2L6GA

Fat-ld2 double labeled construct with free ld4 peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
161
Chain Sequence
MANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPHSNLSELDRLLLELNAVQHNPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Focal adhesion kinase 1, linker, Paxillin
publication title Fat-Ld2 Double Labeled Construct with Free Ld4 Peptide
rcsb
source organism Gallus gallus, unidentified
molecule tags Transferase,cell adhesion
total genus 56
structure length 161
sequence length 176
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2l6gA00
4XEFA 1WTYA 1OW6A 2JPUA 4XEKA 2KK1A 1WWPA 1UFBA 3GM3A 3U0CA 3AJMA 3C18A 4NQFA 2L6FA 3RQEA 1K04A 3L8JA 4R32A 3GM2A 1QVXA 2JX0A 3RQFA 1V4AA 1WOLA 1ZZPA 3JYYA 3C8GD 3C8GB 2LK4A 3L8IA 3MFNA 1KNYA 3B71A 3C8GA 3O10A 3JZ0A 1K05A 1OW7A 3K7DA 4XEVA 3TULA 2YWAA 2Q00A 3RQGA 2HSBA 5F28E 3GM1A 3U3FA 1K40A 3S9OA 2L6HA 1JOGA 1PV3A 3BRJA 4EBKA 1OW8A 4EBJA 1KTMA 2PBEA 1O3UA 2L6GA
chains in the Genus database with same CATH superfamily
3ASOC 2XLHA 1RJ9B 2JPUA 2QTVA 4GQHA 4E18A 3JYHA 5B3IA 2VASA 2R9RB 5IY5C 1E84A 3SP1A 1L3PA 1ORYA 1TQGA 3S28A 3L8JA 3SYNA 3AGTA 2R7OA 1FFTC 4EKWA 2H8AA 2R03A 1Q0FA 1JPJA 3JRTA 1WATA 1T6IA 5KYUA 5CIVA 1WGWA 1A7VA 3DZAA 2R7SA 2WZFA 3JSZA 2J0WA 3L34A 4DVYP 2C03A 3VM6A 5KYNA 4AX2A 1RCPA 1OW7A 3I5PA 2IXNA 4MTFA 4W8KA 2KW3C 2YLGA 2D5RB 2P0NA 4RD9A 2XLOA 3FOOA 1RKEA 3VYWA 3X2QC 4O6YA 5B1AC 5F5HA 4EHPA 4BJ5C 2VC9A 1OCZC 3EH1A 3EZIA 1K40A 4AE4A 1PD0A 3JT1A 3DXJF 4L6RA 1A7EA 4WGYA 4PK4A 4EBJA 4E7SA 2QNLA 1C17M 1NFOA 4NTFA 1E85A 1VTMP 1C03A 2Y3DA 1D0ZA 3DM9B 4NQFA 2OU6A 4OD4A 3RQEA 3FVYA 1D1AA 2X0CA 1LI5A 3LJBA 1R4TA 4MNDA 3AOUA 2ICWG 1JAFA 1YYXA 3NMIA 1C02A 3L0IA 4KI2A 2XS8A 4MTOA 4EBBA 1VK5A 5E33A 2QY9A 3F46A 2ASRA 2VCAA 3K1HA 4K1OA 4LACB 4YL0A 5HSWA 1O87A 1LVKA 3US6A 3OEOA 4HFKB 2KNHA 1VLTA 1JR8A 5DS5A 5COGA 5F28E 4DBQA 4I44A 5JP7A 4JURI 3FHDA 4MVZA 3W4YA 2EPKX 1TKNA 3ABLC 4CBEA 4Q7CA 4CS9C 4JEBA 2TMVP 1TWCA 2OEVA 2ZXWC 3ATPA 3MBGA 4HFFB 3U8VA 2NG1A 2XLWA 5DQZA 4IGGA 2J45A 1U6HA 2A0BA 2GA0A 1JRAA 1K04A 4C3EA 2KJGA 4NTBA 2NSFA 2J9UA 3CZ6A 256BA 3EFOB 1UG7A 1M56C 5JUAA 2XXAA 1WOLA 1XZQA 2KGOA 3JYYA 4PFPA 4H4KC 3V5ZA 4J7TA 4E0HA 2HSQA 2IXMA 3LS1A 3NMJA 4C7OA 2G3KA 2DYRC 4IB4A 1L7CA 2EINC 1ZHYA 5EGYA 1CPRA 1M6TA 2HZ8A 4QDLA 5L0GA 4XPWA 1LPEA 1MMDA 3RFYA 3S9OA 3ZC4A 1G4US 2OKUA 1MNEA 4XLNF 1ZHXA 1V54C 3ZVRA 4OIPF 1KTMA 2HV7A 1SYQA 2A1DD 2EIMC 2L6GA 3EH2A 3UNGC 4D4NA 5DVWA 5A6JA 4N06A 1APCA 2PNOA 2J7PA 2WVOA 4N4WA 1LS4A 1FAPB 1VYIA 3KYJA 3ABKC 5JT4A 2YL7A 3UGPA 3ECSA 2Q7RA 3W8IA 4DRJB 2AP3A 2A0UA 4QI2A 4U9EA 3DI5A 4UDVA 2CNWD 3EGXB 4U5EE 4OIQF 1QZXA 1H6GA 5EK0A 5TJ5E 3W8HA 4YN0B 3ASNC 4XEVA 5B3SC 2UUIA 1FFHA 2YWAA 2Y3BA 1YZCA 2LCHA 3AG4C 1G5ZA 1GQAA 1ZU5A 3F47A 1D0XA 2BE5F 3LEOA 3LESA 4X0RA 3B29A 5CI8A 2YQYA 2L6HA 1QSPA 4Z9IA 3EGDB 3FAPB 3ZQVA 5JLIA 1OW8A 3MYIA 3LNMB 1Z63A 5A6AA 2OCCC 2W9YA 2G62A 1OQCA 4AK9A 4YT5A 3EHNA 5DLJA 1I5NA 1OW6A 3S27A 1A7DA 5HV9A 3DJNB 2XLMA 5BQIA 1RKCA 4JTAB 2Q3TA 2LP4A 3QVZA 5KYXB 1V74B 2LFFA 4RDAA 5E3AA 3AG3C 1OR3A 1LE4A 1SR2A 3AQCA 3C62A 3ZWIA 1QVXA 1J8YF 1S7ZA 1M2VA 2P61A 3ITFA 1HY5A 4FX5A 3L1MA 4JVSA 3C8GD 2YL0A 1D1CA 2KQ9A 3MFNA 3IQTA 4FESA 3HKKA 5BQGA 4EUKB 3X1OA 5EHHA 2R7XA 1HMOA 1ZHZA 2NUPA 4HE8D 4MVQA 2FGYA 1RJ9A 4YK5A 3MX3A 3SNHA 3N2ZB 1GS9A 1Q0KA 2OJQA 2XSEA 1LS1A 3U2LA 4FWVA 1F1MA 2H7BA 3IEEA 2YKZA 1VMAA 4MVMA 4C3BA 5DS6A 4ZLDA 5JVEA 3QW1A 2IOQA 1SZIA 2VCCA 3GEEA 3K6BA 4JW1A 4MVSA 4CX9A 1FNTc 1MQVA 3SXKA 4A4AA 1FMVA 2CW0F 4Q5SF 4KNWA 1A0BA 4R32A 4KC9A 4YL3A 2J46A 4J30B 4IWBA 3RVYA 2XL4A 2HV6A 3FOPA 1ZU4A 4EWCA 2OJED 1QPUA 5L0DA 4CDYA 2LSEA 3C8ZA 2L7AA 3M1CB 2Y3HA 3QW0A 4NY3A 3NKDA 3RQFA 1W2WA 1OXBA 1WASA 2R7TA 2MWQA 4K0DA 2HFIA 4PACA 2XS1A 3B9QA 2AU5A 2EPMX 3E70C 3UMKA 5L0HA 5L0IA 3TULA 4PJMA 4U9DA 5KYWA 3V5YA 1BR1A 2Y3GA 5E3CA 5KYYB 4JZAA 1J8MF 3IQ6A 1ZW3A 2BC5A 3QTHA 4LLEA 4YT4A 3SXMA 3PCVA 4O79A 1IZMA 1OCOC 1RXQA 4ZLCA 4OINF 3KL4A 3GWLA 1O3UA 1BZ4A 5T3TA 4BPMA 5B1BC 4JJGA 1Q0MA 3G4XA 3R2PA 2Q9BA 1BR4A 3ZIBA 2QLAA 2R7RA 5JS5A 2EIKC 3NKEA 3T9OA 5A6BA 4C3DA 3HLZA 2YVKA 3NMKA 3FXHA 2Q9AA 3LS0A 3AGUA 1LI7A 2JX0A 3GM2A 5E2QA 3CQZA 4MW3A 3TOLA 4BJ5A 2MHRA 2WL8A 3HJCA 4ANJA 4YT2A 1CGOA 2ZXPA 3CEXA 3EG9B 3IPMO 3N0TA 4OIOF 3DKAA 3IHUA 3NYJA 5T3WA 1XWJA 4CDVA 1ZHWA 3B0PA 2Q00A 4O7GA 4GEHA 4AL0A 3WAQA 3A11A 1ZYRF 1T6QA 1OKKA 1Q0DA 4Z9HA 3Q7LA 2EPNA 4CS7A 4I1MA 4BEJA 4CIPA 1E83A 3HTKC 4CDAA 1VB5A 1MMGA 2MYSA 1E86A 2R7QA 3S29A 4XEFA 1RKEB 1HE1A 4CJGA 4E7ZA 2JD3A 1LE2A 3AJMA 2ZXOA 2A69F 2PFDA 2I8BA 2YEVA 4LDKA 4AE4B 2J9BA 4BJTA 4YT8A 2XLDA 1ST6A 4G78A 4DRHB 5DS4A 1T5OA 4LDRA 5A69A 1NFNA 3T6GB 1QLEC 4JCHA 4GYTA 1ZZPA 2YL3A 2YRFA 4LERA 1T6UA 4MVUA 2EPOA 3G4ZA 2HKVA 3JZ0A 4CS9A 1CGME 3K7DA 2EIJC 2WZLA 3AG2C 3N24A 5CI9A 2L81A 4JJFA 1HE9A 2G3VA 3U3FA 2Y69C 2OQMA 2XL8A 4U5DE 4WGZA 3QVYA 4NC3A 1PV3A 1HW1A 3DD7A 3H2UA 3M4BA 3QZCA 2QUPA 4D4XA 2J0XA 3WHNA 1YVIA 2B0HA 3GEIA 3EGXA 1ORJA 1TR2A 1WTYA 4QI0A 4DBRA 2P1AA 3U0CA 4N6CA 4P9TA 4XPYA 3EHMA 3H2VA 1PCXA 3TJ5A 2R7WA 1ZVZA 3HNIA 4I3MA 1H9GA 2DI3A 2X51A 1BBHA 3AQBA 3SZRA 2AVKA 3LAYA 4B6IA 3EGDA 2Q9CA 1EI7A 1FR0A 4CS8C 3DWWA 3EQLF 4AL1A 5AC5A 4J7YA 4U5CE 3EZHA 1XZPA 2L9JA 4P6IC 2W45A 3KMIA 3K66A 1TFOB 4NCQA 5FCLA 2XXAB 3LNRA 2VCBA 3LLKA 3M79A 3NG1A 3Q6NA 3EJNA 2E87A 3CSKA 5KYXA 3PHF2 2M64A 4F4BA 2V3CC 3I5QA 3DAFA 1TWAA 2PBEA 2HMZA 2NSGA 2VH3A 3C8GB 3U9MA 4CJOA 1M2OA 1NBBA 2XL6A 1M57C 1WWPA 3S84A 3SXZA 3B0UX 3C7JA 4DXWA 2L6FA 2O9XA 1ZW2A 5JSLA 2XLEA 1JMWA 2D4UA 5COFA 4BJ6C 2WB7A 2H7VC 4Z9JA 1NG1A 1DOWA 2NUTA 4JRZA 4E17A 1TWGA 2A68F 3U2MA 3FAJA 2DGJA 4ULWA 4XTKA 1BDJB 2PX0A 3O10A 4CSAA 1G4WR 3S90A 5D92A 1MMNA 3ZQYA 3FDQA 1OXKA 4DRIB 1V55C 5L3QA 3PMRA 3GM1A 4I1OB 2IXOA 1BR2A 1A41A 3RYLA 3VAYA 1AUEA 1NSGB 1EA8A 3DE9A 4IJJA 1O5HA 2GFHA 2YLDA 3RH3A 3JCUQ 3M4CA 4EIYA 5K0IA 2ZXRA 2J7PD 4A2NB 3B0VC 5L0FA 2CGEA 4M63A 4FAPB 3ABMC 1IW7F 3EPVA 5KYYA 3HNKA 3K1IC 2RD9A 4MTGA 2HS5A 4CSAC 3LLIA 3IQ5A 4PJJA 4IAQA 3MYFA 3GORA 3KYIA 4CIHA 4MS2A 2LK4A 1PD1A 1T9KA 4ULVA 2PP4A 2ZD9A 3T4RA 5BUOA 3RKOF 1YA9A 1HMDA 5AC4A 1LIHA 1Z23A 1RMVA 2W4BA 2PX3A 4N6HA 1SF8A 2XRHA 1M2VB 3UR3C 2Y39A 4LDQA 3TK0A 2KC3A 3AG1C 5COMA 5L0CA 2W4MA 4Q4ZF 2R25A 4WABA 2LD6A 4PR9A 2HUJA 3K33A 3FMSA 4KNVA 2XLVA 2XM0A 2YHSA 1G8XA 3EG9A 5L3VA 4XPXA 1FTSA 3GEHA 1NU9C 1OCRC 2P7VA 4XQ1A 2YL1A 1DOVA 5JRAA 1YJGA 2R02A 2GAQA 4JIOA 4U5GA 1YYJA 4G0HA 3ZTZA 1R5ID 4JTCB 2P6VA 2C04A 4P9FA 3V5XA 1ZHTA 2IXPA 3HNJA 2LQGA 2OG2A 1NU7D 4DOZA 1OCCC 1YDIA 1NLXA 3ZSUA 4YWQA 4JCZA 3RQGA 4DJ9A 1YA7O 4ER9A 3SEOA 5KYUB 1EQ1A 4PJLA 4J32B 4NTAA 4EBKA 2H7OA 2WVQA 4MVRA 3RF3A 3NYLA 3EFOA 4BG0A 5KYWB 2RSEB 4HEAJ 3U3BA 2KK1A 4YJWA 1KU2A 3OWTA 3KPHA 1VYKA 4RBNA 2J9WA 3E9VA 2GDCA 2CYDA 2M4EA 2ZPAA 4O6MA 2A6EF 1V4AA 4E0IA 3UMHA 3UMIA 3JRMO 5AGFA 3DAGA 3L8IA 4BJ1A 3HNLA 3B71A 1U0BB 2CNWA 3JTLO 3VF0A 4OIRF 2LIGA 1Q0GA 1VLSA 2Q4FA 2OOCA 5DQTA 4XLPF 3RW0A 4MVOA 2ETSA 3G50A 2IM8A 1QKRA 3QMKA 4JC7A 3DM5A 3KH2A 4XWJA 1B68A 1YZAA 1MMAA 4G7ZF 3O55A 2CDQA 3U9JA 4PJNA 2J8WA 1I4YA 1UFBA 5A6BD 2XM4A 3C18A 2R7VA 2A6HF 3V7OA 3ZTMA 2FFHA 4WJ0A 3J06A 1H7IA 2VB6A 5L0JA 1VOMA 4ONSA 3U8PA 4U5FE 1D0YA 3NRHA 4W8PA 4U5HA 3R7CA 4DVZA 3C8GA 2F22A 2LFDA 3IQCA 3M15A 4IARA 1QQ3A 3GODA 3DJUB 4PFOA 2AWCA 1OKKD 5A6KA 1SMYF 4BEMJ 2HSBA 3W2VA 3MLGA 3GANA 2WZGA 2KSFA 1TWHA 2UUHA 3Q6MA 3C63A 3TOMA 1CPQA 1JOGA 2Z15A 1I4ZA 1NZEA 3T6BA 2DYSC 4C7OB 4K7BA 4YL1A 4JKVA 5T1DB 1EKYA 4KBLA 3LUTB 3LEVA 3POVA 3I4UA 5D91A 3ZG1A 5BQHA 3H65A 3SXYA 3ZDLA 1D1BA 1JPNA 2CCYA 2I15A 1YARO 3BEHA 4CS8A 3WODF 2OEXA 2EILC 4IRUA 1ORSC 1Y4CA 4JEAA 5FZTA 3NDBB 3Q7GA 3WG7C 2BL2A 5F5FA 1U89A 1GGQA 1KNYA 3A9CA 1AEPA 1Z5ZA 4G7OF 2NPUA 2DB4A 1N1CA 2HMQA 2YLIA 3NYMA 1TFKB 4IAOA 2PF4E 3DE8A 2YZSA 3VRCA 4G7HF 4MW8A 2QE9A 3TQOA 2IBFA 4MQ9F 1FMWA 2AWYA 3O39A 3O6XA 3BRJA 3KKBA 2B0JA 2IYLD 2R05A 3DMDA 2V26A 2HJ3A 3JSEO 1AVOB 4OD5A 3RIPA 1LM3B 3TD7A 4BJ6A 4LLCA 4O6NA 1S05A 4U5BE 1LKXA 4XEKA 2J9VA 3GM3A 2R7UA 3U5SA 2GWWA 1YLMA 1MNDA 1CGNA 2FAPB 3PDMP 3T6JA 1WN0A 1GM5A 3GWNA 3OA1A 1Z6AA 3RVZA 1Z3IX 3CAXA 3S0XA 1K05A 1YAUO 4H54A 4JE9A 3W2WA 2EPLX 1H9TA 3TJ6A 2WVNA 3UGOA 2KYHA 1Y6DA 2NUTB 1T01A 5GPGB 4JTDB 1Z7Qc 1HW2A 1E2XA 2HJMA 3K1IA 2NUPB 1OR2A
chains in the Genus database with same CATH topology
4XEFA 1WTYA 1OW6A 2JPUA 4XEKA 2KK1A 1WWPA 1UFBA 3GM3A 3U0CA 3AJMA 3C18A 4NQFA 2L6FA 3RQEA 1K04A 3L8JA 4R32A 3GM2A 1QVXA 2JX0A 3RQFA 1V4AA 1WOLA 1ZZPA 3JYYA 3C8GD 3C8GB 2LK4A 3L8IA 3MFNA 1KNYA 3B71A 3C8GA 3O10A 3JZ0A 1K05A 1OW7A 3K7DA 4XEVA 3TULA 2YWAA 2Q00A 3RQGA 2HSBA 5F28E 3GM1A 3U3FA 1K40A 3S9OA 2L6HA 1JOGA 1PV3A 3BRJA 4EBKA 1OW8A 4EBJA 1KTMA 2PBEA 1O3UA 2L6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XEF A;  1WTY A;  1OW6 A;  2JPU A;  4XEK A;  2KK1 A;  1WWP A;  1UFB A;  3GM3 A;  3U0C A;  3AJM A;  3C18 A;  4NQF A;  2L6F A;  3RQE A;  1K04 A;  3L8J A;  4R32 A;  3GM2 A;  1QVX A;  2JX0 A;  3RQF A;  1V4A A;  1WOL A;  1ZZP A;  3JYY A;  3C8G D;  3C8G B;  2LK4 A;  3L8I A;  3MFN A;  1KNY A;  3B71 A;  3C8G A;  3O10 A;  3JZ0 A;  1K05 A;  1OW7 A;  3K7D A;  4XEV A;  3TUL A;  2YWA A;  2Q00 A;  3RQG A;  2HSB A;  5F28 E;  3GM1 A;  3U3F A;  1K40 A;  3S9O A;  2L6H A;  1JOG A;  1PV3 A;  3BRJ A;  4EBK A;  1OW8 A;  4EBJ A;  1KTM A;  2PBE A;  1O3U A;  2L6G A; 
#chains in the Genus database with same CATH topology
 3ASO C;  2XLH A;  1RJ9 B;  2JPU A;  2QTV A;  4GQH A;  4E18 A;  3JYH A;  5B3I A;  2VAS A;  2R9R B;  5IY5 C;  1E84 A;  3SP1 A;  1L3P A;  1ORY A;  1TQG A;  3S28 A;  3L8J A;  3SYN A;  3AGT A;  2R7O A;  1FFT C;  4EKW A;  2H8A A;  2R03 A;  1Q0F A;  1JPJ A;  3JRT A;  1WAT A;  1T6I A;  5KYU A;  5CIV A;  1WGW A;  1A7V A;  3DZA A;  2R7S A;  2WZF A;  3JSZ A;  2J0W A;  3L34 A;  4DVY P;  2C03 A;  3VM6 A;  5KYN A;  4AX2 A;  1RCP A;  1OW7 A;  3I5P A;  2IXN A;  4MTF A;  4W8K A;  2KW3 C;  2YLG A;  2D5R B;  2P0N A;  4RD9 A;  2XLO A;  3FOO A;  1RKE A;  3VYW A;  3X2Q C;  4O6Y A;  5B1A C;  5F5H A;  4EHP A;  4BJ5 C;  2VC9 A;  1OCZ C;  3EH1 A;  3EZI A;  1K40 A;  4AE4 A;  1PD0 A;  3JT1 A;  3DXJ F;  4L6R A;  1A7E A;  4WGY A;  4PK4 A;  4EBJ A;  4E7S A;  2QNL A;  1C17 M;  1NFO A;  4NTF A;  1E85 A;  1VTM P;  1C03 A;  2Y3D A;  1D0Z A;  3DM9 B;  4NQF A;  2OU6 A;  4OD4 A;  3RQE A;  3FVY A;  1D1A A;  2X0C A;  1LI5 A;  3LJB A;  1R4T A;  4MND A;  3AOU A;  2ICW G;  1JAF A;  1YYX A;  3NMI A;  1C02 A;  3L0I A;  4KI2 A;  2XS8 A;  4MTO A;  4EBB A;  1VK5 A;  5E33 A;  2QY9 A;  3F46 A;  2ASR A;  2VCA A;  3K1H A;  4K1O A;  4LAC B;  4YL0 A;  5HSW A;  1O87 A;  1LVK A;  3US6 A;  3OEO A;  4HFK B;  2KNH A;  1VLT A;  1JR8 A;  5DS5 A;  5COG A;  5F28 E;  4DBQ A;  4I44 A;  5JP7 A;  4JUR I;  3FHD A;  4MVZ A;  3W4Y A;  2EPK X;  1TKN A;  3ABL C;  4CBE A;  4Q7C A;  4CS9 C;  4JEB A;  2TMV P;  1TWC A;  2OEV A;  2ZXW C;  3ATP A;  3MBG A;  4HFF B;  3U8V A;  2NG1 A;  2XLW A;  5DQZ A;  4IGG A;  2J45 A;  1U6H A;  2A0B A;  2GA0 A;  1JRA A;  1K04 A;  4C3E A;  2KJG A;  4NTB A;  2NSF A;  2J9U A;  3CZ6 A;  256B A;  3EFO B;  1UG7 A;  1M56 C;  5JUA A;  2XXA A;  1WOL A;  1XZQ A;  2KGO A;  3JYY A;  4PFP A;  4H4K C;  3V5Z A;  4J7T A;  4E0H A;  2HSQ A;  2IXM A;  3LS1 A;  3NMJ A;  4C7O A;  2G3K A;  2DYR C;  4IB4 A;  1L7C A;  2EIN C;  1ZHY A;  5EGY A;  1CPR A;  1M6T A;  2HZ8 A;  4QDL A;  5L0G A;  4XPW A;  1LPE A;  1MMD A;  3RFY A;  3S9O A;  3ZC4 A;  1G4U S;  2OKU A;  1MNE A;  4XLN F;  1ZHX A;  1V54 C;  3ZVR A;  4OIP F;  1KTM A;  2HV7 A;  1SYQ A;  2A1D D;  2EIM C;  2L6G A;  3EH2 A;  3UNG C;  4D4N A;  5DVW A;  5A6J A;  4N06 A;  1APC A;  2PNO A;  2J7P A;  2WVO A;  4N4W A;  1LS4 A;  1FAP B;  1VYI A;  3KYJ A;  3ABK C;  5JT4 A;  2YL7 A;  3UGP A;  3ECS A;  2Q7R A;  3W8I A;  4DRJ B;  2AP3 A;  2A0U A;  4QI2 A;  4U9E A;  3DI5 A;  4UDV A;  2CNW D;  3EGX B;  4U5E E;  4OIQ F;  1QZX A;  1H6G A;  5EK0 A;  5TJ5 E;  3W8H A;  4YN0 B;  3ASN C;  4XEV A;  5B3S C;  2UUI A;  1FFH A;  2YWA A;  2Y3B A;  1YZC A;  2LCH A;  3AG4 C;  1G5Z A;  1GQA A;  1ZU5 A;  3F47 A;  1D0X A;  2BE5 F;  3LEO A;  3LES A;  4X0R A;  3B29 A;  5CI8 A;  2YQY A;  2L6H A;  1QSP A;  4Z9I A;  3EGD B;  3FAP B;  3ZQV A;  5JLI A;  1OW8 A;  3MYI A;  3LNM B;  1Z63 A;  5A6A A;  2OCC C;  2W9Y A;  2G62 A;  1OQC A;  4AK9 A;  4YT5 A;  3EHN A;  5DLJ A;  1I5N A;  1OW6 A;  3S27 A;  1A7D A;  5HV9 A;  3DJN B;  2XLM A;  5BQI A;  1RKC A;  4JTA B;  2Q3T A;  2LP4 A;  3QVZ A;  5KYX B;  1V74 B;  2LFF A;  4RDA A;  5E3A A;  3AG3 C;  1OR3 A;  1LE4 A;  1SR2 A;  3AQC A;  3C62 A;  3ZWI A;  1QVX A;  1J8Y F;  1S7Z A;  1M2V A;  2P61 A;  3ITF A;  1HY5 A;  4FX5 A;  3L1M A;  4JVS A;  3C8G D;  2YL0 A;  1D1C A;  2KQ9 A;  3MFN A;  3IQT A;  4FES A;  3HKK A;  5BQG A;  4EUK B;  3X1O A;  5EHH A;  2R7X A;  1HMO A;  1ZHZ A;  2NUP A;  4HE8 D;  4MVQ A;  2FGY A;  1RJ9 A;  4YK5 A;  3MX3 A;  3SNH A;  3N2Z B;  1GS9 A;  1Q0K A;  2OJQ A;  2XSE A;  1LS1 A;  3U2L A;  4FWV A;  1F1M A;  2H7B A;  3IEE A;  2YKZ A;  1VMA A;  4MVM A;  4C3B A;  5DS6 A;  4ZLD A;  5JVE A;  3QW1 A;  2IOQ A;  1SZI A;  2VCC A;  3GEE A;  3K6B A;  4JW1 A;  4MVS A;  4CX9 A;  1FNT c;  1MQV A;  3SXK A;  4A4A A;  1FMV A;  2CW0 F;  4Q5S F;  4KNW A;  1A0B A;  4R32 A;  4KC9 A;  4YL3 A;  2J46 A;  4J30 B;  4IWB A;  3RVY A;  2XL4 A;  2HV6 A;  3FOP A;  1ZU4 A;  4EWC A;  2OJE D;  1QPU A;  5L0D A;  4CDY A;  2LSE A;  3C8Z A;  2L7A A;  3M1C B;  2Y3H A;  3QW0 A;  4NY3 A;  3NKD A;  3RQF A;  1W2W A;  1OXB A;  1WAS A;  2R7T A;  2MWQ A;  4K0D A;  2HFI A;  4PAC A;  2XS1 A;  3B9Q A;  2AU5 A;  2EPM X;  3E70 C;  3UMK A;  5L0H A;  5L0I A;  3TUL A;  4PJM A;  4U9D A;  5KYW A;  3V5Y A;  1BR1 A;  2Y3G A;  5E3C A;  5KYY B;  4JZA A;  1J8M F;  3IQ6 A;  1ZW3 A;  2BC5 A;  3QTH A;  4LLE A;  4YT4 A;  3SXM A;  3PCV A;  4O79 A;  1IZM A;  1OCO C;  1RXQ A;  4ZLC A;  4OIN F;  3KL4 A;  3GWL A;  1O3U A;  1BZ4 A;  5T3T A;  4BPM A;  5B1B C;  4JJG A;  1Q0M A;  3G4X A;  3R2P A;  2Q9B A;  1BR4 A;  3ZIB A;  2QLA A;  2R7R A;  5JS5 A;  2EIK C;  3NKE A;  3T9O A;  5A6B A;  4C3D A;  3HLZ A;  2YVK A;  3NMK A;  3FXH A;  2Q9A A;  3LS0 A;  3AGU A;  1LI7 A;  2JX0 A;  3GM2 A;  5E2Q A;  3CQZ A;  4MW3 A;  3TOL A;  4BJ5 A;  2MHR A;  2WL8 A;  3HJC A;  4ANJ A;  4YT2 A;  1CGO A;  2ZXP A;  3CEX A;  3EG9 B;  3IPM O;  3N0T A;  4OIO F;  3DKA A;  3IHU A;  3NYJ A;  5T3W A;  1XWJ A;  4CDV A;  1ZHW A;  3B0P A;  2Q00 A;  4O7G A;  4GEH A;  4AL0 A;  3WAQ A;  3A11 A;  1ZYR F;  1T6Q A;  1OKK A;  1Q0D A;  4Z9H A;  3Q7L A;  2EPN A;  4CS7 A;  4I1M A;  4BEJ A;  4CIP A;  1E83 A;  3HTK C;  4CDA A;  1VB5 A;  1MMG A;  2MYS A;  1E86 A;  2R7Q A;  3S29 A;  4XEF A;  1RKE B;  1HE1 A;  4CJG A;  4E7Z A;  2JD3 A;  1LE2 A;  3AJM A;  2ZXO A;  2A69 F;  2PFD A;  2I8B A;  2YEV A;  4LDK A;  4AE4 B;  2J9B A;  4BJT A;  4YT8 A;  2XLD A;  1ST6 A;  4G78 A;  4DRH B;  5DS4 A;  1T5O A;  4LDR A;  5A69 A;  1NFN A;  3T6G B;  1QLE C;  4JCH A;  4GYT A;  1ZZP A;  2YL3 A;  2YRF A;  4LER A;  1T6U A;  4MVU A;  2EPO A;  3G4Z A;  2HKV A;  3JZ0 A;  4CS9 A;  1CGM E;  3K7D A;  2EIJ C;  2WZL A;  3AG2 C;  3N24 A;  5CI9 A;  2L81 A;  4JJF A;  1HE9 A;  2G3V A;  3U3F A;  2Y69 C;  2OQM A;  2XL8 A;  4U5D E;  4WGZ A;  3QVY A;  4NC3 A;  1PV3 A;  1HW1 A;  3DD7 A;  3H2U A;  3M4B A;  3QZC A;  2QUP A;  4D4X A;  2J0X A;  3WHN A;  1YVI A;  2B0H A;  3GEI A;  3EGX A;  1ORJ A;  1TR2 A;  1WTY A;  4QI0 A;  4DBR A;  2P1A A;  3U0C A;  4N6C A;  4P9T A;  4XPY A;  3EHM A;  3H2V A;  1PCX A;  3TJ5 A;  2R7W A;  1ZVZ A;  3HNI A;  4I3M A;  1H9G A;  2DI3 A;  2X51 A;  1BBH A;  3AQB A;  3SZR A;  2AVK A;  3LAY A;  4B6I A;  3EGD A;  2Q9C A;  1EI7 A;  1FR0 A;  4CS8 C;  3DWW A;  3EQL F;  4AL1 A;  5AC5 A;  4J7Y A;  4U5C E;  3EZH A;  1XZP A;  2L9J A;  4P6I C;  2W45 A;  3KMI A;  3K66 A;  1TFO B;  4NCQ A;  5FCL A;  2XXA B;  3LNR A;  2VCB A;  3LLK A;  3M79 A;  3NG1 A;  3Q6N A;  3EJN A;  2E87 A;  3CSK A;  5KYX A;  3PHF 2;  2M64 A;  4F4B A;  2V3C C;  3I5Q A;  3DAF A;  1TWA A;  2PBE A;  2HMZ A;  2NSG A;  2VH3 A;  3C8G B;  3U9M A;  4CJO A;  1M2O A;  1NBB A;  2XL6 A;  1M57 C;  1WWP A;  3S84 A;  3SXZ A;  3B0U X;  3C7J A;  4DXW A;  2L6F A;  2O9X A;  1ZW2 A;  5JSL A;  2XLE A;  1JMW A;  2D4U A;  5COF A;  4BJ6 C;  2WB7 A;  2H7V C;  4Z9J A;  1NG1 A;  1DOW A;  2NUT A;  4JRZ A;  4E17 A;  1TWG A;  2A68 F;  3U2M A;  3FAJ A;  2DGJ A;  4ULW A;  4XTK A;  1BDJ B;  2PX0 A;  3O10 A;  4CSA A;  1G4W R;  3S90 A;  5D92 A;  1MMN A;  3ZQY A;  3FDQ A;  1OXK A;  4DRI B;  1V55 C;  5L3Q A;  3PMR A;  3GM1 A;  4I1O B;  2IXO A;  1BR2 A;  1A41 A;  3RYL A;  3VAY A;  1AUE A;  1NSG B;  1EA8 A;  3DE9 A;  4IJJ A;  1O5H A;  2GFH A;  2YLD A;  3RH3 A;  3JCU Q;  3M4C A;  4EIY A;  5K0I A;  2ZXR A;  2J7P D;  4A2N B;  3B0V C;  5L0F A;  2CGE A;  4M63 A;  4FAP B;  3ABM C;  1IW7 F;  3EPV A;  5KYY A;  3HNK A;  3K1I C;  2RD9 A;  4MTG A;  2HS5 A;  4CSA C;  3LLI A;  3IQ5 A;  4PJJ A;  4IAQ A;  3MYF A;  3GOR A;  3KYI A;  4CIH A;  4MS2 A;  2LK4 A;  1PD1 A;  1T9K A;  4ULV A;  2PP4 A;  2ZD9 A;  3T4R A;  5BUO A;  3RKO F;  1YA9 A;  1HMD A;  5AC4 A;  1LIH A;  1Z23 A;  1RMV A;  2W4B A;  2PX3 A;  4N6H A;  1SF8 A;  2XRH A;  1M2V B;  3UR3 C;  2Y39 A;  4LDQ A;  3TK0 A;  2KC3 A;  3AG1 C;  5COM A;  5L0C A;  2W4M A;  4Q4Z F;  2R25 A;  4WAB A;  2LD6 A;  4PR9 A;  2HUJ A;  3K33 A;  3FMS A;  4KNV A;  2XLV A;  2XM0 A;  2YHS A;  1G8X A;  3EG9 A;  5L3V A;  4XPX A;  1FTS A;  3GEH A;  1NU9 C;  1OCR C;  2P7V A;  4XQ1 A;  2YL1 A;  1DOV A;  5JRA A;  1YJG A;  2R02 A;  2GAQ A;  4JIO A;  4U5G A;  1YYJ A;  4G0H A;  3ZTZ A;  1R5I D;  4JTC B;  2P6V A;  2C04 A;  4P9F A;  3V5X A;  1ZHT A;  2IXP A;  3HNJ A;  2LQG A;  2OG2 A;  1NU7 D;  4DOZ A;  1OCC C;  1YDI A;  1NLX A;  3ZSU A;  4YWQ A;  4JCZ A;  3RQG A;  4DJ9 A;  1YA7 O;  4ER9 A;  3SEO A;  5KYU B;  1EQ1 A;  4PJL A;  4J32 B;  4NTA A;  4EBK A;  2H7O A;  2WVQ A;  4MVR A;  3RF3 A;  3NYL A;  3EFO A;  4BG0 A;  5KYW B;  2RSE B;  4HEA J;  3U3B A;  2KK1 A;  4YJW A;  1KU2 A;  3OWT A;  3KPH A;  1VYK A;  4RBN A;  2J9W A;  3E9V A;  2GDC A;  2CYD A;  2M4E A;  2ZPA A;  4O6M A;  2A6E F;  1V4A A;  4E0I A;  3UMH A;  3UMI A;  3JRM O;  5AGF A;  3DAG A;  3L8I A;  4BJ1 A;  3HNL A;  3B71 A;  1U0B B;  2CNW A;  3JTL O;  3VF0 A;  4OIR F;  2LIG A;  1Q0G A;  1VLS A;  2Q4F A;  2OOC A;  5DQT A;  4XLP F;  3RW0 A;  4MVO A;  2ETS A;  3G50 A;  2IM8 A;  1QKR A;  3QMK A;  4JC7 A;  3DM5 A;  3KH2 A;  4XWJ A;  1B68 A;  1YZA A;  1MMA A;  4G7Z F;  3O55 A;  2CDQ A;  3U9J A;  4PJN A;  2J8W A;  1I4Y A;  1UFB A;  5A6B D;  2XM4 A;  3C18 A;  2R7V A;  2A6H F;  3V7O A;  3ZTM A;  2FFH A;  4WJ0 A;  3J06 A;  1H7I A;  2VB6 A;  5L0J A;  1VOM A;  4ONS A;  3U8P A;  4U5F E;  1D0Y A;  3NRH A;  4W8P A;  4U5H A;  3R7C A;  4DVZ A;  3C8G A;  2F22 A;  2LFD A;  3IQC A;  3M15 A;  4IAR A;  1QQ3 A;  3GOD A;  3DJU B;  4PFO A;  2AWC A;  1OKK D;  5A6K A;  1SMY F;  4BEM J;  2HSB A;  3W2V A;  3MLG A;  3GAN A;  2WZG A;  2KSF A;  1TWH A;  2UUH A;  3Q6M A;  3C63 A;  3TOM A;  1CPQ A;  1JOG A;  2Z15 A;  1I4Z A;  1NZE A;  3T6B A;  2DYS C;  4C7O B;  4K7B A;  4YL1 A;  4JKV A;  5T1D B;  1EKY A;  4KBL A;  3LUT B;  3LEV A;  3POV A;  3I4U A;  5D91 A;  3ZG1 A;  5BQH A;  3H65 A;  3SXY A;  3ZDL A;  1D1B A;  1JPN A;  2CCY A;  2I15 A;  1YAR O;  3BEH A;  4CS8 A;  3WOD F;  2OEX A;  2EIL C;  4IRU A;  1ORS C;  1Y4C A;  4JEA A;  5FZT A;  3NDB B;  3Q7G A;  3WG7 C;  2BL2 A;  5F5F A;  1U89 A;  1GGQ A;  1KNY A;  3A9C A;  1AEP A;  1Z5Z A;  4G7O F;  2NPU A;  2DB4 A;  1N1C A;  2HMQ A;  2YLI A;  3NYM A;  1TFK B;  4IAO A;  2PF4 E;  3DE8 A;  2YZS A;  3VRC A;  4G7H F;  4MW8 A;  2QE9 A;  3TQO A;  2IBF A;  4MQ9 F;  1FMW A;  2AWY A;  3O39 A;  3O6X A;  3BRJ A;  3KKB A;  2B0J A;  2IYL D;  2R05 A;  3DMD A;  2V26 A;  2HJ3 A;  3JSE O;  1AVO B;  4OD5 A;  3RIP A;  1LM3 B;  3TD7 A;  4BJ6 A;  4LLC A;  4O6N A;  1S05 A;  4U5B E;  1LKX A;  4XEK A;  2J9V A;  3GM3 A;  2R7U A;  3U5S A;  2GWW A;  1YLM A;  1MND A;  1CGN A;  2FAP B;  3PDM P;  3T6J A;  1WN0 A;  1GM5 A;  3GWN A;  3OA1 A;  1Z6A A;  3RVZ A;  1Z3I X;  3CAX A;  3S0X A;  1K05 A;  1YAU O;  4H54 A;  4JE9 A;  3W2W A;  2EPL X;  1H9T A;  3TJ6 A;  2WVN A;  3UGO A;  2KYH A;  1Y6D A;  2NUT B;  1T01 A;  5GPG B;  4JTD B;  1Z7Q c;  1HW2 A;  1E2X A;  2HJM A;  3K1I A;  2NUP B;  1OR2 A; 
#chains in the Genus database with same CATH homology
 4XEF A;  1WTY A;  1OW6 A;  2JPU A;  4XEK A;  2KK1 A;  1WWP A;  1UFB A;  3GM3 A;  3U0C A;  3AJM A;  3C18 A;  4NQF A;  2L6F A;  3RQE A;  1K04 A;  3L8J A;  4R32 A;  3GM2 A;  1QVX A;  2JX0 A;  3RQF A;  1V4A A;  1WOL A;  1ZZP A;  3JYY A;  3C8G D;  3C8G B;  2LK4 A;  3L8I A;  3MFN A;  1KNY A;  3B71 A;  3C8G A;  3O10 A;  3JZ0 A;  1K05 A;  1OW7 A;  3K7D A;  4XEV A;  3TUL A;  2YWA A;  2Q00 A;  3RQG A;  2HSB A;  5F28 E;  3GM1 A;  3U3F A;  1K40 A;  3S9O A;  2L6H A;  1JOG A;  1PV3 A;  3BRJ A;  4EBK A;  1OW8 A;  4EBJ A;  1KTM A;  2PBE A;  1O3U A;  2L6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...