2L6GA

Fat-ld2 double labeled construct with free ld4 peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
161
Chain Sequence
MANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPHSNLSELDRLLLELNAVQHNPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Focal adhesion kinase 1, linker, Paxillin
publication title Fat-Ld2 Double Labeled Construct with Free Ld4 Peptide
rcsb
source organism Gallus gallus, unidentified
molecule tags Transferase,cell adhesion
total genus 56
structure length 161
sequence length 176
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2l6gA00
3C18A 1OW8A 2PBEA 1O3UA 1ZZPA 3B71A 1K05A 2JPUA 3L8IA 2HSBA 3C8GD 3MFNA 1QVXA 4R32A 1KNYA 3U3FA 4EBJA 3RQEA 3BRJA 3C8GA 3U0CA 4XEVA 2Q00A 2L6GA 4NQFA 1K04A 3GM1A 1OW7A 3AJMA 2L6HA 1UFBA 3C8GB 1JOGA 3K7DA 1V4AA 2LK4A 5F28E 3JZ0A 3TULA 3O10A 3L8JA 1WOLA 3RQGA 3GM3A 2YWAA 2KK1A 3GM2A 3RQFA 1OW6A 3JYYA 2L6FA 1PV3A 1KTMA 4XEKA 4XEFA 1WTYA 4EBKA 1WWPA 1K40A 3S9OA 2JX0A
chains in the Genus database with same CATH superfamily
1MNEA 1V55C 3WAQA 1OW8A 4CS9C 4OIRF 2RD9A 1TWAA 2XLWA 5A6BD 3GWLA 2W45A 3EGXB 1ZHZA 2R25A 2FGYA 1MMNA 2RSEB 2YKZA 1KNYA 2LQGA 3JSZA 3Q6NA 2YRFA 1VK5A 1NSGB 3CZ6A 2R7XA 1RKCA 1YVIA 4BJ1A 1TQGA 1UG7A 1J8MF 4H54A 2VC9A 4RBNA 2W4BA 1HE1A 3L34A 2VB6A 4QI2A 4O6YA 2HKVA 3DJNB 1E83A 2A6HF 2R7UA 3S28A 5KYXB 5F5FA 1C17M 4I3MA 3A11A 4YT5A 2OEXA 2OG2A 4NY3A 5HSWA 3E9VA 3JYYA 2YZSA 5L0FA 2KSFA 1Q0MA 3KMIA 2HMQA 1WTYA 2CCYA 1Z23A 2KW3C 1CGOA 2WVNA 4IGGA 4XEFA 4I44A 3UR3C 3VRCA 4CIHA 1O5HA 5KYYB 3C7JA 2PBEA 2XS8A 2YL7A 5CI9A 3O6XA 4CDYA 3B0UX 1K05A 4AX2A 1BR1A 2YL3A 3ZIBA 4KI2A 4U5FE 4EUKB 2LIGA 3DD7A 5F5HA 2LCHA 3U9JA 3ZTMA 1ST6A 1YZAA 3QMKA 4YL3A 3I4UA 4BJ5C 1D0ZA 1M2VB 3ZDLA 2C04A 2EPMX 2YLGA 2WB7A 3JRTA 1S05A 1T6UA 3GM1A 4EBBA 2HMZA 1NBBA 3GEEA 4YN0B 5EHHA 2PFDA 3L8JA 3IEEA 2YL0A 3KPHA 4G78A 5JUAA 1LKXA 1PD1A 2CNWA 3W2VA 1PV3A 1VLTA 1Y4CA 2GAQA 1LVKA 3DJUB 3Q7GA 2H8AA 2H7OA 4P6IC 4U9EA 4Z9HA 2PX0A 1RXQA 3N24A 3C18A 1A41A 1EI7A 2VH3A 3NMIA 3MYFA 3SP1A 1CPQA 3HNIA 1YYXA 2DB4A 3GORA 3Q6MA 2ZXOA 1IW7F 4QI0A 1RKEB 3K1IA 3U9MA 1H9GA 2R05A 4FWVA 4U5HA 1D1CA 2ICWG 1GQAA 4JTAB 4JEAA 1Q0GA 3U8PA 1CPRA 2G3KA 1LPEA 4DJ9A 1Q0KA 2VCAA 3OEOA 5T1DB 3POVA 4EHPA 2A1DD 2MWQA 5CIVA 1XWJA 1M56C 3QZCA 3U3BA 3EZIA 3R2PA 4CJGA 3H2UA 4JJFA 1BR2A 5FZTA 1WOLA 4MVOA 4O79A 4UDVA 3DAFA 3V5ZA 1ZHXA 3LESA 1Z6AA 2LD6A 2Q9BA 4MS2A 2EINC 2J46A 5K0IA 4CS7A 1DOWA 1GGQA 1I4YA 3SNHA 4B6IA 4PJNA 1D1BA 3FHDA 3KKBA 5FCLA 3TJ6A 2NG1A 1G5ZA 2J45A 3RYLA 2EIKC 4R32A 2WZFA 3JSEO 3VF0A 1ZYRF 1G4US 4ER9A 2R7TA 1JPJA 1QLEC 5EGYA 1QKRA 3BEHA 5E3CA 2HJMA 2OOCA 5COFA 1VB5A 2IXPA 1UFBA 2Q7RA 1HMOA 4CDVA 3RH3A 3O10A 1ORYA 4E18A 2J7PD 2XL6A 2FFHA 2P0NA 1XZQA 3JTLO 4MVSA 2NUTA 3DAGA 1BZ4A 4EKWA 2NSGA 2R7OA 4XEKA 4MTGA 2XRHA 3C8ZA 3UGPA 4ZLDA 3ATPA 4U5DE 3B0VC 1LIHA 3NYMA 1YA7O 5L3VA 1W2WA 4OIPF 1PD0A 1MQVA 1ZZPA 2KQ9A 2HV6A 1AUEA 2JPUA 2XL8A 1VYKA 1EQ1A 4M63A 4DVYP 4U5EE 3AGUA 4G7HF 1ZU5A 3BRJA 1JMWA 5HV9A 1XZPA 4XEVA 1LS4A 3US6A 2QNLA 2OQMA 2Y39A 3WHNA 4YT8A 2XLOA 4U5GA 1RMVA 3QTHA 2ASRA 3K1HA 3LEVA 4RDAA 3S84A 3F46A 3QVYA 2Z15A 2EPNA 5AC5A 2J0WA 4ANJA 1PCXA 1VLSA 5L0DA 5DS5A 1HMDA 1AEPA 3N2ZB 5KYUA 2KK1A 5A6KA 1IZMA 1T5OA 4A4AA 2V26A 1LM3B 1OR3A 2M64A 3EG9A 5AC4A 1HW1A 5L0GA 3F47A 1Z63A 3ASOC 2CW0F 1WWPA 2ZXWC 4E0IA 2OEVA 2OKUA 4C3DA 2Y3GA 1O3UA 1MMDA 2ZD9A 4WABA 4AE4A 4DBQA 3A9CA 3G4ZA 5L0CA 4N6CA 1G4WR 4PACA 3EQLF 4GYTA 3L1MA 1LS1A 3M1CB 1OCOC 4PFPA 3V5YA 1QSPA 4DRIB 3UGOA 1OCCC 3EJNA 2NPUA 3DWWA 3NRHA 4J7YA 2L6HA 2IYLD 4LACB 4PJMA 3W8HA 3V5XA 3K7DA 3LS1A 4Z9IA 3HTKC 2CNWD 1OKKD 2D5RB 4JC7A 3W2WA 2Q9AA 3TULA 1ORJA 4U5BE 3SXYA 1KTMA 3C62A 3DKAA 2JD3A 3M79A 3LUTB 3W8IA 2YLIA 3LLKA 2J0XA 2PX3A 2HJ3A 2CGEA 1ZVZA 3QW0A 3DI5A 4W8KA 3I5QA 3J06A 5L0IA 3TK0A 2J9UA 4XQ1A 2NUTB 1DOVA 2QY9A 4NC3A 5L3QA 3NKEA 2D4UA 2XM4A 4U5CE 1TWGA 5L0HA 3S90A 2XM0A 2R7WA 3RIPA 1NU9C 3VYWA 4C3EA 5TJ5E 1LE2A 2G62A 2J9VA 2LFFA 2VASA 3C8GA 3U0CA 4EIYA 3T6JA 4MNDA 2IOQA 2Y3BA 4OD4A 2YHSA 1R4TA 2H7VC 4YL0A 2AVKA 1OCRC 3EHNA 2XLHA 5L0JA 4NCQA 4ULVA 3SXKA 1Z5ZA 5BQHA 3EFOA 4CS8A 3C63A 4OIQF 4E7SA 1WGWA 3CSKA 3GEHA 1A7EA 4XTKA 3RW0A 4KBLA 4MVRA 4C7OA 4G7OF 2YLDA 4PR9A 3AG4C 1K40A 3CAXA 3KYJA 3RVYA 3MYIA 3HJCA 5KYUB 3K33A 4YT2A 3EG9B 3FOPA 4XLNF 3FDQA 1LE4A 3ECSA 2XSEA 3IQTA 4IRUA 1SZIA 4JCHA 4YK5A 2F22A 3IQCA 4NTAA 3RVZA 4CX9A 4EBJA 4F4BA 1ZHYA 4XPYA 5DS4A 1EKYA 3GODA 4AE4B 2KYHA 4DBRA 4JTCB 4OINF 1T01A 1D0XA 2XLEA 3FVYA 5B3SC 2NSFA 2WL8A 4YJWA 1T6IA 3K1IC 4BPMA 4CSAA 1SMYF 2E87A 3TOMA 2YEVA 4IJJA 1B68A 1OXKA 5E33A 4CBEA 2PF4E 2WZGA 5DS6A 3IPMO 2B0HA 2BL2A 3S0XA 3NDBB 5JP7A 4MW3A 3H2VA 2IXNA 2YQYA 4HE8D 4AK9A 4MQ9F 1VMAA 2HUJA 2NUPA 3AGTA 3NMJA 1C02A 1QVXA 2EILC 3K6BA 4Q7CA 5D92A 2C03A 2UUIA 2HV7A 1E2XA 2KJGA 1O87A 2P6VA 4L6RA 1OR2A 4HFFB 2GFHA 3DMDA 1JR8A 3C8GB 1JOGA 3HLZA 1GM5A 2EIMC 3JZ0A 3ZC4A 3ZSUA 4Z9JA 3GM3A 4GEHA 1I5NA 4ULWA 2EPLX 2ZPAA 3IHUA 5KYNA 3EFOB 4WGZA 3TJ5A 1RJ9A 3OWTA 3U2LA 1ZW2A 2DGJA 2QUPA 2QTVA 2R7VA 2A0BA 4XWJA 4C7OB 1QPUA 4FESA 3B71A 2G3VA 1TWCA 1U89A 3Q7LA 2O9XA 4PJLA 3WG7C 1F1MA 4ONSA 4FX5A 5CI8A 1NFOA 2DI3A 1E84A 3LAYA 3N0TA 3UMHA 3VM6A 2XXAA 3DM9B 1TWHA 3KYIA 5DVWA 4MTFA 1M57C 4YL1A 3W4YA 3LNRA 1L3PA 2AWCA 3SXMA 3AJMA 5JLIA 4HFKB 4JKVA 3SXZA 2I15A 1G8XA 1MNDA 1V4AA 2GWWA 2XLVA 3QW1A 1M6TA 3KL4A 4JEBA 4N6HA 3RQGA 2B0JA 2YWAA 4DRJB 1H9TA 3ABLC 1VTMP 2P1AA 1KU2A 3EPVA 3M4BA 1J8YF 1FR0A 3DM5A 1NZEA 2JX0A 2FAPB 3ABMC 4WGYA 4NTFA 4X0RA 4IWBA 3ZTZA 4BEJA 2KNHA 3UNGC 1RCPA 2EPKX 4MVZA 3X1OA 1V74B 1YARO 2OCCC 2LSEA 2W4MA 2P7VA 256BA 1YAUO 3LEOA 2PNOA 2YVKA 4BJ6A 3U2MA 2UUHA 3AQCA 3TOLA 1C03A 2DYRC 4ZLCA 1WATA 3ZVRA 3G4XA 1QZXA 4H4KC 2NUPB 5DLJA 2MHRA 2W9YA 4YWQA 3HNKA 3T6GB 3B29A 4E17A 5B1AC 5DQTA 4LDRA 3HKKA 3TD7A 4P9FA 3CEXA 4CS9A 1FFHA 4JE9A 2J7PA 1A7VA 3G50A 2L6FA 4JIOA 4FAPB 1T9KA 3ITFA 2Y3HA 3MFNA 2HFIA 4BJTA 3PDMP 3S9OA 3GWNA 3NYLA 1A7DA 1FFTC 4RD9A 2X0CA 4O6MA 4N4WA 4MVMA 4LERA 1RJ9B 4K7BA 2HSBA 2LFDA 2VCBA 2WVQA 3GANA 3NG1A 4D4NA 2GA0A 1R5ID 4G7ZF 3NMKA 4JRZA 4PK4A 5A6JA 2IXMA 2A0UA 4IARA 4P9TA 3RFYA 5JT4A 1ORSC 3DZAA 3ABKC 3DXJF 3B9QA 3E70C 4D4XA 5BQIA 1NG1A 3FAPB 3UMIA 2XXAB 1AVOB 2Y69C 3RKOF 3FMSA 2CDQA 4JURI 4XPXA 5JS5A 2R7RA 3H65A 5A69A 5JVEA 2WZLA 1OW6A 3PCVA 5B1BC 3SEOA 2A68F 5JRAA 3MX3A 1BR4A 1OCZC 1CGNA 2IBFA 2L9JA 3DE8A 4LDQA 1NLXA 2YL1A 1D0YA 4XPWA 5EK0A 4BJ5A 2P61A 2AU5A 4CS8C 1OXBA 1ZHWA 1LI7A 1YLMA 1YDIA 1GS9A 1M2OA 1I4ZA 2HSQA 3EH1A 4A2NB 3HNJA 5A6BA 2GDCA 1YZCA 1WASA 2HS5A 4O7GA 1Q0DA 2KGOA 2MYSA 1ZU4A 1APCA 1FMWA 1VOMA 3JT1A 1U6HA 3LJBA 2Q00A 1TKNA 3LS0A 3ZQVA 4Q4ZF 4NQFA 4WJ0A 4AL0A 1D1AA 1TR2A 3K66A 1YJGA 1S7ZA 1V54C 4I1OB 5KYWA 5E3AA 5F28E 2XS1A 4IAOA 3FOOA 4JW1A 2TMVP 1OKKA 2J9WA 1A0BA 2WVOA 4DVZA 4OD5A 5COMA 4J7TA 4JTDB 4IB4A 4O6NA 4GQHA 3TQOA 4DRHB 3L0IA 2A6EF 3WODF 4EWCA 3O39A 2IM8A 4MVQA 3MBGA 4K1OA 2CYDA 4CSAC 4K0DA 1Z7Qc 3IQ6A 5GPGB 1NU7D 1Q0FA 2R9RB 2PP4A 5JSLA 2J9BA 3O55A 1EA8A 1LI5A 3L8IA 3U5SA 1FAPB 4OIOF 1NFNA 4JVSA 2R7SA 4G0HA 1FTSA 1OQCA 4CJOA 3AQBA 3U3FA 4DOZA 4IAQA 3X2QC 5BQGA 2OU6A 5COGA 3EHMA 1U0BB 5B3IA 4XLPF 2OJQA 1N1CA 3AOUA 2IXOA 4U9DA 1YA9A 2H7BA 4LDKA 3AG1C 3B0PA 3ZG1A 2LK4A 3NKDA 3EGDA 2R03A 2I8BA 1BBHA 3QVZA 4YT4A 3KH2A 1JPNA 3NYJA 4PJJA 3JYHA 3M15A 2BC5A 4J32B 1ZW3A 3AG3C 1MMGA 1VYIA 3S27A 3EGXA 3HNLA 4CIPA 1FMVA 1T6QA 2VCCA 3UMKA 3V7OA 5BUOA 3S29A 4JZAA 4AL1A 2QLAA 4CDAA 5IY5C 4KC9A 3AG2C 3LLIA 2AP3A 1MMAA 4C3BA 3ZQYA 4DXWA 3PHF2 5DQZA 4MVUA 5T3WA 3I5PA 3OA1A 4LLEA 4E7ZA 2ETSA 3R7CA 3T6BA 1HE9A 5KYXA 3T4RA 1JRAA 3JRMO 1YYJA 4Q5SF 2R7QA 2ZXPA 3PMRA 4W8PA 4BG0A 3ZWIA 3EH2A 2A69F 3LNMB 1SR2A 4QDLA 3IQ5A 4HEAJ 1H6GA 2Q9CA 4KNVA 4E0HA 2V3CC 3DE9A 5KYYA 2J8WA 1TFOB 2EIJC 2X51A 2ZXRA 2HZ8A 4JJGA 5KYWB 4KNWA 3T9OA 2L81A 1WN0A 2LP4A 4EBKA 4NTBA 2OJED 4MW8A 2XLDA 5A6AA 2Q4FA 2Q3TA 2EPOA 1TFKB 1ZHTA 3CQZA 1E86A 2XLMA 1BDJB 4J30B 1M2VA 3GEIA 1FNTc 3ASNC 3SZRA 2L7AA 5T3TA 3MLGA 4PFOA 2KC3A 3SYNA 3C8GD 1SF8A 3RF3A 3RQEA 1SYQA 2Y3DA 3M4CA 4LLCA 1E85A 5AGFA 2M4EA 2L6GA 3VAYA 1K04A 4BEMJ 1OW7A 1L7CA 2DYSC 2QE9A 3EZHA 4JCZA 4N06A 4I1MA 1CGME 2R02A 1HY5A 3JCUQ 4BJ6C 3U8VA 5E2QA 3FAJA 2BE5F 1Y6DA 2AWYA 1Z3IX 3GM2A 3RQFA 1HW2A 1JAFA 2XL4A 3FXHA 4MTOA 1QQ3A 5D91A 3EGDB 1RKEA 1H7IA
chains in the Genus database with same CATH topology
3C18A 1OW8A 2PBEA 1O3UA 1ZZPA 3B71A 1K05A 2JPUA 3L8IA 2HSBA 3C8GD 3MFNA 1QVXA 4R32A 1KNYA 3U3FA 4EBJA 3RQEA 3BRJA 3C8GA 3U0CA 4XEVA 2Q00A 2L6GA 4NQFA 1K04A 3GM1A 1OW7A 3AJMA 2L6HA 1UFBA 3C8GB 1JOGA 3K7DA 1V4AA 2LK4A 5F28E 3JZ0A 3TULA 3O10A 3L8JA 1WOLA 3RQGA 3GM3A 2YWAA 2KK1A 3GM2A 3RQFA 1OW6A 3JYYA 2L6FA 1PV3A 1KTMA 4XEKA 4XEFA 1WTYA 4EBKA 1WWPA 1K40A 3S9OA 2JX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C18 A;  1OW8 A;  2PBE A;  1O3U A;  1ZZP A;  3B71 A;  1K05 A;  2JPU A;  3L8I A;  2HSB A;  3C8G D;  3MFN A;  1QVX A;  4R32 A;  1KNY A;  3U3F A;  4EBJ A;  3RQE A;  3BRJ A;  3C8G A;  3U0C A;  4XEV A;  2Q00 A;  2L6G A;  4NQF A;  1K04 A;  3GM1 A;  1OW7 A;  3AJM A;  2L6H A;  1UFB A;  3C8G B;  1JOG A;  3K7D A;  1V4A A;  2LK4 A;  5F28 E;  3JZ0 A;  3TUL A;  3O10 A;  3L8J A;  1WOL A;  3RQG A;  3GM3 A;  2YWA A;  2KK1 A;  3GM2 A;  3RQF A;  1OW6 A;  3JYY A;  2L6F A;  1PV3 A;  1KTM A;  4XEK A;  4XEF A;  1WTY A;  4EBK A;  1WWP A;  1K40 A;  3S9O A;  2JX0 A; 
#chains in the Genus database with same CATH topology
 1MNE A;  1V55 C;  3WAQ A;  1OW8 A;  4CS9 C;  4OIR F;  2RD9 A;  1TWA A;  2XLW A;  5A6B D;  3GWL A;  2W45 A;  3EGX B;  1ZHZ A;  2R25 A;  2FGY A;  1MMN A;  2RSE B;  2YKZ A;  1KNY A;  2LQG A;  3JSZ A;  3Q6N A;  2YRF A;  1VK5 A;  1NSG B;  3CZ6 A;  2R7X A;  1RKC A;  1YVI A;  4BJ1 A;  1TQG A;  1UG7 A;  1J8M F;  4H54 A;  2VC9 A;  4RBN A;  2W4B A;  1HE1 A;  3L34 A;  2VB6 A;  4QI2 A;  4O6Y A;  2HKV A;  3DJN B;  1E83 A;  2A6H F;  2R7U A;  3S28 A;  5KYX B;  5F5F A;  1C17 M;  4I3M A;  3A11 A;  4YT5 A;  2OEX A;  2OG2 A;  4NY3 A;  5HSW A;  3E9V A;  3JYY A;  2YZS A;  5L0F A;  2KSF A;  1Q0M A;  3KMI A;  2HMQ A;  1WTY A;  2CCY A;  1Z23 A;  2KW3 C;  1CGO A;  2WVN A;  4IGG A;  4XEF A;  4I44 A;  3UR3 C;  3VRC A;  4CIH A;  1O5H A;  5KYY B;  3C7J A;  2PBE A;  2XS8 A;  2YL7 A;  5CI9 A;  3O6X A;  4CDY A;  3B0U X;  1K05 A;  4AX2 A;  1BR1 A;  2YL3 A;  3ZIB A;  4KI2 A;  4U5F E;  4EUK B;  2LIG A;  3DD7 A;  5F5H A;  2LCH A;  3U9J A;  3ZTM A;  1ST6 A;  1YZA A;  3QMK A;  4YL3 A;  3I4U A;  4BJ5 C;  1D0Z A;  1M2V B;  3ZDL A;  2C04 A;  2EPM X;  2YLG A;  2WB7 A;  3JRT A;  1S05 A;  1T6U A;  3GM1 A;  4EBB A;  2HMZ A;  1NBB A;  3GEE A;  4YN0 B;  5EHH A;  2PFD A;  3L8J A;  3IEE A;  2YL0 A;  3KPH A;  4G78 A;  5JUA A;  1LKX A;  1PD1 A;  2CNW A;  3W2V A;  1PV3 A;  1VLT A;  1Y4C A;  2GAQ A;  1LVK A;  3DJU B;  3Q7G A;  2H8A A;  2H7O A;  4P6I C;  4U9E A;  4Z9H A;  2PX0 A;  1RXQ A;  3N24 A;  3C18 A;  1A41 A;  1EI7 A;  2VH3 A;  3NMI A;  3MYF A;  3SP1 A;  1CPQ A;  3HNI A;  1YYX A;  2DB4 A;  3GOR A;  3Q6M A;  2ZXO A;  1IW7 F;  4QI0 A;  1RKE B;  3K1I A;  3U9M A;  1H9G A;  2R05 A;  4FWV A;  4U5H A;  1D1C A;  2ICW G;  1GQA A;  4JTA B;  4JEA A;  1Q0G A;  3U8P A;  1CPR A;  2G3K A;  1LPE A;  4DJ9 A;  1Q0K A;  2VCA A;  3OEO A;  5T1D B;  3POV A;  4EHP A;  2A1D D;  2MWQ A;  5CIV A;  1XWJ A;  1M56 C;  3QZC A;  3U3B A;  3EZI A;  3R2P A;  4CJG A;  3H2U A;  4JJF A;  1BR2 A;  5FZT A;  1WOL A;  4MVO A;  4O79 A;  4UDV A;  3DAF A;  3V5Z A;  1ZHX A;  3LES A;  1Z6A A;  2LD6 A;  2Q9B A;  4MS2 A;  2EIN C;  2J46 A;  5K0I A;  4CS7 A;  1DOW A;  1GGQ A;  1I4Y A;  3SNH A;  4B6I A;  4PJN A;  1D1B A;  3FHD A;  3KKB A;  5FCL A;  3TJ6 A;  2NG1 A;  1G5Z A;  2J45 A;  3RYL A;  2EIK C;  4R32 A;  2WZF A;  3JSE O;  3VF0 A;  1ZYR F;  1G4U S;  4ER9 A;  2R7T A;  1JPJ A;  1QLE C;  5EGY A;  1QKR A;  3BEH A;  5E3C A;  2HJM A;  2OOC A;  5COF A;  1VB5 A;  2IXP A;  1UFB A;  2Q7R A;  1HMO A;  4CDV A;  3RH3 A;  3O10 A;  1ORY A;  4E18 A;  2J7P D;  2XL6 A;  2FFH A;  2P0N A;  1XZQ A;  3JTL O;  4MVS A;  2NUT A;  3DAG A;  1BZ4 A;  4EKW A;  2NSG A;  2R7O A;  4XEK A;  4MTG A;  2XRH A;  3C8Z A;  3UGP A;  4ZLD A;  3ATP A;  4U5D E;  3B0V C;  1LIH A;  3NYM A;  1YA7 O;  5L3V A;  1W2W A;  4OIP F;  1PD0 A;  1MQV A;  1ZZP A;  2KQ9 A;  2HV6 A;  1AUE A;  2JPU A;  2XL8 A;  1VYK A;  1EQ1 A;  4M63 A;  4DVY P;  4U5E E;  3AGU A;  4G7H F;  1ZU5 A;  3BRJ A;  1JMW A;  5HV9 A;  1XZP A;  4XEV A;  1LS4 A;  3US6 A;  2QNL A;  2OQM A;  2Y39 A;  3WHN A;  4YT8 A;  2XLO A;  4U5G A;  1RMV A;  3QTH A;  2ASR A;  3K1H A;  3LEV A;  4RDA A;  3S84 A;  3F46 A;  3QVY A;  2Z15 A;  2EPN A;  5AC5 A;  2J0W A;  4ANJ A;  1PCX A;  1VLS A;  5L0D A;  5DS5 A;  1HMD A;  1AEP A;  3N2Z B;  5KYU A;  2KK1 A;  5A6K A;  1IZM A;  1T5O A;  4A4A A;  2V26 A;  1LM3 B;  1OR3 A;  2M64 A;  3EG9 A;  5AC4 A;  1HW1 A;  5L0G A;  3F47 A;  1Z63 A;  3ASO C;  2CW0 F;  1WWP A;  2ZXW C;  4E0I A;  2OEV A;  2OKU A;  4C3D A;  2Y3G A;  1O3U A;  1MMD A;  2ZD9 A;  4WAB A;  4AE4 A;  4DBQ A;  3A9C A;  3G4Z A;  5L0C A;  4N6C A;  1G4W R;  4PAC A;  3EQL F;  4GYT A;  3L1M A;  1LS1 A;  3M1C B;  1OCO C;  4PFP A;  3V5Y A;  1QSP A;  4DRI B;  3UGO A;  1OCC C;  3EJN A;  2NPU A;  3DWW A;  3NRH A;  4J7Y A;  2L6H A;  2IYL D;  4LAC B;  4PJM A;  3W8H A;  3V5X A;  3K7D A;  3LS1 A;  4Z9I A;  3HTK C;  2CNW D;  1OKK D;  2D5R B;  4JC7 A;  3W2W A;  2Q9A A;  3TUL A;  1ORJ A;  4U5B E;  3SXY A;  1KTM A;  3C62 A;  3DKA A;  2JD3 A;  3M79 A;  3LUT B;  3W8I A;  2YLI A;  3LLK A;  2J0X A;  2PX3 A;  2HJ3 A;  2CGE A;  1ZVZ A;  3QW0 A;  3DI5 A;  4W8K A;  3I5Q A;  3J06 A;  5L0I A;  3TK0 A;  2J9U A;  4XQ1 A;  2NUT B;  1DOV A;  2QY9 A;  4NC3 A;  5L3Q A;  3NKE A;  2D4U A;  2XM4 A;  4U5C E;  1TWG A;  5L0H A;  3S90 A;  2XM0 A;  2R7W A;  3RIP A;  1NU9 C;  3VYW A;  4C3E A;  5TJ5 E;  1LE2 A;  2G62 A;  2J9V A;  2LFF A;  2VAS A;  3C8G A;  3U0C A;  4EIY A;  3T6J A;  4MND A;  2IOQ A;  2Y3B A;  4OD4 A;  2YHS A;  1R4T A;  2H7V C;  4YL0 A;  2AVK A;  1OCR C;  3EHN A;  2XLH A;  5L0J A;  4NCQ A;  4ULV A;  3SXK A;  1Z5Z A;  5BQH A;  3EFO A;  4CS8 A;  3C63 A;  4OIQ F;  4E7S A;  1WGW A;  3CSK A;  3GEH A;  1A7E A;  4XTK A;  3RW0 A;  4KBL A;  4MVR A;  4C7O A;  4G7O F;  2YLD A;  4PR9 A;  3AG4 C;  1K40 A;  3CAX A;  3KYJ A;  3RVY A;  3MYI A;  3HJC A;  5KYU B;  3K33 A;  4YT2 A;  3EG9 B;  3FOP A;  4XLN F;  3FDQ A;  1LE4 A;  3ECS A;  2XSE A;  3IQT A;  4IRU A;  1SZI A;  4JCH A;  4YK5 A;  2F22 A;  3IQC A;  4NTA A;  3RVZ A;  4CX9 A;  4EBJ A;  4F4B A;  1ZHY A;  4XPY A;  5DS4 A;  1EKY A;  3GOD A;  4AE4 B;  2KYH A;  4DBR A;  4JTC B;  4OIN F;  1T01 A;  1D0X A;  2XLE A;  3FVY A;  5B3S C;  2NSF A;  2WL8 A;  4YJW A;  1T6I A;  3K1I C;  4BPM A;  4CSA A;  1SMY F;  2E87 A;  3TOM A;  2YEV A;  4IJJ A;  1B68 A;  1OXK A;  5E33 A;  4CBE A;  2PF4 E;  2WZG A;  5DS6 A;  3IPM O;  2B0H A;  2BL2 A;  3S0X A;  3NDB B;  5JP7 A;  4MW3 A;  3H2V A;  2IXN A;  2YQY A;  4HE8 D;  4AK9 A;  4MQ9 F;  1VMA A;  2HUJ A;  2NUP A;  3AGT A;  3NMJ A;  1C02 A;  1QVX A;  2EIL C;  3K6B A;  4Q7C A;  5D92 A;  2C03 A;  2UUI A;  2HV7 A;  1E2X A;  2KJG A;  1O87 A;  2P6V A;  4L6R A;  1OR2 A;  4HFF B;  2GFH A;  3DMD A;  1JR8 A;  3C8G B;  1JOG A;  3HLZ A;  1GM5 A;  2EIM C;  3JZ0 A;  3ZC4 A;  3ZSU A;  4Z9J A;  3GM3 A;  4GEH A;  1I5N A;  4ULW A;  2EPL X;  2ZPA A;  3IHU A;  5KYN A;  3EFO B;  4WGZ A;  3TJ5 A;  1RJ9 A;  3OWT A;  3U2L A;  1ZW2 A;  2DGJ A;  2QUP A;  2QTV A;  2R7V A;  2A0B A;  4XWJ A;  4C7O B;  1QPU A;  4FES A;  3B71 A;  2G3V A;  1TWC A;  1U89 A;  3Q7L A;  2O9X A;  4PJL A;  3WG7 C;  1F1M A;  4ONS A;  4FX5 A;  5CI8 A;  1NFO A;  2DI3 A;  1E84 A;  3LAY A;  3N0T A;  3UMH A;  3VM6 A;  2XXA A;  3DM9 B;  1TWH A;  3KYI A;  5DVW A;  4MTF A;  1M57 C;  4YL1 A;  3W4Y A;  3LNR A;  1L3P A;  2AWC A;  3SXM A;  3AJM A;  5JLI A;  4HFK B;  4JKV A;  3SXZ A;  2I15 A;  1G8X A;  1MND A;  1V4A A;  2GWW A;  2XLV A;  3QW1 A;  1M6T A;  3KL4 A;  4JEB A;  4N6H A;  3RQG A;  2B0J A;  2YWA A;  4DRJ B;  1H9T A;  3ABL C;  1VTM P;  2P1A A;  1KU2 A;  3EPV A;  3M4B A;  1J8Y F;  1FR0 A;  3DM5 A;  1NZE A;  2JX0 A;  2FAP B;  3ABM C;  4WGY A;  4NTF A;  4X0R A;  4IWB A;  3ZTZ A;  4BEJ A;  2KNH A;  3UNG C;  1RCP A;  2EPK X;  4MVZ A;  3X1O A;  1V74 B;  1YAR O;  2OCC C;  2LSE A;  2W4M A;  2P7V A;  256B A;  1YAU O;  3LEO A;  2PNO A;  2YVK A;  4BJ6 A;  3U2M A;  2UUH A;  3AQC A;  3TOL A;  1C03 A;  2DYR C;  4ZLC A;  1WAT A;  3ZVR A;  3G4X A;  1QZX A;  4H4K C;  2NUP B;  5DLJ A;  2MHR A;  2W9Y A;  4YWQ A;  3HNK A;  3T6G B;  3B29 A;  4E17 A;  5B1A C;  5DQT A;  4LDR A;  3HKK A;  3TD7 A;  4P9F A;  3CEX A;  4CS9 A;  1FFH A;  4JE9 A;  2J7P A;  1A7V A;  3G50 A;  2L6F A;  4JIO A;  4FAP B;  1T9K A;  3ITF A;  2Y3H A;  3MFN A;  2HFI A;  4BJT A;  3PDM P;  3S9O A;  3GWN A;  3NYL A;  1A7D A;  1FFT C;  4RD9 A;  2X0C A;  4O6M A;  4N4W A;  4MVM A;  4LER A;  1RJ9 B;  4K7B A;  2HSB A;  2LFD A;  2VCB A;  2WVQ A;  3GAN A;  3NG1 A;  4D4N A;  2GA0 A;  1R5I D;  4G7Z F;  3NMK A;  4JRZ A;  4PK4 A;  5A6J A;  2IXM A;  2A0U A;  4IAR A;  4P9T A;  3RFY A;  5JT4 A;  1ORS C;  3DZA A;  3ABK C;  3DXJ F;  3B9Q A;  3E70 C;  4D4X A;  5BQI A;  1NG1 A;  3FAP B;  3UMI A;  2XXA B;  1AVO B;  2Y69 C;  3RKO F;  3FMS A;  2CDQ A;  4JUR I;  4XPX A;  5JS5 A;  2R7R A;  3H65 A;  5A69 A;  5JVE A;  2WZL A;  1OW6 A;  3PCV A;  5B1B C;  3SEO A;  2A68 F;  5JRA A;  3MX3 A;  1BR4 A;  1OCZ C;  1CGN A;  2IBF A;  2L9J A;  3DE8 A;  4LDQ A;  1NLX A;  2YL1 A;  1D0Y A;  4XPW A;  5EK0 A;  4BJ5 A;  2P61 A;  2AU5 A;  4CS8 C;  1OXB A;  1ZHW A;  1LI7 A;  1YLM A;  1YDI A;  1GS9 A;  1M2O A;  1I4Z A;  2HSQ A;  3EH1 A;  4A2N B;  3HNJ A;  5A6B A;  2GDC A;  1YZC A;  1WAS A;  2HS5 A;  4O7G A;  1Q0D A;  2KGO A;  2MYS A;  1ZU4 A;  1APC A;  1FMW A;  1VOM A;  3JT1 A;  1U6H A;  3LJB A;  2Q00 A;  1TKN A;  3LS0 A;  3ZQV A;  4Q4Z F;  4NQF A;  4WJ0 A;  4AL0 A;  1D1A A;  1TR2 A;  3K66 A;  1YJG A;  1S7Z A;  1V54 C;  4I1O B;  5KYW A;  5E3A A;  5F28 E;  2XS1 A;  4IAO A;  3FOO A;  4JW1 A;  2TMV P;  1OKK A;  2J9W A;  1A0B A;  2WVO A;  4DVZ A;  4OD5 A;  5COM A;  4J7T A;  4JTD B;  4IB4 A;  4O6N A;  4GQH A;  3TQO A;  4DRH B;  3L0I A;  2A6E F;  3WOD F;  4EWC A;  3O39 A;  2IM8 A;  4MVQ A;  3MBG A;  4K1O A;  2CYD A;  4CSA C;  4K0D A;  1Z7Q c;  3IQ6 A;  5GPG B;  1NU7 D;  1Q0F A;  2R9R B;  2PP4 A;  5JSL A;  2J9B A;  3O55 A;  1EA8 A;  1LI5 A;  3L8I A;  3U5S A;  1FAP B;  4OIO F;  1NFN A;  4JVS A;  2R7S A;  4G0H A;  1FTS A;  1OQC A;  4CJO A;  3AQB A;  3U3F A;  4DOZ A;  4IAQ A;  3X2Q C;  5BQG A;  2OU6 A;  5COG A;  3EHM A;  1U0B B;  5B3I A;  4XLP F;  2OJQ A;  1N1C A;  3AOU A;  2IXO A;  4U9D A;  1YA9 A;  2H7B A;  4LDK A;  3AG1 C;  3B0P A;  3ZG1 A;  2LK4 A;  3NKD A;  3EGD A;  2R03 A;  2I8B A;  1BBH A;  3QVZ A;  4YT4 A;  3KH2 A;  1JPN A;  3NYJ A;  4PJJ A;  3JYH A;  3M15 A;  2BC5 A;  4J32 B;  1ZW3 A;  3AG3 C;  1MMG A;  1VYI A;  3S27 A;  3EGX A;  3HNL A;  4CIP A;  1FMV A;  1T6Q A;  2VCC A;  3UMK A;  3V7O A;  5BUO A;  3S29 A;  4JZA A;  4AL1 A;  2QLA A;  4CDA A;  5IY5 C;  4KC9 A;  3AG2 C;  3LLI A;  2AP3 A;  1MMA A;  4C3B A;  3ZQY A;  4DXW A;  3PHF 2;  5DQZ A;  4MVU A;  5T3W A;  3I5P A;  3OA1 A;  4LLE A;  4E7Z A;  2ETS A;  3R7C A;  3T6B A;  1HE9 A;  5KYX A;  3T4R A;  1JRA A;  3JRM O;  1YYJ A;  4Q5S F;  2R7Q A;  2ZXP A;  3PMR A;  4W8P A;  4BG0 A;  3ZWI A;  3EH2 A;  2A69 F;  3LNM B;  1SR2 A;  4QDL A;  3IQ5 A;  4HEA J;  1H6G A;  2Q9C A;  4KNV A;  4E0H A;  2V3C C;  3DE9 A;  5KYY A;  2J8W A;  1TFO B;  2EIJ C;  2X51 A;  2ZXR A;  2HZ8 A;  4JJG A;  5KYW B;  4KNW A;  3T9O A;  2L81 A;  1WN0 A;  2LP4 A;  4EBK A;  4NTB A;  2OJE D;  4MW8 A;  2XLD A;  5A6A A;  2Q4F A;  2Q3T A;  2EPO A;  1TFK B;  1ZHT A;  3CQZ A;  1E86 A;  2XLM A;  1BDJ B;  4J30 B;  1M2V A;  3GEI A;  1FNT c;  3ASN C;  3SZR A;  2L7A A;  5T3T A;  3MLG A;  4PFO A;  2KC3 A;  3SYN A;  3C8G D;  1SF8 A;  3RF3 A;  3RQE A;  1SYQ A;  2Y3D A;  3M4C A;  4LLC A;  1E85 A;  5AGF A;  2M4E A;  2L6G A;  3VAY A;  1K04 A;  4BEM J;  1OW7 A;  1L7C A;  2DYS C;  2QE9 A;  3EZH A;  4JCZ A;  4N06 A;  4I1M A;  1CGM E;  2R02 A;  1HY5 A;  3JCU Q;  4BJ6 C;  3U8V A;  5E2Q A;  3FAJ A;  2BE5 F;  1Y6D A;  2AWY A;  1Z3I X;  3GM2 A;  3RQF A;  1HW2 A;  1JAF A;  2XL4 A;  3FXH A;  4MTO A;  1QQ3 A;  5D91 A;  3EGD B;  1RKE A;  1H7I A; 
#chains in the Genus database with same CATH homology
 3C18 A;  1OW8 A;  2PBE A;  1O3U A;  1ZZP A;  3B71 A;  1K05 A;  2JPU A;  3L8I A;  2HSB A;  3C8G D;  3MFN A;  1QVX A;  4R32 A;  1KNY A;  3U3F A;  4EBJ A;  3RQE A;  3BRJ A;  3C8G A;  3U0C A;  4XEV A;  2Q00 A;  2L6G A;  4NQF A;  1K04 A;  3GM1 A;  1OW7 A;  3AJM A;  2L6H A;  1UFB A;  3C8G B;  1JOG A;  3K7D A;  1V4A A;  2LK4 A;  5F28 E;  3JZ0 A;  3TUL A;  3O10 A;  3L8J A;  1WOL A;  3RQG A;  3GM3 A;  2YWA A;  2KK1 A;  3GM2 A;  3RQF A;  1OW6 A;  3JYY A;  2L6F A;  1PV3 A;  1KTM A;  4XEK A;  4XEF A;  1WTY A;  4EBK A;  1WWP A;  1K40 A;  3S9O A;  2JX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...