2L6GA

Fat-ld2 double labeled construct with free ld4 peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
161
Chain Sequence
b'MANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPHSNLSELDRLLLELNAVQHNPPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Focal adhesion kinase 1, linker, Paxillin
publication title Fat-Ld2 Double Labeled Construct with Free Ld4 Peptide
rcsb
source organism Gallus gallus, unidentified
molecule tags Transferase,cell adhesion
total genus 56
structure length 161
sequence length 176
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2l6gA00
3C8GB 1UFBA 3GM3A 3O10A 2HSBA 2L6FA 3JYYA 1K40A 3AJMA 3C18A 1OW6A 1WWPA 1JOGA 2KK1A 1PV3A 2L6GA 1OW8A 4XEKA 2YWAA 3U0CA 2Q00A 1WOLA 4R32A 1ZZPA 5F28E 3L8IA 2JPUA 2LK4A 3JZ0A 3TULA 1QVXA 1V4AA 2JX0A 3C8GA 3BRJA 4XEFA 3B71A 3GM2A 3MFNA 3S9OA 1K05A 3K7DA 4XEVA 1O3UA 3RQFA 1KTMA 4NQFA 1OW7A 3RQEA 3C8GD 3U3FA 4EBJA 2L6HA 3GM1A 1KNYA 2PBEA 4EBKA 1WTYA 3RQGA 1K04A 3L8JA
chains in the Genus database with same CATH superfamily
1WN0A 1U89A 1YLMA 1AUEA 2DGJA 4CS9A 3T6GB 1I4ZA 2WZFA 3C18A 1Z23A 1V55C 1Z3IX 2WL8A 4PJMA 2EIJC 4MNDA 3M4BA 1RJ9B 5JRAA 4JZAA 4XLNF 3CEXA 2XM4A 4GQHA 4MTGA 4DJ9A 1M2VA 1DOVA 1BDJB 3CQZA 4KNVA 1FTSA 5AC5A 2FAPB 2YLGA 2XLDA 3R2PA 4LERA 2PF4E 2XS1A 4A2NB 3EHNA 3GM1A 4BJ6A 5B3SC 2YZSA 4JJFA 3VYWA 2GWWA 4JEBA 3FHDA 5BUOA 1G5ZA 1WTYA 3DI5A 1LPEA 2C04A 2XM0A 2R7TA 2FGYA 5DS6A 3FOPA 3H2UA 3GM3A 4MTOA 1I4YA 2YRFA 3DJUB 4PJNA 1LI7A 4L6RA 5D92A 1NFOA 5DVWA 3C63A 2ZD9A 3NYLA 3ZVRA 5A6JA 1FR0A 3KMIA 1MMDA 4D4XA 1J8MF 3M79A 1HE1A 2EPKX 1HMDA 4G7OF 3QMKA 5DS5A 4N6CA 4J30B 1RKCA 5F28E 4ULVA 2NG1A 2XLVA 4PK4A 4YK5A 3V7OA 2OEXA 1GM5A 4CDYA 4KI2A 4JE9A 5T3WA 4C3EA 4UDVA 1V74B 2PX3A 2R9RB 3LS0A 5A6BA 2VCAA 4LDRA 5KYUA 1ZU5A 5KYYA 2XL8A 3A9CA 4DOZA 1TWCA 2XXAA 3DWWA 2LSEA 2IXMA 4ER9A 3B0PA 2DYSC 2Y69C 2R7SA 2QUPA 4IRUA 4DVZA 1H9GA 1WWPA 2EPOA 1BR4A 1JR8A 1R5ID 2J7PD 3ASOC 1OXBA 3H2VA 5L0GA 2H7OA 4IWBA 3R7CA 4WGZA 2VCBA 4BG0A 3GANA 3GEEA 4RBNA 4XPXA 4CIHA 1S7ZA 3JRMO 4DBQA 2M4EA 5L0IA 1Q0FA 1IZMA 4Q7CA 1LS4A 1BR1A 1TR2A 3S28A 3EQLF 3K1HA 3KL4A 4WABA 4BJ1A 2Q9BA 2G3KA 1VTMP 3CAXA 3EFOB 4U5CE 4G7HF 1D0XA 2PNOA 3F46A 3LESA 3A11A 1O5HA 2H7VC 4O7GA 1M6TA 2XL4A 2H7BA 3C62A 3HKKA 5K0IA 5COMA 3K33A 2A1DD 4EHPA 4J7TA 4E0HA 3QW1A 1UFBA 2AVKA 2OCCC 3AG2C 4C7OB 3KPHA 3K66A 2OKUA 2HKVA 2Q4FA 2VB6A 4G78A 1L7CA 2YLDA 5IY5C 5L0JA 1MMGA 2X0CA 2OJQA 4MS2A 2CNWD 5KYNA 1JAFA 3V5XA 1YA9A 2P61A 2ZXOA 1OCRC 4MVZA 5EGYA 4HEAJ 1WOLA 1YVIA 3EGDB 1ZZPA 3W8HA 3TQOA 4PJJA 3FAJA 3TULA 4FWVA 3GWNA 3U2LA 2CCYA 1ZHTA 3CSKA 1YA7O 2NSGA 3GM2A 1SMYF 4K0DA 3AOUA 3HJCA 3U8VA 1EKYA 3U3FA 1YDIA 5GPGB 4X0RA 1U0BB 1G4WR 1RJ9A 1EA8A 2Y3BA 3ABMC 4IAQA 4MVMA 5E3AA 2HS5A 5B1AC 2YL7A 3MYIA 2XS8A 1D0YA 4JKVA 1OR2A 4YL1A 1VB5A 3C7JA 2OQMA 1Z7Qc 3JYYA 3L0IA 5FZTA 4O6YA 2KC3A 1FFTC 3DAFA 5JS5A 2WVOA 3O39A 4JC7A 3RYLA 1ZHWA 1VOMA 5EK0A 2R05A 4IGGA 2Q00A 3HNJA 3HLZA 4Q5SF 2XLMA 2IXPA 3AGTA 1A7VA 3ZG1A 5CI9A 5JUAA 1QKRA 2KQ9A 4PJLA 3BRJA 3WAQA 3GEIA 1YYXA 4DBRA 2GA0A 3JSEO 3RQFA 2AWCA 3IQ5A 4MTFA 3JTLO 2R7QA 3S27A 3VRCA 1T6IA 2CYDA 3SXZA 3I5PA 3SYNA 1OKKD 1ZW2A 2J45A 1E86A 1K04A 3U2MA 3EGXB 4N4WA 4CJOA 3L8JA 4P9FA 3ZWIA 4BJTA 4F4BA 2XRHA 2YQYA 1Q0GA 2O9XA 4JRZA 1RXQA 4CBEA 4JVSA 3T9OA 1PV3A 2V26A 2GDCA 3N2ZB 3W2VA 4BJ5C 1LM3B 2R7XA 2R03A 3ZTZA 3UMKA 2Y3HA 3AG3C 3DJNB 4DRIB 4N6HA 1T6UA 2XLHA 5T1DB 2Q3TA 2YL0A 5DLJA 4YT4A 1OCZC 3S84A 4XEFA 4Z9IA 2HUJA 3MFNA 3K1IA 3QTHA 4U5HA 4U9EA 2EIMC 3TJ6A 1NG1A 4J7YA 2KNHA 3AQBA 4MW8A 1Q0MA 3C8GD 3LUTB 3O55A 3ZIBA 4ZLCA 1B68A 4QDLA 3DXJF 3HNKA 2I8BA 3VAYA 4AE4B 2W4MA 2OG2A 3GWLA 4EIYA 1TWAA 4PR9A 2HSBA 3T6BA 2RD9A 1E2XA 2LQGA 2X51A 5KYXB 4LDQA 1H7IA 3EFOA 3N0TA 2R7OA 1FFHA 3AG4C 3SP1A 5JP7A 2A68F 4JW1A 3V5YA 2HFIA 4EUKB 3FVYA 3L8IA 5AGFA 1GQAA 3B9QA 1C02A 2WVNA 1JRAA 3JRTA 1Y6DA 2ZPAA 2Q9AA 3M4CA 4C7OA 4OIPF 1KU2A 1KTMA 3U9JA 2E87A 2IXNA 3QVZA 3RQEA 4OIQF 2ETSA 4EBJA 3ATPA 3LAYA 1ZYRF 3S0XA 1EQ1A 1XZPA 3Q7GA 5A6AA 3B0UX 4PFOA 3MLGA 3UGPA 1EI7A 3EGDA 4JCHA 4ULWA 4W8PA 5HSWA 1J8YF 2J9UA 3NMIA 2OEVA 1NFNA 2CNWA 3O10A 1DOWA 3US6A 3GORA 3GODA 4OD4A 4YL3A 3DM9B 2G3VA 2L9JA 4AX2A 4G7ZF 2NUTB 3RKOF 4OD5A 2CDQA 1SYQA 4PFPA 1C03A 3FDQA 1U6HA 2P0NA 4M63A 4MVUA 4Z9HA 3ZSUA 3LS1A 4XPYA 3JYHA 3FXHA 5F5FA 2ZXPA 1WATA 3X2QC 4KNWA 4O79A 3NKDA 3PMRA 2V3CC 1QQ3A 1SZIA 3T6JA 1BR2A 2RSEB 4JURI 4ONSA 4PACA 3UR3C 4E7SA 1CGOA 4CS8C 4GYTA 4XWJA 1OW7A 3UNGC 2KSFA 3MBGA 1YZCA 2L6HA 2MWQA 1Z63A 1KNYA 1CGME 3G50A 1NLXA 4YJWA 4XLPF 2Y3GA 3ECSA 4G0HA 4O6NA 1Y4CA 4DVYP 3TOLA 1NSGB 3EZIA 3LEVA 3UGOA 4NTFA 1PCXA 4E17A 2P6VA 2KYHA 4LACB 3FOOA 5EHHA 1K40A 2IM8A 4CDVA 3LEOA 2KK1A 2QY9A 3O6XA 4MVQA 2YLIA 2YEVA 5JSLA 3AGUA 2IOQA 1TQGA 2CW0F 3DKAA 1TWHA 1ZHXA 3OWTA 1FMVA 2H8AA 3EGXA 3RW0A 1LE2A 1CGNA 2R25A 3EH2A 2AP3A 3KH2A 5E3CA 2AWYA 2R7VA 4MVOA 2JD3A 3LNRA 4NQFA 2F22A 1D0ZA 2J0WA 2VC9A 3L1MA 3LJBA 4BPMA 3CZ6A 4KBLA 3RIPA 1ZU4A 3ITFA 1ZHZA 3HNIA 1YARO 2PBEA 1ORJA 3RQGA 1M57C 3EJNA 3IPMO 1LKXA 1Q0DA 2XSEA 3Q6NA 3SXYA 4CIPA 1RMVA 2Q9CA 2PFDA 4JTDB 4GEHA 3RVZA 1T9KA 5T3TA 3IQTA 5JLIA 3F47A 1RCPA 3AQCA 3KKBA 2R7WA 3JSZA 3ZDLA 2B0HA 2KJGA 4HE8D 1D1AA 4CS8A 1JOGA 3UMHA 3ABLC 2D4UA 1FMWA 2EPNA 5KYWB 2LFDA 4BEMJ 5L3QA 4ZLDA 2YWAA 3U0CA 1ST6A 2A6EF 4AE4A 4CS9C 1OQCA 2J9WA 2LK4A 4K1OA 5TJ5E 3MYFA 2LD6A 1W2WA 3B71A 2UUHA 4ANJA 4U5DE 5KYXA 3HTKC 3RF3A 4I1MA 2OJED 1HMOA 1ORSC 3ZC4A 3B0VC 1WASA 3QVYA 2XLEA 3MX3A 1APCA 4NTBA 1XWJA 4RD9A 1CPRA 1NU7D 1ZW3A 4JIOA 4KC9A 1VLTA 1LI5A 4LLEA 5FCLA 4IJJA 2XL6A 3POVA 3S90A 2HJMA 1YJGA 5COGA 2KGOA 4C3BA 1NU9C 1L3PA 1Q0KA 2GFHA 3AJMA 2IYLD 2YKZA 3DM5A 3NYMA 4N06A 4Z9JA 3WHNA 1H9TA 2GAQA 4IAOA 4QI0A 4RDAA 2ZXRA 1OW8A 4P6IC 4U5FE 3KYIA 4WGYA 5E33A 4D4NA 3ZQYA 3JZ0A 4JEAA 1K05A 3LLKA 2IXOA 2OU6A 3EH1A 2YL3A 3G4ZA 3IEEA 3NYJA 4I44A 4W8KA 2NUTA 1E84A 4CSAC 2OOCA 5BQGA 2CGEA 3T4RA 1FNTc 2AU5A 3EG9B 3M15A 5D91A 1OCOC 2D5RB 3U3BA 1WGWA 4C3DA 2P7VA 4NTAA 2NSFA 1E83A 2EIKC 2J7PA 3C8GB 4J32B 2M64A 3KYJA 5B3IA 3PCVA 2J0XA 2G62A 1FAPB 3DE9A 2LP4A 2LCHA 4YT5A 5E2QA 3W8IA 1LVKA 2WVQA 1PD1A 2ICWG 2L81A 1Z5ZA 3HNLA 3S29A 1ZHYA 2I15A 2NUPB 2ASRA 4U5BE 1QPUA 4E0IA 1TKNA 3V5ZA 3ZQVA 5L0CA 3W4YA 3J06A 1TWGA 1JMWA 2L7AA 5CIVA 1UG7A 2EILC 1ZVZA 4DXWA 2C03A 5L0DA 1T5OA 1D1BA 1D1CA 1HE9A 2A0BA 1TFKB 4NY3A 2UUIA 4BJ5A 4EBKA 1MMNA 5A6KA 5BQIA 3PHF2 2DI3A 256BA 2HV6A 4MQ9F 4JCZA 4NCQA 1T01A 3EPVA 4AL1A 4XQ1A 4YL0A 1MNEA 4DRJB 2VCCA 2J46A 2P1AA 2BL2A 3SXKA 1OW6A 3ASNC 3JT1A 2A69F 4CSAA 3EZHA 5L0FA 5AC4A 3U9MA 4XEKA 4MW3A 4U5EE 3TK0A 4CS7A 4H54A 4HFFB 4LLCA 1QZXA 2WB7A 2WZLA 4EBBA 1QVXA 3WODF 2A0UA 3S9OA 3SZRA 4AL0A 5DQTA 2IBFA 4CX9A 1XZQA 1JPJA 2VASA 3DZAA 4IARA 4U5GA 3TOMA 3B29A 3IQ6A 3DAGA 2W45A 3M1CB 3ZTMA 5F5HA 4I1OB 5KYWA 2W4BA 1JPNA 2Y39A 2Q7RA 1HW2A 2B0JA 1OXKA 1R4TA 2HSQA 1M2VB 3FMSA 4HFKB 4CJGA 2EPMX 4XTKA 1A0BA 1TFOB 1VLSA 2FFHA 1I5NA 2L6FA 3RVYA 2Y3DA 3Q6MA 3IHUA 5COFA 2W9YA 3NKEA 3UMIA 4WJ0A 4K7BA 2J9VA 4E18A 5DS4A 1CPQA 2NPUA 3JCUQ 1MQVA 3G4XA 3SEOA 1M2OA 1PD0A 1T6QA 2HV7A 2JPUA 2R7RA 2DYRC 3NMKA 3W2WA 3LLIA 4IB4A 1C17M 2J8WA 3Q7LA 1N1CA 1GS9A 3LNMB 3K7DA 2BE5F 4XEVA 4MVSA 1OKKA 3I4UA 1A7EA 2YVKA 3OEOA 1OR3A 4JJGA 4JTAB 3C8ZA 4LDKA 4YT2A 1MNDA 1V54C 3L34A 1VYIA 3SXMA 3AG1C 4FAPB 4I3MA 3IQCA 1LS1A 4U9DA 1SR2A 5A6BD 2LIGA 2QTVA 2QLAA 3I5QA 4DRHB 2KW3C 3DD7A 3H65A 3TD7A 4CDAA 3SNHA 2Z15A 2LFFA 1OCCC 1RKEA 1LIHA 3E70C 4Q4ZF 2XLOA 1BZ4A 1NZEA 3DMDA 5KYUB 5KYYB 1A41A 3RFYA 5L0HA 2XXAB 4O6MA 2PP4A 2ZXWC 1BBHA 1H6GA 4JTCB 3EHMA 3BEHA 4OIRF 1A7DA 4R32A 1ORYA 4E7ZA 3TJ5A 1VYKA 3EG9A 2EPLX 3WG7C 2PX0A 1MMAA 1VMAA 1V4AA 4OINF 3C8GA 1AVOB 2MHRA 4EKWA 3FAPB 4XPWA 4BEJA 2R7UA 1E85A 1O3UA 2YL1A 1GGQA 1IW7F 4H4KC 4YN0B 5JT4A 4FESA 5DQZA 2R02A 4EWCA 3N24A 3QZCA 2HMZA 1S05A 1SF8A 4MVRA 1AEPA 5HV9A 4A4AA 1G4US 1YZAA 2J9BA 3NG1A 3VM6A 2NUPA 3ABKC 3K1IC 4NC3A 2HZ8A 3NMJA 5CI8A 3DE8A 2QE9A 3U5SA 3QW0A 2XLWA 4B6IA 5JVEA 1HW1A 1Z6AA 2DB4A 3OA1A 3X1OA 4BJ6C 4OIOF 2HJ3A 1LE4A 1O87A 2L6GA 1YYJA 4P9TA 2QNLA 3RH3A 2YHSA 1QSPA 1QLEC 2EINC 5L3VA 2MYSA 1YAUO 2A6HF 1G8XA 2JX0A 1RKEB 2WZGA 4QI2A 4YT8A 3E9VA 5A69A 2VH3A 3GEHA 4AK9A 5BQHA 5B1BC 1NBBA 2BC5A 3U8PA 3VF0A 3PDMP 2TMVP 1HY5A 1M56C 1F1MA 4FX5A 2HMQA 3NDBB 3K6BA 4YWQA 3NRHA 1VK5A
chains in the Genus database with same CATH topology
3C8GB 1UFBA 3GM3A 3O10A 2HSBA 2L6FA 3JYYA 1K40A 3AJMA 3C18A 1OW6A 1WWPA 1JOGA 2KK1A 1PV3A 2L6GA 1OW8A 4XEKA 2YWAA 3U0CA 2Q00A 1WOLA 4R32A 1ZZPA 5F28E 3L8IA 2JPUA 2LK4A 3JZ0A 3TULA 1QVXA 1V4AA 2JX0A 3C8GA 3BRJA 4XEFA 3B71A 3GM2A 3MFNA 3S9OA 1K05A 3K7DA 4XEVA 1O3UA 3RQFA 1KTMA 4NQFA 1OW7A 3RQEA 3C8GD 3U3FA 4EBJA 2L6HA 3GM1A 1KNYA 2PBEA 4EBKA 1WTYA 3RQGA 1K04A 3L8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8G B;  1UFB A;  3GM3 A;  3O10 A;  2HSB A;  2L6F A;  3JYY A;  1K40 A;  3AJM A;  3C18 A;  1OW6 A;  1WWP A;  1JOG A;  2KK1 A;  1PV3 A;  2L6G A;  1OW8 A;  4XEK A;  2YWA A;  3U0C A;  2Q00 A;  1WOL A;  4R32 A;  1ZZP A;  5F28 E;  3L8I A;  2JPU A;  2LK4 A;  3JZ0 A;  3TUL A;  1QVX A;  1V4A A;  2JX0 A;  3C8G A;  3BRJ A;  4XEF A;  3B71 A;  3GM2 A;  3MFN A;  3S9O A;  1K05 A;  3K7D A;  4XEV A;  1O3U A;  3RQF A;  1KTM A;  4NQF A;  1OW7 A;  3RQE A;  3C8G D;  3U3F A;  4EBJ A;  2L6H A;  3GM1 A;  1KNY A;  2PBE A;  4EBK A;  1WTY A;  3RQG A;  1K04 A;  3L8J A; 
#chains in the Genus database with same CATH topology
 1WN0 A;  1U89 A;  1YLM A;  1AUE A;  2DGJ A;  4CS9 A;  3T6G B;  1I4Z A;  2WZF A;  3C18 A;  1Z23 A;  1V55 C;  1Z3I X;  2WL8 A;  4PJM A;  2EIJ C;  4MND A;  3M4B A;  1RJ9 B;  5JRA A;  4JZA A;  4XLN F;  3CEX A;  2XM4 A;  4GQH A;  4MTG A;  4DJ9 A;  1M2V A;  1DOV A;  1BDJ B;  3CQZ A;  4KNV A;  1FTS A;  5AC5 A;  2FAP B;  2YLG A;  2XLD A;  3R2P A;  4LER A;  2PF4 E;  2XS1 A;  4A2N B;  3EHN A;  3GM1 A;  4BJ6 A;  5B3S C;  2YZS A;  4JJF A;  3VYW A;  2GWW A;  4JEB A;  3FHD A;  5BUO A;  1G5Z A;  1WTY A;  3DI5 A;  1LPE A;  2C04 A;  2XM0 A;  2R7T A;  2FGY A;  5DS6 A;  3FOP A;  3H2U A;  3GM3 A;  4MTO A;  1I4Y A;  2YRF A;  3DJU B;  4PJN A;  1LI7 A;  4L6R A;  5D92 A;  1NFO A;  5DVW A;  3C63 A;  2ZD9 A;  3NYL A;  3ZVR A;  5A6J A;  1FR0 A;  3KMI A;  1MMD A;  4D4X A;  1J8M F;  3M79 A;  1HE1 A;  2EPK X;  1HMD A;  4G7O F;  3QMK A;  5DS5 A;  4N6C A;  4J30 B;  1RKC A;  5F28 E;  4ULV A;  2NG1 A;  2XLV A;  4PK4 A;  4YK5 A;  3V7O A;  2OEX A;  1GM5 A;  4CDY A;  4KI2 A;  4JE9 A;  5T3W A;  4C3E A;  4UDV A;  1V74 B;  2PX3 A;  2R9R B;  3LS0 A;  5A6B A;  2VCA A;  4LDR A;  5KYU A;  1ZU5 A;  5KYY A;  2XL8 A;  3A9C A;  4DOZ A;  1TWC A;  2XXA A;  3DWW A;  2LSE A;  2IXM A;  4ER9 A;  3B0P A;  2DYS C;  2Y69 C;  2R7S A;  2QUP A;  4IRU A;  4DVZ A;  1H9G A;  1WWP A;  2EPO A;  1BR4 A;  1JR8 A;  1R5I D;  2J7P D;  3ASO C;  1OXB A;  3H2V A;  5L0G A;  2H7O A;  4IWB A;  3R7C A;  4WGZ A;  2VCB A;  4BG0 A;  3GAN A;  3GEE A;  4RBN A;  4XPX A;  4CIH A;  1S7Z A;  3JRM O;  4DBQ A;  2M4E A;  5L0I A;  1Q0F A;  1IZM A;  4Q7C A;  1LS4 A;  1BR1 A;  1TR2 A;  3S28 A;  3EQL F;  3K1H A;  3KL4 A;  4WAB A;  4BJ1 A;  2Q9B A;  2G3K A;  1VTM P;  3CAX A;  3EFO B;  4U5C E;  4G7H F;  1D0X A;  2PNO A;  3F46 A;  3LES A;  3A11 A;  1O5H A;  2H7V C;  4O7G A;  1M6T A;  2XL4 A;  2H7B A;  3C62 A;  3HKK A;  5K0I A;  5COM A;  3K33 A;  2A1D D;  4EHP A;  4J7T A;  4E0H A;  3QW1 A;  1UFB A;  2AVK A;  2OCC C;  3AG2 C;  4C7O B;  3KPH A;  3K66 A;  2OKU A;  2HKV A;  2Q4F A;  2VB6 A;  4G78 A;  1L7C A;  2YLD A;  5IY5 C;  5L0J A;  1MMG A;  2X0C A;  2OJQ A;  4MS2 A;  2CNW D;  5KYN A;  1JAF A;  3V5X A;  1YA9 A;  2P61 A;  2ZXO A;  1OCR C;  4MVZ A;  5EGY A;  4HEA J;  1WOL A;  1YVI A;  3EGD B;  1ZZP A;  3W8H A;  3TQO A;  4PJJ A;  3FAJ A;  3TUL A;  4FWV A;  3GWN A;  3U2L A;  2CCY A;  1ZHT A;  3CSK A;  1YA7 O;  2NSG A;  3GM2 A;  1SMY F;  4K0D A;  3AOU A;  3HJC A;  3U8V A;  1EKY A;  3U3F A;  1YDI A;  5GPG B;  4X0R A;  1U0B B;  1G4W R;  1RJ9 A;  1EA8 A;  2Y3B A;  3ABM C;  4IAQ A;  4MVM A;  5E3A A;  2HS5 A;  5B1A C;  2YL7 A;  3MYI A;  2XS8 A;  1D0Y A;  4JKV A;  1OR2 A;  4YL1 A;  1VB5 A;  3C7J A;  2OQM A;  1Z7Q c;  3JYY A;  3L0I A;  5FZT A;  4O6Y A;  2KC3 A;  1FFT C;  3DAF A;  5JS5 A;  2WVO A;  3O39 A;  4JC7 A;  3RYL A;  1ZHW A;  1VOM A;  5EK0 A;  2R05 A;  4IGG A;  2Q00 A;  3HNJ A;  3HLZ A;  4Q5S F;  2XLM A;  2IXP A;  3AGT A;  1A7V A;  3ZG1 A;  5CI9 A;  5JUA A;  1QKR A;  2KQ9 A;  4PJL A;  3BRJ A;  3WAQ A;  3GEI A;  1YYX A;  4DBR A;  2GA0 A;  3JSE O;  3RQF A;  2AWC A;  3IQ5 A;  4MTF A;  3JTL O;  2R7Q A;  3S27 A;  3VRC A;  1T6I A;  2CYD A;  3SXZ A;  3I5P A;  3SYN A;  1OKK D;  1ZW2 A;  2J45 A;  1E86 A;  1K04 A;  3U2M A;  3EGX B;  4N4W A;  4CJO A;  3L8J A;  4P9F A;  3ZWI A;  4BJT A;  4F4B A;  2XRH A;  2YQY A;  1Q0G A;  2O9X A;  4JRZ A;  1RXQ A;  4CBE A;  4JVS A;  3T9O A;  1PV3 A;  2V26 A;  2GDC A;  3N2Z B;  3W2V A;  4BJ5 C;  1LM3 B;  2R7X A;  2R03 A;  3ZTZ A;  3UMK A;  2Y3H A;  3AG3 C;  3DJN B;  4DRI B;  4N6H A;  1T6U A;  2XLH A;  5T1D B;  2Q3T A;  2YL0 A;  5DLJ A;  4YT4 A;  1OCZ C;  3S84 A;  4XEF A;  4Z9I A;  2HUJ A;  3MFN A;  3K1I A;  3QTH A;  4U5H A;  4U9E A;  2EIM C;  3TJ6 A;  1NG1 A;  4J7Y A;  2KNH A;  3AQB A;  4MW8 A;  1Q0M A;  3C8G D;  3LUT B;  3O55 A;  3ZIB A;  4ZLC A;  1B68 A;  4QDL A;  3DXJ F;  3HNK A;  2I8B A;  3VAY A;  4AE4 B;  2W4M A;  2OG2 A;  3GWL A;  4EIY A;  1TWA A;  4PR9 A;  2HSB A;  3T6B A;  2RD9 A;  1E2X A;  2LQG A;  2X51 A;  5KYX B;  4LDQ A;  1H7I A;  3EFO A;  3N0T A;  2R7O A;  1FFH A;  3AG4 C;  3SP1 A;  5JP7 A;  2A68 F;  4JW1 A;  3V5Y A;  2HFI A;  4EUK B;  3FVY A;  3L8I A;  5AGF A;  1GQA A;  3B9Q A;  1C02 A;  2WVN A;  1JRA A;  3JRT A;  1Y6D A;  2ZPA A;  2Q9A A;  3M4C A;  4C7O A;  4OIP F;  1KU2 A;  1KTM A;  3U9J A;  2E87 A;  2IXN A;  3QVZ A;  3RQE A;  4OIQ F;  2ETS A;  4EBJ A;  3ATP A;  3LAY A;  1ZYR F;  3S0X A;  1EQ1 A;  1XZP A;  3Q7G A;  5A6A A;  3B0U X;  4PFO A;  3MLG A;  3UGP A;  1EI7 A;  3EGD A;  4JCH A;  4ULW A;  4W8P A;  5HSW A;  1J8Y F;  2J9U A;  3NMI A;  2OEV A;  1NFN A;  2CNW A;  3O10 A;  1DOW A;  3US6 A;  3GOR A;  3GOD A;  4OD4 A;  4YL3 A;  3DM9 B;  2G3V A;  2L9J A;  4AX2 A;  4G7Z F;  2NUT B;  3RKO F;  4OD5 A;  2CDQ A;  1SYQ A;  4PFP A;  1C03 A;  3FDQ A;  1U6H A;  2P0N A;  4M63 A;  4MVU A;  4Z9H A;  3ZSU A;  3LS1 A;  4XPY A;  3JYH A;  3FXH A;  5F5F A;  2ZXP A;  1WAT A;  3X2Q C;  4KNW A;  4O79 A;  3NKD A;  3PMR A;  2V3C C;  1QQ3 A;  1SZI A;  3T6J A;  1BR2 A;  2RSE B;  4JUR I;  4ONS A;  4PAC A;  3UR3 C;  4E7S A;  1CGO A;  4CS8 C;  4GYT A;  4XWJ A;  1OW7 A;  3UNG C;  2KSF A;  3MBG A;  1YZC A;  2L6H A;  2MWQ A;  1Z63 A;  1KNY A;  1CGM E;  3G50 A;  1NLX A;  4YJW A;  4XLP F;  2Y3G A;  3ECS A;  4G0H A;  4O6N A;  1Y4C A;  4DVY P;  3TOL A;  1NSG B;  3EZI A;  3LEV A;  3UGO A;  4NTF A;  1PCX A;  4E17 A;  2P6V A;  2KYH A;  4LAC B;  3FOO A;  5EHH A;  1K40 A;  2IM8 A;  4CDV A;  3LEO A;  2KK1 A;  2QY9 A;  3O6X A;  4MVQ A;  2YLI A;  2YEV A;  5JSL A;  3AGU A;  2IOQ A;  1TQG A;  2CW0 F;  3DKA A;  1TWH A;  1ZHX A;  3OWT A;  1FMV A;  2H8A A;  3EGX A;  3RW0 A;  1LE2 A;  1CGN A;  2R25 A;  3EH2 A;  2AP3 A;  3KH2 A;  5E3C A;  2AWY A;  2R7V A;  4MVO A;  2JD3 A;  3LNR A;  4NQF A;  2F22 A;  1D0Z A;  2J0W A;  2VC9 A;  3L1M A;  3LJB A;  4BPM A;  3CZ6 A;  4KBL A;  3RIP A;  1ZU4 A;  3ITF A;  1ZHZ A;  3HNI A;  1YAR O;  2PBE A;  1ORJ A;  3RQG A;  1M57 C;  3EJN A;  3IPM O;  1LKX A;  1Q0D A;  2XSE A;  3Q6N A;  3SXY A;  4CIP A;  1RMV A;  2Q9C A;  2PFD A;  4JTD B;  4GEH A;  3RVZ A;  1T9K A;  5T3T A;  3IQT A;  5JLI A;  3F47 A;  1RCP A;  3AQC A;  3KKB A;  2R7W A;  3JSZ A;  3ZDL A;  2B0H A;  2KJG A;  4HE8 D;  1D1A A;  4CS8 A;  1JOG A;  3UMH A;  3ABL C;  2D4U A;  1FMW A;  2EPN A;  5KYW B;  2LFD A;  4BEM J;  5L3Q A;  4ZLD A;  2YWA A;  3U0C A;  1ST6 A;  2A6E F;  4AE4 A;  4CS9 C;  1OQC A;  2J9W A;  2LK4 A;  4K1O A;  5TJ5 E;  3MYF A;  2LD6 A;  1W2W A;  3B71 A;  2UUH A;  4ANJ A;  4U5D E;  5KYX A;  3HTK C;  3RF3 A;  4I1M A;  2OJE D;  1HMO A;  1ORS C;  3ZC4 A;  3B0V C;  1WAS A;  3QVY A;  2XLE A;  3MX3 A;  1APC A;  4NTB A;  1XWJ A;  4RD9 A;  1CPR A;  1NU7 D;  1ZW3 A;  4JIO A;  4KC9 A;  1VLT A;  1LI5 A;  4LLE A;  5FCL A;  4IJJ A;  2XL6 A;  3POV A;  3S90 A;  2HJM A;  1YJG A;  5COG A;  2KGO A;  4C3B A;  1NU9 C;  1L3P A;  1Q0K A;  2GFH A;  3AJM A;  2IYL D;  2YKZ A;  3DM5 A;  3NYM A;  4N06 A;  4Z9J A;  3WHN A;  1H9T A;  2GAQ A;  4IAO A;  4QI0 A;  4RDA A;  2ZXR A;  1OW8 A;  4P6I C;  4U5F E;  3KYI A;  4WGY A;  5E33 A;  4D4N A;  3ZQY A;  3JZ0 A;  4JEA A;  1K05 A;  3LLK A;  2IXO A;  2OU6 A;  3EH1 A;  2YL3 A;  3G4Z A;  3IEE A;  3NYJ A;  4I44 A;  4W8K A;  2NUT A;  1E84 A;  4CSA C;  2OOC A;  5BQG A;  2CGE A;  3T4R A;  1FNT c;  2AU5 A;  3EG9 B;  3M15 A;  5D91 A;  1OCO C;  2D5R B;  3U3B A;  1WGW A;  4C3D A;  2P7V A;  4NTA A;  2NSF A;  1E83 A;  2EIK C;  2J7P A;  3C8G B;  4J32 B;  2M64 A;  3KYJ A;  5B3I A;  3PCV A;  2J0X A;  2G62 A;  1FAP B;  3DE9 A;  2LP4 A;  2LCH A;  4YT5 A;  5E2Q A;  3W8I A;  1LVK A;  2WVQ A;  1PD1 A;  2ICW G;  2L81 A;  1Z5Z A;  3HNL A;  3S29 A;  1ZHY A;  2I15 A;  2NUP B;  2ASR A;  4U5B E;  1QPU A;  4E0I A;  1TKN A;  3V5Z A;  3ZQV A;  5L0C A;  3W4Y A;  3J06 A;  1TWG A;  1JMW A;  2L7A A;  5CIV A;  1UG7 A;  2EIL C;  1ZVZ A;  4DXW A;  2C03 A;  5L0D A;  1T5O A;  1D1B A;  1D1C A;  1HE9 A;  2A0B A;  1TFK B;  4NY3 A;  2UUI A;  4BJ5 A;  4EBK A;  1MMN A;  5A6K A;  5BQI A;  3PHF 2;  2DI3 A;  256B A;  2HV6 A;  4MQ9 F;  4JCZ A;  4NCQ A;  1T01 A;  3EPV A;  4AL1 A;  4XQ1 A;  4YL0 A;  1MNE A;  4DRJ B;  2VCC A;  2J46 A;  2P1A A;  2BL2 A;  3SXK A;  1OW6 A;  3ASN C;  3JT1 A;  2A69 F;  4CSA A;  3EZH A;  5L0F A;  5AC4 A;  3U9M A;  4XEK A;  4MW3 A;  4U5E E;  3TK0 A;  4CS7 A;  4H54 A;  4HFF B;  4LLC A;  1QZX A;  2WB7 A;  2WZL A;  4EBB A;  1QVX A;  3WOD F;  2A0U A;  3S9O A;  3SZR A;  4AL0 A;  5DQT A;  2IBF A;  4CX9 A;  1XZQ A;  1JPJ A;  2VAS A;  3DZA A;  4IAR A;  4U5G A;  3TOM A;  3B29 A;  3IQ6 A;  3DAG A;  2W45 A;  3M1C B;  3ZTM A;  5F5H A;  4I1O B;  5KYW A;  2W4B A;  1JPN A;  2Y39 A;  2Q7R A;  1HW2 A;  2B0J A;  1OXK A;  1R4T A;  2HSQ A;  1M2V B;  3FMS A;  4HFK B;  4CJG A;  2EPM X;  4XTK A;  1A0B A;  1TFO B;  1VLS A;  2FFH A;  1I5N A;  2L6F A;  3RVY A;  2Y3D A;  3Q6M A;  3IHU A;  5COF A;  2W9Y A;  3NKE A;  3UMI A;  4WJ0 A;  4K7B A;  2J9V A;  4E18 A;  5DS4 A;  1CPQ A;  2NPU A;  3JCU Q;  1MQV A;  3G4X A;  3SEO A;  1M2O A;  1PD0 A;  1T6Q A;  2HV7 A;  2JPU A;  2R7R A;  2DYR C;  3NMK A;  3W2W A;  3LLI A;  4IB4 A;  1C17 M;  2J8W A;  3Q7L A;  1N1C A;  1GS9 A;  3LNM B;  3K7D A;  2BE5 F;  4XEV A;  4MVS A;  1OKK A;  3I4U A;  1A7E A;  2YVK A;  3OEO A;  1OR3 A;  4JJG A;  4JTA B;  3C8Z A;  4LDK A;  4YT2 A;  1MND A;  1V54 C;  3L34 A;  1VYI A;  3SXM A;  3AG1 C;  4FAP B;  4I3M A;  3IQC A;  1LS1 A;  4U9D A;  1SR2 A;  5A6B D;  2LIG A;  2QTV A;  2QLA A;  3I5Q A;  4DRH B;  2KW3 C;  3DD7 A;  3H65 A;  3TD7 A;  4CDA A;  3SNH A;  2Z15 A;  2LFF A;  1OCC C;  1RKE A;  1LIH A;  3E70 C;  4Q4Z F;  2XLO A;  1BZ4 A;  1NZE A;  3DMD A;  5KYU B;  5KYY B;  1A41 A;  3RFY A;  5L0H A;  2XXA B;  4O6M A;  2PP4 A;  2ZXW C;  1BBH A;  1H6G A;  4JTC B;  3EHM A;  3BEH A;  4OIR F;  1A7D A;  4R32 A;  1ORY A;  4E7Z A;  3TJ5 A;  1VYK A;  3EG9 A;  2EPL X;  3WG7 C;  2PX0 A;  1MMA A;  1VMA A;  1V4A A;  4OIN F;  3C8G A;  1AVO B;  2MHR A;  4EKW A;  3FAP B;  4XPW A;  4BEJ A;  2R7U A;  1E85 A;  1O3U A;  2YL1 A;  1GGQ A;  1IW7 F;  4H4K C;  4YN0 B;  5JT4 A;  4FES A;  5DQZ A;  2R02 A;  4EWC A;  3N24 A;  3QZC A;  2HMZ A;  1S05 A;  1SF8 A;  4MVR A;  1AEP A;  5HV9 A;  4A4A A;  1G4U S;  1YZA A;  2J9B A;  3NG1 A;  3VM6 A;  2NUP A;  3ABK C;  3K1I C;  4NC3 A;  2HZ8 A;  3NMJ A;  5CI8 A;  3DE8 A;  2QE9 A;  3U5S A;  3QW0 A;  2XLW A;  4B6I A;  5JVE A;  1HW1 A;  1Z6A A;  2DB4 A;  3OA1 A;  3X1O A;  4BJ6 C;  4OIO F;  2HJ3 A;  1LE4 A;  1O87 A;  2L6G A;  1YYJ A;  4P9T A;  2QNL A;  3RH3 A;  2YHS A;  1QSP A;  1QLE C;  2EIN C;  5L3V A;  2MYS A;  1YAU O;  2A6H F;  1G8X A;  2JX0 A;  1RKE B;  2WZG A;  4QI2 A;  4YT8 A;  3E9V A;  5A69 A;  2VH3 A;  3GEH A;  4AK9 A;  5BQH A;  5B1B C;  1NBB A;  2BC5 A;  3U8P A;  3VF0 A;  3PDM P;  2TMV P;  1HY5 A;  1M56 C;  1F1M A;  4FX5 A;  2HMQ A;  3NDB B;  3K6B A;  4YWQ A;  3NRH A;  1VK5 A; 
#chains in the Genus database with same CATH homology
 3C8G B;  1UFB A;  3GM3 A;  3O10 A;  2HSB A;  2L6F A;  3JYY A;  1K40 A;  3AJM A;  3C18 A;  1OW6 A;  1WWP A;  1JOG A;  2KK1 A;  1PV3 A;  2L6G A;  1OW8 A;  4XEK A;  2YWA A;  3U0C A;  2Q00 A;  1WOL A;  4R32 A;  1ZZP A;  5F28 E;  3L8I A;  2JPU A;  2LK4 A;  3JZ0 A;  3TUL A;  1QVX A;  1V4A A;  2JX0 A;  3C8G A;  3BRJ A;  4XEF A;  3B71 A;  3GM2 A;  3MFN A;  3S9O A;  1K05 A;  3K7D A;  4XEV A;  1O3U A;  3RQF A;  1KTM A;  4NQF A;  1OW7 A;  3RQE A;  3C8G D;  3U3F A;  4EBJ A;  2L6H A;  3GM1 A;  1KNY A;  2PBE A;  4EBK A;  1WTY A;  3RQG A;  1K04 A;  3L8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...