3B0VC

Trna-dihydrouridine synthase from thermus thermophilus in complex with trna
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
315
structure length
315
Chain Sequence
b'MLDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALLALSTKANREIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLMEEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA
publication title Molecular basis of dihydrouridine formation on tRNA
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase/rna
total genus 108
structure length 315
sequence length 315
chains with identical sequence D
ec nomenclature ec 1.3.1.91: tRNA-dihydrouridine(20) synthase (NAD(P)(+)).
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01207 Dus Dihydrouridine synthase (Dus)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3b0vC02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3b0vC01
1RQHA 4OE7A 1JUEA 3TROA 3M0ZA 1W5PA 3C52A 2NLIA 3HQ1A 3S5NA 1KV5A 3MP3A 4U4MA 2DZTA 2A0NA 4JX5A 5EKYA 1F7BA 3EX6A 2NUXA 2WSYA 4HN4A 3UNDA 3SFKA 1Z41A 4LVDA 1TTJA 3IIXA 3PM6A 3ABSA 3K30A 4K37A 2TPSA 1J2WA 2E5CA 3FYOA 3PS7A 4MKNA 4E2BA 1NVMA 1W3IA 1AW5A 1FDYA 2NWSA 4N6EA 1OHLA 2ZA3A 2DZSA 3EX3A 5LGXA 3RK8A 4OHQA 2FDSA 1JRCA 3CIWA 3HGJA 1GJPA 2JGYA 3W7KA 1XUUA 3PR2A 4Y6GA 3NR0A 4O8RA 3U2OA 3W7MA 3TFXA 1CW2A 5FEWA 3UXDA 4I7UA 1MZHA 4HNVA 2XN0A 3T44A 3EKZA 2CWNA 5D2XA 2NXGA 1JCMP 4K8HA 4XKYB 5TQLA 1FWWA 1X1ZA 2KZHA 4NVTA 3UWZA 4O54A 4PTNA 3UWQA 3RF9A 3FIGA 1L6YA 1V7YA 4B5NA 1THFD 4FNSA 2C1HA 1DBTA 1BTMA 4JXCA 3T40A 2CLHA 3A5FA 3N73A 4O1DA 4LOCA 1FCQA 4GFSA 3LTPA 1H7RA 4RZ5A 4R33A 5AOUA 3LI1A 1S3HA 5AHMA 3TIMA 4R7JA 2GVGA 1R2SA 1HO1A 3E9AA 1Z44A 3P61A 5G2WA 4NX0A 3O07A 2FB3A 4E0CA 3DFQA 5CZSA 1ZHAA 5J5DA 3GR7A 3Q58A 2CLIA 1TTPA 1T96A 1TPH1 3PAJA 2VELA 1FWTA 2YYUA 2FPYA 1H7XA 4IUOA 1YXCA 4I7WA 3STFA 1VHNA 2E6YA 3LXBA 4UC5A 2BWGA 2JBMA 3PVFA 3TC6A 4RXFA 4U28A 3T78A 3W7CA 1SO6A 2R8WA 3P81A 4FX6M 1FY6A 3P84A 5I3IA 4XZ9A 3SZ8A 4Y96A 3NL5A 3QEZA 5L9FA 2LLEA 2TYSA 3E02A 3L67A 1S5TA 3PBYA 3Q2DA 5HWMA 1WV2A 4CNOA 2C18A 3DBPA 3PUOA 3A9IA 4LT9A 2J27A 2CLFA 1JRBA 1LLZA 2QDGA 3L5MA 5CPMA 4ADTA 3NXFA 1AW2A 3P5YA 3LM7A 2QDHA 1F5ZA 1SFLA 3VE9A 4NXKA 1FDJA 5FESA 4WQ6A 3FS2A 3LHWA 3SGUA 3GDMA 1OABA 4UTUA 2VFHA 3CEPA 1F74A 3MBFA 1OX4B 3EWZA 4LU0A 4LY8A 3W1MA 4YCOA 3DI0A 1L6SA 1OF8A 4DF0A 1KFEA 1KFBA 4MVAA 3RFAA 1LTDA 4QISA 4DQWA 3JRKA 1XBVA 3TU9A 1R30A 4MFEA 4UNKA 4LW7A 1TIMA 2V81A 3IGSA 1WDWA 4PODA 1LCOA 3N2XA 3OVQA 1WA3A 1TPEA 1L2UA 3HOJA 3W1QA 3W2KA 3W7PA 2ZZ5A 1Q6RA 1JJKA 4MUZA 1VYRA 1VH7A 2XN2A 3O6CA 2V82A 5DLCA 3USBA 4EIVA 1GTHA 1ZAIA 1K8YA 3W07A 2A2IA 1WQ5A 4XWUA 2Y7FA 5K4XA 1OK4A 3ATYA 4A2RA 1ME9A 3P62A 5T26A 2CZDA 3UXAA 4E38A 1FX6A 4OV4A 2ZTKA 7TIMA 3KFTA 4JX4A 2GPTA 3B06A 1Y0EA 5ABTA 2WJZA 2Q3OA 4O15A 1GZGA 2V30A 5HJLA 3QW3A 1MO0A 3THAA 3PB2A 1H1ZA 1KA9F 2IQTA 4M19A 4NUWA 3W74A 3CQ0A 3NQ2A 1ZJIA 1LBFA 3ZWSA 1B4KA 2GQ9A 3O15A 4ZQOA 5DCEA 1SO5A 1ICSA 3GXPA 2G5WA 1H7OA 4MOZA 3STEA 4JTFA 3CIXA 2VFFA 4ZQPA 5AHFA 3TCEA 3VKJA 4PL2A 1FQ0A 4IPIA 4PEKA 1WAUA 2HS8A 4CCEA 3S1WA 1VPXA 1N8FA 3LLDA 1JUBA 3TUUA 1JCLA 2ABBA 5IBXC 2GJNA 3RMJA 5FEPA 3LCLA 3OA3A 2O7SA 2OZ0A 1P0NA 1KBJA 1DQWA 2ZYFA 5F2MA 4N9EA 4UMBA 3W1AA 2NWRA 4QNWA 2VFDA 4FNQA 5CKSA 4NJIA 2C3ZA 2GOUA 4PA8A 3C2OA 1TTIA 2EAWA 2A7RA 4C1KA 2ABAA 1UUOA 3G1XA 1C8VA 4JNMA 3B8DA 4UUIA 1DORA 5D09A 3HPZA 2ZRZA 1RQBA 1KM1A 1U5JA 5D04C 3WK3A 1NF0A 1TTQA 1I2RA 3NQEA 4LV9A 1SZFA 1KTCA 3IIVA 2YW4A 3V1PA 5K9DA 3UY7A 3IGUA 2GVLA 5KZMA 4FNTA 4LVBA 1JQVA 4WJEA 4IMEA 2ZRVA 4UTHA 3W85A 1EPXA 1O5XA 3L5AA 4RK8A 4N6FA 3VE7A 4P61A 4ZVJA 1PV8A 1LOLA 2V2HA 1EUAA 3P82A 3OHIA 2A6NA 1IIHA 4DPQA 3TQ0A 1QAPA 1G4EA 2WNNA 5AHNA 1H61A 2CLKA 1W3TA 4BFAA 3W86A 4WD0A 1OG0A 2AQWA 4ML9A 3EXSA 5KMYA 4TO8A 2Y61A 3JS3A 2Y6ZA 4JICA 3W23A 4JTJA 2QCDA 4E2DA 4N02A 1GWJA 5D37A 3P67A 4K8EA 3M6YA 4UMAA 4LV4A 2H3DA 2E5BA 1LOQA 2E09A 1VR6A 3DFSA 4IGHA 2NXIA 1RR2A 3OIXA 4UIOA 1H7WA 3F03K 2DU2A 3DH7A 3QC3A 4JX6A 5C5YA 2P0OA 1QOPA 2I1OA 3W7EA 3M1ZA 3NPWA 2YR1A 2X1RA 1VCFA 3O06A 3QFEA 4AEOA 4BF9A 2Q8ZA 3I68A 3RU6A 2ZQ0A 4NJJA 1YXDA 1TPWA 3BARA 4IX2A 4ZZ9A 1YDOA 1Q45A 3R5EA 5EMUA 4FHAA 4O28A 2J6XA 2E6AA 1FCBA 3QW4B 3WK1A 2AGKA 1I4NA 3QQ0A 4R53A 2VEIA 3VI2A 3TMQA 2VFGA 3CM4A 3B03A 4NQ1A 3CLMA 1A50A 4TU1A 4HNNA 1W5NA 1OJXA 3O6YX 5FF0A 4XTDA 1SZGA 1W1ZA 2ZZ4A 1ZNNA 4Y90A 1GVQA 4NX5A 3QPYA 4ORIA 3L5LA 1D9EA 3GLCA 2YZRA 1H62A 4O50A 4RX0A 5DXYA 1NEYA 2QF7A 3MWAA 5K4ZA 2Z6IA 4UTKA 3T7VA 4FXRA 2WKJA 3O05A 1OYBA 3HG4A 3R12A 1XCFA 3P74A 3A22A 4NU7A 2H6RA 3I7RA 1TB3A 1VCGA 3FA5A 1TREA 2B7OA 4K7VA 2TSYA 1W56A 3DFPA 3GB6A 4YXGA 1SW0A 2QUTA 1KFKA 3M5ZA 4LRSA 4MZ8A 3FOKA 5CZ0A 5I3KA 3MHGA 1JUKA 5F1VA 2BZNA 1A5AA 2ZCGA 4FNRA 3G1AA 2YYTA 4HPJA 1KTNA 4O1AA 3DXIA 2E1DA 2C19A 2BSLA 3DFOA 4R34A 3EX2A 5G2IA 3VNDA 4OGZA 5H91A 2Y7DA 4NJHA 3QRHA 4NNAA 3T4CA 4LRTA 1FCVA 4DEFA 4N4QA 4EWND 3PF3A 2QCLA 5D03A 2WOQA 4Q32A 4UTJA 4UTLA 1AMKA 2V9DA 3PULA 5G5IA 2YX0A 1DVJA 4NZJA 4AXKA 1D3HA 3W7GA 1NAL1 3C0JA 4EF8A 2A1YA 1KLYA 3DENA 5AN7A 1TV8A 4ZQCA 2QCCA 2E6DA 4MLRA 3KRUA 2RDTA 3NQFA 2VFIA 1Z42A 2NUYA 3IRDA 3ZWTA 2NX9A 1Q6OA 2V0TA 2FJKA 4Y9AA 4HSNA 2VC6A 3TXZA 1GVSA 4WOQA 1S5WA 3KOFA 1X1OA 3GDRA 1B57A 2ATSA 1BEUA 3S5YA 4G1KA 1OYCA 5FF2A 3W3OA 3W71A 1GOXA 5LNSA 1IF2A 3MHUA 5C6MA 4UTWC 4RV8A 5HMSA 2NV1A 4MJZA 3UPWA 3PBVA 2XN1A 2YW3A 1L6WA 2A5HA 2YGYA 2F84A 4O4VA 2YDAA 4JTLA 3LBCA 1OFEA 2ZA1A 3GIYA 3W7HA 2FTPA 4YWIA 1EB3A 3B0PA 2D73A 5AYZA 3W73A 2RH9A 1V5XA 3UZJA 1JCJA 1TRDA 2X30A 3RNDA 3NM3A 1XM3A 2WSQA 3DZ1A 4XQ6A 3W1XA 4IQLA 1H1YA 4TR9A 3DHFA 2QJIA 3MO7A 2OT1A 2PCQA 3WK2A 3C2VA 1I2NA 3QJAA 3LRLA 1X6UA 1TV7A 2TRSA 4C1LA 2CLEA 3F4WA 4O14A 3QF0A 1SQ7A 4L4LA 4UTWA 1N7KA 2XFWA 2ZA2A 4LC6A 3W1TA 1FBAA 1JR1A 3G3MA 3G8EA 4S2BA 2V2CA 5LHEA 3WJZA 1AK5A 3LTSA 3L68A 1JCXA 4AB4A 1VZWA 4OBTA 4RCXA 1HO4A 3DKLA 3LHVA 4BI6A 3O8AA 1PS9A 3PSWA 2PC4A 4GUIA 3W2MA 1B4EA 3LCIA 3NQ8A 2Y70A 3S1UA 4XBKA 2JK2A 3L0NA 3TV8A 1KBIA 3S8HA 2NX1A 4UR8A 4O13A 3HGOA 1OVDA 4N9CA 2ISWA 3GNDA 3GKAA 1EP3A 4JIQA 4LWWA 4UFKA 3MI2A 4O0KA 1JVNA 4JTTA 3TQKA 3C6CA 1OFRA 2BLEA 3FKRA 4RKAA 3ZR4A 4DF2A 2WNQA 1LYXA 1H5YA 1Q6QA 1SO3A 1QOQA 3HPXA 3STGA 4JTKA 4ORMA 2EGZA 1M7PA 4IXXA 2QCHA 3LXAA 4X3ZA 3LCXA 2A4AA 1KM2A 3UY8A 1KFCA 3NL6A 2Q3RA 1AW1A 3SJ3A 4IOTA 1PIIA 3PC0A 5AB3A 1KLZA 5CZTA 3W87A 2OCZA 5D05A 3CC1A 4AF0A 5HWNA 3QSTA 1SSDA 5K3VA 4XBSA 3G1HA 5FF4A 4PL1A 2UV8G 4NNBA 5KSWA 5BRBA 1K8ZA 4O1BA 1ZENA 5I3JA 4MLJA 1MSSA 4IMDA 3OG3A 4OU1A 4IJBA 2ALDA 4CQ8A 3G1SA 1QO5A 1LP6A 3NM1A 3G0XA 3O16A 4O10A 4ZQMA 1WOAA 2QCDB 3N9RA 4FNPA 4HNTA 3NEVA 2QUVA 1UCWA 3QYQA 1ZCOA 3IIZA 3N3MA 4I9AA 4UR7A 1WOBA 4TMBA 2W0UA 5CG7A 4UFLA 5C54A 3LV6A 3E0IA 3B4UA 1T99A 1GPWA 2CLOA 4JS3A 2Y7EA 3P80A 2ZZ1A 3W2NA 4JYEA 3NPVA 1RD5A 4QJ1A 3WJYA 1J5TA 2QEZA 3BLEA 3NYZA 1R2RA 4YCPA 3UZ5A 3NNTA 1ZAHA 2GUUA 2QJGA 3LI0A 1UUMA 1O95A 1W5MA 4O53A 1P4CA 4WUIA 3PG8A 2Q8LA 3B0VC 5K7JA 1GT8A 4GBUA 4K38A 1IIGA 2VEMA 2Z1BA 4PFMA 1UJPA 4N2YA 3UWUA 1ICQA 2X1UA 1OX6A 1F76A 3MBDA 4RR4A 3P5ZA 3MW7A 2ZRXA 5HR7A 5KINA 4BR1A 4ZQRA 1PCKA 4LS0A 3GKFA 2BX7A 1DHPA 1JULA 1R47A 1A53A 5F2LA 3NPXA 1QR7A 3G1DA 5BMWA 4UXDA 3U6WA 1CX9A 1TPB1 1LRTA 1PHWA 3GAKA 4BI5A 3EWYA 5DELA 2Z6JA 3QMRA 5D38A 1XC4A 3G18A 3MI6A 1HTIA 3KXQA 4MFDA 5HNRA 3ZFHA 4AWTA 2X2GA 2ZBTA 5AC7A 4JTSA 3TQVA 2J9ZA 3TSBA 2E6FA 5EY5A 3KRZA 3TW6A 2J24A 2Y88A 4HIBA 1NF7A 3SY5A 1K3UA 2J88A 3OEXA 4LS1A 4OQVA 3SGZA 4ZL1A 1EUNA 4H6KA 3S42A 3P60A 2CFFA 4RZ6A 1RZMA 1VC4A 3W7DA 6TIMA 1G4PA 2C0AA 2QCNA 1YDVA 5C55A 5LZLA 3W75A 4FIRA 3N34A 2HTMA 1IXQA 2VOMA 3CHVA 3ABQA 3G22A 4DO4A 3BG5A 1TPFA 3TSMA 2NZLA 1O5KA 4AH7A 1S5VA 2EPHA 2OT0A 5FI8A 1LRQA 4KWWA 1GG1A 4O57A 4JY9A 5CPOA 4BK9A 4ALDA 3LHYA 2R91A 5U4NA 2YXGA 1GQNA 3KRSA 4DO6A 3EXTA 5D2WA 2DJXA 1T8XA 1I45A 3M7WA 6ALDA 4H3DA 1TPVA 2EF9A 3NG3A 3SECA 2CU0A 1DL3A 5TBOA 5EYWA 1KFJA 1YTDA 3HO8A 2B7NA 4ICNA 3ABRA 1QPQA 3W1NA 5BOOA 1P5BA 3ANYA 4BI7A 3W7IA 1GVFA 3UYCA 3QH2A 5D32A 3HJZA 3QSRA 3TMLA 4GUHA 3O63A 5LKYA 3P8IA 4JTEA 1RV8A 2ISVA 4CNNA 2J9YA 2QCMA 3DAQA 2Y7GA 1DQXA 1SPQA 3TW7A 1FXQA 1OFBA 4Z1BA 4LTSA 1ZFJA 1PL9A 3M9YA 5IBXA 2JKEA 5F4WA 1ME7A 3TXVA 4YL2A 3M5VA 5DBUA 1YADA 3HIJA 3W1LA 1M7OA 1LORA 4RJEA 5DY3A 1W0MA 4UMCA 1AG1O 3DHDA 3QQ1A 3CU2A 3L9CA 4HT3A 1GYLA 3A21A 3GR8A 1I2QA 5CSRA 1G69A 1R46A 4X22A 3R13A 2ZRUA 2NXHA 1XL9A 3MI3A 1HL2A 4FNUA 4AVFA 4P2VA 3BLIA 5AYXA 3HG2A 3G1VA 5F2IA 2DJLA 1LBMA 4OT7A 1XBXA 4TIMA 3LDVA 2G95A 1VJIA 4XUGA 3RLVA 1NSJA 3EWWA 4ONVA 3M16A 1H7NA 1A5BA 4KFNA 3AO0A 1YYAA 2W79A 4TX9A 1EA0A 3KVMA 4QITA 5CSSA 5I3FA 4NT0A 2E68A 1I2PA 1SZNA 1ADOA 2NX3A 3G1YA 1GVOA 4QAIA 3ELFA 3SI9A 3KVKA 3KVJA 1SFJA 2DZUA 4Z1DA 3G1FA 1Q3NA 4Z08A 1H51A 1XBYA 1E51A 1FWSA 1J4EA 3Q37A 3W70A 4H4IA 3W1PA 3ABOA 5F4SA 1AL8A 3EWXA 1EEPA 3BW3A 1HUVA 3M44A 3PUEA 1F6PA 1TJPA 1BKSA 2Z0IA 3F4NA 4WOZA 3B0UX 4JY8A 4LUIA 1ZALA 2ZFAA 3INPA 3DKJA 2C6QA 4IMGA 4UTTC 3DFTA 4IWWA 3HPSA 1DOSA 3DU0A 3M5XA 2Z2UA 4JDBA 3LCWA 1P1XA 2Y63A 4O19A 3LCHA 2HS6A 3W9ZA 5AFDA 3TFCA 5F1UA 2O7QA 4Z1AA 3DI1A 3LB0A 4S2CA 2V8ZA 1TJRA 3L21A 3C56A 5DCDA 1SW7A 3NPUA 4DBEA 2FPVA 2CLMA 3HG5A 4UFHA 3LXCA 2A7PA 1XKYA 1U83A 4AF0B 1G7UA 2YFOA 4GUFA 4MZYA 4M6VA 4K7YA 1EWEA 1ZY9A 4O17A 3S1XA 2A6LA 3M41A 2B4GA 1NFBA 3KAOA 2PE4A 2A7NA 4HSOA 3S6DA 4DPPA 3GVGA 4WY0F 3ATZA 4K36A 3KVLA 4LNYA 4UTTA 2QCEA 5DY2A 3HB9A 1K7FA 3FYPA 4HKPA 4LVFA 1F73A 1VS1A 5LNUA 5AHEA 1IGSA 3HG3A 2A21A 5K2ZA 3OVRA 3W7JA 2W6RA 5D2TA 4ZQNA 1IXOA 5LSMA 1TRIA 1F05A 1WYIA 2ZZ2A 3G8RA 5FEZA 2EHHA 5L6UA 1A5CA 4O52A 1O94A 5LNWA 5DXXA 2RKXA 1OYAA 2CZEA 4KKXA 4NNCA 5K9CA 4A21A 3EEGA 1BWLA 3VFLA 1FDZA 3IGXA 1QMLA 1XDMA 4UCGA 4A2SA 3P8JA 3W7LA 3NQMA 4ADSA 3MHFA 3NOEA 3TJXA 4QNEA 3CTLA 3PUDA 3B05A 3IVSA 1D3GA 3NDOA 5HULA 4PC8A 3NQAA 4MZ1A 5EA9A 1K7EA 4I7VA 4JYFA 1DJNA 3NL3A 1PE1A 5CGQA 1KW1A 1K7XA 4WY0A 1KM5A 4UTIA 1KM0A 2HSAA 3NGJA 3W2LA 3G3DA 2TMDA 1EX5A 4HPXA 3IEBA 5CZJA 2C14A 4J9JA 3A5VA 2GQAA 3GYEA 2B7QA 3BW4A 5EPDA 2NUWA 4JEQA 3R89A 4QM1A 2WO5A 3GXTA 2WNZA 1OFDA 1SU5A 1YLVA 2VFEA 1LLWA 3W7QA 3NQ6A 1O60A 2WV8A 3PG9A 5KZEA 2ZZ3A 1XI3A 4PH6A 4AHOA 2OX1A 4XTIA 1K03A 2H8XA 4A3UA 3LV5A 1P0KA 3FFSA 1FXPA 1PCWA 3PY2A 4EF9A 4NJGA 3NQGA 5E93A 4N9DA 2QAPA 4AHQA 3W7RA 1T0OA 1KM4A 4YMZA 1QNVA 1M5WA 1N55A 1W5OA 2BTMA 4JDYA 1FCUA 1EP2A 2ZRYA 1YTEA 1XDLA 3OVPA 3W83A 1YDNA 3GDLA 1TPC1 1W8SA 1QPRA 4UFMA 1KM6A 3IV3A 2VKZG 4FEZA 1QFEA 1LDCA 1OF6A 2WQPA 2PURA 1SUXA 1SZEA 5AC8A 1Z48A 3NVTA 5CPLA 3AJXA 3BGJA 3E96A 2ZRWA 3YPIA 1GYNA 1LZOA 4MY9A 3NA8A 3C61A 3W2UA 2RHGA 1W37A 3L2IA 4AAJA 3UWVA 1DKWA 1SO4A 5SWUA 5LHFA 4OV9A 4GUJA 3UWWA 3W76A 3W84A 4CCDA 4YLWA 1FWRA 4IXHA 1QWGA 1TQJA 3QM3A 4GXMA 4OWGA 3L66A 4CQ9A 3DGRA 3S5ZA 2B0MA 4M6PA 3THQA 2QAFA 1OFQA 3BVJA 4M7TA 3W72A 3SIZA 1L9WA 3FKKA 2RDUA 4WXZA 1QPNA 2RFGA 1XBZA 2I14A 4Z1CA 3C4UA 5IM51 4NXSA 2I9EA 5A8GA 3G0UA 3IVUA 2QKFA 3DFNA 3QPZA 4JN6A 5BMXA 5CPNA 1TYGA 4L4MA 3CWNA 1WX0A 3W1UA 1H60A 2FIQA 3W7OA 1FWNA 2WPBA 3LERA 2PRMA 3M5YA 3IVTA 4DBDA 2AAMA 3BPWA 4DXVA 4FXSA 2B7PA 1OFOA 5D2VA 3LHUA 1RQEA 3FJ6A 1QPOA 5G4WA 3OBKA 4MYXA 2YCEA 3BV4A 4K39A 3LBMA 2DORA 1I2OA 1EWDA 3GDTA 1ZAJA 3R8RA 1TCDA 2P1FA 5LGZA 3PSVA 5G1TA 5FF7A 3N2MA 5AHLA 3I7QA 4UFJA 4GC4A 1WXJA 3NZ1A 1EIXA 1M6JA 4MY1A 5EBUA 2GJLA 3W88A 4KFPA 1RPXA 3B04A 2CZFA 4RZ4A 4WX2A 1TO3A 3M47A 1YPFA 3LX9A 2OJPA 4QSHA 1YXYA 2DZWA 4M5PA 3TJLA 1KM3A 3TK7A 4FIQA 2YFNA 5A5WA 2FFCA 5LNRA 3FLUA 1DJQA 3QZEA 2VEKA 5EL1A 4O16A 1W5QA 5HWJA 3GNNA 1CI1A 3N9SA 3TX9A 3CT7A 5K9XA 3PBUA 1HFBA 4FX7A 1F2JA 1FUYA 2FQIA 5I3HA 3MMTA 2QCGA 5G4EA 4W9TA 3PWAA 4AHPA 4JTHA 1EP1A 5GVJA 4QIUA 3LCFA 4M7SA 2OMAA 2YSWA 4QQ3A 4JIPA 1VQTA 3N14A 3TA6A 3PBWA 2RDWA 2A85A 2VEPA 1TMHA 2FB2A 4Q4KA 3W22A 4DF1A 3W1RA 1PVNA 3C2RA 2QCFA 2C16A 3MJYA 1R2TA 4FF7A 1H50A 3Q94A 3TAKA 1DV7A 3PB0A 4KFOA 2DZVA 3NQDA 1YTKA 4IMFA 1AL7A 4AWSA 5KTLA 1JCNA 1C29A 3GAYA 1GTEA 3QMTA 3NQCA 3TKFA 1JQXA 3WFAA 5DCBA 1RVGA 5F4XA 3IIPA 2V2DA 3L0KA 3C2FA 2F7FA 5J5RA 4UTMA 5HUOA 4AMAA 4O11A 4GWEA 2ZZ6A 3KHJA 3C2EA 4TMCA 1JCYA 1MXSA 4XKYA 2H8ZA 1G4TA 1B9BA 1VHCA 2FLIA 5MHBA 5U7SA 3EXRA 2CW6A 2H90A 3I7SA 3HMJG 1X8FA 5LNVA 4LVGA 5D02A 1H7PA 1VLWA 4IX0A 2JGQA 1TSIA 2DZXA 3EB2A 4JYDA 3JR2A 4MYAA 1X7FA 1YPIA 1LRNA 3WK0A 1G7VA 5C2XA 1B3OA 1ML1A 8TIMA 1VYSX 4GE8A 2X1TA 2ISSA 1KV8A 1G67A 4EVZA 3CWOX 2VENA 4ZMGA 3MYPA 3CB8A 3N19B 5E1QA 3EWUA 5I3GA 4CQAA 1KFLA 4MY8A 2C15A 3NL2A 4PCFA 3HBLA 2ZZ7A 4MJMA 2GVJA 2H3BA 3FJLA 3IIOA 3MYOA 3BLFA 3G0SA 3LGEA 3TNOA 3QMSA 4IPJA 4MPQA 3V75A 5D33A 2E77A 2E5DA 2Y85A 5AYYA 3SR7A 4M6QA 3HGRA 3T55A 3CEUA 3RLUA 4WY0B 2DP3A 4KWVA 3LRKA 5KITA 1TQXA 3TH6A 3LCGA 4JD4A 4JTGA 3R2GA 2QUUA 3NZRA 5D30A 2G97A 3ZS4A 4CNPA 4LS2A 3WJSA 3GXNA 5H2ZA 4JTUA 3BO9A 5HUPA 4ADUA 4GJ1A 2G96A 2HMCA 2YPIA 2NV2A 3STCA 1TV5A 2Y62A 2ZTJA 2X1SA 3UQNA 3H55A 1OFPA 5HR6A 1XXXA 3H53A 5G2HA 3GZ3A 1I8JA 3MUXA 3GX9A 3S0CA 2CZ5A 4RLIA 1KTBA 4WZHA 1GEQA 2JKAA 1GVRA 3A24A 1G6CA 1QCWA 4Y8FA 1IXPA 1OX4A 3NQ7A 4AWUA 4BWLC 3LHZA 2PRLA 3VCRA 4O1CA 3O1NA 4LUJA 4N9BA 3UWYA 5D2YA 4Q33A 1SSGA 2X16A 5DN1A 3G24A 4WXYA 1W54A 1TPDA 4NJKA 1LROA 2PRHA 3U8GA 3NQVA 4CLMA 1WBJA 3BK0A 3E49A 3EX1A 1K02A 3F1QA 1ME8A 2EKCA 3W7NA 4UFIA 2VXNA 4DO5A 5KZDA 4A29A 1W3NA 3HGSA 4X2RA 3TDFA 3LTYA 4K6AA 4POCA 1OX5A 3CPRA 1G4SA 2DZPA 4Z0SA 1BWKA 3WJXA 1UB3A 2J9XA 2R14A 4O18A 3S9YA 5G1YA 1VGAA 3C3NA 3NO5A 1A5SA 5TIMA 5AC6A 3UPBA 3D0CA 5HINA 5HQEA 1UASA 4JR5A 4LC8A 1MEIA 4UNLA 1OK6A 4GUGA 5BNKA 4BWLA 3KX6A 4GNJA 3EWBX 5BW6A 1H63A 4JTIA 1MEWA 1HG3A 2P10A 4NZFA 3EX4A 4EOUA 4FB7A 3A23A 1QO2A 1VRDA 3HF3A 4IMCA 3L0GA 3H54A 1ICPA 4DELA 2C13A 3WJWA 4X9SA 3GK0A 1LOSA 4JGDA 1IXNA 3TC7A 2Y89A 3S5OA 1VLIA 3LLFA 2V5LA 4O4WA 1OFAA 1LM1A 2FPTA 4MIMA 3EKLA 3O6DA 4O12A 4LVAA 3M43A 3NAVA 1ALDA 3W6YA 3W2JA 1SR9A 1O4UA 3P7YA 3UD6A 2R94A 3LRMA 4GRSA 2CLLA 3BW2A 3LOTA 3TAOA 1WBHA 3C8FA 2BXVA 1XUZA 5FF3A 3I6RA 1LBLA 3TSDA 4S1FA 3S1VA 1GG0A 1SW3A 3L65A 1W31A 1QDSA 4RXGA 1K8XA 4Z0JA 3SSJA 3FEMA 3I65A 5E0KA 5F2GA 4A22A 3TR2A 1ONRA 4FO4A 3MP5A 4O0ZA 2ZDRA 3BG9A 3BGGA 5AHIA 1Q6LA 1C9DA 1VYPX 4HHPA 2ATMA 3LHTA 4CCCA 2JKPA 1TPUA 3SW6A 4N4PA 1F6KA 2QR6A 1VCVA 2GQ8A 2QJHA 1XFBA 5FEXA 1MEHA 3GDKA 2V5BA 3BG3A 2WSRA 4D2JA 3E12A 4HNUA 4FX8A 3TE9A 3MP4A 5DBTA 1PHQA 1UBSA
chains in the Genus database with same CATH superfamily
1C93A 3WLPA 3ZSSA 1CEOA 2OZ3A 3C52A 5HNNA 5T9BG 1A7VA 4U4MA 4WHBA 1GNXA 4IUGA 3TR9A 1PD0A 4B2DA 1UA3A 3H6OA 4HN4A 4AZ7A 4Q4RA 3SFKA 1H41A 4JHMA 3SFWA 4Q7CA 1TTJA 4IZGA 4D6DA 3I6EA 3SRHA 1DIEA 1R4TA 3OGRA 1NVMA 1AJZA 1FDYA 2NWSA 4N6EA 1OHLA 3G6LA 4LDKA 4HU3A 2Z1KA 5I79A 2DZSA 5LGXA 4C6NA 1WKEA 1X97A 4YVVA 2FZ8A 1PAMA 1TZ9A 3W7KA 1XUUA 4Y6GA 4YK5A 3T0CA 2HQAA 1U1JA 1JAFA 1M2VA 3TFXA 3W7MA 4C6MA 5EFFA 3U5YA 4BZYA 3WQ8A 4GFIA 2Y3HA 3T44A 3SSZA 1ECEA 1NP0A 3LEOA 3CHDA 5D2XA 5JLIA 4AX6A 1KRMA 1JCMP 4RDYA 1QJWA 5TQLA 4NVTA 4B9ZA 1E9YB 4O54A 3CMGA 4LANA 4AZBA 2F2HA 4ZBCA 3GU1A 1JNDA 1O12A 1V7YA 3CLWA 4QX4A 4A6GA 4FNSA 4RV3A 4MNMA 3EDJA 4LLCA 1DBTA 2ADAA 2GZXA 2GJXA 2VB6A 1XGDA 1CGOA 2Z00A 1TA3A 3KOXA 3E70C 1BVWA 2ISFA 5AOUA 5BCAA 1K77A 3LI1A 5AHMA 1POJA 3A4WA 3P61A 3VYWA 3SRKA 4G7OF 5CZSA 4A3YA 4YYFA 2Q6ZA 1TTPA 1NG1A 2YYUA 2ZX7A 6A3HA 2OG9A 4JCLA 2PGFA 3WLTA 1YXCA 2ONEA 2FVKA 4H00A 3IJLA 3CS2A 1Z7Qc 2BWGA 5AYBA 2PD5A 3I5QA 1FY6A 1TJ0A 3AHZA 4IQEA 3VGBA 2LFFA 1EZ2A 3RCMA 4ULVA 2LLEA 3L67A 2CC0A 4WGHA 4AY1A 5HWMA 2NVCA 2C18A 5A6TC 1I75A 1UP0A 4P7LA 3A9IA 4LT9A 4PULA 4IB4A 1BQGA 4ADTA 1W2VA 4CN6A 3LM7A 1DWFM 1VD6A 2QDHA 2GWWA 1RK6A 3TYCA 3VE9A 2X41A 4NXKA 1FDJA 3N24A 4S3CA 3LHWA 2POZA 3SGUA 4DJFD 4EPDC 2R6OA 3AIUA 5FJUA 4RW3A 5BXTA 1W1VA 3NDYA 3OP2A 4LY8A 1L6SA 2WC3A 2OSWA 3WLQA 4DF0A 1BTCA 4JKKA 4PYSA 1FMVA 1KFBA 4CNUA 5EBAA 1LTDA 5EMMA 4QISA 4PTMA 5FD0A 1R30A 3BOFA 1E84A 2C71A 4UNKA 1TIMA 2V81A 1R0MA 4AIUA 1KKOA 4ACYA 1LCOA 6XIAA 2OQHA 1AQ0A 3VU2A 4ANJA 3AXKA 3W2KA 3W7PA 2ZZ5A 3GFYA 2IXUA 1PZ2A 3PUGA 1VH7A 3EZIA 3ITOA 5BYWA 4BJ5C 3DFYA 1K8YA 4P5UA 1J8MF 3N6QA 1OK4A 3QW1A 2IPFA 4A2RA 4NAEA 1HKVA 1GQLA 5A95A 3UXAA 2VX7A 3GM8A 5HA7A 2Y3DA 3OLIA 3KFTA 1K05A 1Y0EA 3HV9A 4HZ8A 1J0IA 4MG4A 2XSXA 3GEHA 4Y9PA 4O15A 2OODA 3PWGA 5HJLA 2PGRA 3MZ2A 1TUFA 2IQTA 3W74A 1MFVA 4H6QA 1MXDA 3K46A 5KYYB 2GQ9A 1LT7A 1NSGB 4ZQOA 5DCEA 5CBJA 4W87A 1SO5A 4PEEA 1ICSA 3CV6A 3DIPA 1RXOB 4H9ZA 3LPGA 4C6QA 3RIPA 4MOZA 3RR4A 4XWJA 4JTFA 1JL8A 2VFFA 5AHFA 1J6OA 3LLKA 1T6MA 2PPGA 3P3BA 4W8AA 3VKJA 5F28E 1CB2A 1ST6A 3F4VA 4WF7A 4IPIA 5DQPA 4GACA 3UZXA 3S1WA 1VPXA 1JUBA 3TUUA 3SCTA 7CGTA 1JCLA 1DIKA 3HPFA 2ABBA 5DO8A 3VOCA 4J3VA 2DYSC 1BYDA 1BFNA 2OXNA 2OZ0A 2HMZA 2P1AA 1XSIA 2ZYFA 4P8VA 4XEKA 2CITA 3CWHA 1K4HA 4QNWA 2W3ZA 1CXLA 3IV8A 1PD1A 2C3ZA 2NW0A 2GOUA 4XO7A 3C2OA 3FGCA 2VL4A 3KRBA 3G1XA 3SCSA 2E67A 1A0BA 4XVEA 3B8DA 4QGCA 1NQKA 1ZYRF 1IT0A 2Y8KA 1KXVA 4G2DA 1BXNA 5BRQA 3V7OA 3DC8A 4GY1A 4LV9A 1R38A 1SZFA 1YIXA 3IIVA 3UY7A 1E4LA 2Y69C 4LVBA 3DG3A 3S90A 3FHQA 1W3HA 3EDKA 4IIGA 3CUFA 4LLEA 4LYPA 2WHJA 2WL8A 1PV8A 2V2HA 2Z1SA 1PXGA 2A6NA 3EEZA 3REQA 1V7AA 3TYEA 4Q4SA 1G4EA 2D0FA 4YT4A 1D1AA 5CPQA 1CGNA 3NXLA 2UUIA 4YWSA 3T42A 3W86A 3GNPA 4Y8EA 4YIWA 5LA1A 3QXBA 3DC0A 4TO8A 1J10A 2ALRA 4UNIA 1CT5A 4BEQA 2Y6ZA 4JICA 3W23A 4Z42C 2VD9A 5D37A 3BAWA 3V5YA 4JKVA 4GX9A 5KYNA 4WKFA 2E5BA 1FVPA 1VR6A 1BAGA 1H7WA 2DU2A 3CL8A 2XGZA 2YR1A 3S2MA 1RJRA 3I3EA 1AH4A 4HN8A 1C92A 5E6ZA 1YXDA 1XLBA 1VF8A 4I8YA 3ZQ9A 1RP9A 4KEZA 2XU2A 1Q45A 1WXYA 2WC7A 4IAQA 2J6XA 1OBAA 1FCBA 1UWUA 2AGKA 4F2BA 1KD0A 4R53A 2VEIA 3B03A 3TK0A 4Q4ZF 3I3DA 3WUEA 4DRSA 4HNNA 5FF0A 4XTDA 3VNZA 1IEIA 1SZGA 3R0UA 4Y90A 4P7QA 1GVQA 4GI8A 4NX5A 3W26A 1JYWA 1U0BB 4AU0A 2YZRA 4RX0A 1P1MA 4LAOA 1HMDA 1CECA 1NEYA 2PDBA 3W8IA 5K4ZA 1MW2A 3SM0A 2X0HA 3HLZA 5L0IA 3DAGA 3QV7A 3O05A 3TYAA 3R12A 1KFWA 4NU7A 1EYEA 1TREA 2R9RA 3NDZA 4W7WA 1W56A 1SW0A 1ZL1A 4V33A 4MZ8A 7A3HA 4CDAA 1E0VA 2XLHA 5F1VA 2BZNA 4XIMA 4U5DE 4D6JA 1SMYF 1DJHA 2ZCGA 4HPJA 3QLLA 5A8NA 1KBBA 1KTNA 4DLMA 4HOXA 2E1DA 4JQ2A 2BSLA 2VQTA 3P93A 2HJPA 3DFOA 5C2GA 5JP7A 1XLMA 4F0LA 2G37A 3CQJA 4DXWA 2DSVA 4OGZA 4WDTA 3FOOA 5H91A 3MC5A 4DEFA 4N4QA 4TQTA 1K9DA 3G2GA 2DVTA 2JEPA 5D03A 5JU6A 1LE2A 4Q32A 5A6BD 4UTJA 1AMKA 3OLDA 2PDGA 3V7PA 2ODOA 4GXWA 3EMCA 3UR5A 4U5HA 2J4GA 1CXHA 4IPLA 4C5YA 1NAL1 1KLYA 1O3UA 2QLAA 2DH2A 1U1HA 3LSCA 1K9TA 4Q4QA 5AN7A 1TV8A 4Q8WA 4Q7NA 3U2MA 3BL3A 3KOWA 4MLRA 2W9MA 4GY7A 1OM0A 3ZT6A 2RDTA 3NQFA 2VFIA 5AKQA 2PA6A 3ZWTA 2NX9A 1EJRC 1W1A1 2FJKA 3TXZA 1AVOB 1GVSA 3GXDA 1S5WA 3ZTMA 4J2PA 4QBXA 2NQ5A 1BEUA 5C9XA 4D1JA 4EWCA 3TNBA 5B7ZA 1IF2A 1N82A 1SJCA 4JQAA 4PUKA 1BGGA 5C6MA 1UWIA 1DIOA 5ECVA 3HQPA 4MJZA 1HMOA 3U4AA 1KGXA 3URNA 4QP0A 3TWAA 3PBVA 1OW8A 2EPMX 1L6WA 3CZ6A 2F84A 3C0SA 4F0KA 4F8XA 3A4JA 3A12A 3UR3C 2FTPA 3GWQA 1I0BA 4CIHA 4YWIA 1W9XA 1XQKA 1UC5A 3OU8A 1Y5VA 5AYZA 2GUYA 1V5XA 3VD5A 1TRDA 1EJTC 1S5MA 1TZZA 1OGGA 3CHEA 1B3WA 3W1XA 3MBGA 3DHFA 2GDQA 3PTDA 4Y9OA 2KQ9A 4O6MA 1KTMA 3QJAA 1WPCA 3BMXA 2QVHA 4O14A 1Y5WA 1SQ7A 4L4LA 4UTWA 5IFPA 3VDHA 3W1TA 2GQ3A 3WNLA 4DXKA 5I78A 2WHMA 5HAOA 3AMLA 3FXYA 1SR2A 4NILA 3AQBA 4L1XA 3MCMA 3JZEA 3LTSA 1V4AA 1RAKA 1VZWA 5L0CA 4MUPA 3B9DA 1W2PA 1GGQA 4BF7A 4CDYA 1S1RA 1PS9A 3PSWA 2KX9A 3R8GA 1B4EA 3LCIA 3NQ8A 4L6DA 2IXPA 3S1UA 3S8HA 4BF5A 3SXKA 4N9CA 1LQ2A 3GNDA 4OIPF 4G6CA 4LWWA 4HTBA 5L3QA 4HBKA 3FN9A 2B81A 2HCVA 1R7AA 4F0RA 2YL8A 1FKWA 3SN4A 1NDVA 2VO5A 2XPKA 3ZYZA 2V3FA 4RKAA 1HT6A 2PF0A 4ZCWA 4P6IC 4D4XA 3HPXA 1UOZA 3WZ0E 3TYDA 3FK4A 1M7PA 1WAWA 3ITGA 3R8HA 1E0UA 2YDSA 4B5WA 2L6FA 4IGGA 5E6YA 1KM2A 1XLKA 1KFCA 3NL6A 3RM9A 4ZEPA 2NPUA 3UZYA 4IOTA 1PIIA 5AB3A 1KLZA 3MU7A 1XG4A 4F0SA 3QSTA 2P8CA 2NQHA 2WMIB 5K3VA 4XBSA 4LAKA 3WLMA 4B5UA 5F5FA 3F5LA 4PL1A 2UV8G 4NNBA 5KSWA 1LE4A 2YWAA 5BRBA 4K8GA 4X60A 4IMDA 5AVHA 4GXPA 4S3AA 2HK1A 3G0XA 3AU6A 4O10A 1OCCC 2QCDB 1H5VA 3G1RA 3VCNA 4H7ZA 1NFNA 1IEXA 4KRUA 3U9JA 3B9QA 1UCWA 4NL1A 4AZCB 1YBQA 3UR7A 3N3MA 1UWRA 2ZX6A 4CUCA 1CGME 2W0UA 4TMBA 5C54A 3S28A 4JBRA 3LV6A 4C65A 3B4UA 2XLDA 3P80A 1C7SA 5C9ZA 4JYEA 2A3AA 1T6IA 2OJQA 3B40A 1ADSA 4JTCA 4QJ1A 4AYGA 1J5TA 3THCA 4E2OA 1Z23A 4DI9A 3UW6A 2H9AA 3UZ5A 3NNTA 4D8LA 1ZAHA 2QJGA 1US2A 4L6HA 3COTA 3QY8A 1W5MA 1R5ID 4WUIA 3PG8A 4DJFC 1GT8A 1IIGA 1L6GA 1UJPA 4N2YA 1V8EA 1ICQA 1R87A 2ASRA 2BGNE 5FZTA 4GYPC 3H22A 4NI8A 3MBDA 3ZMRA 1V6XA 2IMRA 1CGTA 3P5ZA 1RKCA 3GKFA 4MJ4A 2VGFA 4HU8A 1XYMA 1R47A 7ODCA 1A53A 2FHCA 4QG6A 2P8BA 3W6MA 3M4CA 2J7PD 3E5PA 3U6WA 1CX9A 1LRTA 2CBJA 2Z6JA 3DMDA 3MI6A 1EJXC 1OCNA 2HROA 1K40A 4N06A 2WZFA 4MSSA 1QQ3A 2WZGA 3APGA 5AC7A 4WJ0A 5EY5A 3KRZA 1E9IA 2Y88A 4B9YA 1W8GA 3AJMA 3SGZA 1OXBA 1D2KA 1EUNA 1G4WR 2ZXDA 4XAZA 4C7GA 4TX6A 3P60A 2V68A 3CQIA 4RZ6A 3CUJA 1PPIA 6TIMA 2X09A 1G4PA 1KQYA 4ZO9A 4ROQA 2A0BA 4X0NA 5CQ1A 3W75A 4FIRA 2HTMA 4HZ6A 4QDLA 3LYEA 1A49A 2VOMA 3PDMP 4F66A 1TPFA 3TSMA 3T05A 3EOUA 1S5VA 3F4CA 3PP7A 3AUJA 4JURI 1NELA 1GOMA 4KWWA 3MS8A 4GIEA 4WSJA 4QROA 4YJWA 4BK9A 3T4RA 5U4NA 2FVLA 5D2WA 2DJXA 3CAXA 2J7FA 5J8LA 3WH7A 1M68A 1UP2A 4H3DA 1B2YA 4HGXA 5AZ1A 1DQUA 3BWWA 3GQYA 4JQ4A 3FA3A 5EYWA 4XAYA 1KGUA 1YNYA 4DUOA 3HO8A 1LLOA 5LXEA 2OGJA 4ICNA 1X96A 3GZAA 3LD5A 4QDWA 1QPQA 3QV6A 1WDPA 5BOOA 2RSEB 1P5BA 3W7IA 3GORA 1GVFA 1E43A 3KDOA 3TMLA 3O63A 3BLKA 6PTDA 1S2WA 1DQXA 3WMSA 2ETSA 4D71A 1OFBA 5KYUB 1UQYA 1QHOA 3MJMA 4JFWA 4YJ5A 1UPPA 5F4WA 1ME7A 2HPMA 3HIJA 3GHRA 1M7OA 3DHDA 4Z2KA 4Z9IA 4B90A 5CSRA 2EXOA 3H2OA 3S6TA 3P0WA 3R13A 2ZOXA 2ZC8A 2ZRUA 2NXHA 1XL9A 3BZGA 5HANA 1EQ1A 4P2VA 5GNZA 2PWGA 4DNMA 2OJED 3QZAA 3HG2A 1QHPA 1XGEA 3G1VA 3MCOA 3WH8A 1NOUA 1NIUA 3SB0A 4OTKA 4TIMA 4BJ1A 3ITLA 2LQGA 3LDVA 4US5D 1VJIA 4XUGA 5JMUA 3L7RA 3VNKA 3M16A 3LZ5A 4KFNA 3SYNA 4MVUA 3AO0A 3GC2A 2FGBA 3UJFA 2O4QA 2VCBA 3D47A 2W5FA 5MKGA 1TR2A 5GQBA 1EA0A 4F79A 4QITA 3QZCA 3OTRA 3B97A 4W84A 4NT0A 3L4WA 4JHOA 4NAFB 1SZNA 1V6YA 3WD2A 1ADOA 3T07A 1UZDA 2FFHA 3IRSA 1LI5A 4KGJA 3DD7A 1SFJA 4Z1DA 2WM1A 1CPQA 1LQ0A 4YTSA 3VNIA 2VX5A 3LGGA 4Q8NA 1NU5A 3ZVIA 1XLCA 4V2XA 3RDKA 3CAVA 1CLVA 3N2ZB 1F6PA 4GQBA 3WQOA 1BKSA 4PMOA 3F4NA 1TCMA 1Y6DA 3ITXA 1UH3A 4GIAA 4GLEA 2G50A 4PFPA 4IMGA 5EFDA 3E38A 1REQB 3M5XA 2WVVB 2NUTA 5ABEA 4JDBA 5CI9A 3GH5A 3F5KA 4YU1A 2GYIA 1P1XA 3HNLA 4O19A 2EJ1A 1OCJA 2HS6A 3LCHA 4TVDA 3W9ZA 1UWQA 2F8QA 3TFCA 3RGTA 2J9WA 4GIRA 3C56A 3WD1A 1V6VA 2PLMA 5BWFA 2FPVA 4LQ1A 4TVCA 4LUYA 2QIWA 2FVMA 3LXCA 5B1BC 1E55A 4AF0B 3QN3A 4GUFA 4MZYA 4M6VA 3AMCA 2B4GA 1IQ8A 1N8WA 1NFBA 4A8RA 4XQ1A 1XQLA 2IKHA 3ZQVA 1Z6KA 3S6DA 4K0DA 1XICA 4MKSA 5AZ0A 1MQQA 2PDNA 2HEJA 2GOKA 6REQB 4UTTA 1LS1A 4PR4A 3FYPA 2PTZA 4HKPA 3CK5A 3CO4A 2OZ8A 4OBRA 4GYFA 4XD6A 2A21A 5GPGB 1B9ZA 4ZQNA 5LSMA 4HOWA 4GQ0A 1TRIA 2ZZ2A 1WYIA 3G8RA 3POHA 5L6UA 4XUYA 1AQFA 2D4UA 4FMVA 2QUMA 2LFDA 5E09A 4AE4B 5I06A 2ON3A 4DUWA 2JALA 3WH9A 1QW8A 3U2EA 3R0KA 4C6EA 3LJBA 5DF0A 3V35A 3B8IA 1DHKA 2W27A 3CTLA 2VVSA 4R7OA 5CJNA 2Q01A 1JEZA 1KW1A 1K7XA 4B3ZA 3W2LA 2FZMA 3GBEA 2DSZA 2VP8A 3IEBA 2C14A 3NO1A 4MHBA 1E5NA 2B7QA 2PTDA 3AAMA 4JEQA 2X0CA 2EKGA 2WJFA 5D9PA 1SU5A 1YLVA 2VFEA 2Q9BA 1PSCA 3W7QA 4AZIA 3LNMA 4G0HA 2WV8A 2HWGA 2Q8XA 4AHOA 2OX1A 4OUIA 1VPYA 1XIGA 3ARRA 4A3UA 3FFSA 3G5EA 4KESA 3QV8A 3U48A 4OVXA 3HNJA 3PY2A 2VGIA 4WVXA 2PX0A 4AHQA 3CH0A 3LLXA 4L1WA 3AG4C 1AODA 1WWPA 2OG2A 2GWGA 3PZNA 2EINC 2V5KA 4AD0A 3GDLA 1W8SA 4JRZA 1UBPC 2ZDSA 3IV3A 2VKZG 2JX0A 4HOZA 1QFEA 2Y4SA 3UNGC 1WZMA 4B6IA 4N6HA 1NFPA 4PE8A 3IQTA 1LKXA 5AC8A 3NVTA 4EPKA 2XFYA 3AJXA 3BGJA 2ZRWA 3YPIA 4MY9A 1C8QA 1W37A 1PDYA 3EG9A 4BA0A 1SO4A 2NUPB 5A1AA 4C1NA 5LHFA 1FNTc 4OV9A 1V54C 5XINA 2XVGA 4Q8QA 1XD1A 1SFTA 4H8HA 2BDQA 4IXHA 4FR1A 2XSAA 3S5ZA 1RJ9B 2B0MA 3N18A 1MMNA 4B5XA 3PJTA 3VGHA 5BQGA 3M7SA 3M46A 4M7TA 2XH7A 5G1MA 2RFGA 3W24A 1O5QA 3SO7A 2BVTA 3C4UA 5HQLA 4NXSA 3K33A 3G0UA 1QI3A 3CZLA 4XVDA 4FOJA 1TYGA 1ZTVA 3UYIA 1O5RA 2ISDA 3NKEA 3WNPA 1RLCL 2PRMA 4GI9A 1Q7QA 4DBDA 3B9OA 4IG2B 5COGA 4FA3A 3LHUA 1XHGA 3FJ6A 4R32A 4GNKB 2QF8A 3AXIA 4EK7A 3OBKA 3HNIA 2BNJA 2ZXQA 2YCEA 3HKKA 3MV01 1AVAA 3PJXA 3LBMA 1EWDA 2J0WA 3S83A 3UXKA 5B7YA 4GC4A 1WXJA 3UR2A 1EIXA 4MY1A 3EFOB 2PTYA 4HK5A 5EBUA 5LIYX 3AALA 2J0XA 2NSGA 3S47A 1V02A 3QHOA 5HDRA 1V93A 2W45A 3AMDA 1MUCA 3TOYA 1YPFA 4QEHA 4I1OB 3H7UA 4WK9A 7ENLA 1YXYA 2X40A 3TK7A 2G3VA 4FIQA 4QLJA 2XRHA 1TKNA 5A5WA 3CYVA 2VEKA 2O4MA 3W28A 1PV3A 1E3ZA 2PC8A 5T9CE 1W9UA 4DI8A 3M15A 3KZPA 3GHSA 3UPMA 1W5QA 3TOMA 1UH2A 4A8NA 5HWJA 2BY1A 4G78A 4ZSUA 5DFAA 1FAPB 4LNCA 4IH3A 1UD3A 4FX7A 4UBPC 1J9YA 5I3HA 5JUVA 5G4EA 2PF4E 3PWAA 3DI5A 4IM4A 2OMAA 3U2LA 1V3MA 1PEZA 1VQTA 2OEMA 2GGIA 5D9MA 2RDWA 2FB2A 4L5ZA 1WDSA 4BEMJ 2WVUA 1PVNA 3BMWA 2C16A 3UERA 1UZ1A 4HMDA 3CIVA 1H50A 3WMBA 4NCQA 1F3XA 3PB0A 2YL3A 1RP8A 1P6BA 2FZNA 1YTKA 4IMFA 1FTXA 1AL7A 5KTLA 3M6DA 1AQHA 3QTGA 4J27A 1TE6A 3IIPA 5J5RA 4GYPA 4CD5A 5CGMA 3TULA 2QJJA 4MW8A 4TMCA 1MXGA 1MXSA 1G4TA 1B9BA 5U7SA 5CI8A 3EXRA 1QPKA 3QV9A 5D02A 2QY9A 4TVUA 4OFCA 1VLWA 2ACQA 4O6NA 3QY6A 1M03A 1OY0A 1LRNA 4GO8A 5C2XA 2LIGA 1IR2A 4GE8A 4MKVA 1GYMA 2ISSA 1T8QA 3CWOX 1V02E 2PDQA 5FJJA 3E3HA 3ZVRA 2Y2WA 1V3LA 3QTHA 3N19B 4M63A 5I3GA 1IW7F 4MY8A 1LWHA 4J32B 2C15A 3NL2A 3SJNA 2VRJA 3L4YA 1FP9A 3IIOA 1IGWA 1RCOB 2WWDA 2J7HA 3C2YA 3QMSA 4MPQA 5E3CA 4Q8OA 2ZADA 4Z2HA 4ATWA 4IMAA 4Q7BA 2Y85A 3KEHA 3HGRA 1VEPA 5I23A 3P6LA 2CBVA 3AGUA 4WY0B 2DP3A 3FMSA 4S3GA 2Y3BA 3S9OA 4JD4A 1C02A 2QUUA 4OIFA 2QV4A 2WC4A 4LS2A 1S39A 5GNXA 3XISA 4GG9A 4MVQA 2DSKA 3BO9A 3KL3A 1LT8A 2GDUA 4EAYA 5E2QA 3HQNA 2YPIA 2E9MA 1HGYA 4M29A 4RE3A 4DWDA 2OZTA 1TJ1A 3EA1A 2E8ZA 3BV7A 3H53A 3TTSA 1HQTA 5CJ5A 4MADA 2HNHA 3P0XA 5A6AA 1UKQA 3VNLA 4RLIA 1GEQA 2X05A 1GVRA 1XIJA 4AD5A 1G6CA 1QCWA 3NOYA 4Y8FA 1J2BA 3LHZA 2PRLA 4DBWA 1BDJB 5D2YA 2CYGA 5DN1A 3G24A 4IISA 1W54A 3T0TA 3BEHA 3VKBA 4G7ZF 1TPDA 4NJKA 1W32A 1ODZA 5ABFB 3U8GA 1HKMA 2PSNA 1FH8A 2OU4A 1B1YA 1WZAA 1K02A 1ME8A 1PYMA 4AD1A 2VXNA 1ZVZA 4X2RA 4HA0A 4GJJA 4AUBA 3VVGA 2Q71A 1OT2A 3CPRA 1G4SA 1EYWA 4ZO8A 4LH8A 4XD4A 4L61A 1LS4A 2R14A 4B5VA 3TYZA 5G1YA 3CV7A 5TIMA 1MW1A 4E8CA 1AQMA 1E0TA 3GW3A 2OGYA 4F3HA 4CVUA 3VIGA 1BBHA 3TN5A 4F4RA 3GANA 3M0YA 2X7WA 5BNKA 4BWLA 3KX6A 4GNJA 3O0FA 4G7HF 2PP1A 1FWIC 4JTIA 3MTWA 5IOBA 1XV8A 1GW1A 3EOLA 1UIPA 4XIAA 2HVNA 4Y9NA 4PMDA 2VC7A 1VFUA 3O39A 3VOGA 1R3SA 4X9SA 1W1TA 1LOSA 3TC7A 3ALGA 3LLFA 1GW9A 2AQVA 5KYYA 4O12A 3SN1A 1ALDA 1EC7A 2OLAA 3P7YA 3AIRA 2AWYA 2BVDA 4E17A 4HCLA 2DYRC 2F6KA 4QEEA 2CLLA 3TAOA 3QTPA 4U5IA 5FF3A 3SADA 4MTVA 3TCSA 1Y5XA 5BXPA 1QDSA 4RXGA 1K8XA 1XD0A 2DUZA 3OO2A 4L65A 1ONRA 1GOIA 3WF3A 1OC7A 2YCJA 2OO6A 3AHTA 4DZAA 1C9DA 4CCCA 2R03A 1TPUA 4N4PA 3FAJA 3MDUA 3ITCA 4I6VA 7XIMA 2WSRA 4MNDA 2OSXA 4M1BA 4FX8A 1MQRA 3MA8A 3N2CA 3TE9A 1PHQA 3MPGA 2D2HA 2DFAA 1UBSA 4OE7A 1IR1A 3TROA 2GGGA 2QJNA 4XZWA 2YL7A 5AY7A 1KV5A 2AGTA 2H7BA 3SCQA 3TZNA 5DQZA 5FSDC 5IXEA 3CAWA 1F7BA 3FY1A 5B1AC 2WSYA 3UU0A 3OYZA 3T4WA 3NEHA 3DX5A 3PM6A 2RD9A 3F2BA 3GIPA 4GISA 4K37A 4L80A 3WF0A 1JFXA 2BY3A 3ZR5A 3FYOA 1GVEA 3OVGA 4W93A 3PS7A 1PTGA 2OWXA 4MKNA 3S9IA 1W3IA 1VPQA 3WAQA 3W01A 3KBMA 2GVEA 2I5IA 2FDSA 3ABKC 1JRCA 3CIWA 3HGJA 2W67A 2JGYA 3PR2A 1Q66A 2J8FA 1HW1A 3SUWA 1KCXA 1CW2A 3GTNA 3PZTA 3UXDA 3M0IA 4I7UA 4HNVA 4LB4A 1HNYA 2XN0A 3EKZA 5JIPA 1XLLA 4ER9A 2WQDA 4CS7A 3WF1A 4RE0A 1KCKA 3EZHA 2KZHA 1ZB5A 3UWZA 4PTNA 2FGLA 2L6GA 1VFOA 3WUGA 1SR0A 4B5NA 1THFD 1VK5A 2CHRA 3DYPA 2C1HA 2E1WA 4PSRA 5IFTA 2CLHA 3N73A 4O1DA 1FCQA 3JYYA 1PO9A 4E7SA 2WMFA 3SQLA 2YL0A 1YA7O 4H9MA 3IJ6A 3VDBA 4PTDA 1NQ6A 4UZUA 3UGRA 1GKRA 1S3HA 2J7GA 5K0IA 1UHVA 3E9AA 2P53A 5G2WA 3O07A 2FB3A 2XUCA 3DYMA 3WQDA 2X0SA 3EWDA 1ZJHA 4ES4A 4N6CA 1T96A 1XFCA 2VELA 3MUCA 2IKGA 4YWQA 2AKZA 3VF0A 4O8AA 2FPYA 4I7WA 2QIIA 3AIQA 3LXBA 3ZWIA 2AMGA 3PVFA 3TC6A 4RXFA 4JCMA 3W7CA 3F2DA 4IFRA 3HA1A 4KRZA 2R8WA 3P81A 2WVQA 3BTNA 2EIKC 2Y5EA 3NL5A 3QEZA 4UOQA 3EAUA 3NJ3A 2TYSA 1BYCA 3WX7A 5I5RA 4W86A 1T7LA 3HV8A 4IAOA 3PBYA 1VYIA 1DTNA 2ZWYA 4CNOA 2R25A 3DOPA 4O7GA 2PB1A 1GQIA 2J27A 2WCGA 1RK5A 1QI0A 1JNEA 1RPKA 2CXEA 3ZJ6A 1R5YA 3S5SA 2R7OA 1F5ZA 4TX8A 2REQB 1BRLB 3OLGA 4WQ6A 4I6KA 2VFHA 1QLEC 3CEPA 1FP8A 3MBFA 1OX4B 5T1DB 4LU0A 4I44A 1OF8A 2PDLA 1KFEA 2M64A 1Z6AA 2DV0A 3WQVA 2GSEA 1XBVA 1IEQA 1B3YA 4IICA 1QI5A 1TE1A 1WCGA 4OIRF 4CS8A 2PU1A 3GVWA 4C7FA 4MGGA 1WDWA 4PODA 3SNHA 1Q6RA 3RF3A 4LUSB 1AJ0A 1JZ4A 4AY7A 1WN0A 3WDJA 3USBA 5DLCA 1NDZA 4EIVA 1OB0A 3J7HA 3W07A 1TQGA 2A2IA 3SY8A 5KZ6A 4JOMA 4N0RA 1EF3A 3ATYA 1ME9A 5EK0A 3P62A 3CUHA 5EU9A 4OV4A 3WL0A 2PGWA 2VMFA 4PMVA 4EP8C 2GPTA 4EHPA 2CKSA 3B06A 1UD8A 5ABTA 2HSQA 2ZKMX 2VR4A 2HS5A 3W53A 2V30A 3H4WA 2OKOA 3ZSTA 1H1ZA 2HPIA 3BGAA 3H12A 1LBFA 3AGTA 2DW6A 2QXWA 3FXGA 4DWSC 1B4KA 1UMYA 4B92A 3O15A 3ANVA 2ZUUA 1KWKA 1GHSA 4ZQPA 2DGJA 5L0FA 1JPIA 1KR0A 2KSFA 1P7TB 1E73M 4PL2A 2LSEA 1ESWA 1WAUA 2HS8A 4U2ZA 1YKWA 4C6DA 3PZUA 7REQB 1F9CA 4L4PA 4A4AA 1YA9A 2XM0A 1HP5A 2DVUA 1MW3A 3KUMA 1Q8JA 3OA3A 1XYLA 4Y9MA 3FAPB 5C9UA 4PTVA 3AIVA 1IHIA 3DDMA 3HN3A 1XIEA 4N9EA 4UMBA 1ISVA 4QLLA 1KGWA 2HXUA 1K4GA 4KEUA 1TWIA 1VFLA 3N29A 4NJIA 2EAWA 2C7FA 1E6PA 4C1KA 4KQNA 2ABAA 4HK6A 1W1PA 2J7PA 2ZRZA 3ARPA 1RQBA 4OUEA 1KM1A 3EJNA 1KCZA 5D04C 3B9NA 1VFSA 1GOKA 1TTQA 4GPNA 4ICMA 3NQEA 2Z28A 1R3YA 1HL8A 3K1GA 1BD0A 3K5XA 4R3UA 1KTCA 2YW4A 3V1PA 5LXXA 3IGUA 4CD6A 3Q7LA 2X51A 4WJEA 3B0XA 3I5PA 2C91A 1OKKA 4UTHA 1M04A 3L5AA 4RK8A 4N6FA 1TWZA 4IT1A 2R7VA 3V5OA 4P61A 5TAOA 5KYWB 1XWYA 1T40A 1EIBA 1LOLA 3U4FA 3IJ9A 4DB7A 1QHZA 2O9RA 2WMIA 1Q2RA 2FTWA 1H61A 2CLKA 1W3TA 4BFAA 4PN2A 1WZKA 2DPEA 2PMQA 3WBEA 1NP2A 1OG0A 3EXSA 3C63A 3JSZA 1QZXA 5CXPA 3AQUA 3USZA 3WLKX 3ABMC 3WQGA 3GTXA 2QCDA 4E2DA 3B29A 4N02A 3H2VA 4WIWA 4K8EA 4AZCA 4LV4A 1BG4A 3DFSA 4L7ZA 1RR2A 3OIXA 3OGVA 3DH7A 4JX6A 2FH6A 3M1ZA 4BJTA 2INEA 1L2QA 4G1NA 1EFZA 3Q6MA 3L2MA 3PFMA 2WCSA 1TPWA 2GSJA 3EH1A 5C9RA 3R5EA 4LF2A 4O28A 2AU5A 4QE5A 3RLHA 2E6AA 4NRRA 4AZHA 3CUGA 4NRSA 4AY8A 3QQ0A 3TMQA 3RYLA 1BHGA 1A50A 1PZ1A 4AX2A 1UA7A 4DAFA 1VYKA 3ZIBA 1PIFA 3LK6A 2XLVA 5D9NA 3VOHA 4KT2A 2QS8A 3WDIA 3VGFA 1NDWA 4ORIA 3L5LA 1MYRA 1WKDA 4TXEA 3UR8A 3RPDA 4PBFA 3QR3A 4O50A 2CCRA 5DXYA 2BG5A 4HYWA 3W6LA 1VKFA 2QF7A 3MWAA 4YNGA 4PSPA 3ZDLA 3DZAA 4NY2A 4S3BA 4CU8A 5A8OA 3CTTA 3GU2A 3HG4A 3VGEA 4KMQA 4QS6A 2H6RA 3HU7A 3I7RA 1TB3A 3RH3A 1FTSA 3FA5A 4G7EB 2B7OA 4ZSTA 4US5A 2TSYA 4I9JA 2WKLA 3RXZA 3AG1C 3ARZA 3M5ZA 5CZ0A 1MMDA 1OC5A 4MB5A 5I3KA 3MHGA 1H9TA 4O0QA 4CJOA 3ENLA 4U9DA 4OJYA 1U5HA 4PMNA 3LG3A 3TTYA 1H49A 3JVAA 5FJRA 4XG1A 1K8CA 1OCRC 4JPGA 3UF9A 3ZSUA 4Z9JA 2HDJA 3CBWA 3AI0A 3LM3A 2UY3A 5FACA 3VNDA 4KRTA 2Y7DA 3WODF 2QCLA 4DJDD 2HKVA 1H0IA 4NTBA 3P14A 4LB3A 4J1OA 1DE5A 3NGFA 3EOSA 2X2YA 1D3HA 4XX6A 3UMKA 2WZEA 1US0A 5L0DA 2C8NA 3AROA 5CC5A 4IGNA 2A1YA 1CGXA 1OEPA 4DM1A 3DENA 4AL0A 4ZLDA 3G77A 4ZQCA 4JTCB 2Y5JA 1TVPA 2E6DA 1W9DM 3TOLA 1VMAA 1UZHA 2YOCA 1JF5A 1XX1A 4Z1YA 1G9HA 2GGHA 3EDEA 2GVYA 3IRDA 3L8JA 4PB4A 3AMGA 3AC0A 4W85A 4LCQA 4E6MA 5JSLA 4WOQA 3KOFA 1X1OA 3GDRA 3SCPA 1B57A 2I5GA 1MDLA 1MUMA 5KYUA 1NDYA 3GFZA 4YN5A 3W71A 1PZ0A 5TJ5E 1EDQA 1XP3A 4D9PA 1PYFA 2Z15A 2NV1A 1QXLA 4H9UA 3C0QA 3DERA 1C3FA 2XN1A 3KWSA 3NMJA 1QKRA 1A0EA 2A5HA 2R05A 3WQWA 3KE0A 4RZBA 2ZA1A 2XIMA 1Y7VA 4GKTA 3W7HA 5DS4A 4C3EA 4JCZA 2F38A 1PKYA 3KTSA 4JQ3A 2D73A 2JE8A 2RH9A 1C9WA 3PZVA 4B3KA 1XM3A 3DZ1A 1H1YA 3SUVA 1U89A 4MQ9F 4US6A 2OT1A 3CYJA 3VDCA 1G8XA 4NZ5A 3LRLA 4MWAC 1TV7A 4WDUA 3WDPP 1EJ7L 3BICA 4JEJA 1SJDA 2NT0A 4NAFA 1OCBA 1PBGA 1KRCC 4H41A 3IACA 2GDVA 2ZA2A 3ORWA 3AWOA 1EA8A 3G3MA 4S2BA 1EA9C 1BZ4A 5CPSA 1UYQA 1FHVA 2EIJC 1JCXA 3V0SA 4OBTA 4H01A 4RCXA 4UB9A 1HO4A 4C6OA 1FWDC 4H8VA 4GUIA 1A4MA 5I24A 2Y70A 4XBKA 1TKKA 3RM4A 2NX1A 4UR8A 3HGOA 4I8DA 4Z2GA 3GD6A 3MI2A 4ULWA 2I9UA 3Q4DA 1BLIA 1OXKA 3TQKA 3RJXA 1REQA 1TMLA 4CSAC 3GE7A 2WVVA 4JTRA 1LYXA 1H5YA 4M1RA 1QOQA 3STGA 4PMUA 4JTKA 4ORMA 2EGZA 3LXAA 1EC8A 2YXXA 1EX1A 5LYRA 1R9YA 4QI2A 4HMNA 1JG9A 3APTA 4H83A 3TZFA 1JPHA 3OYXA 2YDQA 3S46A 1AW1A 4ECLA 1Z69A 5LA0A 2OCZA 4CS9A 4AF0A 4CNTA 4FI4A 1E4NA 2OTDA 2Z7GA 3BZJA 4MTGA 4AVNA 2WJDA 3G1HA 5FF4A 3S1GA 1V0MA 2OFJA 7TAAA 5KETA 4D6EA 3OG3A 2QMKA 1LJYA 1QPUA 1SJBA 3NM1A 2GA0A 3OZPA 2HE5A 6REQA 1ELSA 3WMCA 3GODA 3O3RA 4LBRA 3R7MA 3H24A 4YPJA 4I9AA 1WOBA 4UFLA 4MVMA 1J8VA 2Z1XA 2VQUA 1GPWA 3GHUA 2Y7EA 4PMXA 4CD7A 1M56C 1X39A 1UKSA 3WJYA 3BLEA 3L4ZA 3I10A 1FWFC 4YCPA 4AE4A 4IL2A 2DI3A 1SYQA 2D5RB 1PIGA 3PTMA 3NG1A 2R02A 1O95A 1UUMA 1O5HA 4S38A 4E4UA 2P6VA 3H2FA 1AA1B 4O53A 1DOVA 1P0BA 4MB3A 4KCTA 3SCRA 3THDA 1QATA 4GBUA 3IAQA 2VEMA 2Z1BA 4PFMA 1E6QM 3VOJA 1JZ7A 2XM2A 2FZ9A 3ALFA 1F76A 3EGDB 4P8WA 4MJ2A 3TA9A 3UGPA 4JN8A 2JQXA 4BR1A 1E1EA 4LS0A 1V3JA 4QHRA 2P0IA 1DHPA 3WDHA 1BF6A 2E25A 2W61A 2QV5A 1TMQA 1EZWA 3G1DA 5BMWA 2JIWA 1BYAA 4MMWA 4MVRA 2IXOA 1UR9A 3EMQA 5D38A 3B9AA 4Q22A 1R3VA 3MX3A 2X2GA 3NUKA 4K2SA 2KJGA 1I0DA 2J9ZA 2UY2A 4LDRA 4HIBA 1NF7A 5L3VA 3UFYA 3OEXA 4OQVA 2XLWA 4C6LA 4ZXLA 4CIPA 2PDCA 5CEWA 3F2CA 2YQYA 4DRIB 3D5HA 3S42A 2F6UA 3W7DA 1GUVA 1V6TA 3MVTA 2MWQA 1TX2A 5C55A 4NKCA 3N34A 2CYDA 3EWCA 4P8XA 1L7CA 1ORSC 3G22A 3RR1A 4URIA 4NP7A 4A05A 4AH7A 4S3KA 1GG1A 1XYAA 3RW0A 2EG6A 4CKQA 2IXMA 3FVYA 2R91A 3A4XA 3VINA 1GQNA 1F8IA 2WXDM 4ZOEA 3WQ6A 4XSLA 2NUPA 3AIBA 3SUUA 4KERA 4OIQF 3DXJF 2CU0A 2ZX5A 3VM7A 1KFJA 1YPXA 4W4QA 1YTDA 3U9MA 1RJ9A 4ZE4A 4PTWA 3P2VA 2YB4A 5FIPA 3ANYA 4BI7A 3ARTA 3TONA 2UY4A 3UYCA 5D32A 4J7RA 3P8IA 4JTEA 4K68A 1RV8A 2P76A 3DAQA 2PWUA 3AIEA 2KC3A 3SUSA 3S0XA 1PL9A 2LD6A 3M0JA 4YL2A 4CN1A 5HMEA 4ERIA 4CNSA 1XC6A 1DJXA 5BXSA 3IQ5A 4RJEA 4QXIA 5DY3A 4FAPB 1ZJBA 3CU2A 9XIAA 4IWBA 3A21A 4DJED 3IQ6A 4M82A 2G3IA 4X22A 4IG2A 1NWSA 4EIYA 2KGOA 5A6LA 3ZOAA 1HL2A 4AVFA 2W66A 4S23A 3T8QA 1WO2A 4KEMA 3SCVA 5KYXB 1CENA 1FWGC 2DZAA 2G95A 3BLLA 1EXPA 3ZXWA 2BXYA 3RUBL 3VKDA 2Z2BA 4TX9A 5EMKA 3SXYA 1RJPA 3EFOA 4HK7A 1YZAA 1KBLA 1PUDA 3UXLA 3JRMO 1PDZA 1OD0A 4FXJA 4KWOA 1I2PA 1JIBA 1L0PA 4B15A 3NTYA 1ZJAA 4R5EA 4JTQA 3DYOA 3ZIZA 3G1YA 2NX3A 2XTKA 3CPGA 2KW3C 2J7BA 4F9DA 3QVZA 5IDIA 5M03A 4S3FA 5BRPA 1Q4WA 1CXKA 1H51A 4QR6A 1PKLA 1J4EA 1ZQ5A 4LYRA 3W70A 4KH2A 2PDMA 3W1PA 5F4SA 1AL8A 3JT1A 4L4OA 1YX1A 5AC5A 1JPDX 4CQCA 3M44A 2C03A 2P50A 1ZS2A 4KBXA 2J46A 1DJYA 3B0UX 1A7DA 1K9EA 1ZALA 2ZFAA 3INPA 3MWCA 2C6QA 1BXBA 1JOGA 3DFTA 4WRHA 2O9TA 1T9KA 2Z2UA 2V3CC 2PNOA 4EXBA 1UD4A 1R86A 2Y63A 1JRAA 4HMEA 5F1UA 5CH9A 2XINA 1U1UA 3DI1A 4J28A 3LB0A 5DEZA 3WF2A 1J0ZA 2PP0A 3CZJA 2PDWA 3QKZA 1WKFA 3NPUA 4HHLA 2PUZA 3TN6A 3ZJKA 4QI0A 3HG5A 2WVSA 2A7PA 2XIBA 4E2VA 2YFOA 4NY3A 2DGAA 1TV2A 3ARXA 1QSPA 3S1XA 2A6LA 3M41A 3WLOA 2NQ9A 4J7YA 3CH9A 4DPPA 3GVGA 4EBBA 4K36A 3ZLFA 3OWTA 3KVLA 1M3UA 2RUSA 3U3HA 2BOGX 1JMWA 1K7FA 1WXZA 2BFGA 2D69A 2WZHA 2OYLA 1Q65A 3GWLA 1VS1A 3N2BA 4Q4OA 5LNUA 2QDEA 3HG3A 3OVRA 4UTFA 3W7JA 1HE9A 2W6RA 5D2TA 1DWHM 1IXOA 1V0KA 2EPKX 1F05A 3QC0A 2EHHA 2FGZA 4WCJA 2UUHA 5T3TA 2EBNA 2OU6A 3ISIX 1UP3A 5LNWA 1T01A 3VKAA 2CZEA 4TUFA 4NNCA 3NRHA 4GZJA 4ERAA 3IGHX 1XDMA 3OBAA 4FX5A 5COMA 3ONBA 2IQ0A 3W7LA 3NQMA 3PPFA 4H54A 3MHFA 2DIEA 3NOEA 3WNMA 3TJXA 3OJGA 1ZUAX 4AVOA 3SCWA 1NJJA 3NDOA 2VDHA 3NQAA 3PPGA 4AWEA 3Q6NA 5EA9A 1MI3A 4JEAA 4BEJA 4MW3A 3NL3A 3KW3A 3PTKA 1PE1A 4HU0A 1YDIA 5CGQA 4WY0A 4GHRA 4UTIA 3RITA 2XS8A 3G3DA 2TMDA 3AUOA 3AOUA 3ANUA 4U9EA 4PMYA 5CZJA 2BVYA 1P48A 4J9JA 3A5VA 3GYEA 5EPDA 2CDQA 1NWTA 3WQ4A 3R2PA 4QCFA 1FH7A 2PTWA 3W2VA 3NQ6A 3UMHA 4CU7A 1I60A 2PBEA 4DVZA 4AX7A 3NYMA 3CQHA 4JHZA 3UG4A 4GBDA 3UBPC 3LV5A 3UGVA 3ZO9A 3CJPA 3VIOA 1PCWA 3B8TA 3KMIA 2E9LA 2ANUA 3U0CA 3PJWA 4NF7A 3LESA 5E93A 4N9DA 2BBFA 4MDOA 3MUZ1 3GFXA 3K1HA 1AEPA 3LS9A 2GLKA 1T0OA 3OQ8A 4IP7A 1V74B 3GM1A 2CW0F 5L0JA 1XDLA 1YDNA 3E0FA 4QLKA 3R43A 1QPRA 2D2GA 3V18A 1PX4A 8CGTA 1R3TA 4MNLA 5HSWA 3UGOA 2PS2A 1SUXA 1ISZA 5ABFA 1SZEA 2NQLA 5HNUA 1K70A 1Z48A 5CPLA 3QOMA 4BQ4A 1LZOA 3IANA 2WHKA 3C61A 5C2CA 1XYCA 3H2CA 2Z29A 1BR1A 3ZJ7A 4OOZA 1Q7ZA 3WBXA 1CPUA 4GUJA 1RVKA 4HEAJ 4YLWA 5A2BA 4N4WA 4GXMA 1TQJA 4U5BE 1NH6A 2ACRA 4CQ9A 5DS5A 3DHPA 4WGZA 1XF0A 1EC9A 1W9PA 4M6PA 3BSHA 3BVJA 3W72A 3SIZA 1L9WA 3ZLHA 3FKKA 2RDUA 2ZPAA 1OR3A 2V3DA 2ZXWC 3VD4A 2INFA 2QKFA 3DFNA 4A3QA 1C90A 3U8VA 2C1IA 4I1MA 1H60A 1RHCA 2FIQA 3W7OA 1FWNA 2BC5A 3KS6A 1NBBA 4BQ3A 2J78A 4JJFA 1YMYA 4LALA 3WKZA 2XISA 3GG7A 1E0WA 1YYJA 4DM2A 3LQGA 2LK4A 3H65A 1OFOA 2QPXA 1Q6EA 4EUKB 5XIMA 4U5FE 2RGLA 1NWUA 3KOYA 3F46A 3PK7A 5FJTA 5G4WA 4F2TA 1ZP3A 3LPOA 2YLLA 2I16A 3AS0A 4IIFA 1WDQA 3FJNA 4M51A 3GDTA 4BQ5A 5E33A 4KF1A 2R1NA 5G1TA 2WMJA 3NZ1A 2WB5A 2PLCA 1A5LC 3WO8A 3K1IA 1E3XA 2CZFA 4ZTYA 4L9YA 3EB3A 1H1NA 1QNQA 2DZWA 2HBVA 1ADDA 3MT1A 2YFNA 2FFCA 1EQPA 1F3WA 4NTFA 2VEFA 2D24A 4LF1A 5B3IA 2Q00A 3RQEA 1XIBA 3EPNA 2OQMA 3N9SA 2QHAA 4YS1A 2TAAA 2M4EA 1NM9A 1N8IA 3E6EA 3WG7C 4D6HA 3MMTA 4GX8A 3AHYA 1R9XA 4XZIA 4AHPA 3BLDA 4XBJA 5GVJA 3FVDA 4CDVA 4QIUA 3VD9A 1Q0FA 1KXTA 3PBWA 5L0HA 1MQVA 5IRPA 4Q4KA 2HSBA 4KW2A 4DF1A 3O6AA 1QVXA 1L3PA 2PX3A 1UW9A 2XH0A 3F5JA 3Q94A 2E4TA 1GOOA 4CD4A 4C6BA 2DZVA 3NQDA 2OEXA 3SGGA 4AWSA 4FAMA 1V4YA 3GAYA 4GH3A 5CIVA 5DCBA 3ARYA 5F4XA 1QOXA 3GRIA 3L0KA 4UTMA 4AMAA 3HFYA 4DBQA 4O11A 4MTFA 3KHJA 1JCYA 1X98A 2H8ZA 4TV6A 5MHBA 4W88A 1RA0A 2CW6A 3MYFA 1X8FA 5LNVA 4GY0A 4OD5A 3BAYA 1H7PA 4NZ3A 1LG1A 2JGQA 4PUJA 1Z5ZA 4JYDA 3DFHA 4XPYA 4S39A 4DN1A 3PZQA 1OG6A 1XSKA 1B3OA 4N42A 1VYSX 2X1TA 4AFYA 4WJ8A 4YVPA 3A3HA 3CB8A 2IXNA 1IEVA 1V77A 3TYBA 1IZKA 4C6CA 1KFLA 1V79A 1HW2A 4JN7A 3OEOA 1E85A 3HBLA 2WMGA 2DQWA 1UWAA 2ZZ7A 4Z2LA 2PODA 1E6ZA 4DOZA 2XHYA 4BJ6A 3B8UA 3H7RA 3TN4A 2CKRA 1F61A 3LGEA 3TNOA 4Q6JA 4AISA 1DTUA 4IPJA 4JNYA 3NDBB 3WEZA 3CZKA 4XO6A 5BOFA 4FOUA 1Q13A 5BXRA 4M6QA 4ZO6A 3CEUA 3RLUA 4MB4A 2F22A 4EKWA 2ZX9A 4XPWA 4KWVA 4FSAA 2H7OA 3LRKA 5KITA 2PF8A 3H26A 2BL2A 4JTGA 1D7KA 2G97A 4IIHA 4PB3A 1E72M 2FDMA 3W29A 3WJSA 3BOXA 1A80A 5FL1A 4K1WA 1GKPA 2V3GA 5HUPA 4YL3A 4J3UA 2PWHA 1D0ZA 4X63A 4DVYP 3AS2A 2NV2A 1C8XA 1TV5A 3WLHA 2Y62A 3ABZA 5LIXX 4V27A 2X1SA 3GVVA 2OSYA 3U5SA 4PMRA 2OPJA 1HJVA 2Z24A 4WKAA 3WNOA 2G3KA 5G2HA 1SMAA 1VFHA 4OBSA 2GGJA 2REQA 1BRLA 3GX9A 1HJSA 2FMNA 2WHLA 2VH3A 3MYIA 3MKCA 3X1OA 2JKAA 3A24A 1NOFA 4DJEC 1RUSA 1OX4A 1R8LA 2UBPC 4R85A 4S3JA 3C8GB 5HMFA 3XINA 2ZE3A 3ZVHB 1TR1A 5TF0A 2Y1HA 2R7UA 1LROA 1S2CA 2AL2B 4J3XA 1QK2A 3VIJA 4M6UA 1EO7A 1VIZA 3EX1A 4CBEA 2EPLX 5DANA 1KQZA 2YJQA 4UFIA 4DO5A 3C5QA 5KZDA 3H21A 3RAOA 3TDFA 4L56A 4LUSA 1CGYA 3LN3A 3E0LA 1NLXA 3Q45A 2DZPA 3WJXA 3W2WA 1UB3A 4O18A 3S9YA 3C3NA 3D0CA 4GYJA 4U5KA 5HINA 5HQEA 1UASA 3VK5A 2ZXOA 3B4YA 1OK6A 1G5AA 4BHYA 3J06A 4GUGA 4MPKA 1CXEA 3EWBX 1H63A 1MEWA 2VC9A 2R7SA 1UR3M 2P10A 3U7BA 1JDFA 1QO2A 4QSFA 2YIHA 3TEVA 1J11A 4M80A 3T0DA 4GQGA 2EJAA 3V36A 1E70M 1ICPA 2EPOA 3GH4A 3FV9A 5FL0A 3C3UA 2YRFA 1VFMA 1GCYA 1IXNA 1YQ2A 2Y89A 3N12A 1AZ1A 2FZDA 1LM1A 1QNOA 3M43A 3N0TA 5LA2A 3UD6A 3W8HA 1DJIA 4JQ1A 1XW8A 3TTQA 2O9PA 3U2CA 2QT3A 2P7VA 1WBHA 1P7TA 4GZIA 1LBLA 1GG0A 7REQA 4YL1A 2L9JA 4C6JA 1QBAA 2VX6A 5C71A 3R25A 4HNCA 3K7DA 3SSJA 3I65A 5F2GA 1A0DA 3L4TA 2OEVA 2QJMA 3I3BA 4FO4A 3LPPA 4GCAA 3MP5A 3HNKA 3DJNB 3C8GD 2VJXA 3UJEA 1EOMA 3VMOA 3TLLA 2GQ8A 2QJHA 1JYVA 4UQEA 1XFBA 4PCSA 3C8NA 3BG3A 3ABLC 3VAVA 1B0IA 4RNHA 1TV4A 3EHMA 2PWEA 3GY1A 3IEEA 3M0ZA 4IJRA 3POVA 3HQ1A 1CIUA 1Q6DA 3S5NA 3MP3A 4YT2A 4NTAA 3FHDA 1CWYA 3ARWA 1RBAA 4PBGA 3JCUQ 4JX5A 2YLIA 2VZOA 3EX6A 5KYWA 2CGEA 4FPSA 3UNDA 1Q0DA 4LVDA 2A3CA 3IIXA 1GVIA 3B8WA 4J7TA 3ZT7A 3AYRA 1UKOA 2CZVA 3MANA 4E2BA 1RY0A 1AW5A 3QR0A 3VDAA 5EGYA 4PK4A 2ZA3A 3U3FA 3RK8A 1XISA 2GFTA 3MKVA 4GVFA 3U2OA 4E8DA 4DJDA 1XCXA 4PJJA 1LIHA 1XSJA 4MS2A 5JUAA 1YYXA 1MZHA 4DX3A 2NXGA 1AD1A 4K8HA 4XKYB 4YTQA 1XLEA 2CETA 3NVDA 1X1ZA 3FJ4A 1GQJA 3RF9A 2WANA 2WK2A 3WLSA 4PUUA 4B4FA 3LZ3A 3T40A 1RLDA 3A5FA 1GZ1A 4AW7A 2NVDA 4GFSA 1LG2A 2Q9CA 3LTPA 1O1ZA 1H7RA 4K1OA 4W8LA 4RZ5A 1UR0A 4R33A 2ACSA 3T9OA 4ONSA 3HM7A 1OCZC 3OW1A 4R7JA 3GIQA 4AL1A 1HO1A 1E1FA 4PZVA 3QR1A 3DFQA 4IRUA 1ZHAA 5J5DA 3Q58A 4PCTA 2CLIA 3PAJA 1TPH1 3B0YA 2W4MA 1J6PA 3V0TA 1TG7A 2A6EF 4HYVA 3STFA 1VHNA 2E6YA 2XL6A 4QE4A 3M0VA 1V08A 2JBMA 2XM1A 2RJGA 3T78A 1XKJA 2J77A 3PZIA 3T6JA 1I6NA 3P84A 3SZ8A 3VD7A 1MUWA 4G7EA 3VNMA 3UCQA 4QAWA 5L9FA 1RH9A 1V3IA 1E86A 3E02A 4C5ZA 1S5TA 4JFTA 3U7VA 3VNYA 3DHUA 3DBPA 3AYVA 4EANA 2CLFA 2ZUNA 1LLZA 4ENLA 1B5TA 3GSMA 1J18A 4JC7A 3L5MA 2PTXA 3NXFA 3P5YA 1OADA 1US3A 3WFLA 2XIIA 5M2FX 3R58A 5DQTA 3Q65A 5HMDA 3GDMA 1N2VA 3MKKA 4UTUA 4IQDA 4E0IA 1UUQA 2VT0A 1A3WA 1F74A 3CXOA 2KAUC 5D92A 2B0JA 3GVQA 4GGBA 2YB1A 4MVAA 3PBGA 5FJIA 5IHRA 3MUAA 1J8YF 3W82A 2WPGA 3WH5A 5LIWX 3TU9A 2NG1A 4MFEA 4GZEA 5T91A 3FDQA 4KNWA 4LW7A 4JZAA 2EEXA 2DUXA 1D8WA 3PN8A 1V6WA 3OVQA 2A3LA 1WA3A 1TPEA 3W1QA 3T2QA 2WVNA 1V3KA 2WZTA 2V82A 4CU6A 1S7ZA 3NYJA 1WQ5A 4XWUA 3NSMA 2Y7FA 4UDVA 3HZ3A 2CZDA 2SFPA 5CJMA 5IDZA 4LACB 4E38A 2J9VA 3SXZA 3GC4A 3BRJA 4JX4A 3V5ZA 3AHVA 2PZNA 1CTNA 1F3EA 2WJZA 1U22A 3IUHA 5B3SC 1J0YA 1GZGA 1TWAA 4PR9A 2IQDA 1MO0A 4QCEA 2BHZA 1KA9F 1BR2A 1ODUA 5CC3A 1I1WA 5CLTA 1JFHA 3DWWA 4L1GA 4M8UA 3AYSA 4JFSA 2VWTA 4Q8PA 2OB3A 4BJ5A 4GI6A 3CIXA 4PJLA 1PWMA 2VD8A 1JGMA 2XWEA 3GS6A 3VIPA 6CGTA