 5KYWA 3E70C 1ZU5A 1LPEA 2VC9A 5B3SC 2XL4A 2XL6A 3GANA 4JEBA 4LERA 4YK5A 3TOLA 1LS1A 3L1MA 1YVIA 1H9GA 2WVNA 1Z5ZA 2J9BA 2XLMA 2G3KA 3JSEO 2OOCA 3MX3A 2KYHA 3EJNA 3T4RA 2KQ9A 1ZW2A 1LE2A 3KPHA 4NY3A 5COMA 3AJMA 3C63A 3U8PA 3HLZA 1G4US 1WOLA 1XZPA 3AOUA 3W2VA 5EHHA 1BR2A 4F4BA 4G0HA 3PHF2 3N0TA 2NUPA 4U9DA 2YZSA 4ULVA 5KYUA 4CSAC 5L0GA 1GQAA 2NUTA 2XXAA 2ZPAA 4JJGA 3SZRA 1OQCA 2LD6A 3IEEA 3EG9A 4AE4B 1VLSA 3FAJA 4H54A 3SYNA 2XLOA 4CDYA 1RKCA 2HFIA 3ZG1A 3AG1C 2ZXPA 2OJED 1VYIA 4FWVA 3MYIA 3JT1A 1HY5A 3DWWA 2XL8A 3Q6NA 4HFFB 3M79A 2CGEA 5EK0A 4EIYA 1YJGA 2R25A 2GFHA 1Q0FA 1RKEB 1VOMA 3M1CB 1LKXA 2XM4A 3S27A 2JPUA 4DVZA 1ST6A 3V5XA 2YRFA 4PJNA 3ITFA 1QPUA 2Y3DA 3U8VA 4DBRA 1PD0A 1QKRA 5E3AA 3UMKA 5A6BD 2AVKA 3L0IA 4N6HA 3IHUA 2R7VA 1T9KA 1ZHTA 2EPOA 2VCAA 1QQ3A 2HZ8A 2J8WA 3EGXB 1R4TA 3F46A 3SXZA 1T6UA 3TD7A 3EQLF 4MNDA 2ZXRA 3C8GD 4Q7CA 1E2XA 1FMVA 4PJLA 5K0IA 2CW0F 4K0DA 2Q3TA 3WODF 3C8GA 2CDQA 3ABLC 2KGOA 2PF4E 3NMIA 2Q4FA 2TMVP 2P1AA 3C8ZA 4GYTA 2R7UA 2V26A 1T6IA 1U6HA 3WAQA 4KBLA 4E0IA 5T3TA 4EWCA 4IB4A 2PBEA 2Q9CA 3K1HA 5E2QA 2YL3A 4DVYP 3AQCA 5BQIA 4JCHA 1A41A 1OCZC 2VH3A 3FHDA 3JRMO 4XEKA 2KNHA 2NUTB 3FAPB 1MNEA 4L6RA 3RFYA 4MS2A 3DXJF 1Q0DA 2IBFA 5L0DA 2NSFA 2EPKX 3C18A 4ANJA 1W2WA 2GA0A 4YL3A 1JMWA 1V74B 3ZDLA 2QE9A 3RF3A 4PJJA 2YL1A 4JURI 2OEVA 1V54C 1Y6DA 1RJ9B 2A68F 2LK4A 5A6AA 3IQCA 1WATA 4OD4A 4IGGA 1H9TA 3NMKA 1ZW3A 4JE9A 5AC4A 1J8MF 3EHNA 4DBQA 2J9UA 2L6FA 1Z3IX 2PNOA 4O6NA 5L0FA 4ZLDA 2XLEA 3GM1A 4LDRA 3K66A 1E85A 3UGPA 3HNKA 1TWCA 1RXQA 4MVQA 2GWWA 1TFKB 1SYQA 4R32A 5BUOA 1M57C 2KJGA 3K7DA 4O6MA 4C7OB 3VF0A 1Z7Qc 4CS8A 5L3QA 4CJOA 3DZAA 2P7VA 3H2VA 3IQ5A 4JTDB 1AVOB 2C04A 4U5BE 3T6JA 4E7ZA 3DE8A 4JJFA 1E84A 1OCRC 2CNWA 3CQZA 4MVUA 5A6JA 2J46A 2L6GA 1ZYRF 2NUPB 4M63A 4QI0A 4XQ1A 2LCHA 4LDQA 5AGFA 3ZSUA 1QVXA 2YL0A 4X0RA 1RMVA 4W8PA 3ASOC 2R7RA 4JTAB 4FAPB 2YEVA 4EHPA 1YDIA 3DD7A 1M2OA 3GORA 1HW1A 1CGNA 4HFKB 2KW3C 2IOQA 4PACA 1NSGB 256BA 3EHMA 3DM9B 3K1IC 3KYIA 1T01A 3LS0A 4MTOA 3SXKA 3V7OA 2J7PA 5B1AC 4YL0A 1V55C 1XZQA 3W8HA 3ZQYA 2Y3BA 1WASA 3OWTA 2IXOA 2J7PD 4KNWA 4IAOA 4XLNF 3R2PA 3VRCA 5JUAA 4MVOA 4C7OA 3CAXA 4I3MA 1PV3A 4JIOA 3QW0A 2VASA 3ZTZA 4BJ5C 3JTLO 2CYDA 5T1DB 2HKVA 1ZHXA 1YLMA 1OR3A 2W9YA 3LEVA 3SEOA 3W4YA 4G78A 3GODA 4QI2A 2J9VA 1V4AA 1ZHZA 4LACB 3UNGC 3FXHA 4XEFA 3B71A 3KYJA 4HE8D 3G4ZA 3HNIA 4WGZA 4A2NB 2EIMC 2ZD9A 2QLAA 3NRHA 1A7DA 4U5DE 2Q7RA 2R7OA 2VCBA 4O7GA 2L9JA 4OIRF 2WZGA 2W4BA 4FESA 4OIOF 5CI8A 1KTMA 4IJJA 2I8BA 1OXBA 4E18A 3OEOA 1H7IA 1ZVZA 3EGDB 1D0ZA 2JX0A 5DQTA 2NPUA 2KSFA 4EBBA 4N4WA 4AL0A 4EBKA 3EGDA 3GEEA 1GM5A 1QLEC 1NFNA 1JPJA 3DE9A 3RQGA 5BQHA 1YAUO 2XLHA 1D1AA 1UG7A 4D4XA 3HKKA 1KNYA 4DRIB 1TKNA 4EUKB 4J32B 4Z9IA 2RSEB 2H7OA 4C3EA 2FGYA 2LQGA 3UMHA 1MMDA 2J0WA 3W8IA 4XTKA 3NG1A 1OW7A 2YLDA 2Q9AA 4XPYA 3CEXA 1LE4A 1HMOA 2DI3A 1CPQA 3NYMA 5L0JA 1K40A 1MQVA 1SR2A 1YYXA 2WVOA 2YL7A 3TK0A 3TOMA 4CIHA 2NG1A 3GM2A 3FMSA 1NBBA 3LUTB 3MYFA 4JKVA 4YJWA 2EPNA 3DI5A 5HSWA 4NTFA 3LLIA 5DLJA 5A6BA 3K6BA 1LVKA 3S84A 2OQMA 3S9OA 1NU9C 1IW7F 3ZVRA 2WZLA 4JC7A 4A4AA 1VYKA 5JLIA 4PFPA 5L0IA 2PX3A 2D4UA 2G62A 3M4BA 4PK4A 3MFNA 1ORYA 2RD9A 2LFFA 1VLTA 1CGOA 2OJQA 3US6A 3EGXA 5KYYB 1BBHA 2DYSC 2QUPA 2MWQA 3NMJA 3SNHA 2IXNA 3EH1A 1S05A 4CSAA 1DOVA 3OA1A 1Z6AA 3ECSA 1MMNA 1ZZPA 3AGTA 3U9JA 3L8IA 3O55A 2YWAA 3GWNA 2L81A 1WWPA 4N6CA 2D5RB 2R9RB 4DJ9A 4NC3A 5B1BC 2B0JA 2BC5A 1YA7O 4U5EE 2A69F 1TWHA 4AX2A 2Q00A 1CGME 1OW6A 1C17M 2EPLX 4HEAJ 3LNMB 2P0NA 4ULWA 2MYSA 3DMDA 4B6IA 1QSPA 1IZMA 4NCQA 3HJCA 2OEXA 4NTBA 1VB5A 1N1CA 3I5PA 3RQEA 3GWLA 1KU2A 2M4EA 4C3BA 4CBEA 5L3VA 3WG7C 5B3IA 4K1OA 2R05A 3LAYA 1NG1A 1Y4CA 4J7TA 5JSLA 3U2MA 2Y39A 1MMGA 3AQBA 2PX0A 3U5SA 2BE5F 2L7AA 4OIQF 3ABMC 2HMQA 1QZXA 2XS8A 4IRUA 4JZAA 4ONSA 3X2QC 3ZQVA 1G4WR 3QMKA 3DKAA 3I4UA 2A1DD 3O6XA 4PFOA 5KYWB 4G7ZF 5L0CA 1TR2A 3RIPA 3EG9B 4AE4A 3FDQA 3IPMO 4CDVA 4DOZA 1VK5A 2PP4A 4K7BA 1H6GA 1TFOB 3J06A 4U5GA 5T3WA 3U2LA 3AGUA 2R7SA 2YVKA 2KC3A 1Q0KA 3RVYA 3B0VC 3Q7LA 1CPRA 1F1MA 1Q0MA 3VM6A 4CS9A 5KYXB 2ASRA 2WL8A 3S28A 2L6HA 3HNJA 4U5FE 3GEHA 5IY5C 1Z23A 2HJMA 3C7JA 4YT5A 2XLWA 4DXWA 4GQHA 1HE9A 3LESA 1C03A 1VMAA 4QDLA 3VYWA 1I5NA 2XSEA 4CS8C 1FR0A 2HSQA 2MHRA 3DJNB 1OR2A 3POVA 5F5FA 2EINC 4DRJB 3C8GB 4I44A 3L8JA 2XLDA 1BZ4A 1D0YA 4W8KA 4JRZA 1HE1A 1SMYF 1YYJA 2VCCA 3L34A 2KK1A 1ZU4A 5CI9A 3QVZA 2XXAB 3JYHA 1U89A 5E33A 4BJ1A 4OD5A 2HV7A 5GPGB 1TWGA 4I1MA 2YLGA 4DRHB 3ZC4A 3PMRA 1M6TA 4CX9A 3NKEA 1M2VB 3EFOA 4GEHA 1LS4A 5A6KA 4WJ0A 1A0BA 1S7ZA 1LI7A 3ABKC 3W2WA 5L0HA 4N06A 4IWBA 3KMIA 2CCYA 2O9XA 3AG4C 4Q5SF 2R7XA 5CIVA 4J7YA 3U3FA 3A9CA 3T9OA 4ZLCA 1EQ1A 5COGA 1GGQA 1O3UA 4D4NA 3N24A 5KYXA 4KNVA 1J8YF 4BEMJ 4XPXA 3EZIA 4KC9A 4Q4ZF 3H2UA 5JT4A 2W45A 3X1OA 4CIPA 3ASNC 2R03A 3LNRA 3LEOA 5D92A 2HUJA 5TJ5E 2DGJA 3SXMA 4EBJA 1E86A 3AG3C 1BR1A 2R7QA 3U9MA 3EPVA 4JVSA 2Y3GA 3ZTMA 2P61A 3ZWIA 2EPMX 1PCXA 2M64A 1A7EA 2IXPA 3GM3A 5DS6A 1XWJA 4IAQA 3IQTA 3B29A 3NYJA 3UMIA 3UGOA 2EILC 4LLEA 2F22A 1SF8A 1EA8A 2IXMA 2NSGA 1C02A 2LFDA 3E9VA 4I1OB 1D0XA 4LLCA 1LI5A 2YHSA 3IQ6A 4P9TA 4XWJA 1I4YA 3ZIBA 3KKBA 1FMWA 2A0BA 2LSEA 2FAPB 1YZCA 2A6HF 4O6YA 3B0PA 3RYLA 1D1BA 4Z9JA 4BJTA 2WZFA 1FTSA 2XLVA 5FCLA 3QTHA 2HJ3A 3JSZA 4MVSA
chains in the Genus database with same CATH topology
3HNLA 5JVEA 1YZAA 4CJOA 3IQ5A 1LM3B 3DE8A 1E84A 5B3IA 2XL6A 4JEBA 5JSLA 3TOLA 5AGFA 3L1MA 2YL0A 3QVYA 5JRAA 1A7VA 2J9BA 2XLMA 1CGNA 1APCA 3ZQVA 3U8PA 256BA 3C63A 4U9DA 4ULVA 4CDVA 3ZQYA 1GQAA 4ER9A 5JUAA 3VRCA 3QW1A 4U9EA 4CDAA 4CDYA 3QW0A 2XLOA 1CPRA 3ZTZA 3HNJA 2XL8A 4JEAA 3M79A 4EIYA 2XLWA 2XM0A 3HNIA 4WGZA 2QLAA 2XM4A 2YKZA 2XLDA 5JS5A 1QPUA 1YYJA 3QVZA 4N6HA 1JAFA 1EKYA 1QQ3A 2J8WA 4N4WA 2YLGA 3DE9A 1M6TA 4CX9A 2XLHA 4IARA 4D4XA 3NMIA 2CCYA 2YLDA 1RCPA 4D4NA 4IB4A 2YL3A 1CPQA 1MQVA 2YL7A 1YYXA 3TOMA 5JT4A 3FOOA 4CIPA 4L6RA 1NBBA 4JKVA 1E86A 3M4CA 3M15A 2YL1A 3ZTMA 3ZWIA 2YLIA 4CJGA 5JLIA 4IAQA 1E83A 3M4BA 3NMKA 4WGYA 4JE9A 1CGOA 3FOPA 1BBHA 3C62A 3IQ6A 3NMJA 1S05A 1YZCA 2XLEA 1E85A 3HNKA 5JP7A 2XLVA 4NC3A 2BC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HNL A;  5JVE A;  1YZA A;  4CJO A;  3IQ5 A;  1LM3 B;  3DE8 A;  1E84 A;  5B3I A;  2XL6 A;  4JEB A;  5JSL A;  3TOL A;  5AGF A;  3L1M A;  2YL0 A;  3QVY A;  5JRA A;  1A7V A;  2J9B A;  2XLM A;  1CGN A;  1APC A;  3ZQV A;  3U8P A;  256B A;  3C63 A;  4U9D A;  4ULV A;  4CDV A;  3ZQY A;  1GQA A;  4ER9 A;  5JUA A;  3VRC A;  3QW1 A;  4U9E A;  4CDA A;  4CDY A;  3QW0 A;  2XLO A;  1CPR A;  3ZTZ A;  3HNJ A;  2XL8 A;  4JEA A;  3M79 A;  4EIY A;  2XLW A;  2XM0 A;  3HNI A;  4WGZ A;  2QLA A;  2XM4 A;  2YKZ A;  2XLD A;  5JS5 A;  1QPU A;  1YYJ A;  3QVZ A;  4N6H A;  1JAF A;  1EKY A;  1QQ3 A;  2J8W A;  4N4W A;  2YLG A;  3DE9 A;  1M6T A;  4CX9 A;  2XLH A;  4IAR A;  4D4X A;  3NMI A;  2CCY A;  2YLD A;  1RCP A;  4D4N A;  4IB4 A;  2YL3 A;  1CPQ A;  1MQV A;  2YL7 A;  1YYX A;  3TOM A;  5JT4 A;  3FOO A;  4CIP A;  4L6R A;  1NBB A;  4JKV A;  1E86 A;  3M4C A;  3M15 A;  2YL1 A;  3ZTM A;  3ZWI A;  2YLI A;  4CJG A;  5JLI A;  4IAQ A;  1E83 A;  3M4B A;  3NMK A;  4WGY A;  4JE9 A;  1CGO A;  3FOP A;  1BBH A;  3C62 A;  3IQ6 A;  3NMJ A;  1S05 A;  1YZC A;  2XLE A;  1E85 A;  3HNK A;  5JP7 A;  2XLV A;  4NC3 A;  2BC5 A; 
#chains in the Genus database with same CATH topology
 4MW3 A;  2AU5 A;  4PJM A;  4OIN F;  1ZHY A;  4PR9 A;  3MLG A;  4UDV A;  4NQF A;  4BJ6 A;  3DAG A;  3JRT A;  1TQG A;  1FFT C;  1WN0 A;  3I5Q A;  1YZA A;  4MTG A;  3VAY A;  5KYY A;  1Z63 A;  1O5H A;  3PCV A;  2H8A A;  3JYY A;  3RW0 A;  1LM3 B;  1OKK D;  1WTY A;  3NYL A;  4E0H A;  2AP3 A;  4FX5 A;  2V3C C;  3N2Z B;  1JPN A;  3RH3 A;  1NFO A;  5AC5 A;  1OKK A;  1D1C A;  3TQO A;  3S0X A;  2CNW D;  3QVY A;  5JRA A;  4MW8 A;  1A7V A;  3NKD A;  4CS9 C;  2Z15 A;  4G7H F;  2HSB A;  4BJ6 C;  1OCC C;  1APC A;  4MVZ A;  4XEV A;  2EIJ C;  2R7W A;  1SZI A;  2UUI A;  4YT2 A;  1JOG A;  2IM8 A;  4LDK A;  1TWA A;  4U5H A;  4ER9 A;  3GEI A;  3CZ6 A;  4YN0 B;  2G3V A;  3A11 A;  2ZXO A;  2UUH A;  5D91 A;  3QW1 A;  1FAP B;  4U9E A;  3SXY A;  2GDC A;  2X51 A;  2AWC A;  4JW1 A;  1G5Z A;  3TJ6 A;  5COF A;  3BRJ A;  4NTA A;  5A69 A;  4JEA A;  1L3P A;  1OCO C;  4EKW A;  1ORS C;  2XM0 A;  2IYL D;  4Z9H A;  2PFD A;  3LLK A;  2J45 A;  2HMZ A;  2R02 A;  4MVM A;  3DJU B;  1U0B B;  2B0H A;  2ZXW C;  2H7V C;  3EZH A;  2HS5 A;  2YKZ A;  3F47 A;  3UR3 C;  1FNT c;  1MND A;  3G4X A;  3EH2 A;  5JS5 A;  3WHN A;  4G7O F;  4CS7 A;  4E7S A;  2LIG A;  3KH2 A;  3NDB B;  1JAF A;  4BPM A;  2OG2 A;  3PDM P;  1EKY A;  3U0C A;  3G50 A;  2OCC C;  1ORJ A;  4BEJ A;  5F5H A;  5DS4 A;  3S29 A;  3R7C A;  2DB4 A;  4P6I C;  3V5Y A;  1YA9 A;  1WGW A;  2YQY A;  2R7T A;  4IAR A;  2EIK C;  2ICW G;  2LP4 A;  2OKU A;  1JRA A;  4O79 A;  3U3B A;  2XRH A;  3RKO F;  5HV9 A;  3LJB A;  4OIP F;  3CSK A;  5KYN A;  1NU7 D;  2XS1 A;  4AL1 A;  4MTF A;  2J0X A;  1M56 C;  1NZE A;  1RCP A;  1T5O A;  2OU6 A;  4JCZ A;  2BL2 A;  5F28 E;  4MVR A;  2VB6 A;  2QY9 A;  5BQG A;  1VTM P;  1EI7 A;  1L7C A;  4P9F A;  1Q0G A;  5DVW A;  1BR4 A;  1GS9 A;  3FOO A;  3JCU Q;  1ZHW A;  3JZ0 A;  1HW2 A;  2A6E F;  5KYU B;  3SP1 A;  3Q6M A;  3B9Q A;  1M2V A;  2Y3H A;  3EFO B;  4JTC B;  4RBN A;  3RVZ A;  2H7B A;  3HTK C;  2JD3 A;  3M4C A;  3MBG A;  3O10 A;  4BG0 A;  2J9W A;  3M15 A;  2AWY A;  3FVY A;  3BEH A;  2C03 A;  2YLI A;  3DAF A;  3QZC A;  4RD9 A;  4J30 B;  4CJG A;  1YAR O;  1NLX A;  2WB7 A;  1AUE A;  1MMA A;  1R5I D;  1FFH A;  3H65 A;  1E83 A;  4YWQ A;  1G8X A;  1K05 A;  3AG2 C;  1DOW A;  1OXK A;  5E3C A;  4WGY A;  1AEP A;  3K1I A;  3FOP A;  3KL4 A;  2HV6 A;  4XLP F;  4KI2 A;  2DYR C;  3O39 A;  5FZT A;  3C62 A;  2W4M A;  4RDA A;  1T6Q A;  3RQF A;  3TJ5 A;  5DS5 A;  1I4Z A;  2I15 A;  1RKE A;  2FFH A;  2Q9B A;  3T6B A;  3V5Z A;  4YT4 A;  5EGY A;  3DM5 A;  1RJ9 A;  2ETS A;  1B68 A;  5JP7 A;  1UFB A;  3K33 A;  1HMD A;  2Y69 C;  1O87 A;  4C3D A;  2P6V A;  4WAB A;  4AK9 A;  4BJ5 A;  3ATP A;  3Q7G A;  4YT8 A;  4H4K C;  4YL1 A;  1PD1 A;  3HNL A;  4MQ9 F;  3TUL A;  5JVE A;  2WVQ A;  1K04 A;  5DQZ A;  1LIH A;  4CDA A;  4E17 A;  1OW8 A;  3B0U X;  3T6G B;  3LS1 A;  1BDJ B;  2A0U A;  2QTV A;  2E87 A;  4U5C E;  3S90 A;  2GAQ A;  2QNL A;  1JR8 A;  4XPW A;  2X0C A;  5KYW A;  3E70 C;  1ZU5 A;  1LPE A;  2VC9 A;  5B3S C;  2XL4 A;  2XL6 A;  3GAN A;  4JEB A;  4LER A;  4YK5 A;  3TOL A;  1LS1 A;  3L1M A;  1YVI A;  1H9G A;  2WVN A;  1Z5Z A;  2J9B A;  2XLM A;  2G3K A;  3JSE O;  2OOC A;  3MX3 A;  2KYH A;  3EJN A;  3T4R A;  2KQ9 A;  1ZW2 A;  1LE2 A;  3KPH A;  4NY3 A;  5COM A;  3AJM A;  3C63 A;  3U8P A;  3HLZ A;  1G4U S;  1WOL A;  1XZP A;  3AOU A;  3W2V A;  5EHH A;  1BR2 A;  4F4B A;  4G0H A;  3PHF 2;  3N0T A;  2NUP A;  4U9D A;  2YZS A;  4ULV A;  5KYU A;  4CSA C;  5L0G A;  1GQA A;  2NUT A;  2XXA A;  2ZPA A;  4JJG A;  3SZR A;  1OQC A;  2LD6 A;  3IEE A;  3EG9 A;  4AE4 B;  1VLS A;  3FAJ A;  4H54 A;  3SYN A;  2XLO A;  4CDY A;  1RKC A;  2HFI A;  3ZG1 A;  3AG1 C;  2ZXP A;  2OJE D;  1VYI A;  4FWV A;  3MYI A;  3JT1 A;  1HY5 A;  3DWW A;  2XL8 A;  3Q6N A;  4HFF B;  3M79 A;  2CGE A;  5EK0 A;  4EIY A;  1YJG A;  2R25 A;  2GFH A;  1Q0F A;  1RKE B;  1VOM A;  3M1C B;  1LKX A;  2XM4 A;  3S27 A;  2JPU A;  4DVZ A;  1ST6 A;  3V5X A;  2YRF A;  4PJN A;  3ITF A;  1QPU A;  2Y3D A;  3U8V A;  4DBR A;  1PD0 A;  1QKR A;  5E3A A;  3UMK A;  5A6B D;  2AVK A;  3L0I A;  4N6H A;  3IHU A;  2R7V A;  1T9K A;  1ZHT A;  2EPO A;  2VCA A;  1QQ3 A;  2HZ8 A;  2J8W A;  3EGX B;  1R4T A;  3F46 A;  3SXZ A;  1T6U A;  3TD7 A;  3EQL F;  4MND A;  2ZXR A;  3C8G D;  4Q7C A;  1E2X A;  1FMV A;  4PJL A;  5K0I A;  2CW0 F;  4K0D A;  2Q3T A;  3WOD F;  3C8G A;  2CDQ A;  3ABL C;  2KGO A;  2PF4 E;  3NMI A;  2Q4F A;  2TMV P;  2P1A A;  3C8Z A;  4GYT A;  2R7U A;  2V26 A;  1T6I A;  1U6H A;  3WAQ A;  4KBL A;  4E0I A;  5T3T A;  4EWC A;  4IB4 A;  2PBE A;  2Q9C A;  3K1H A;  5E2Q A;  2YL3 A;  4DVY P;  3AQC A;  5BQI A;  4JCH A;  1A41 A;  1OCZ C;  2VH3 A;  3FHD A;  3JRM O;  4XEK A;  2KNH A;  2NUT B;  3FAP B;  1MNE A;  4L6R A;  3RFY A;  4MS2 A;  3DXJ F;  1Q0D A;  2IBF A;  5L0D A;  2NSF A;  2EPK X;  3C18 A;  4ANJ A;  1W2W A;  2GA0 A;  4YL3 A;  1JMW A;  1V74 B;  3ZDL A;  2QE9 A;  3RF3 A;  4PJJ A;  2YL1 A;  4JUR I;  2OEV A;  1V54 C;  1Y6D A;  1RJ9 B;  2A68 F;  2LK4 A;  5A6A A;  3IQC A;  1WAT A;  4OD4 A;  4IGG A;  1H9T A;  3NMK A;  1ZW3 A;  4JE9 A;  5AC4 A;  1J8M F;  3EHN A;  4DBQ A;  2J9U A;  2L6F A;  1Z3I X;  2PNO A;  4O6N A;  5L0F A;  4ZLD A;  2XLE A;  3GM1 A;  4LDR A;  3K66 A;  1E85 A;  3UGP A;  3HNK A;  1TWC A;  1RXQ A;  4MVQ A;  2GWW A;  1TFK B;  1SYQ A;  4R32 A;  5BUO A;  1M57 C;  2KJG A;  3K7D A;  4O6M A;  4C7O B;  3VF0 A;  1Z7Q c;  4CS8 A;  5L3Q A;  4CJO A;  3DZA A;  2P7V A;  3H2V A;  3IQ5 A;  4JTD B;  1AVO B;  2C04 A;  4U5B E;  3T6J A;  4E7Z A;  3DE8 A;  4JJF A;  1E84 A;  1OCR C;  2CNW A;  3CQZ A;  4MVU A;  5A6J A;  2J46 A;  2L6G A;  1ZYR F;  2NUP B;  4M63 A;  4QI0 A;  4XQ1 A;  2LCH A;  4LDQ A;  5AGF A;  3ZSU A;  1QVX A;  2YL0 A;  4X0R A;  1RMV A;  4W8P A;  3ASO C;  2R7R A;  4JTA B;  4FAP B;  2YEV A;  4EHP A;  1YDI A;  3DD7 A;  1M2O A;  3GOR A;  1HW1 A;  1CGN A;  4HFK B;  2KW3 C;  2IOQ A;  4PAC A;  1NSG B;  256B A;  3EHM A;  3DM9 B;  3K1I C;  3KYI A;  1T01 A;  3LS0 A;  4MTO A;  3SXK A;  3V7O A;  2J7P A;  5B1A C;  4YL0 A;  1V55 C;  1XZQ A;  3W8H A;  3ZQY A;  2Y3B A;  1WAS A;  3OWT A;  2IXO A;  2J7P D;  4KNW A;  4IAO A;  4XLN F;  3R2P A;  3VRC A;  5JUA A;  4MVO A;  4C7O A;  3CAX A;  4I3M A;  1PV3 A;  4JIO A;  3QW0 A;  2VAS A;  3ZTZ A;  4BJ5 C;  3JTL O;  2CYD A;  5T1D B;  2HKV A;  1ZHX A;  1YLM A;  1OR3 A;  2W9Y A;  3LEV A;  3SEO A;  3W4Y A;  4G78 A;  3GOD A;  4QI2 A;  2J9V A;  1V4A A;  1ZHZ A;  4LAC B;  3UNG C;  3FXH A;  4XEF A;  3B71 A;  3KYJ A;  4HE8 D;  3G4Z A;  3HNI A;  4WGZ A;  4A2N B;  2EIM C;  2ZD9 A;  2QLA A;  3NRH A;  1A7D A;  4U5D E;  2Q7R A;  2R7O A;  2VCB A;  4O7G A;  2L9J A;  4OIR F;  2WZG A;  2W4B A;  4FES A;  4OIO F;  5CI8 A;  1KTM A;  4IJJ A;  2I8B A;  1OXB A;  4E18 A;  3OEO A;  1H7I A;  1ZVZ A;  3EGD B;  1D0Z A;  2JX0 A;  5DQT A;  2NPU A;  2KSF A;  4EBB A;  4N4W A;  4AL0 A;  4EBK A;  3EGD A;  3GEE A;  1GM5 A;  1QLE C;  1NFN A;  1JPJ A;  3DE9 A;  3RQG A;  5BQH A;  1YAU O;  2XLH A;  1D1A A;  1UG7 A;  4D4X A;  3HKK A;  1KNY A;  4DRI B;  1TKN A;  4EUK B;  4J32 B;  4Z9I A;  2RSE B;  2H7O A;  4C3E A;  2FGY A;  2LQG A;  3UMH A;  1MMD A;  2J0W A;  3W8I A;  4XTK A;  3NG1 A;  1OW7 A;  2YLD A;  2Q9A A;  4XPY A;  3CEX A;  1LE4 A;  1HMO A;  2DI3 A;  1CPQ A;  3NYM A;  5L0J A;  1K40 A;  1MQV A;  1SR2 A;  1YYX A;  2WVO A;  2YL7 A;  3TK0 A;  3TOM A;  4CIH A;  2NG1 A;  3GM2 A;  3FMS A;  1NBB A;  3LUT B;  3MYF A;  4JKV A;  4YJW A;  2EPN A;  3DI5 A;  5HSW A;  4NTF A;  3LLI A;  5DLJ A;  5A6B A;  3K6B A;  1LVK A;  3S84 A;  2OQM A;  3S9O A;  1NU9 C;  1IW7 F;  3ZVR A;  2WZL A;  4JC7 A;  4A4A A;  1VYK A;  5JLI A;  4PFP A;  5L0I A;  2PX3 A;  2D4U A;  2G62 A;  3M4B A;  4PK4 A;  3MFN A;  1ORY A;  2RD9 A;  2LFF A;  1VLT A;  1CGO A;  2OJQ A;  3US6 A;  3EGX A;  5KYY B;  1BBH A;  2DYS C;  2QUP A;  2MWQ A;  3NMJ A;  3SNH A;  2IXN A;  3EH1 A;  1S05 A;  4CSA A;  1DOV A;  3OA1 A;  1Z6A A;  3ECS A;  1MMN A;  1ZZP A;  3AGT A;  3U9J A;  3L8I A;  3O55 A;  2YWA A;  3GWN A;  2L81 A;  1WWP A;  4N6C A;  2D5R B;  2R9R B;  4DJ9 A;  4NC3 A;  5B1B C;  2B0J A;  2BC5 A;  1YA7 O;  4U5E E;  2A69 F;  1TWH A;  4AX2 A;  2Q00 A;  1CGM E;  1OW6 A;  1C17 M;  2EPL X;  4HEA J;  3LNM B;  2P0N A;  4ULW A;  2MYS A;  3DMD A;  4B6I A;  1QSP A;  1IZM A;  4NCQ A;  3HJC A;  2OEX A;  4NTB A;  1VB5 A;  1N1C A;  3I5P A;  3RQE A;  3GWL A;  1KU2 A;  2M4E A;  4C3B A;  4CBE A;  5L3V A;  3WG7 C;  5B3I A;  4K1O A;  2R05 A;  3LAY A;  1NG1 A;  1Y4C A;  4J7T A;  5JSL A;  3U2M A;  2Y39 A;  1MMG A;  3AQB A;  2PX0 A;  3U5S A;  2BE5 F;  2L7A A;  4OIQ F;  3ABM C;  2HMQ A;  1QZX A;  2XS8 A;  4IRU A;  4JZA A;  4ONS A;  3X2Q C;  3ZQV A;  1G4W R;  3QMK A;  3DKA A;  3I4U A;  2A1D D;  3O6X A;  4PFO A;  5KYW B;  4G7Z F;  5L0C A;  1TR2 A;  3RIP A;  3EG9 B;  4AE4 A;  3FDQ A;  3IPM O;  4CDV A;  4DOZ A;  1VK5 A;  2PP4 A;  4K7B A;  1H6G A;  1TFO B;  3J06 A;  4U5G A;  5T3W A;  3U2L A;  3AGU A;  2R7S A;  2YVK A;  2KC3 A;  1Q0K A;  3RVY A;  3B0V C;  3Q7L A;  1CPR A;  1F1M A;  1Q0M A;  3VM6 A;  4CS9 A;  5KYX B;  2ASR A;  2WL8 A;  3S28 A;  2L6H A;  3HNJ A;  4U5F E;  3GEH A;  5IY5 C;  1Z23 A;  2HJM A;  3C7J A;  4YT5 A;  2XLW A;  4DXW A;  4GQH A;  1HE9 A;  3LES A;  1C03 A;  1VMA A;  4QDL A;  3VYW A;  1I5N A;  2XSE A;  4CS8 C;  1FR0 A;  2HSQ A;  2MHR A;  3DJN B;  1OR2 A;  3POV A;  5F5F A;  2EIN C;  4DRJ B;  3C8G B;  4I44 A;  3L8J A;  2XLD A;  1BZ4 A;  1D0Y A;  4W8K A;  4JRZ A;  1HE1 A;  1SMY F;  1YYJ A;  2VCC A;  3L34 A;  2KK1 A;  1ZU4 A;  5CI9 A;  3QVZ A;  2XXA B;  3JYH A;  1U89 A;  5E33 A;  4BJ1 A;  4OD5 A;  2HV7 A;  5GPG B;  1TWG A;  4I1M A;  2YLG A;  4DRH B;  3ZC4 A;  3PMR A;  1M6T A;  4CX9 A;  3NKE A;  1M2V B;  3EFO A;  4GEH A;  1LS4 A;  5A6K A;  4WJ0 A;  1A0B A;  1S7Z A;  1LI7 A;  3ABK C;  3W2W A;  5L0H A;  4N06 A;  4IWB A;  3KMI A;  2CCY A;  2O9X A;  3AG4 C;  4Q5S F;  2R7X A;  5CIV A;  4J7Y A;  3U3F A;  3A9C A;  3T9O A;  4ZLC A;  1EQ1 A;  5COG A;  1GGQ A;  1O3U A;  4D4N A;  3N24 A;  5KYX A;  4KNV A;  1J8Y F;  4BEM J;  4XPX A;  3EZI A;  4KC9 A;  4Q4Z F;  3H2U A;  5JT4 A;  2W45 A;  3X1O A;  4CIP A;  3ASN C;  2R03 A;  3LNR A;  3LEO A;  5D92 A;  2HUJ A;  5TJ5 E;  2DGJ A;  3SXM A;  4EBJ A;  1E86 A;  3AG3 C;  1BR1 A;  2R7Q A;  3U9M A;  3EPV A;  4JVS A;  2Y3G A;  3ZTM A;  2P61 A;  3ZWI A;  2EPM X;  1PCX A;  2M64 A;  1A7E A;  2IXP A;  3GM3 A;  5DS6 A;  1XWJ A;  4IAQ A;  3IQT A;  3B29 A;  3NYJ A;  3UMI A;  3UGO A;  2EIL C;  4LLE A;  2F22 A;  1SF8 A;  1EA8 A;  2IXM A;  2NSG A;  1C02 A;  2LFD A;  3E9V A;  4I1O B;  1D0X A;  4LLC A;  1LI5 A;  2YHS A;  3IQ6 A;  4P9T A;  4XWJ A;  1I4Y A;  3ZIB A;  3KKB A;  1FMW A;  2A0B A;  2LSE A;  2FAP B;  1YZC A;  2A6H F;  4O6Y A;  3B0P A;  3RYL A;  1D1B A;  4Z9J A;  4BJT A;  2WZF A;  1FTS A;  2XLV A;  5FCL A;  3QTH A;  2HJ3 A;  3JSZ A;  4MVS A; 
#chains in the Genus database with same CATH homology
 3HNL A;  5JVE A;  1YZA A;  4CJO A;  3IQ5 A;  1LM3 B;  3DE8 A;  1E84 A;  5B3I A;  2XL6 A;  4JEB A;  5JSL A;  3TOL A;  5AGF A;  3L1M A;  2YL0 A;  3QVY A;  5JRA A;  1A7V A;  2J9B A;  2XLM A;  1CGN A;  1APC A;  3ZQV A;  3U8P A;  256B A;  3C63 A;  4U9D A;  4ULV A;  4CDV A;  3ZQY A;  1GQA A;  4ER9 A;  5JUA A;  3VRC A;  3QW1 A;  4U9E A;  4CDA A;  4CDY A;  3QW0 A;  2XLO A;  1CPR A;  3ZTZ A;  3HNJ A;  2XL8 A;  4JEA A;  3M79 A;  4EIY A;  2XLW A;  2XM0 A;  3HNI A;  4WGZ A;  2QLA A;  2XM4 A;  2YKZ A;  2XLD A;  5JS5 A;  1QPU A;  1YYJ A;  3QVZ A;  4N6H A;  1JAF A;  1EKY A;  1QQ3 A;  2J8W A;  4N4W A;  2YLG A;  3DE9 A;  1M6T A;  4CX9 A;  2XLH A;  4IAR A;  4D4X A;  3NMI A;  2CCY A;  2YLD A;  1RCP A;  4D4N A;  4IB4 A;  2YL3 A;  1CPQ A;  1MQV A;  2YL7 A;  1YYX A;  3TOM A;  5JT4 A;  3FOO A;  4CIP A;  4L6R A;  1NBB A;  4JKV A;  1E86 A;  3M4C A;  3M15 A;  2YL1 A;  3ZTM A;  3ZWI A;  2YLI A;  4CJG A;  5JLI A;  4IAQ A;  1E83 A;  3M4B A;  3NMK A;  4WGY A;  4JE9 A;  1CGO A;  3FOP A;  1BBH A;  3C62 A;  3IQ6 A;  3NMJ A;  1S05 A;  1YZC A;  2XLE A;  1E85 A;  3HNK A;  5JP7 A;  2XLV A;  4NC3 A;  2BC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...