2L6GA

Fat-ld2 double labeled construct with free ld4 peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
161
Chain Sequence
MANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPHSNLSELDRLLLELNAVQHNPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase,cell adhesion
molecule keywords Focal adhesion kinase 1, linker, Paxillin
publication title Fat-Ld2 Double Labeled Construct with Free Ld4 Peptide
rcsb
source organism Gallus gallus, unidentified
total genus 56
structure length 161
sequence length 176
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2l6gA00
1UFBA 3C18A 3U0CA 2JPUA 1K05A 3AJMA 4XEFA 3JZ0A 3GM2A 1V4AA 3RQGA 3L8IA 3B71A 1O3UA 5F28E 2L6FA 2YWAA 2Q00A 3RQFA 2HSBA 2PBEA 3TULA 2JX0A 2L6HA 4EBJA 2L6GA 1K40A 1OW6A 4R32A 1KTMA 4XEKA 3GM3A 3O10A 3C8GA 3L8JA 3GM1A 4EBKA 1WWPA 4NQFA 3S9OA 3MFNA 1WTYA 3C8GD 2KK1A 3JYYA 3RQEA 3C8GB 1JOGA 1KNYA 1K04A 1QVXA 3U3FA 2LK4A 1ZZPA 3K7DA 3BRJA 1OW8A 4XEVA 1PV3A 1WOLA 1OW7A
chains in the Genus database with same CATH superfamily
3RYLA 2Q3TA 4JJGA 4U5DE 3L1MA 3QVYA 2BE5F 4UDVA 2OJED 3MYIA 2KYHA 4DVZA 3QMKA 1S05A 5JVEA 1VK5A 2FGYA 1LS1A 4NTFA 5L0DA 2Q7RA 4HE8D 5DQZA 3POVA 5KYUA 2EIMC 2HKVA 2FFHA 3M79A 3C62A 4XPXA 5F5FA 2E87A 2D5RB 1A41A 4NTAA 1LI7A 2G62A 2EPKX 3ABKC 1SMYF 1SR2A 4NC3A 2H7BA 3RW0A 3SXMA 1EA8A 1Z5ZA 1EQ1A 2VCAA 1MMDA 3ZTMA 4ANJA 1QQ3A 5BQHA 3T6BA 3TOLA 4XWJA 2W9YA 1QVXA 1OCZC 4LDRA 3X2QC 1VTMP 3CZ6A 4WGYA 5BQIA 4CBEA 4U5BE 1LI5A 1MMNA 1RKEB 1TWGA 2YVKA 3S9OA 4DOZA 2J7PD 4EIYA 4XLNF 1LM3B 4AK9A 1Z3IX 1K05A 2Z15A 3JZ0A 3GM2A 5GPGB 2L7AA 3U2MA 1H9TA 3LUTB 2TMVP 2XXAA 1NSGB 2DGJA 5F28E 2Y39A 1F1MA 4AL0A 2XLEA 4YT8A 1YA7O 2R7QA 4EHPA 1ZHZA 5KYYA 3PCVA 3PMRA 2IOQA 2P1AA 1QLEC 3IQ6A 4RD9A 4P9TA 2R7WA 3SZRA 3AG1C 3LJBA 3EQLF 5AGFA 3LS0A 1T6UA 5E3AA 4NQFA 5DVWA 3S28A 5DS4A 3G4ZA 3WODF 2IBFA 1YARO 2OEXA 4XLPF 2C03A 4XEVA 3U3BA 2ICWG 5JRAA 4U5CE 1ZU5A 3C63A 3W8IA 3NYMA 4CJOA 1HY5A 1M56C 2ZXRA 3EHNA 3C7JA 3IQCA 1M57C 3GWNA 1FMWA 2ZD9A 3U9MA 4C3EA 2A6EF 2NUTA 2YLIA 3N2ZB 1MNEA 2MWQA 2W45A 4YT4A 5B3IA 4BEJA 2Q4FA 1NG1A 2Y3BA 1BR4A 4U9EA 3FAJA 5A6BD 1W2WA 4IAOA 2EINC 3AGUA 3MYFA 1NZEA 3GM3A 2I8BA 4EWCA 4Z9JA 1FR0A 1D1BA 5B1AC 3EGDB 3RQEA 4HFFB 1LE2A 2LSEA 3M15A 5L0CA 2NUPA 1ZU4A 3NMIA 5HV9A 2V3CC 1S7ZA 1HE1A 3KKBA 2PX0A 3QVZA 2KK1A 4K0DA 4CDVA 1A0BA 3TQOA 1AEPA 3KH2A 1SYQA 3RIPA 3M4CA 4MW8A 3LNRA 4OD4A 3FHDA 3Q7GA 4OD5A 2XLMA 1XZQA 2HJMA 3ASOC 2A6HF 4CIPA 1Q0KA 2A0UA 4C7OB 3IQTA 2ASRA 5TJ5E 3RVZA 1ZHWA 3AQCA 3RQFA 1E84A 4WABA 4FAPB 4KC9A 4JTCB 3UMKA 2QY9A 1LVKA 4PK4A 3UMHA 1C02A 2HV6A 3C8GA 4MTGA 1M2OA 3L8JA 4WGZA 2PF4E 1WWPA 2EPMX 2YHSA 3V5ZA 2P0NA 4C3DA 4JEBA 4FESA 4AE4B 2I15A 2M64A 4XPYA 1T6QA 3O55A 2CGEA 3GORA 2WVOA 2XRHA 3E70C 5FCLA 4EBBA 4B6IA 2KC3A 4CSAC 3CSKA 3TJ5A 1U89A 2OU6A 1JMWA 3KMIA 1HW2A 2JPUA 2J45A 1NU7D 4XEFA 1ZHYA 2Q9BA 3DJUB 4JE9A 3JSEO 4YL1A 3B0PA 3ZWIA 1T01A 1BDJB 3QW1A 5AC5A 1ZW2A 1EI7A 1FMVA 1UG7A 1YVIA 2MHRA 2VC9A 3I5QA 3JRTA 1OXBA 2XM4A 256BA 3LAYA 2ZPAA 5E3CA 2LFFA 2PBEA 4NTBA 4ULVA 3VAYA 3JYHA 1VMAA 3OA1A 1WASA 4AX2A 2OEVA 3AG4C 4A2NB 2XLVA 3H65A 3R2PA 3E9VA 3TD7A 2R7SA 2Y69C 3GM1A 1TKNA 3FXHA 1ZHTA 3I5PA 1NFNA 1D0ZA 3M1CB 1VB5A 4LERA 1HW1A 3SNHA 4CS8C 3ABLC 4F4BA 2XL8A 3W2WA 2J9UA 2XSEA 5L3QA 2R7OA 3K33A 3G50A 1G4US 1JPJA 4OIRF 3EZIA 1YZAA 4CIHA 3M4BA 4X0RA 3ZC4A 4YT2A 4CS7A 3RVYA 3ASNC 4PJMA 4MVMA 3EG9B 4FX5A 1TQGA 1JR8A 1OCCC 3L8IA 4DBQA 3LLKA 3LNMB 3NYJA 3W4YA 1ZHXA 3JTLO 1RXQA 3FMSA 5COFA 2ZXWC 3AG2C 2CYDA 1OW6A 1OQCA 3DJNB 4IARA 5L0FA 5EGYA 1A7EA 2L9JA 3NDBB 2EPNA 4JRZA 1N1CA 4L6RA 1A7DA 2AU5A 3AOUA 1U0BB 3R7CA 2EILC 3N0TA 2P6VA 1RJ9B 4CSAA 4DRJB 1Q0GA 2F22A 3DXJF 3FOPA 3K7DA 4XQ1A 3U5SA 5CI9A 2KSFA 2HV7A 4KNVA 3V5XA 4Q7CA 1D0XA 3C18A 4J7YA 5JSLA 4HFKB 2R7UA 1MNDA 5EK0A 2A0BA 1H9GA 4U5FE 3RQGA 5KYWB 2B0JA 2D4UA 2Y3HA 5DS5A 2R9RB 4CS8A 3LEOA 3UNGC 3ZQYA 3HNLA 4ZLCA 3TULA 1I5NA 2G3KA 3X1OA 3HNJA 1MQVA 4XEKA 2XL4A 2EIKC 4GQHA 4O6NA 4BG0A 3VYWA 1WTYA 4BJ1A 3EZHA 1RKEA 1D1AA 1E83A 4I1OB 4E0HA 2HSQA 1V74B 2UUIA 1V55C 1JPNA 2OOCA 3EFOB 3IPMO 4U5EE 3RF3A 3Q6MA 2YRFA 3K1IC 1QSPA 2AWCA 2ETSA 2WVQA 1YYJA 2J9VA 3I4UA 5JT4A 1V4AA 2NSGA 4AL1A 2EPOA 2LQGA 4QI0A 4GEHA 4MVZA 5K0IA 3ZTZA 1D0YA 2GWWA 4JZAA 3C8ZA 3L34A 5CI8A 4CS9C 3EGXB 4ONSA 1H6GA 2VCBA 4E17A 4J32B 3SXKA 5E2QA 1J8MF 4JC7A 3TOMA 3HKKA 3S90A 1SZIA 2ZXPA 4LLEA 2LFDA 2XM0A 1VYIA 4MS2A 2DB4A 3AQBA 4YK5A 3NKEA 3K6BA 3KYJA 4D4XA 3H2VA 2J0XA 2UUHA 2OQMA 4MVOA 2QUPA 4JCHA 5FZTA 3ZIBA 4DVYP 1RCPA 3F46A 1Q0FA 4LDQA 3EHMA 3SXZA 3UMIA 5L3VA 1RMVA 4QDLA 2QTVA 3ZG1A 3AG3C 1APCA 1JAFA 1PD0A 4XTKA 4U5HA 3U0CA 3GWLA 2WB7A 3DM5A 2KNHA 3ZQVA 2NSFA 4N06A 3Q6NA 1C17M 3CEXA 3DD7A 4PFOA 2HMZA 1GQAA 5JP7A 4MTOA 3T9OA 5A69A 4J7TA 1VLTA 3DM9B 3ECSA 3HNKA 1GM5A 2Q9CA 2ZXOA 4FWVA 1TWCA 4Q4ZF 1ST6A 2EIJC 3K1IA 1D1CA 1G5ZA 4HEAJ 4IWBA 1VLSA 3O39A 3EGDA 4YT5A 1ORYA 2WZGA 1OR2A 1QZXA 2BL2A 2YQYA 5KYNA 4YJWA 3BEHA 3HNIA 5KYXB 4I44A 1O87A 3UR3C 4E7SA 5JS5A 1FTSA 2DYSC 2QNLA 1A7VA 1KNYA 4CS9A 1K04A 3LS1A 3NRHA 4XPWA 1T6IA 2YL0A 2OCCC 2GA0A 5L0JA 1TWAA 2P61A 3EH2A 4CDAA 1U6HA 1IZMA 2M4EA 2IXNA 3SEOA 3QW0A 1XZPA 3A11A 3MX3A 2OG2A 4Z9HA 1FFHA 2HMQA 1I4ZA 1OR3A 1CGNA 3DI5A 5BQGA 1TR2A 4RDAA 2YWAA 3ZSUA 2GFHA 2XLWA 2YLGA 3KPHA 2KQ9A 1E86A 3RH3A 1Z23A 3NMJA 3S0XA 3AGTA 1SF8A 3GODA 3SP1A 4AE4A 3PDMP 1TFKB 1WATA 2CW0F 5L0IA 2DYRC 1Z63A 4BEMJ 1LE4A 2AVKA 4ZLDA 4N6HA 5L0GA 4K1OA 2WZFA 2NG1A 2WZLA 3FDQA 1ZW3A 4DXWA 3OWTA 4W8KA 2JD3A 4G0HA 3C8GD 3G4XA 3N24A 3JCUQ 4H4KC 1M2VB 1GS9A 2BC5A 1TWHA 2LD6A 3LESA 4PFPA 2H8AA 2YEVA 5DS6A 4OIPF 4BJ5C 4JW1A 3DMDA 2YLDA 1O3UA 3MBGA 5CIVA 2L6FA 3RKOF 1MMGA 2Q00A 3RFYA 4JEAA 2XLHA 1VYKA 1MMAA 1OXKA 4R32A 3GEEA 5D92A 4A4AA 3W2VA 2YKZA 5KYUB 2XLOA 3LLIA 1L3PA 3JT1A 4E0IA 1H7IA 4D4NA 1DOVA 3UGPA 3HTKC 5DLJA 1JOGA 1BBHA 3CAXA 1GGQA 1EKYA 2IXPA 2LK4A 2YL1A 3K66A 4MQ9F 4O79A 1HMDA 1WN0A 1NU9C 2HZ8A 1NLXA 4MVSA 4YL3A 4BPMA 1ZYRF 2LIGA 3Q7LA 4DJ9A 3EG9A 1UFBA 1QPUA 1PD1A 1LPEA 2W4BA 4IJJA 1G4WR 4I1MA 4CX9A 1YYXA 3UGOA 2KGOA 3WHNA 4PACA 3DWWA 1Z6AA 3FAPB 3GANA 3FVYA 5COGA 1BR2A 4PJNA 1LIHA 1WGWA 3WAQA 2VH3A 2O9XA 4BJ6C 2XXAB 5COMA 2DI3A 1CPRA 3DKAA 2L6GA 1BZ4A 4JIOA 4EBJA 4YWQA 5KYYB 3VF0A 4O7GA 3O10A 3DZAA 1RJ9A 4MVUA 3A9CA 3DAGA 3HJCA 5F5HA 4EBKA 4JTAB 1J8YF 3ATPA 5T3WA 5BUOA 1FAPB 2G3VA 4MW3A 4BJ5A 5IY5C 5A6AA 1YAUO 3NMKA 4YL0A 3U3FA 2R7RA 3O6XA 3J06A 3F47A 2EPLX 1JRAA 1Y6DA 2CNWA 4JURI 5HSWA 1PV3A 2YZSA 3CQZA 5KYWA 5A6BA 2XS8A 3V7OA 1IW7F 1L7CA 4G7OF 4OIOF 5T1DB 1NBBA 2PP4A 1R5ID 5T3TA 1YJGA 2H7OA 3T4RA 4P9FA 3SXYA 4BJTA 3V5YA 4NCQA 2R7TA 1TFOB 2NUTB 4PJJA 2NPUA 2AWYA 2HSBA 2LP4A 4G7HF 2Y3DA 4Q5SF 2VASA 1YA9A 4OIQF 2MYSA 3LEVA 4JVSA 1CPQA 4PR9A 4DBRA 5JUAA 1DOWA 4CDYA 3EFOA 3B9QA 3QZCA 1YZCA 2X51A 3IEEA 4O6YA 1CGOA 2Q9AA 3L0IA 2WL8A 4WJ0A 4OINF 4MNDA 3T6JA 3NYLA 4NY3A 3IHUA 4BJ6A 1RKCA 2NUPB 4G78A 4EKWA 3TK0A 3JSZA 3EH1A 1ORJA 3IQ5A 3EGXA 5DQTA 2R02A 2VCCA 4U5GA 2CNWD 2OKUA 2OJQA 3B71A 2R05A 5AC4A 4JKVA 1AUEA 4P6IC 1ORSC 2J8WA 2PX3A 1PCXA 1Y4CA 3MLGA 3GEIA 1Z7Qc 2KJGA 4J30B 2GDCA 2HFIA 3DE8A 3EPVA 3JRMO 4ULWA 3VRCA 1T5OA 5L0HA 4IB4A 3U9JA 1YLMA 3VM6A 2QE9A 2W4MA 3MFNA 3JYYA 2HUJA 3C8GB 1HMOA 3S27A 5B3SC 2P7VA 4QI2A 3TJ6A 3BRJA 2J9BA 5E33A 2X0CA 5A6KA 4KBLA 2R7XA 3EJNA 1E2XA 1I4YA 1OW7A 2VB6A 3PHF2 4MVQA 4GYTA 2PFDA 3SYNA 4LDKA 1V54C 2J9WA 1XWJA 3S84A 2IYLD 4C7OA 1YDIA 2XL6A 2YL3A 2XS1A 2B0HA 4U9DA 1B68A 4RBNA 2QLAA 4JJFA 4DRIB 1OKKA 3KYIA 3K1HA 2V26A 1ZVZA 1BR1A 2Y3GA 2A69F 2LCHA 3NKDA 1KTMA 4I3MA 2AP3A 3QTHA 5KYXA 2L81A 4JCZA 3T6GB 5D91A 2C04A 2R03A 2RSEB 1OCOC 3W8HA 3U8VA 2R7VA 3DE9A 3DAFA 4LLCA 4N4WA 2GAQA 3B0VC 3GEHA 4K7BA 5A6JA 2RD9A 3B29A 1G8XA 1OW8A 3B0UX 1HE9A 2YL7A 4E7ZA 1NFOA 1O5HA 1WOLA 1Q0MA 4PJLA 1E85A 4EUKB 4MVRA 2FAPB 2CDQA 1VOMA 1KU2A 3AJMA 3U8PA 3ZVRA 1QKRA 2IXOA 2XLDA 4E18A 1CGME 2HJ3A 2IM8A 3FOOA 4ER9A 3NG1A 3WG7C 1LKXA 1FFTC 1Q0DA 5EHHA 4N6CA 4H54A 1C03A 2A1DD 2CCYA 3U2LA 2JX0A 2L6HA 1LS4A 4O6MA 4JTDB 1K40A 2H7VC 4IAQA 4KNWA 4IRUA 4W8PA 4YN0B 3KL4A 4MTFA 3US6A 3ZDLA 3ITFA 4C3BA 4CJGA 2J7PA 1FNTc 1R4TA 1OKKD 3H2UA 5JLIA 4G7ZF 2KW3C 3ABMC 3OEOA 2J0WA 3S29A 1OCRC 2J46A 2HS5A 4DRHB 4LACB 4KI2A 2A68F 3HLZA 1M6TA 1ZZPA 2WVNA 1M2VA 2IXMA 4IGGA 4M63A 1T9KA 5B1BC 4Z9IA 1AVOB 2R25A 2PNOA
chains in the Genus database with same CATH topology
1UFBA 3C18A 3U0CA 2JPUA 1K05A 3AJMA 4XEFA 3JZ0A 3GM2A 1V4AA 3RQGA 3L8IA 3B71A 1O3UA 5F28E 2L6FA 2YWAA 2Q00A 3RQFA 2HSBA 2PBEA 3TULA 2JX0A 2L6HA 4EBJA 2L6GA 1K40A 1OW6A 4R32A 1KTMA 4XEKA 3GM3A 3O10A 3C8GA 3L8JA 3GM1A 4EBKA 1WWPA 4NQFA 3S9OA 3MFNA 1WTYA 3C8GD 2KK1A 3JYYA 3RQEA 3C8GB 1JOGA 1KNYA 1K04A 1QVXA 3U3FA 2LK4A 1ZZPA 3K7DA 3BRJA 1OW8A 4XEVA 1PV3A 1WOLA 1OW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFB A;  3C18 A;  3U0C A;  2JPU A;  1K05 A;  3AJM A;  4XEF A;  3JZ0 A;  3GM2 A;  1V4A A;  3RQG A;  3L8I A;  3B71 A;  1O3U A;  5F28 E;  2L6F A;  2YWA A;  2Q00 A;  3RQF A;  2HSB A;  2PBE A;  3TUL A;  2JX0 A;  2L6H A;  4EBJ A;  2L6G A;  1K40 A;  1OW6 A;  4R32 A;  1KTM A;  4XEK A;  3GM3 A;  3O10 A;  3C8G A;  3L8J A;  3GM1 A;  4EBK A;  1WWP A;  4NQF A;  3S9O A;  3MFN A;  1WTY A;  3C8G D;  2KK1 A;  3JYY A;  3RQE A;  3C8G B;  1JOG A;  1KNY A;  1K04 A;  1QVX A;  3U3F A;  2LK4 A;  1ZZP A;  3K7D A;  3BRJ A;  1OW8 A;  4XEV A;  1PV3 A;  1WOL A;  1OW7 A; 
#chains in the Genus database with same CATH topology
 3RYL A;  2Q3T A;  4JJG A;  4U5D E;  3L1M A;  3QVY A;  2BE5 F;  4UDV A;  2OJE D;  3MYI A;  2KYH A;  4DVZ A;  3QMK A;  1S05 A;  5JVE A;  1VK5 A;  2FGY A;  1LS1 A;  4NTF A;  5L0D A;  2Q7R A;  4HE8 D;  5DQZ A;  3POV A;  5KYU A;  2EIM C;  2HKV A;  2FFH A;  3M79 A;  3C62 A;  4XPX A;  5F5F A;  2E87 A;  2D5R B;  1A41 A;  4NTA A;  1LI7 A;  2G62 A;  2EPK X;  3ABK C;  1SMY F;  1SR2 A;  4NC3 A;  2H7B A;  3RW0 A;  3SXM A;  1EA8 A;  1Z5Z A;  1EQ1 A;  2VCA A;  1MMD A;  3ZTM A;  4ANJ A;  1QQ3 A;  5BQH A;  3T6B A;  3TOL A;  4XWJ A;  2W9Y A;  1QVX A;  1OCZ C;  4LDR A;  3X2Q C;  1VTM P;  3CZ6 A;  4WGY A;  5BQI A;  4CBE A;  4U5B E;  1LI5 A;  1MMN A;  1RKE B;  1TWG A;  2YVK A;  3S9O A;  4DOZ A;  2J7P D;  4EIY A;  4XLN F;  1LM3 B;  4AK9 A;  1Z3I X;  1K05 A;  2Z15 A;  3JZ0 A;  3GM2 A;  5GPG B;  2L7A A;  3U2M A;  1H9T A;  3LUT B;  2TMV P;  2XXA A;  1NSG B;  2DGJ A;  5F28 E;  2Y39 A;  1F1M A;  4AL0 A;  2XLE A;  4YT8 A;  1YA7 O;  2R7Q A;  4EHP A;  1ZHZ A;  5KYY A;  3PCV A;  3PMR A;  2IOQ A;  2P1A A;  1QLE C;  3IQ6 A;  4RD9 A;  4P9T A;  2R7W A;  3SZR A;  3AG1 C;  3LJB A;  3EQL F;  5AGF A;  3LS0 A;  1T6U A;  5E3A A;  4NQF A;  5DVW A;  3S28 A;  5DS4 A;  3G4Z A;  3WOD F;  2IBF A;  1YAR O;  2OEX A;  4XLP F;  2C03 A;  4XEV A;  3U3B A;  2ICW G;  5JRA A;  4U5C E;  1ZU5 A;  3C63 A;  3W8I A;  3NYM A;  4CJO A;  1HY5 A;  1M56 C;  2ZXR A;  3EHN A;  3C7J A;  3IQC A;  1M57 C;  3GWN A;  1FMW A;  2ZD9 A;  3U9M A;  4C3E A;  2A6E F;  2NUT A;  2YLI A;  3N2Z B;  1MNE A;  2MWQ A;  2W45 A;  4YT4 A;  5B3I A;  4BEJ A;  2Q4F A;  1NG1 A;  2Y3B A;  1BR4 A;  4U9E A;  3FAJ A;  5A6B D;  1W2W A;  4IAO A;  2EIN C;  3AGU A;  3MYF A;  1NZE A;  3GM3 A;  2I8B A;  4EWC A;  4Z9J A;  1FR0 A;  1D1B A;  5B1A C;  3EGD B;  3RQE A;  4HFF B;  1LE2 A;  2LSE A;  3M15 A;  5L0C A;  2NUP A;  1ZU4 A;  3NMI A;  5HV9 A;  2V3C C;  1S7Z A;  1HE1 A;  3KKB A;  2PX0 A;  3QVZ A;  2KK1 A;  4K0D A;  4CDV A;  1A0B A;  3TQO A;  1AEP A;  3KH2 A;  1SYQ A;  3RIP A;  3M4C A;  4MW8 A;  3LNR A;  4OD4 A;  3FHD A;  3Q7G A;  4OD5 A;  2XLM A;  1XZQ A;  2HJM A;  3ASO C;  2A6H F;  4CIP A;  1Q0K A;  2A0U A;  4C7O B;  3IQT A;  2ASR A;  5TJ5 E;  3RVZ A;  1ZHW A;  3AQC A;  3RQF A;  1E84 A;  4WAB A;  4FAP B;  4KC9 A;  4JTC B;  3UMK A;  2QY9 A;  1LVK A;  4PK4 A;  3UMH A;  1C02 A;  2HV6 A;  3C8G A;  4MTG A;  1M2O A;  3L8J A;  4WGZ A;  2PF4 E;  1WWP A;  2EPM X;  2YHS A;  3V5Z A;  2P0N A;  4C3D A;  4JEB A;  4FES A;  4AE4 B;  2I15 A;  2M64 A;  4XPY A;  1T6Q A;  3O55 A;  2CGE A;  3GOR A;  2WVO A;  2XRH A;  3E70 C;  5FCL A;  4EBB A;  4B6I A;  2KC3 A;  4CSA C;  3CSK A;  3TJ5 A;  1U89 A;  2OU6 A;  1JMW A;  3KMI A;  1HW2 A;  2JPU A;  2J45 A;  1NU7 D;  4XEF A;  1ZHY A;  2Q9B A;  3DJU B;  4JE9 A;  3JSE O;  4YL1 A;  3B0P A;  3ZWI A;  1T01 A;  1BDJ B;  3QW1 A;  5AC5 A;  1ZW2 A;  1EI7 A;  1FMV A;  1UG7 A;  1YVI A;  2MHR A;  2VC9 A;  3I5Q A;  3JRT A;  1OXB A;  2XM4 A;  256B A;  3LAY A;  2ZPA A;  5E3C A;  2LFF A;  2PBE A;  4NTB A;  4ULV A;  3VAY A;  3JYH A;  1VMA A;  3OA1 A;  1WAS A;  4AX2 A;  2OEV A;  3AG4 C;  4A2N B;  2XLV A;  3H65 A;  3R2P A;  3E9V A;  3TD7 A;  2R7S A;  2Y69 C;  3GM1 A;  1TKN A;  3FXH A;  1ZHT A;  3I5P A;  1NFN A;  1D0Z A;  3M1C B;  1VB5 A;  4LER A;  1HW1 A;  3SNH A;  4CS8 C;  3ABL C;  4F4B A;  2XL8 A;  3W2W A;  2J9U A;  2XSE A;  5L3Q A;  2R7O A;  3K33 A;  3G50 A;  1G4U S;  1JPJ A;  4OIR F;  3EZI A;  1YZA A;  4CIH A;  3M4B A;  4X0R A;  3ZC4 A;  4YT2 A;  4CS7 A;  3RVY A;  3ASN C;  4PJM A;  4MVM A;  3EG9 B;  4FX5 A;  1TQG A;  1JR8 A;  1OCC C;  3L8I A;  4DBQ A;  3LLK A;  3LNM B;  3NYJ A;  3W4Y A;  1ZHX A;  3JTL O;  1RXQ A;  3FMS A;  5COF A;  2ZXW C;  3AG2 C;  2CYD A;  1OW6 A;  1OQC A;  3DJN B;  4IAR A;  5L0F A;  5EGY A;  1A7E A;  2L9J A;  3NDB B;  2EPN A;  4JRZ A;  1N1C A;  4L6R A;  1A7D A;  2AU5 A;  3AOU A;  1U0B B;  3R7C A;  2EIL C;  3N0T A;  2P6V A;  1RJ9 B;  4CSA A;  4DRJ B;  1Q0G A;  2F22 A;  3DXJ F;  3FOP A;  3K7D A;  4XQ1 A;  3U5S A;  5CI9 A;  2KSF A;  2HV7 A;  4KNV A;  3V5X A;  4Q7C A;  1D0X A;  3C18 A;  4J7Y A;  5JSL A;  4HFK B;  2R7U A;  1MND A;  5EK0 A;  2A0B A;  1H9G A;  4U5F E;  3RQG A;  5KYW B;  2B0J A;  2D4U A;  2Y3H A;  5DS5 A;  2R9R B;  4CS8 A;  3LEO A;  3UNG C;  3ZQY A;  3HNL A;  4ZLC A;  3TUL A;  1I5N A;  2G3K A;  3X1O A;  3HNJ A;  1MQV A;  4XEK A;  2XL4 A;  2EIK C;  4GQH A;  4O6N A;  4BG0 A;  3VYW A;  1WTY A;  4BJ1 A;  3EZH A;  1RKE A;  1D1A A;  1E83 A;  4I1O B;  4E0H A;  2HSQ A;  1V74 B;  2UUI A;  1V55 C;  1JPN A;  2OOC A;  3EFO B;  3IPM O;  4U5E E;  3RF3 A;  3Q6M A;  2YRF A;  3K1I C;  1QSP A;  2AWC A;  2ETS A;  2WVQ A;  1YYJ A;  2J9V A;  3I4U A;  5JT4 A;  1V4A A;  2NSG A;  4AL1 A;  2EPO A;  2LQG A;  4QI0 A;  4GEH A;  4MVZ A;  5K0I A;  3ZTZ A;  1D0Y A;  2GWW A;  4JZA A;  3C8Z A;  3L34 A;  5CI8 A;  4CS9 C;  3EGX B;  4ONS A;  1H6G A;  2VCB A;  4E17 A;  4J32 B;  3SXK A;  5E2Q A;  1J8M F;  4JC7 A;  3TOM A;  3HKK A;  3S90 A;  1SZI A;  2ZXP A;  4LLE A;  2LFD A;  2XM0 A;  1VYI A;  4MS2 A;  2DB4 A;  3AQB A;  4YK5 A;  3NKE A;  3K6B A;  3KYJ A;  4D4X A;  3H2V A;  2J0X A;  2UUH A;  2OQM A;  4MVO A;  2QUP A;  4JCH A;  5FZT A;  3ZIB A;  4DVY P;  1RCP A;  3F46 A;  1Q0F A;  4LDQ A;  3EHM A;  3SXZ A;  3UMI A;  5L3V A;  1RMV A;  4QDL A;  2QTV A;  3ZG1 A;  3AG3 C;  1APC A;  1JAF A;  1PD0 A;  4XTK A;  4U5H A;  3U0C A;  3GWL A;  2WB7 A;  3DM5 A;  2KNH A;  3ZQV A;  2NSF A;  4N06 A;  3Q6N A;  1C17 M;  3CEX A;  3DD7 A;  4PFO A;  2HMZ A;  1GQA A;  5JP7 A;  4MTO A;  3T9O A;  5A69 A;  4J7T A;  1VLT A;  3DM9 B;  3ECS A;  3HNK A;  1GM5 A;  2Q9C A;  2ZXO A;  4FWV A;  1TWC A;  4Q4Z F;  1ST6 A;  2EIJ C;  3K1I A;  1D1C A;  1G5Z A;  4HEA J;  4IWB A;  1VLS A;  3O39 A;  3EGD A;  4YT5 A;  1ORY A;  2WZG A;  1OR2 A;  1QZX A;  2BL2 A;  2YQY A;  5KYN A;  4YJW A;  3BEH A;  3HNI A;  5KYX B;  4I44 A;  1O87 A;  3UR3 C;  4E7S A;  5JS5 A;  1FTS A;  2DYS C;  2QNL A;  1A7V A;  1KNY A;  4CS9 A;  1K04 A;  3LS1 A;  3NRH A;  4XPW A;  1T6I A;  2YL0 A;  2OCC C;  2GA0 A;  5L0J A;  1TWA A;  2P61 A;  3EH2 A;  4CDA A;  1U6H A;  1IZM A;  2M4E A;  2IXN A;  3SEO A;  3QW0 A;  1XZP A;  3A11 A;  3MX3 A;  2OG2 A;  4Z9H A;  1FFH A;  2HMQ A;  1I4Z A;  1OR3 A;  1CGN A;  3DI5 A;  5BQG A;  1TR2 A;  4RDA A;  2YWA A;  3ZSU A;  2GFH A;  2XLW A;  2YLG A;  3KPH A;  2KQ9 A;  1E86 A;  3RH3 A;  1Z23 A;  3NMJ A;  3S0X A;  3AGT A;  1SF8 A;  3GOD A;  3SP1 A;  4AE4 A;  3PDM P;  1TFK B;  1WAT A;  2CW0 F;  5L0I A;  2DYR C;  1Z63 A;  4BEM J;  1LE4 A;  2AVK A;  4ZLD A;  4N6H A;  5L0G A;  4K1O A;  2WZF A;  2NG1 A;  2WZL A;  3FDQ A;  1ZW3 A;  4DXW A;  3OWT A;  4W8K A;  2JD3 A;  4G0H A;  3C8G D;  3G4X A;  3N24 A;  3JCU Q;  4H4K C;  1M2V B;  1GS9 A;  2BC5 A;  1TWH A;  2LD6 A;  3LES A;  4PFP A;  2H8A A;  2YEV A;  5DS6 A;  4OIP F;  4BJ5 C;  4JW1 A;  3DMD A;  2YLD A;  1O3U A;  3MBG A;  5CIV A;  2L6F A;  3RKO F;  1MMG A;  2Q00 A;  3RFY A;  4JEA A;  2XLH A;  1VYK A;  1MMA A;  1OXK A;  4R32 A;  3GEE A;  5D92 A;  4A4A A;  3W2V A;  2YKZ A;  5KYU B;  2XLO A;  3LLI A;  1L3P A;  3JT1 A;  4E0I A;  1H7I A;  4D4N A;  1DOV A;  3UGP A;  3HTK C;  5DLJ A;  1JOG A;  1BBH A;  3CAX A;  1GGQ A;  1EKY A;  2IXP A;  2LK4 A;  2YL1 A;  3K66 A;  4MQ9 F;  4O79 A;  1HMD A;  1WN0 A;  1NU9 C;  2HZ8 A;  1NLX A;  4MVS A;  4YL3 A;  4BPM A;  1ZYR F;  2LIG A;  3Q7L A;  4DJ9 A;  3EG9 A;  1UFB A;  1QPU A;  1PD1 A;  1LPE A;  2W4B A;  4IJJ A;  1G4W R;  4I1M A;  4CX9 A;  1YYX A;  3UGO A;  2KGO A;  3WHN A;  4PAC A;  3DWW A;  1Z6A A;  3FAP B;  3GAN A;  3FVY A;  5COG A;  1BR2 A;  4PJN A;  1LIH A;  1WGW A;  3WAQ A;  2VH3 A;  2O9X A;  4BJ6 C;  2XXA B;  5COM A;  2DI3 A;  1CPR A;  3DKA A;  2L6G A;  1BZ4 A;  4JIO A;  4EBJ A;  4YWQ A;  5KYY B;  3VF0 A;  4O7G A;  3O10 A;  3DZA A;  1RJ9 A;  4MVU A;  3A9C A;  3DAG A;  3HJC A;  5F5H A;  4EBK A;  4JTA B;  1J8Y F;  3ATP A;  5T3W A;  5BUO A;  1FAP B;  2G3V A;  4MW3 A;  4BJ5 A;  5IY5 C;  5A6A A;  1YAU O;  3NMK A;  4YL0 A;  3U3F A;  2R7R A;  3O6X A;  3J06 A;  3F47 A;  2EPL X;  1JRA A;  1Y6D A;  2CNW A;  4JUR I;  5HSW A;  1PV3 A;  2YZS A;  3CQZ A;  5KYW A;  5A6B A;  2XS8 A;  3V7O A;  1IW7 F;  1L7C A;  4G7O F;  4OIO F;  5T1D B;  1NBB A;  2PP4 A;  1R5I D;  5T3T A;  1YJG A;  2H7O A;  3T4R A;  4P9F A;  3SXY A;  4BJT A;  3V5Y A;  4NCQ A;  2R7T A;  1TFO B;  2NUT B;  4PJJ A;  2NPU A;  2AWY A;  2HSB A;  2LP4 A;  4G7H F;  2Y3D A;  4Q5S F;  2VAS A;  1YA9 A;  4OIQ F;  2MYS A;  3LEV A;  4JVS A;  1CPQ A;  4PR9 A;  4DBR A;  5JUA A;  1DOW A;  4CDY A;  3EFO A;  3B9Q A;  3QZC A;  1YZC A;  2X51 A;  3IEE A;  4O6Y A;  1CGO A;  2Q9A A;  3L0I A;  2WL8 A;  4WJ0 A;  4OIN F;  4MND A;  3T6J A;  3NYL A;  4NY3 A;  3IHU A;  4BJ6 A;  1RKC A;  2NUP B;  4G78 A;  4EKW A;  3TK0 A;  3JSZ A;  3EH1 A;  1ORJ A;  3IQ5 A;  3EGX A;  5DQT A;  2R02 A;  2VCC A;  4U5G A;  2CNW D;  2OKU A;  2OJQ A;  3B71 A;  2R05 A;  5AC4 A;  4JKV A;  1AUE A;  4P6I C;  1ORS C;  2J8W A;  2PX3 A;  1PCX A;  1Y4C A;  3MLG A;  3GEI A;  1Z7Q c;  2KJG A;  4J30 B;  2GDC A;  2HFI A;  3DE8 A;  3EPV A;  3JRM O;  4ULW A;  3VRC A;  1T5O A;  5L0H A;  4IB4 A;  3U9J A;  1YLM A;  3VM6 A;  2QE9 A;  2W4M A;  3MFN A;  3JYY A;  2HUJ A;  3C8G B;  1HMO A;  3S27 A;  5B3S C;  2P7V A;  4QI2 A;  3TJ6 A;  3BRJ A;  2J9B A;  5E33 A;  2X0C A;  5A6K A;  4KBL A;  2R7X A;  3EJN A;  1E2X A;  1I4Y A;  1OW7 A;  2VB6 A;  3PHF 2;  4MVQ A;  4GYT A;  2PFD A;  3SYN A;  4LDK A;  1V54 C;  2J9W A;  1XWJ A;  3S84 A;  2IYL D;  4C7O A;  1YDI A;  2XL6 A;  2YL3 A;  2XS1 A;  2B0H A;  4U9D A;  1B68 A;  4RBN A;  2QLA A;  4JJF A;  4DRI B;  1OKK A;  3KYI A;  3K1H A;  2V26 A;  1ZVZ A;  1BR1 A;  2Y3G A;  2A69 F;  2LCH A;  3NKD A;  1KTM A;  4I3M A;  2AP3 A;  3QTH A;  5KYX A;  2L81 A;  4JCZ A;  3T6G B;  5D91 A;  2C04 A;  2R03 A;  2RSE B;  1OCO C;  3W8H A;  3U8V A;  2R7V A;  3DE9 A;  3DAF A;  4LLC A;  4N4W A;  2GAQ A;  3B0V C;  3GEH A;  4K7B A;  5A6J A;  2RD9 A;  3B29 A;  1G8X A;  1OW8 A;  3B0U X;  1HE9 A;  2YL7 A;  4E7Z A;  1NFO A;  1O5H A;  1WOL A;  1Q0M A;  4PJL A;  1E85 A;  4EUK B;  4MVR A;  2FAP B;  2CDQ A;  1VOM A;  1KU2 A;  3AJM A;  3U8P A;  3ZVR A;  1QKR A;  2IXO A;  2XLD A;  4E18 A;  1CGM E;  2HJ3 A;  2IM8 A;  3FOO A;  4ER9 A;  3NG1 A;  3WG7 C;  1LKX A;  1FFT C;  1Q0D A;  5EHH A;  4N6C A;  4H54 A;  1C03 A;  2A1D D;  2CCY A;  3U2L A;  2JX0 A;  2L6H A;  1LS4 A;  4O6M A;  4JTD B;  1K40 A;  2H7V C;  4IAQ A;  4KNW A;  4IRU A;  4W8P A;  4YN0 B;  3KL4 A;  4MTF A;  3US6 A;  3ZDL A;  3ITF A;  4C3B A;  4CJG A;  2J7P A;  1FNT c;  1R4T A;  1OKK D;  3H2U A;  5JLI A;  4G7Z F;  2KW3 C;  3ABM C;  3OEO A;  2J0W A;  3S29 A;  1OCR C;  2J46 A;  2HS5 A;  4DRH B;  4LAC B;  4KI2 A;  2A68 F;  3HLZ A;  1M6T A;  1ZZP A;  2WVN A;  1M2V A;  2IXM A;  4IGG A;  4M63 A;  1T9K A;  5B1B C;  4Z9I A;  1AVO B;  2R25 A;  2PNO A; 
#chains in the Genus database with same CATH homology
 1UFB A;  3C18 A;  3U0C A;  2JPU A;  1K05 A;  3AJM A;  4XEF A;  3JZ0 A;  3GM2 A;  1V4A A;  3RQG A;  3L8I A;  3B71 A;  1O3U A;  5F28 E;  2L6F A;  2YWA A;  2Q00 A;  3RQF A;  2HSB A;  2PBE A;  3TUL A;  2JX0 A;  2L6H A;  4EBJ A;  2L6G A;  1K40 A;  1OW6 A;  4R32 A;  1KTM A;  4XEK A;  3GM3 A;  3O10 A;  3C8G A;  3L8J A;  3GM1 A;  4EBK A;  1WWP A;  4NQF A;  3S9O A;  3MFN A;  1WTY A;  3C8G D;  2KK1 A;  3JYY A;  3RQE A;  3C8G B;  1JOG A;  1KNY A;  1K04 A;  1QVX A;  3U3F A;  2LK4 A;  1ZZP A;  3K7D A;  3BRJ A;  1OW8 A;  4XEV A;  1PV3 A;  1WOL A;  1OW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...