2L6GA

Fat-ld2 double labeled construct with free ld4 peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
161
Chain Sequence
MANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPHSNLSELDRLLLELNAVQHNPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fat-Ld2 Double Labeled Construct with Free Ld4 Peptide
rcsb
source organism Gallus gallus, unidentified
molecule tags Transferase,cell adhesion
molecule keywords Focal adhesion kinase 1, linker, Paxillin
total genus 56
structure length 161
sequence length 176
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2l6gA00
1UFBA 3GM2A 3C8GD 2KK1A 1WTYA 3RQEA 3GM3A 3JYYA 3L8IA 3JZ0A 2L6FA 3C8GA 4XEFA 2JX0A 4R32A 3TULA 3O10A 3C18A 1KNYA 1OW6A 3S9OA 3U0CA 1WOLA 1JOGA 1K04A 3GM1A 3L8JA 4XEVA 5F28E 4EBKA 2JPUA 3MFNA 1O3UA 1WWPA 3BRJA 2PBEA 4XEKA 1OW8A 1V4AA 1KTMA 2LK4A 2Q00A 1PV3A 3K7DA 3U3FA 2L6GA 3AJMA 3B71A 2YWAA 3RQGA 1QVXA 3C8GB 1K05A 2L6HA 1K40A 4EBJA 1OW7A 2HSBA 3RQFA 4NQFA 1ZZPA
chains in the Genus database with same CATH superfamily
3DM9B 1H9GA 4IWBA 3SP1A 4C3BA 3TJ5A 1YYXA 3JYHA 3PDMP 5T3TA 5EHHA 2W4BA 5COFA 4Z9HA 2ICWG 4NTBA 3HKKA 5DS5A 1LVKA 1VYIA 2ZXRA 3V7OA 4OIOF 2L81A 2VB6A 2TMVP 1Z7Qc 1GM5A 1MMAA 3K33A 4IB4A 4JC7A 4XQ1A 4MTFA 4YN0B 3L0IA 3B0PA 4XEVA 5K0IA 5L0JA 2R7WA 2JPUA 3WHNA 1O3UA 4W8PA 1ZYRF 4U9EA 1TWAA 4JCHA 1BR2A 4MQ9F 1WN0A 1EA8A 2XSEA 2NSGA 1NLXA 5L0DA 5B3SC 3B9QA 2IXNA 1OKKA 5JS5A 2XS1A 2RSEB 2X0CA 4FX5A 1MMDA 5F5FA 4GYTA 4BJTA 3ZQYA 4O6YA 4PACA 4JKVA 3ATPA 3C8GD 1WTYA 3ZTZA 4XLNF 2A0BA 2BL2A 3OA1A 1T5OA 2AP3A 3EG9A 3L8IA 1I5NA 3SXYA 4MTOA 3TD7A 4D4NA 2RD9A 2Y69C 1DOVA 3M4BA 4JE9A 4JRZA 4C7OA 4QDLA 2P61A 2PF4E 2GAQA 3O10A 3QVZA 1C03A 2HJMA 4DVZA 3U0CA 3Q6NA 3FDQA 4DJ9A 1M6TA 1W2WA 1LPEA 2IM8A 4YT8A 2CYDA 1HE1A 2P7VA 2J45A 2KJGA 4MVRA 3SYNA 2Q00A 3ZG1A 3QZCA 1OCRC 4CJGA 2P0NA 3VM6A 1CPRA 3S27A 5A6BA 4G7ZF 3KL4A 1GS9A 2EINC 2R9RB 4CDAA 1QLEC 3DAFA 3KPHA 4C3DA 4NCQA 5L0GA 1AEPA 1O5HA 4WJ0A 1VTMP 1VMAA 3JCUQ 1ZHYA 3NRHA 4RDAA 4CS7A 2R7VA 5L3VA 1E83A 1SF8A 4BJ5C 2XM4A 4XTKA 4I44A 4XEFA 4PFOA 3IQCA 3DZAA 3QW1A 4NTFA 3S90A 3TULA 4Q7CA 1A7EA 1G4US 3MX3A 1YYJA 2P6VA 4E18A 4CSAC 4P9FA 4WGYA 3NDBB 3JTLO 2YLDA 2E87A 2OJQA 2PBEA 2OEXA 1XZQA 1KTMA 1LI7A 1FNTc 1QPUA 5BQHA 1FMVA 2L6GA 3NMJA 1WGWA 1H9TA 1GQAA 5KYWA 1RCPA 3ASOC 3E70C 2YZSA 3H2UA 2O9XA 2R7XA 4E17A 5A6KA 3ECSA 4UDVA 3LS0A 3TK0A 4BEJA 2P1AA 3AOUA 2DYSC 2LD6A 2XLHA 3I5QA 1NFNA 3S84A 3AGUA 3IQTA 2Y39A 1EI7A 2CGEA 4JEAA 2QNLA 3NMIA 4AK9A 4JEBA 2XLEA 1LS1A 4IRUA 4WGZA 4X0RA 1YA9A 3SNHA 3FXHA 4CS9C 2R7UA 2C04A 2XL6A 3HNKA 2VASA 4HFKB 4PJLA 4BG0A 2LIGA 5JLIA 3ABKC 1QZXA 4DRIB 2KYHA 1HMDA 2W4MA 3JSZA 3WAQA 2XXAA 2A68F 4CS9A 4KNWA 2KW3C 2EPMX 4IAQA 2DI3A 2J0XA 3DJUB 2YHSA 3LNMB 1YAUO 3G4ZA 2WZFA 4KNVA 4OD4A 3EG9B 4NTAA 2R7SA 4MVZA 2J9BA 4JIOA 1CGME 2C03A 2YL3A 1ZU5A 2YRFA 3N24A 3QMKA 3RIPA 3UGPA 2LSEA 2PX0A 2ZXPA 5E3CA 3HNIA 3LEOA 2Q9CA 5CI8A 3M1CB 5A6JA 4JTAB 1IW7F 4IAOA 4ZLCA 3GM3A 3TQOA 3EGDA 4LLEA 3MBGA 4CIHA 3R2PA 4P6IC 3FOOA 2Q4FA 1NZEA 1G4WR 2YVKA 4KBLA 1RMVA 2WVNA 4O6MA 3S9OA 1JOGA 2R03A 1OCZC 1Q0MA 3L8JA 4CSAA 2PNOA 4A2NB 2HS5A 2YL7A 4CX9A 1V4AA 4FESA 5KYYB 1L7CA 1YJGA 4J7TA 5JSLA 2IBFA 4BJ5A 1JPJA 2WZLA 3NKEA 2OJED 1WASA 2NUTB 1J8MF 4LDKA 4MVQA 1K40A 4JVSA 3MYIA 4N4WA 5FCLA 3CQZA 2OQMA 4G0HA 2HKVA 3A9CA 3K1HA 3N0TA 2GFHA 4YL3A 2M4EA 4E7ZA 1OKKD 3RH3A 3DE9A 3EHMA 1Q0FA 1JAFA 1JPNA 4R32A 1RKEB 1Z63A 3CEXA 1KNYA 2W9YA 4XPWA 3O6XA 3VAYA 2CDQA 1G8XA 1Z3IX 4N6CA 3UMIA 5BQIA 2PX3A 3R7CA 3NYMA 1Z5ZA 4PJMA 2NUPA 1QVXA 2EIMC 3SXKA 2BE5F 4FWVA 1A0BA 2G62A 2HZ8A 3EGXA 3KYJA 1N1CA 2R05A 3KYIA 2UUHA 5BUOA 4A4AA 2AVKA 5DS6A 4AE4B 4YT2A 3IHUA 1NU7D 2EPLX 4IJJA 4BPMA 5JRAA 3K1IA 4Q5SF 3F46A 3AG1C 3TOLA 5L0FA 4N6HA 4DBRA 3NYLA 2Q7RA 2L6FA 3C8GA 4PK4A 2D4UA 2J9VA 5JT4A 2QY9A 1TFKB 1HW1A 4QI0A 1U6HA 2VCBA 3EFOB 4XWJA 4DOZA 3DXJF 1E86A 1WOLA 1K04A 2DYRC 1BZ4A 3C63A 1CGOA 2J9UA 3EFOA 3FAJA 3GWLA 3Q6MA 3RF3A 3RVZA 4EUKB 2R7RA 4LERA 1YZCA 1HMOA 5COGA 2XL4A 3LS1A 3RFYA 3U3FA 3US6A 4CS8A 1EQ1A 1YLMA 1E85A 1IZMA 4PJJA 3DMDA 2IXMA 2XLMA 2YLGA 3GORA 4P9TA 3CSKA 1NFOA 3HJCA 1E84A 3SXZA 2PP4A 3LEVA 3GANA 2MWQA 3AG3C 5KYXA 4BJ1A 1Q0GA 1PD1A 2MYSA 3HNLA 1LE2A 4Z9JA 1MQVA 5CIVA 4CDYA 4BJ6A 2VCAA 2Q9BA 4GEHA 1VK5A 5E2QA 3NKDA 2GWWA 3W2VA 2AU5A 3V5ZA 1V55C 3SEOA 3ITFA 5KYNA 2D5RB 4L6RA 4JJGA 4YJWA 4CBEA 2YKZA 1ORYA 3V5XA 4EHPA 4G7OF 4H4KC 2VC9A 2HMZA 2QUPA 5EGYA 1FR0A 2R25A 1RJ9B 3GWNA 2YWAA 1HE9A 1ZW3A 5E3AA 5DQTA 1KU2A 4M63A 1A41A 4ER9A 2L7AA 3GEHA 2L9JA 4O79A 1LIHA 1TQGA 4YL0A 3CZ6A 3U8VA 3W2WA 3POVA 5COMA 3VYWA 4GQHA 4W8KA 3K66A 2YEVA 4JCZA 2FGYA 2KQ9A 256BA 2WB7A 2FFHA 1O87A 1TR2A 2KNHA 4JTCB 1RJ9A 2CNWA 4OIQF 1BR1A 2EIJC 1DOWA 2B0HA 1C17M 1E2XA 3ABMC 3AG2C 1NBBA 3TJ6A 3WG7C 4Q4ZF 4YT4A 3MFNA 4IARA 3BRJA 3LLKA 4MW8A 3RKOF 2ZD9A 1ZU4A 4MVMA 1VB5A 2J8WA 3X2QC 3T9OA 4JURI 4O7GA 5L0CA 2V3CC 3RQGA 1UG7A 4OD5A 5GPGB 1FFTC 3LNRA 1TFOB 2AWCA 2L6HA 1OQCA 2B0JA 3LUTB 1OW7A 3U8PA 3HLZA 3ASNC 1VLTA 5L0HA 3JRMO 5KYUA 2A6HF 1B68A 2A1DD 4LLCA 1M2VB 1MNDA 3MYFA 1FTSA 3RQEA 3W8IA 2IOQA 2IXPA 3ZQVA 3HTKC 4N06A 4G7HF 5D91A 3VRCA 3BEHA 3DKAA 1OXBA 1T6QA 3IQ6A 5CI9A 5DVWA 4NC3A 3ZIBA 3AQCA 4U5CE 1LM3B 2Z15A 4IGGA 3RVYA 4EBBA 3AG4C 5L3QA 4K7BA 3C8ZA 2LK4A 2EILC 3RW0A 3DJNB 4I1MA 3C62A 4PFPA 1VOMA 4QI2A 1AUEA 4U9DA 3ZC4A 2IYLD 4I1OB 3U2LA 2R7QA 2V26A 1VLSA 2XLWA 2HFIA 5T1DB 1Z23A 2CCYA 1SMYF 2HMQA 3EJNA 3K6BA 3AQBA 4ANJA 1WATA 4Z9IA 3GEIA 4E0HA 3H2VA 2LQGA 3ZVRA 3GM2A 1HW2A 2EPOA 4LDQA 1T6IA 5KYWB 3J06A 2WZGA 2DB4A 2KC3A 5EK0A 3JYYA 1ORJA 3JZ0A 3G4XA 3Q7LA 4J7YA 4MVOA 2JD3A 5JP7A 5A6BD 3DD7A 2YQYA 4MVUA 2VCCA 1D0ZA 2GDCA 3TOMA 2NUPB 2H7BA 2YLIA 3X1OA 4C7OB 2LCHA 2XS8A 2OCCC 5B1BC 1A7DA 2HJ3A 2WL8A 4HEAJ 2XL8A 1D1AA 3T6BA 2OEVA 5F28E 4XEKA 4NY3A 4JJFA 3QW0A 1SR2A 1VYKA 3DM5A 1PV3A 2NPUA 2A69F 2ZPAA 1LI5A 3K7DA 3KMIA 4I3MA 4AL0A 5IY5C 1TWGA 3B71A 3LESA 1U0BB 1XZPA 1OR2A 4XPYA 3G50A 3IPMO 4F4BA 3GEEA 1ZHTA 1BDJB 5F5HA 1CGNA 1QQ3A 3JSEO 4B6IA 2QTVA 1U89A 2G3VA 2XM0A 3W8HA 3S29A 1ZW2A 2H7VC 2KK1A 3GODA 1FFHA 1D0XA 2AWYA 3S0XA 2QE9A 2HSQA 4KC9A 5BQGA 1SYQA 2I15A 4ONSA 1C02A 1OCOC 3ZWIA 3NG1A 4YT5A 3SZRA 3B0VC 1TWHA 2FAPB 1RKCA 3M15A 4MVSA 1ZHWA 1M56C 5JVEA 3FVYA 4OIPF 3L1MA 1Y4CA 3EZHA 1MMGA 3A11A 1R4TA 3MLGA 4BJ6C 3UGOA 3HNJA 4MNDA 5HV9A 1YDIA 3DI5A 1PCXA 3ZTMA 1SZIA 3DE8A 3FMSA 1Z6AA 1HY5A 1OCCC 1Y6DA 2A0UA 2CNWD 1L3PA 4ZLDA 1UFBA 4CJOA 2J9WA 1NG1A 2HV6A 1H6GA 3EZIA 1MNEA 5T3WA 3T4RA 1LE4A 4U5FE 3UR3C 1CPQA 1D1BA 5B1AC 1JRAA 3EHNA 4PR9A 3ZDLA 1V54C 3EGDB 5AC4A 3IEEA 3JT1A 2J46A 2DGJA 3PMRA 1OW6A 1I4YA 1YVIA 3E9VA 3K1IC 4XPXA 3U9JA 5A69A 1XWJA 3EGXB 1BBHA 3PHF2 2HUJA 4HFFB 2KGOA 2XLDA 3EH1A 2GA0A 2XRHA 5JUAA 4LACB 2Q9AA 3AJMA 4FAPB 2LP4A 1LKXA 1AVOB 1TWCA 3C8GB 4J32B 3M4CA 3M79A 3W4YA 3ZSUA 1ST6A 2X51A 4JTDB 2EPKX 2G3KA 3OEOA 4NQFA 2NUTA 3RQFA 3U5SA 2J7PA 3F47A 1H7IA 1R5ID 4PJNA 2Y3BA 3AGTA 1Q0DA 4BEMJ 4J30B 4H54A 3U2MA 4YL1A 5DQZA 3O55A 2EPNA 5D92A 1ZHZA 4K1OA 4AX2A 4U5BE 4U5EE 3T6GB 4AL1A 1ZHXA 2OU6A 2LFDA 4JW1A 4EBKA 3GM1A 2W45A 3PCVA 4MW3A 3S28A 2R7OA 4OINF 4EWCA 3DAGA 1G5ZA 2Q3TA 3U3BA 1APCA 4G78A 1F1MA 1T01A 2OKUA 1FAPB 3H65A 1Q0KA 4YWQA 5L0IA 5TJ5E 4CIPA 3C7JA 3UNGC 3NMKA 1K05A 3KKBA 4RD9A 2H7OA 5HSWA 3VF0A 2ZXOA 3ABLC 1BR4A 4LDRA 3SXMA 1ZZPA 1RXQA 3QTHA 2OG2A 1QKRA 2I8BA 5E33A 4JZAA 2MHRA 2ZXWC 3FAPB 4K0DA 2Y3GA 4DBQA 2HV7A 3U9MA 5DLJA 1D0YA 2LFFA 2XLOA 3FHDA 4DRHB 3LJBA 4MTGA 1S7ZA 2VH3A 3LLIA 3WODF 2KSFA 1RKEA 2Y3DA 1GGQA 2JX0A 2WVOA 1NU9C 2NG1A 1FMWA 4U5HA 3V5YA 3CAXA 3O39A 4U5GA 3EH2A 2R7TA 5KYYA 1YARO 4ULVA 1PD0A 3UMHA 2J0WA 1WWPA 4C3EA 4XLPF 3OWTA 2R02A 3QVYA 2IXOA 2PFDA 5B3IA 4HE8D 4YK5A 3LAYA 2YL0A 3KH2A 3T6JA 4DVYP 1M57C 1ZVZA 1TKNA 2UUIA 3RYLA 4D4XA 3NYJA 2M64A 3IQ5A 3L34A 1OXKA 2H8AA 2XXAB 1M2VA 1V74B 2OOCA 2HSBA 1MMNA 1QSPA 3JRTA 4AE4A 3Q7GA 1JMWA 3I5PA 5DS4A 2ETSA 4E0IA 1T9KA 2A6EF 4EKWA 2EIKC 2WVQA 4E7SA 3B0UX 2CW0F 4WABA 1S05A 4EIYA 4KI2A 1J8YF 3EPVA 5FZTA 2ASRA 2NSFA 4OIRF 3C18A 1JR8A 5A6AA 2BC5A 1A7VA 1OW8A 4MS2A 1YZAA 1NSGB 3DWWA 4DXWA 5AC5A 5KYUB 1LS4A 5KYXB 4ULWA 1I4ZA 1M2OA 3N2ZB 1OR3A 1YA7O 2XLVA 3B29A 3UMKA 4DRJB 2YL1A 3FOPA 4U5DE 1T6UA 2Y3HA 5AGFA 2J7PD 4O6NA 4RBNA 1EKYA 1D1CA 4CS8C 4CDVA 4EBJA 3I4UA 3EQLF 1ORSC 2F22A 2QLAA
chains in the Genus database with same CATH topology
1UFBA 3GM2A 3C8GD 2KK1A 1WTYA 3RQEA 3GM3A 3JYYA 3L8IA 3JZ0A 2L6FA 3C8GA 4XEFA 2JX0A 4R32A 3TULA 3O10A 3C18A 1KNYA 1OW6A 3S9OA 3U0CA 1WOLA 1JOGA 1K04A 3GM1A 3L8JA 4XEVA 5F28E 4EBKA 2JPUA 3MFNA 1O3UA 1WWPA 3BRJA 2PBEA 4XEKA 1OW8A 1V4AA 1KTMA 2LK4A 2Q00A 1PV3A 3K7DA 3U3FA 2L6GA 3AJMA 3B71A 2YWAA 3RQGA 1QVXA 3C8GB 1K05A 2L6HA 1K40A 4EBJA 1OW7A 2HSBA 3RQFA 4NQFA 1ZZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFB A;  3GM2 A;  3C8G D;  2KK1 A;  1WTY A;  3RQE A;  3GM3 A;  3JYY A;  3L8I A;  3JZ0 A;  2L6F A;  3C8G A;  4XEF A;  2JX0 A;  4R32 A;  3TUL A;  3O10 A;  3C18 A;  1KNY A;  1OW6 A;  3S9O A;  3U0C A;  1WOL A;  1JOG A;  1K04 A;  3GM1 A;  3L8J A;  4XEV A;  5F28 E;  4EBK A;  2JPU A;  3MFN A;  1O3U A;  1WWP A;  3BRJ A;  2PBE A;  4XEK A;  1OW8 A;  1V4A A;  1KTM A;  2LK4 A;  2Q00 A;  1PV3 A;  3K7D A;  3U3F A;  2L6G A;  3AJM A;  3B71 A;  2YWA A;  3RQG A;  1QVX A;  3C8G B;  1K05 A;  2L6H A;  1K40 A;  4EBJ A;  1OW7 A;  2HSB A;  3RQF A;  4NQF A;  1ZZP A; 
#chains in the Genus database with same CATH topology
 3DM9 B;  1H9G A;  4IWB A;  3SP1 A;  4C3B A;  3TJ5 A;  1YYX A;  3JYH A;  3PDM P;  5T3T A;  5EHH A;  2W4B A;  5COF A;  4Z9H A;  2ICW G;  4NTB A;  3HKK A;  5DS5 A;  1LVK A;  1VYI A;  2ZXR A;  3V7O A;  4OIO F;  2L81 A;  2VB6 A;  2TMV P;  1Z7Q c;  1GM5 A;  1MMA A;  3K33 A;  4IB4 A;  4JC7 A;  4XQ1 A;  4MTF A;  4YN0 B;  3L0I A;  3B0P A;  4XEV A;  5K0I A;  5L0J A;  2R7W A;  2JPU A;  3WHN A;  1O3U A;  4W8P A;  1ZYR F;  4U9E A;  1TWA A;  4JCH A;  1BR2 A;  4MQ9 F;  1WN0 A;  1EA8 A;  2XSE A;  2NSG A;  1NLX A;  5L0D A;  5B3S C;  3B9Q A;  2IXN A;  1OKK A;  5JS5 A;  2XS1 A;  2RSE B;  2X0C A;  4FX5 A;  1MMD A;  5F5F A;  4GYT A;  4BJT A;  3ZQY A;  4O6Y A;  4PAC A;  4JKV A;  3ATP A;  3C8G D;  1WTY A;  3ZTZ A;  4XLN F;  2A0B A;  2BL2 A;  3OA1 A;  1T5O A;  2AP3 A;  3EG9 A;  3L8I A;  1I5N A;  3SXY A;  4MTO A;  3TD7 A;  4D4N A;  2RD9 A;  2Y69 C;  1DOV A;  3M4B A;  4JE9 A;  4JRZ A;  4C7O A;  4QDL A;  2P61 A;  2PF4 E;  2GAQ A;  3O10 A;  3QVZ A;  1C03 A;  2HJM A;  4DVZ A;  3U0C A;  3Q6N A;  3FDQ A;  4DJ9 A;  1M6T A;  1W2W A;  1LPE A;  2IM8 A;  4YT8 A;  2CYD A;  1HE1 A;  2P7V A;  2J45 A;  2KJG A;  4MVR A;  3SYN A;  2Q00 A;  3ZG1 A;  3QZC A;  1OCR C;  4CJG A;  2P0N A;  3VM6 A;  1CPR A;  3S27 A;  5A6B A;  4G7Z F;  3KL4 A;  1GS9 A;  2EIN C;  2R9R B;  4CDA A;  1QLE C;  3DAF A;  3KPH A;  4C3D A;  4NCQ A;  5L0G A;  1AEP A;  1O5H A;  4WJ0 A;  1VTM P;  1VMA A;  3JCU Q;  1ZHY A;  3NRH A;  4RDA A;  4CS7 A;  2R7V A;  5L3V A;  1E83 A;  1SF8 A;  4BJ5 C;  2XM4 A;  4XTK A;  4I44 A;  4XEF A;  4PFO A;  3IQC A;  3DZA A;  3QW1 A;  4NTF A;  3S90 A;  3TUL A;  4Q7C A;  1A7E A;  1G4U S;  3MX3 A;  1YYJ A;  2P6V A;  4E18 A;  4CSA C;  4P9F A;  4WGY A;  3NDB B;  3JTL O;  2YLD A;  2E87 A;  2OJQ A;  2PBE A;  2OEX A;  1XZQ A;  1KTM A;  1LI7 A;  1FNT c;  1QPU A;  5BQH A;  1FMV A;  2L6G A;  3NMJ A;  1WGW A;  1H9T A;  1GQA A;  5KYW A;  1RCP A;  3ASO C;  3E70 C;  2YZS A;  3H2U A;  2O9X A;  2R7X A;  4E17 A;  5A6K A;  3ECS A;  4UDV A;  3LS0 A;  3TK0 A;  4BEJ A;  2P1A A;  3AOU A;  2DYS C;  2LD6 A;  2XLH A;  3I5Q A;  1NFN A;  3S84 A;  3AGU A;  3IQT A;  2Y39 A;  1EI7 A;  2CGE A;  4JEA A;  2QNL A;  3NMI A;  4AK9 A;  4JEB A;  2XLE A;  1LS1 A;  4IRU A;  4WGZ A;  4X0R A;  1YA9 A;  3SNH A;  3FXH A;  4CS9 C;  2R7U A;  2C04 A;  2XL6 A;  3HNK A;  2VAS A;  4HFK B;  4PJL A;  4BG0 A;  2LIG A;  5JLI A;  3ABK C;  1QZX A;  4DRI B;  2KYH A;  1HMD A;  2W4M A;  3JSZ A;  3WAQ A;  2XXA A;  2A68 F;  4CS9 A;  4KNW A;  2KW3 C;  2EPM X;  4IAQ A;  2DI3 A;  2J0X A;  3DJU B;  2YHS A;  3LNM B;  1YAU O;  3G4Z A;  2WZF A;  4KNV A;  4OD4 A;  3EG9 B;  4NTA A;  2R7S A;  4MVZ A;  2J9B A;  4JIO A;  1CGM E;  2C03 A;  2YL3 A;  1ZU5 A;  2YRF A;  3N24 A;  3QMK A;  3RIP A;  3UGP A;  2LSE A;  2PX0 A;  2ZXP A;  5E3C A;  3HNI A;  3LEO A;  2Q9C A;  5CI8 A;  3M1C B;  5A6J A;  4JTA B;  1IW7 F;  4IAO A;  4ZLC A;  3GM3 A;  3TQO A;  3EGD A;  4LLE A;  3MBG A;  4CIH A;  3R2P A;  4P6I C;  3FOO A;  2Q4F A;  1NZE A;  1G4W R;  2YVK A;  4KBL A;  1RMV A;  2WVN A;  4O6M A;  3S9O A;  1JOG A;  2R03 A;  1OCZ C;  1Q0M A;  3L8J A;  4CSA A;  2PNO A;  4A2N B;  2HS5 A;  2YL7 A;  4CX9 A;  1V4A A;  4FES A;  5KYY B;  1L7C A;  1YJG A;  4J7T A;  5JSL A;  2IBF A;  4BJ5 A;  1JPJ A;  2WZL A;  3NKE A;  2OJE D;  1WAS A;  2NUT B;  1J8M F;  4LDK A;  4MVQ A;  1K40 A;  4JVS A;  3MYI A;  4N4W A;  5FCL A;  3CQZ A;  2OQM A;  4G0H A;  2HKV A;  3A9C A;  3K1H A;  3N0T A;  2GFH A;  4YL3 A;  2M4E A;  4E7Z A;  1OKK D;  3RH3 A;  3DE9 A;  3EHM A;  1Q0F A;  1JAF A;  1JPN A;  4R32 A;  1RKE B;  1Z63 A;  3CEX A;  1KNY A;  2W9Y A;  4XPW A;  3O6X A;  3VAY A;  2CDQ A;  1G8X A;  1Z3I X;  4N6C A;  3UMI A;  5BQI A;  2PX3 A;  3R7C A;  3NYM A;  1Z5Z A;  4PJM A;  2NUP A;  1QVX A;  2EIM C;  3SXK A;  2BE5 F;  4FWV A;  1A0B A;  2G62 A;  2HZ8 A;  3EGX A;  3KYJ A;  1N1C A;  2R05 A;  3KYI A;  2UUH A;  5BUO A;  4A4A A;  2AVK A;  5DS6 A;  4AE4 B;  4YT2 A;  3IHU A;  1NU7 D;  2EPL X;  4IJJ A;  4BPM A;  5JRA A;  3K1I A;  4Q5S F;  3F46 A;  3AG1 C;  3TOL A;  5L0F A;  4N6H A;  4DBR A;  3NYL A;  2Q7R A;  2L6F A;  3C8G A;  4PK4 A;  2D4U A;  2J9V A;  5JT4 A;  2QY9 A;  1TFK B;  1HW1 A;  4QI0 A;  1U6H A;  2VCB A;  3EFO B;  4XWJ A;  4DOZ A;  3DXJ F;  1E86 A;  1WOL A;  1K04 A;  2DYR C;  1BZ4 A;  3C63 A;  1CGO A;  2J9U A;  3EFO A;  3FAJ A;  3GWL A;  3Q6M A;  3RF3 A;  3RVZ A;  4EUK B;  2R7R A;  4LER A;  1YZC A;  1HMO A;  5COG A;  2XL4 A;  3LS1 A;  3RFY A;  3U3F A;  3US6 A;  4CS8 A;  1EQ1 A;  1YLM A;  1E85 A;  1IZM A;  4PJJ A;  3DMD A;  2IXM A;  2XLM A;  2YLG A;  3GOR A;  4P9T A;  3CSK A;  1NFO A;  3HJC A;  1E84 A;  3SXZ A;  2PP4 A;  3LEV A;  3GAN A;  2MWQ A;  3AG3 C;  5KYX A;  4BJ1 A;  1Q0G A;  1PD1 A;  2MYS A;  3HNL A;  1LE2 A;  4Z9J A;  1MQV A;  5CIV A;  4CDY A;  4BJ6 A;  2VCA A;  2Q9B A;  4GEH A;  1VK5 A;  5E2Q A;  3NKD A;  2GWW A;  3W2V A;  2AU5 A;  3V5Z A;  1V55 C;  3SEO A;  3ITF A;  5KYN A;  2D5R B;  4L6R A;  4JJG A;  4YJW A;  4CBE A;  2YKZ A;  1ORY A;  3V5X A;  4EHP A;  4G7O F;  4H4K C;  2VC9 A;  2HMZ A;  2QUP A;  5EGY A;  1FR0 A;  2R25 A;  1RJ9 B;  3GWN A;  2YWA A;  1HE9 A;  1ZW3 A;  5E3A A;  5DQT A;  1KU2 A;  4M63 A;  1A41 A;  4ER9 A;  2L7A A;  3GEH A;  2L9J A;  4O79 A;  1LIH A;  1TQG A;  4YL0 A;  3CZ6 A;  3U8V A;  3W2W A;  3POV A;  5COM A;  3VYW A;  4GQH A;  4W8K A;  3K66 A;  2YEV A;  4JCZ A;  2FGY A;  2KQ9 A;  256B A;  2WB7 A;  2FFH A;  1O87 A;  1TR2 A;  2KNH A;  4JTC B;  1RJ9 A;  2CNW A;  4OIQ F;  1BR1 A;  2EIJ C;  1DOW A;  2B0H A;  1C17 M;  1E2X A;  3ABM C;  3AG2 C;  1NBB A;  3TJ6 A;  3WG7 C;  4Q4Z F;  4YT4 A;  3MFN A;  4IAR A;  3BRJ A;  3LLK A;  4MW8 A;  3RKO F;  2ZD9 A;  1ZU4 A;  4MVM A;  1VB5 A;  2J8W A;  3X2Q C;  3T9O A;  4JUR I;  4O7G A;  5L0C A;  2V3C C;  3RQG A;  1UG7 A;  4OD5 A;  5GPG B;  1FFT C;  3LNR A;  1TFO B;  2AWC A;  2L6H A;  1OQC A;  2B0J A;  3LUT B;  1OW7 A;  3U8P A;  3HLZ A;  3ASN C;  1VLT A;  5L0H A;  3JRM O;  5KYU A;  2A6H F;  1B68 A;  2A1D D;  4LLC A;  1M2V B;  1MND A;  3MYF A;  1FTS A;  3RQE A;  3W8I A;  2IOQ A;  2IXP A;  3ZQV A;  3HTK C;  4N06 A;  4G7H F;  5D91 A;  3VRC A;  3BEH A;  3DKA A;  1OXB A;  1T6Q A;  3IQ6 A;  5CI9 A;  5DVW A;  4NC3 A;  3ZIB A;  3AQC A;  4U5C E;  1LM3 B;  2Z15 A;  4IGG A;  3RVY A;  4EBB A;  3AG4 C;  5L3Q A;  4K7B A;  3C8Z A;  2LK4 A;  2EIL C;  3RW0 A;  3DJN B;  4I1M A;  3C62 A;  4PFP A;  1VOM A;  4QI2 A;  1AUE A;  4U9D A;  3ZC4 A;  2IYL D;  4I1O B;  3U2L A;  2R7Q A;  2V26 A;  1VLS A;  2XLW A;  2HFI A;  5T1D B;  1Z23 A;  2CCY A;  1SMY F;  2HMQ A;  3EJN A;  3K6B A;  3AQB A;  4ANJ A;  1WAT A;  4Z9I A;  3GEI A;  4E0H A;  3H2V A;  2LQG A;  3ZVR A;  3GM2 A;  1HW2 A;  2EPO A;  4LDQ A;  1T6I A;  5KYW B;  3J06 A;  2WZG A;  2DB4 A;  2KC3 A;  5EK0 A;  3JYY A;  1ORJ A;  3JZ0 A;  3G4X A;  3Q7L A;  4J7Y A;  4MVO A;  2JD3 A;  5JP7 A;  5A6B D;  3DD7 A;  2YQY A;  4MVU A;  2VCC A;  1D0Z A;  2GDC A;  3TOM A;  2NUP B;  2H7B A;  2YLI A;  3X1O A;  4C7O B;  2LCH A;  2XS8 A;  2OCC C;  5B1B C;  1A7D A;  2HJ3 A;  2WL8 A;  4HEA J;  2XL8 A;  1D1A A;  3T6B A;  2OEV A;  5F28 E;  4XEK A;  4NY3 A;  4JJF A;  3QW0 A;  1SR2 A;  1VYK A;  3DM5 A;  1PV3 A;  2NPU A;  2A69 F;  2ZPA A;  1LI5 A;  3K7D A;  3KMI A;  4I3M A;  4AL0 A;  5IY5 C;  1TWG A;  3B71 A;  3LES A;  1U0B B;  1XZP A;  1OR2 A;  4XPY A;  3G50 A;  3IPM O;  4F4B A;  3GEE A;  1ZHT A;  1BDJ B;  5F5H A;  1CGN A;  1QQ3 A;  3JSE O;  4B6I A;  2QTV A;  1U89 A;  2G3V A;  2XM0 A;  3W8H A;  3S29 A;  1ZW2 A;  2H7V C;  2KK1 A;  3GOD A;  1FFH A;  1D0X A;  2AWY A;  3S0X A;  2QE9 A;  2HSQ A;  4KC9 A;  5BQG A;  1SYQ A;  2I15 A;  4ONS A;  1C02 A;  1OCO C;  3ZWI A;  3NG1 A;  4YT5 A;  3SZR A;  3B0V C;  1TWH A;  2FAP B;  1RKC A;  3M15 A;  4MVS A;  1ZHW A;  1M56 C;  5JVE A;  3FVY A;  4OIP F;  3L1M A;  1Y4C A;  3EZH A;  1MMG A;  3A11 A;  1R4T A;  3MLG A;  4BJ6 C;  3UGO A;  3HNJ A;  4MND A;  5HV9 A;  1YDI A;  3DI5 A;  1PCX A;  3ZTM A;  1SZI A;  3DE8 A;  3FMS A;  1Z6A A;  1HY5 A;  1OCC C;  1Y6D A;  2A0U A;  2CNW D;  1L3P A;  4ZLD A;  1UFB A;  4CJO A;  2J9W A;  1NG1 A;  2HV6 A;  1H6G A;  3EZI A;  1MNE A;  5T3W A;  3T4R A;  1LE4 A;  4U5F E;  3UR3 C;  1CPQ A;  1D1B A;  5B1A C;  1JRA A;  3EHN A;  4PR9 A;  3ZDL A;  1V54 C;  3EGD B;  5AC4 A;  3IEE A;  3JT1 A;  2J46 A;  2DGJ A;  3PMR A;  1OW6 A;  1I4Y A;  1YVI A;  3E9V A;  3K1I C;  4XPX A;  3U9J A;  5A69 A;  1XWJ A;  3EGX B;  1BBH A;  3PHF 2;  2HUJ A;  4HFF B;  2KGO A;  2XLD A;  3EH1 A;  2GA0 A;  2XRH A;  5JUA A;  4LAC B;  2Q9A A;  3AJM A;  4FAP B;  2LP4 A;  1LKX A;  1AVO B;  1TWC A;  3C8G B;  4J32 B;  3M4C A;  3M79 A;  3W4Y A;  3ZSU A;  1ST6 A;  2X51 A;  4JTD B;  2EPK X;  2G3K A;  3OEO A;  4NQF A;  2NUT A;  3RQF A;  3U5S A;  2J7P A;  3F47 A;  1H7I A;  1R5I D;  4PJN A;  2Y3B A;  3AGT A;  1Q0D A;  4BEM J;  4J30 B;  4H54 A;  3U2M A;  4YL1 A;  5DQZ A;  3O55 A;  2EPN A;  5D92 A;  1ZHZ A;  4K1O A;  4AX2 A;  4U5B E;  4U5E E;  3T6G B;  4AL1 A;  1ZHX A;  2OU6 A;  2LFD A;  4JW1 A;  4EBK A;  3GM1 A;  2W45 A;  3PCV A;  4MW3 A;  3S28 A;  2R7O A;  4OIN F;  4EWC A;  3DAG A;  1G5Z A;  2Q3T A;  3U3B A;  1APC A;  4G78 A;  1F1M A;  1T01 A;  2OKU A;  1FAP B;  3H65 A;  1Q0K A;  4YWQ A;  5L0I A;  5TJ5 E;  4CIP A;  3C7J A;  3UNG C;  3NMK A;  1K05 A;  3KKB A;  4RD9 A;  2H7O A;  5HSW A;  3VF0 A;  2ZXO A;  3ABL C;  1BR4 A;  4LDR A;  3SXM A;  1ZZP A;  1RXQ A;  3QTH A;  2OG2 A;  1QKR A;  2I8B A;  5E33 A;  4JZA A;  2MHR A;  2ZXW C;  3FAP B;  4K0D A;  2Y3G A;  4DBQ A;  2HV7 A;  3U9M A;  5DLJ A;  1D0Y A;  2LFF A;  2XLO A;  3FHD A;  4DRH B;  3LJB A;  4MTG A;  1S7Z A;  2VH3 A;  3LLI A;  3WOD F;  2KSF A;  1RKE A;  2Y3D A;  1GGQ A;  2JX0 A;  2WVO A;  1NU9 C;  2NG1 A;  1FMW A;  4U5H A;  3V5Y A;  3CAX A;  3O39 A;  4U5G A;  3EH2 A;  2R7T A;  5KYY A;  1YAR O;  4ULV A;  1PD0 A;  3UMH A;  2J0W A;  1WWP A;  4C3E A;  4XLP F;  3OWT A;  2R02 A;  3QVY A;  2IXO A;  2PFD A;  5B3I A;  4HE8 D;  4YK5 A;  3LAY A;  2YL0 A;  3KH2 A;  3T6J A;  4DVY P;  1M57 C;  1ZVZ A;  1TKN A;  2UUI A;  3RYL A;  4D4X A;  3NYJ A;  2M64 A;  3IQ5 A;  3L34 A;  1OXK A;  2H8A A;  2XXA B;  1M2V A;  1V74 B;  2OOC A;  2HSB A;  1MMN A;  1QSP A;  3JRT A;  4AE4 A;  3Q7G A;  1JMW A;  3I5P A;  5DS4 A;  2ETS A;  4E0I A;  1T9K A;  2A6E F;  4EKW A;  2EIK C;  2WVQ A;  4E7S A;  3B0U X;  2CW0 F;  4WAB A;  1S05 A;  4EIY A;  4KI2 A;  1J8Y F;  3EPV A;  5FZT A;  2ASR A;  2NSF A;  4OIR F;  3C18 A;  1JR8 A;  5A6A A;  2BC5 A;  1A7V A;  1OW8 A;  4MS2 A;  1YZA A;  1NSG B;  3DWW A;  4DXW A;  5AC5 A;  5KYU B;  1LS4 A;  5KYX B;  4ULW A;  1I4Z A;  1M2O A;  3N2Z B;  1OR3 A;  1YA7 O;  2XLV A;  3B29 A;  3UMK A;  4DRJ B;  2YL1 A;  3FOP A;  4U5D E;  1T6U A;  2Y3H A;  5AGF A;  2J7P D;  4O6N A;  4RBN A;  1EKY A;  1D1C A;  4CS8 C;  4CDV A;  4EBJ A;  3I4U A;  3EQL F;  1ORS C;  2F22 A;  2QLA A; 
#chains in the Genus database with same CATH homology
 1UFB A;  3GM2 A;  3C8G D;  2KK1 A;  1WTY A;  3RQE A;  3GM3 A;  3JYY A;  3L8I A;  3JZ0 A;  2L6F A;  3C8G A;  4XEF A;  2JX0 A;  4R32 A;  3TUL A;  3O10 A;  3C18 A;  1KNY A;  1OW6 A;  3S9O A;  3U0C A;  1WOL A;  1JOG A;  1K04 A;  3GM1 A;  3L8J A;  4XEV A;  5F28 E;  4EBK A;  2JPU A;  3MFN A;  1O3U A;  1WWP A;  3BRJ A;  2PBE A;  4XEK A;  1OW8 A;  1V4A A;  1KTM A;  2LK4 A;  2Q00 A;  1PV3 A;  3K7D A;  3U3F A;  2L6G A;  3AJM A;  3B71 A;  2YWA A;  3RQG A;  1QVX A;  3C8G B;  1K05 A;  2L6H A;  1K40 A;  4EBJ A;  1OW7 A;  2HSB A;  3RQF A;  4NQF A;  1ZZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...