3B0VC

Trna-dihydrouridine synthase from thermus thermophilus in complex with trna
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
315
structure length
315
Chain Sequence
MLDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALLALSTKANREIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLMEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/rna
molecule keywords tRNA
publication title Molecular basis of dihydrouridine formation on tRNA
pubmed doi rcsb
source organism Thermus thermophilus
total genus 108
structure length 315
sequence length 315
chains with identical sequence D
ec nomenclature ec 1.3.1.91: tRNA-dihydrouridine(20) synthase (NAD(P)(+)).
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01207 Dus Dihydrouridine synthase (Dus)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3b0vC02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3b0vC01
3HGSA 5F1VA 5DELA 3NPWA 1FCBA 2Z6JA 1B4KA 5LNVA 4NNCA 3MJYA 3MW7A 5DY3A 3SSJA 3NQ7A 3QZEA 1A53A 1A5BA 2H8XA 3LHZA 4QIUA 1FXQA 1W8SA 2OT0A 2NWSA 1DJQA 3BVJA 1MO0A 2WSRA 3W6YA 2C14A 2QKFA 1Q45A 3S1XA 4EOUA 5AYXA 3LLFA 4IX0A 1W5QA 3NQ2A 4O52A 2WOQA 3SFKA 1H51A 4MOZA 2TYSA 2B7QA 3W22A 3CC1A 3N3MA 4WXYA 2A6LA 4X2RA 2PURA 4M5PA 3TMQA 3YPIA 2C16A 1I45A 1PHWA 4AH7A 2XN2A 3CB8A 2QAFA 1MZHA 1HO4A 3NPXA 1FWWA 4K38A 4K8EA 1UASA 5HUPA 2YGYA 5G2HA 3C0JA 4DBEA 2H90A 3E9AA 4PA8A 3NPUA 1AW5A 3CIWA 4ORMA 4YCPA 2A85A 3M5YA 3HF3A 4R53A 4ALDA 1G67A 3KHJA 3WJYA 5LHFA 3NNTA 4OU1A 1F76A 1IF2A 1L6SA 4XUGA 4OGZA 2CZ5A 1SO5A 1N7KA 3G3MA 4WY0B 4HNUA 3DFPA 1R46A 2D73A 4JDBA 4RZ6A 3TSBA 2EAWA 3L68A 1L6YA 4G1KA 1THFD 4FNSA 4EVZA 2A21A 1GEQA 3NQ6A 3L0GA 2E5BA 2WQPA 3ABSA 2YCEA 1XI3A 4JTHA 2W6RA 3RFAA 2WKJA 1JRCA 4N9CA 3W84A 3GK0A 1DHPA 1XL9A 3LTSA 4WY0A 4S1FA 3TMLA 5DN1A 4GUJA 3BO9A 3R89A 4X3ZA 4KFPA 3VE9A 3GAYA 4DBDA 2IQTA 3USBA 4NVTA 4Z1DA 4JTGA 2Y70A 3VI2A 3CTLA 2PRMA 3AO0A 4IUOA 1JR1A 1VCGA 2CZFA 3MHGA 4A2RA 1GYLA 2OMAA 1KM0A 1W5MA 3DZ1A 3I6RA 1F74A 1DQXA 4JTEA 1SFJA 1LROA 1RQHA 3NAVA 2B0MA 3EX3A 4MY8A 4O53A 2A7PA 1YXYA 4U28A 3P80A 5AHNA 1JCNA 4NXSA 4XBKA 4ORIA 1LP6A 2ZTJA 4R34A 4HPXA 3NM3A 3OEXA 2E6DA 2JBMA 5DCBA 1OX4B 4AB4A 1ZCOA 1ZNNA 4YCOA 2VOMA 1P0KA 3EWUA 3IVTA 1W3NA 2RDWA 5HNRA 3HPXA 3T4CA 2V30A 4M19A 4TIMA 1VCFA 4CQ9A 4DPQA 1F73A 1TRIA 1YTEA 1A5AA 3PS7A 4UTTA 1FX6A 1HG3A 2CLFA 1GZGA 3QW4B 1VYSX 3UWUA 4DF0A 1OX4A 1JUBA 2RHGA 4FF7A 3LV5A 1K3UA 3EWBX 5KZDA 4MZ8A 2C15A 2Z1BA 1TJRA 4IWWA 1DV7A 3NQFA 3SGZA 5AC7A 1OYAA 3TROA 3O07A 4XTIA 2ZZ1A 1J4EA 2QCLA 1K8XA 3PY2A 1O4UA 3GIYA 3TXZA 4JD4A 1K02A 5GVJA 1L2UA 3VNDA 3MP3A 1EB3A 3ATZA 1OF6A 3KRZA 3M7WA 4ICNA 4IPJA 1F05A 3E12A 4TX9A 5D2WA 1ML1A 4FXSA 1C9DA 3A23A 3Q94A 4JY8A 3N19B 4NX0A 2H6RA 1B4EA 3W7OA 1QCWA 3QF0A 3W2NA 3DGRA 5J5DA 3W7IA 5D33A 5EL1A 1SSDA 3PG8A 3A22A 4TMBA 5IM51 3FLUA 3N14A 2ZZ7A 4TU1A 4FNQA 4XQ6A 1T99A 1VC4A 2WNQA 2DZUA 1Q6RA 3HQ1A 3W7EA 1XCFA 5T26A 4JTTA 2NX9A 1O95A 1XUUA 3HGRA 2Y7EA 3S5NA 2FB2A 4IJBA 4CCDA 3GX9A 4HT3A 2XN0A 3PWAA 4XWUA 5DCDA 1JCLA 4JN6A 1FCUA 1XBXA 2FPYA 3N34A 1PHQA 4X9SA 2PRHA 2O7SA 5HULA 1F5ZA 1LCOA 3GDTA 4JYEA 1M5WA 5F2LA 4YWIA 3P8IA 4RX0A 2ZZ6A 1FUYA 3RF9A 1PL9A 2Y7GA 3PR2A 4ZZ9A 4QSHA 1AW2A 1W5OA 3KRUA 2B4GA 3M9YA 4MJZA 3B0PA 4I7WA 1WV2A 2NLIA 1VRDA 4P2VA 3IGSA 3G24A 1JQVA 1LYXA 5DLCA 3WJZA 3R13A 3W7KA 1FDZA 7TIMA 2PCQA 4LW7A 1KTNA 2RFGA 3L5AA 5L6UA 3UZJA 3UWQA 5D09A 3TSDA 2OCZA 2GQ8A 3L21A 3GNDA 2WO5A 4JYFA 1L9WA 1QPNA 4UTMA 1YTDA 3DKJA 1PS9A 3P5ZA 3O6CA 1IGSA 4DO4A 4WD0A 2BXVA 4GE8A 3GB6A 1XC4A 5AYZA 3QMRA 3P84A 3R2GA 4LNYA 2Z0IA 3GDRA 3U2OA 3M5ZA 3M5VA 3GXTA 1ICSA 2ISWA 1OK6A 1TV7A 1QOPA 3MP4A 4IX2A 4PFMA 3Q58A 4UMAA 3PUDA 1HUVA 2G97A 5G2WA 1O60A 1PV8A 2GVJA 5I3FA 3ZFHA 4AEOA 3PVFA 4HNVA 2CLHA 1TPEA 3LXBA 4EF8A 4PH6A 3MWAA 1CI1A 4O12A 1U83A 3B4UA 4UFMA 2ZZ2A 1H61A 2V9DA 4YL2A 5D2XA 3O1NA 4YMZA 3EX1A 5DXYA 1SZFA 1O94A 3QPYA 4HIBA 5HR7A 1QPOA 2A6NA 3W2MA 5IBXC 2HMCA 4GXMA 1W5PA 3UPBA 1S5WA 2J9ZA 5FF3A 1JVNA 3EB2A 3M16A 4O4VA 2OT1A 3B06A 3HO8A 4ADSA 3LTYA 5HWNA 1CW2A 3PB2A 4JX5A 3MO7A 3HG4A 1IXQA 1H7WA 2OZ0A 2FB3A 2VFHA 4RXFA 3S5ZA 5BRBA 3BW2A 4W9TA 1SO4A 3NQDA 4CQAA 4M6QA 1M7PA 5CZJA 4QAIA 2FDSA 4BWLA 4O11A 1G7VA 3U6WA 4ZQRA 1TO3A 5F2MA 4CNNA 1AMKA 3FJ6A 3OVPA 4JX4A 3QJAA 2ISSA 4GWEA 4QNWA 5CG7A 4AHPA 3NQ8A 4OWGA 2X1TA 3TUUA 3MBDA 1DQWA 4ZQMA 1GVQA 3FYOA 4Q4KA 4HPJA 1H5YA 3P74A 5FF4A 1QPRA 5DY2A 4FNUA 3WK2A 4S2BA 3LGEA 3TAOA 4MY9A 8TIMA 4NUWA 3NVTA 1YDVA 2QDGA 1TQJA 2YYTA 4WXZA 3DAQA 4JGDA 2CFFA 3W2LA 2V0TA 3G0UA 5CSRA 2YZRA 3C4UA 1G4PA 2GQAA 3EKZA 2ATMA 1ZAIA 3C2EA 3TC6A 3IVUA 2NV2A 1RZMA 3QMTA 3QRHA 3O15A 1RD5A 3BG9A 4JX6A 3P62A 5K9DA 3DKLA 3T40A 2P0OA 5AC8A 1X8FA 3M5XA 4UFKA 3BG5A 5A5WA 5FEZA 3OIXA 2HTMA 1Q6QA 1K7XA 4FX8A 4LT9A 1WDWA 4UTWA 2CW6A 3DFQA 3LCFA 3NZ1A 3GDMA 3MUXA 4JXCA 3DXIA 1GVOA 3CM4A 4YLWA 4JTIA 3WJSA 4DELA 3LCXA 1OG0A 3NM1A 5HR6A 6ALDA 5SWUA 3V75A 1K8YA 4UFLA 2EGZA 4NJHA 3GXNA 4LU0A 4Y90A 4KFNA 1UUOA 5FEPA 3C2VA 3ELFA 1JULA 4JDYA 2TMDA 1N55A 1EWDA 1EP1A 2A7NA 2J9YA 1SSGA 3NO5A 3LRLA 2X30A 1GJPA 3NQVA 4IMGA 4K36A 2TPSA 3TKFA 1G7UA 5KSWA 1OYCA 1BTMA 3H54A 4ADTA 3NQGA 1LRQA 2DP3A 3TW6A 3IIPA 4NJIA 4JTJA 1KLYA 2Y6ZA 3DHDA 5KTLA 3BV4A 3PBUA 4Y9AA 1O5XA 3G1VA 2RH9A 4O4WA 3W7PA 2A7RA 2W79A 2FPVA 2UV8G 3M1ZA 3S0CA 3MHFA 4RCXA 3MI6A 4YXGA 2E77A 3E49A 2NX1A 5KITA 3S9YA 3THQA 1UBSA 1RQBA 1VPXA 2YDAA 3W1PA 3NL2A 1H1ZA 1QMLA 2V81A 3OHIA 3V1PA 3OVRA 5CZTA 3SGUA 3ABRA 3Q2DA 3W7JA 5G5IA 3TX9A 4NT0A 3SECA 5I3IA 1K7FA 2FJKA 4K39A 3W88A 1OFQA 4D2JA 3B03A 4EWND 1H60A 1VCVA 5G2IA 5C54A 1OFEA 3TIMA 1TIMA 3PM6A 4LTSA 3FKKA 1SO3A 5FEWA 4UR8A 3G1FA 2DZSA 1TTQA 2DZPA 2DZWA 3PAJA 3PSWA 4AWSA 4UTUA 4PCFA 3TR2A 3W71A 3W7NA 4DEFA 3CEPA 2ZA2A 1K7EA 4O17A 1S5TA 1UJPA 2QCFA 2Y85A 4O57A 3IVSA 1J2WA 4JTLA 2NUWA 2Y7DA 4QITA 2E6FA 1PIIA 1P4CA 3G1SA 3TC7A 3UNDA 4CCCA 1I2RA 1KM1A 2V2HA 3FS2A 3QEZA 4K6AA 3L5MA 3LV6A 2CLKA 1FDJA 4RZ4A 3W1QA 2VFFA 4LV4A 3TE9A 1TPFA 1A5CA 3B05A 4MLRA 1QPQA 4MFEA 3WK3A 2TRSA 3JR2A 4ZQOA 3DFTA 3N2XA 4TO8A 3S1VA 5BW6A 5KZEA 1TMHA 4FB7A 2TSYA 1V7YA 3W85A 4L4MA 1XBYA 4E0CA 3G1DA 2X1SA 5K7JA 5D2TA 3F03K 2G5WA 3LLDA 1FWRA 3IRDA 4HKPA 3NZRA 5E93A 3S1WA 1HO1A 1TCDA 2I1OA 1TPVA 4OQVA 2LLEA 4N9BA 2VEKA 3GZ3A 1ICQA 3BW4A 1ZJIA 3L65A 1I2PA 4HHPA 3FOKA 3EXTA 1BWLA 3BK0A 3I7RA 4ADUA 3NXFA 2AQWA 4JIPA 1NFBA 1GTEA 3IGUA 1U5JA 2J9XA 2X1UA 5K4ZA 4N02A 3NQCA 4DQWA 5BMWA 1P1XA 4LRTA 3C8FA 5IBXA 1LZOA 2V5LA 4NZFA 3W1RA 4HNTA 3LHVA 3BARA 4UTHA 5EMUA 1OF8A 5CPNA 3UY8A 2OX1A 3IIZA 3A21A 3I7QA 2GQ9A 1H7XA 2QEZA 2ZZ3A 3INPA 2C0AA 2ZRXA 3W23A 4PC8A 1I8JA 3UQNA 2FTPA 3KAOA 2GUUA 1KV8A 3DH7A 4O50A 3CU2A 2JKEA 3STFA 3W07A 4IXXA 3UD6A 4RR4A 2W0UA 1C29A 1ME9A 2PRLA 3WK1A 3QPZA 3C61A 4I7VA 3HGOA 1XDMA 3OBKA 4LVDA 4JNMA 1OFDA 5J5RA 1Z42A 3RK8A 3G8RA 2E5CA 3FKRA 1ZFJA 1WQ5A 4WQ6A 3UWWA 4Z1CA 5AHMA 2CLOA 5G4EA 3SY5A 3STEA 1KM5A 4NNBA 3W7RA 1KA9F 3QQ1A 4O10A 3EWWA 2PE4A 1B3OA 1VHCA 5I3GA 1KBIA 1OVDA 3S42A 3E02A 3W1LA 1EIXA 2YPIA 5H91A 3PG9A 3CIXA 3IV3A 3O8AA 1ZHAA 3MI3A 1TJPA 1TREA 2FLIA 1AK5A 3P7YA 4MJMA 4AVFA 3TJLA 2WJZA 1BWKA 2JGQA 3HB9A 3W2UA 3WJWA 3LHUA 5FEXA 5BOOA 1E51A 1XKYA 1QR7A 3LDVA 4JIQA 1T8XA 5G4WA 1ME7A 3W2JA 3LERA 4GUFA 3CHVA 3W75A 1FCQA 3M41A 3CWOX 1TTPA 4O13A 5C2XA 4UXDA 5HQEA 4GRSA 4IGHA 1EA0A 3W7GA 4I7UA 5AFDA 2CLLA 3W7MA 1R2SA 3FYPA 4WY0F 2VEIA 4LS1A 2ZRUA 1YDOA 5EA9A 1WX0A 2ABBA 3NQMA 5TQLA 3LHWA 1ADOA 5HJLA 3L2IA 4UMCA 1KV5A 1GVFA 1SZNA 1TPC1 1VQTA 1WBHA 3W1NA 3ANYA 4O15A 3VKJA 1LDCA 3HG3A 1UB3A 3FFSA 1Q3NA 1V5XA 3W7DA 2C19A 5D38A 3QW3A 4EF9A 1S3HA 3KOFA 5KZMA 2YFOA 3NPVA 4NQ1A 2Q3OA 4OV9A 3RLUA 1DVJA 2CLEA 4Z0SA 5FF0A 3PULA 4UTLA 1PVNA 4WJEA 4M7TA 2WSYA 1QO2A 3IGXA 5TBOA 1TQXA 3K30A 5F4SA 3W1MA 1KW1A 3ZR4A 3TV8A 4DXVA 4JTKA 4O1DA 3C6CA 1TPB1 3NR0A 4BI6A 1W3TA 2A1YA 3O6YX 3ZWSA 3GVGA 2FQIA 5D2YA 1LRTA 4DO6A 1TPUA 1ZALA 3C3NA 4PL2A 3LRMA 2Q3RA 2C13A 2ZFAA 2ZRZA 1FWTA 1X6UA 5AB3A 2YSWA 3DI1A 1KBJA 2WPBA 1KTCA 1KTBA 1KFKA 2YX0A 3HIJA 4Z08A 3TJXA 3G0SA 1TB3A 1TPWA 3UXAA 3GYEA 5H2ZA 2RDUA 3LBCA 3S5YA 2E5DA 1OX6A 4GBUA 3LXCA 4PEKA 1MEHA 1BEUA 4O1BA 2QCDB 3T55A 4J9JA 1X7FA 4Y96A 2DZVA 3MYOA 5I3KA 2JKPA 2X2GA 4JYDA 3QSTA 1IXNA 2Y63A 1H7OA 2J88A 3P61A 3DENA 3LI1A 4K8HA 5D05A 2QCNA 1R30A 2QCDA 4JTUA 1QFEA 3LHTA 4MY1A 4LC6A 1B9BA 1SFLA 4RK8A 3LTPA 1XXXA 4S2CA 3EXSA 4EIVA 3N73A 1JJKA 4WZHA 2ZRWA 4CLMA 4BR1A 3W3OA 1H63A 2ZA1A 1P5BA 4UFHA 4GUGA 3THAA 2BLEA 3W7QA 2YR1A 1OX5A 1GG0A 1FCVA 2ALDA 4UNKA 1VGAA 3CWNA 1KM2A 1LOSA 4FX6M 2Z2UA 2A4AA 1XUZA 1ICPA 2QDHA 3F4WA 3HJZA 3L66A 4AAJA 3P82A 4U4MA 1T96A 3PC0A 3KRSA 4O18A 5F1UA 3TCEA 1LLWA 3G18A 1F7BA 4LUJA 2E1DA 3MI2A 3M43A 1DL3A 5K2ZA 1LOLA 3CT7A 1R47A 4IPIA 4LY8A 4ZL1A 3W9ZA 4FEZA 2ZDRA 4OE7A 1QOQA 2VEMA 3S6DA 2NXGA 1QNVA 1EWEA 1VJIA 4UTTC 1XBVA 5EPDA 2Q8LA 3H53A 1YXDA 2F7FA 3KXQA 1F6KA 1OFPA 2Z6IA 3HGJA 3G1XA 2G95A 2GJLA 3TXVA 1FY6A 1SW0A 4AF0B 3PB0A 1WBJA 1KM4A 1YYAA 3TDFA 4HSOA 1O5KA 1AL7A 2H8ZA 3PF3A 4M6VA 1KM6A 1S5VA 3SJ3A 3Q37A 5D37A 3F1QA 2ZZ4A 3G1AA 3SI9A 3WK0A 2AAMA 5K4XA 4FNRA 1A5SA 4P61A 5F4XA 4POCA 1WOBA 4LVFA 3GR7A 3N9SA 4AF0A 3MP5A 2NUYA 4O14A 3EXRA 4FNTA 2E6AA 2C3ZA 3LHYA 4JEQA 2BZNA 3C56A 4QM1A 1JCJA 3TQKA 2NUXA 3VFLA 1Q6OA 5MHBA 4UUIA 1QDSA 1FXPA 3M6YA 3A24A 1SU5A 4M6PA 2Y62A 2H3DA 4RZ5A 3M0ZA 2EPHA 4MYXA 1ZAJA 1Z41A 1IIHA 3DHFA 2QJIA 1Q6LA 2Y61A 1OFBA 1OK4A 1ZENA 1VS1A 1Y0EA 4ZQNA 1G69A 2QJHA 3STCA 1C8VA 1EEPA 3QSRA 3W7CA 2WV8A 5CKSA 2JKAA 1D3GA 2I14A 3CPRA 3BLEA 3L0NA 3PUOA 4K7VA 1LORA 3A5VA 3O06A 4LRSA 2AGKA 3UPWA 2ISVA 1LBFA 3RLVA 1LLZA 2VC6A 1W54A 4BFAA 1WYIA 4IOTA 5LNRA 3OVQA 1H50A 3TFXA 3EX4A 4N4QA 1A50A 2NWRA 2VENA 3P81A 4OT7A 4RLIA 3HBLA 4X22A 3KX6A 1H7NA 2FIQA 4XBSA 5EYWA 4C1LA 4A2SA 1YTKA 5F2GA 3E0IA 3TSMA 1IXOA 2ZZ5A 1GTHA 4ZQPA 5DXXA 3EX2A 1PCKA 3IEBA 3HPZA 4OV4A 1VH7A 1AW1A 1R2RA 5F2IA 5EY5A 2ABAA 3RU6A 2I9EA 4N9DA 1XM3A 1OFRA 2GOUA 2VELA 5AC6A 1OHLA 1JCMP 3LXAA 4M7SA 3G3DA 1LOQA 2CLIA 4NXKA 4UFIA 1MEIA 1W3IA 2CU0A 3DI0A 1H1YA 5LZLA 1VLIA 3BW3A 4MPQA 1EUAA 2Y7FA 3L0KA 4AWTA 1JUEA 3NDOA 2NX3A 5CZSA 3P67A 3QFEA 2GVGA 3NGJA 1JCXA 2P1FA 4IMFA 1GQNA 2RDTA 1QO5A 4NNAA 3TA6A 5K9CA 4MYAA 2E68A 3RMJA 5C5YA 2V2DA 3LB0A 3E96A 3NL5A 4BI5A 2WSQA 3B0VC 4IMEA 4UIOA 1OABA 3TNOA 4Q32A 3ATYA 2A5HA 1EP2A 4HN4A 3H55A 1VYPX 1T0OA 4HNNA 4RJEA 4O1AA 5BMXA 3EWYA 5AHFA 2ZRYA 4A22A 3NL3A 1NVMA 4Z0JA 5HINA 1I2OA 3N9RA 4GC4A 3ZWTA 5LNSA 1GVRA 1Z48A 2FFCA 3S5OA 5KMYA 4I9AA 2B7NA 5HUOA 1TTJA 1GVSA 1TV8A 3CQ0A 1DKWA 2J6XA 2C18A 1OFAA 2XFWA 4GNJA 1AL8A 1LRNA 1SUXA 3I68A 3A9IA 3EX6A 1GPWA 2R91A 3LBMA 4FNPA 4OBTA 4BWLC 4ZVJA 4ZMGA 3NL6A 1M7OA 3LCWA 2ATSA 4KWWA 2FPTA 3M44A 2E09A 4JR5A 3T7VA 3SR7A 3DFSA 3TFCA 1IXPA 3BG3A 3FEMA 1P0NA 5HMSA 1K8ZA 1RR2A 4BI7A 4MZ1A 1RQEA 4A21A 5I3HA 1CX9A 5C6MA 4PL1A 2YXGA 3UWYA 3FIGA 2QUUA 3L5LA 1SW3A 1YDNA 2VKZG 5K9XA 3JRKA 2B7PA 3IIVA 1XDLA 4JS3A 1JCYA 3GKFA 1I4NA 3GDLA 2GVLA 5D2VA 1IIGA 3QM3A 2O7QA 3KVMA 1PCWA 3BGJA 4FO4A 4H3DA 4MUZA 2DORA 3LM7A 3L9CA 4NU7A 1MEWA 3G8EA 3S1UA 3IIXA 3W86A 3BGGA 1LTDA 3R12A 5LKYA 5CZ0A 4PODA 4TMCA 3EWXA 4ZQCA 4LC8A 3SZ8A 3LX9A 5CPMA 4RXGA 5EBUA 4DO5A 3DFNA 2VXNA 4UTWC 3HG5A 2CZEA 4HSNA 1H7RA 4IMCA 5CPOA 5D03A 2B7OA 1K03A 1KLZA 3UYCA 3TH6A 2PC4A 2J24A 1W31A 1JRBA 1GWJA 4K37A 4O1CA 4AXKA 4Y6GA 5L9FA 3MBFA 2WNNA 5AHIA 3JS3A 2VFGA 1MXSA 1KFCA 2G96A 3O6DA 2X1RA 3QH2A 1Z44A 4KKXA 2VFDA 1D3HA 5AHLA 5K3VA 3W2KA 1OYBA 2NXHA 3G0XA 4N4PA 1DOSA 1M6JA 3STGA 3UWZA 1VR6A 4FIQA 4R7JA 3TQVA 5D02A 3W73A 4UC5A 1VYRA 2DZTA 5LSMA 3GAKA 3QC3A 1W56A 3UZ5A 1OFOA 1D9EA 1XFBA 5DBTA 3R8RA 5DBUA 3GXPA 2JGYA 4JICA 1X1ZA 4UTIA 1GYNA 4WX2A 3W83A 5FI8A 1WOAA 5LNWA 1MSSA 3LCHA 3I65A 4MVAA 1WAUA 5CPLA 2NXIA 3ZS4A 3NG3A 3PSVA 1LBMA 4O54A 1JUKA 3PUEA 4Y8FA 4Z1BA 1NAL1 1WXJA 4H4IA 5F4WA 3M47A 2ZCGA 1G4EA 4UTKA 5CSSA 3DU0A 2HS6A 2JK2A 4QQ3A 1ONRA 1TSIA 2P10A 3MYPA 4BK9A 4O28A 3B04A 1J5TA 3QMSA 4JY9A 4XTDA 4AMAA 4CNPA 2V2CA 3A5FA 4MLJA 5E1QA 2F84A 3DBPA 5AN7A 4L4LA 4DF1A 4R33A 2QF7A 1JQXA 1NF0A 3P5YA 4LS0A 3TQ0A 1SW7A 3W76A 4KWVA 2CZDA 4UTJA 3PBVA 1F6PA 3W1AA 2QR6A 4H6KA 3TAKA 3LCIA 2QAPA 3GNNA 4FXRA 4CCEA 5LNUA 4NZJA 2C6QA 3U8GA 3GKAA 4LVGA 3WFAA 2Y89A 1FDYA 2ZRVA 3MHUA 2VFIA 4XZ9A 4LS2A 3C2FA 4FX7A 3TK7A 4UFJA 4NJGA 3BLFA 1KFLA 2YYUA 1W1ZA 1XBZA 4KFOA 4JTFA 4RV8A 3ABOA 4A3UA 2BWGA 1DJNA 2NV1A 1LBLA 5BNKA 4GFSA 1BKSA 1GT8A 5C55A 4WOZA 1SZEA 4ML9A 1FWSA 4UMBA 3PBWA 2R14A 3W1UA 2YFNA 4UCGA 3NEVA 2CWNA 2QCEA 1GOXA 3GR8A 3IIOA 3QQ0A 4LVAA 4GUHA 1OJXA 2E6YA 1KFBA 3UXDA 3WJXA 1EP3A 2QUTA 1NF7A 4N6FA 3W1XA 1FBAA 1RVGA 1VZWA 4LVBA 1PE1A 2QUVA 5HWJA 1NEYA 1I2QA 3W7HA 3SW6A 3PBYA 1YXCA 1QWGA 1R2TA 1VLWA 4IQLA 1YADA 1ALDA 2R8WA 4O8RA 5CGQA 2V5BA 4MKNA 3EKLA 1SZGA 1YPFA 2EF9A 1VHNA 5G1YA 2XN1A 4XKYB 4QJ1A 3UY7A 5E0KA 2DU2A 4K7YA 4WUIA 2V82A 3DFOA 6TIMA 1RV8A 5LGXA 3GLCA 4Z1AA 3W70A 4CNOA 3L67A 2GPTA 2HS8A 1TPH1 3O05A 1UUMA 4XKYA 3GDKA 4WOQA 4AHOA 5I3JA 3RNDA 4NJJA 2DJLA 3W74A 2DJXA 2VFEA 1W0MA 2GJNA 3SIZA 3LCLA 4N6EA 4NX5A 1X1OA 3OG3A 3G1HA 1HL2A 5G1TA 2Q8ZA 2QCGA 1GG1A 2H3BA 3CEUA 4O0ZA 3NQAA 5FF2A 1AG1O 1ZY9A 1TTIA 2ZBTA 4FIRA 2A0NA 2ZYFA 2NZLA 4MZYA 3O16A 3ABQA 1TYGA 1HTIA 1EUNA 2EKCA 1G4TA 3MMTA 3KVKA 3QYQA 4FHAA 3TU9A 4E38A 4A29A 1DBTA 3UWVA 1SR9A 2RKXA 3D0CA 5DCEA 5LGZA 1H62A 4GUIA 3G22A 1KM3A 5ABTA 4MFDA 4DF2A 4GJ1A 4Q33A 4E2BA 1TV5A 1FQ0A 1NSJA 4IXHA 3HOJA 1SO6A 3NA8A 3FJLA 3S8HA 1HFBA 3G1YA 2QCHA 1N8FA 1LM1A 2VEPA 5TIMA 3LOTA 5FESA 4B5NA 2ZTKA 3W1TA 1DORA 4LOCA 4UNLA 1SPQA 2EHHA 4N2YA 3W7LA 3HMJG 4DPPA 2BSLA 5D30A 2Y88A 5AHEA 3OA3A 2ZQ0A 3W87A 3B0UX 2YW4A 2QJGA 2QCCA 5LHEA 3C2OA 3VCRA 1YPIA 1FWNA 4NJKA 4MIMA 3F4NA 2YW3A 4RKAA 3R5EA 4OHQA 4C1KA 5FF7A 1ME8A 3C52A 5EKYA 5AYYA 1B57A 2C1HA 2QCMA 3BLIA 3N2MA 4JTSA 1G4SA 4AHQA 1F2JA 2CLMA 1RPXA 4TR9A 4CQ8A 3W72A 2KZHA 1W37A 5D04C 2X16A 1KFEA 1H7PA 1TRDA 1I2NA 4PTNA 3NQEA 3LI0A 4QISA 1W5NA 2J27A 3EEGA 4LV9A 1KFJA 3T78A 3VE7A 1L6WA 4O16A 3LCGA 5U7SA 5HWMA 5U4NA 3O63A 5KINA 1EX5A 2BTMA 1TPDA 3I7SA 3KVLA 3CLMA 3HPSA 4ONVA 4AWUA 2BX7A 2R94A 3LRKA 4E2DA 4O19A 5A8GA 3P8JA 2V8ZA 3B8DA 3FA5A 2WNZA 3HG2A 4LWWA 1UCWA 4N9EA 3BPWA 5D32A 3NOEA 1SQ7A 2ZA3A 4LUIA 1WA3A 3AJXA 1ZAHA 3C2RA 4QNEA 1EPXA 4O0KA 4IMDA 2HSAA 4UR7A 4BF9A 2OJPA 2DZXA 3T44A 3P60A 5AOUA 1G6CA 3KVJA 3NYZA 2A2IA 1YLVA 3EWZA 1QAPA 3KFTA 3TW7A
chains in the Genus database with same CATH superfamily
1MQQA 2Y5EA 3HGSA 5F1VA 4PB3A 4NNCA 1ISZA 3KZPA 3SSJA 3T8QA 4DI8A 1ZVZA 2NQLA 1FXQA 3BVJA 1XIEA 2E4TA 4KBXA 5IDZA 3EFOB 3TTEA 1RSCA 3F46A 2OKTA 2C14A 4B2DD 4EOUA 3N6QA 1V02A 3OU8A 2TYSA 2JE8A 2B7QA 3W22A 3ZOAA 4HHLA 2VGBA 3EPNA 2W27A 1Z23A 4DLFA 3N3MA 5JU6A 3YPIA 3BV7A 2C16A 3EFOA 1AH0A 4YWQA 4Y7EA 4AH7A 1KCXA 2QAFA 2V3GA 1HO4A 3NPXA 1RCXB 1GVIA 4PMVA 2YCJA 2GOKA 4C7GA 4DBEA 3WQPA 4DJED 1ZU8A 1V3LA 3NPUA 4L9YA 1UWIA 4PRWA 4R53A 1Q0GA 2VUYA 3ZMRA 1G67A 4O1FA 3K1DA 3NNTA 1F76A 1IF2A 4JFVA 2NQHA 3DHPA 3G3MA 1LWJA 4QG8A 4OD5A 3EWCA 2REQB 2EAWA 4EWCA 3SN1A 3L68A 3W53A 1CECA 4PR9A 3HV8A 2NSFA 2D20A 1MNZA 1E72M 4GKLA 5G4HC 3NG1A 2WQPA 3TOYA 2YCEA 1IT7A 3GRIA 4N6HA 4K68A 2BVWA 3K8LA 5JRAA 3NYDA 3LTSA 4ATWA 4CD4A 5IRPA 5HA7A 4S1FA 3TMLA 1H41A 4GUJA 2REQA 3R89A 4U2ZA 3QLDA 2HV5A 4DBDA 2X0SA 2CZVA 4NVTA 3K5XA 4Z1DA 3DXJF 3G4ZA 1W9PA 1AQHA 3CSKA 3LNRA 5CJNA 4IUOA 2IM8A 1YE6A 4AFYA 1W5MA 3QTPA 3H7RA 3DZ1A 2L7AA 4CD7A 1SFJA 1DWAM 1LROA 5JMUA 3AHYA 3T8LA 4MY8A 1PDZA 2HPMA 4O53A 3QQWA 4IT1A 4DRJB 1X6NA 1DP0A 3CZ6A 3LPPA 4U28A 4BJ6C 3QV7A 4K3ZA 1BF2A 4LF1A 3F47A 3NXLA 2Y5JA 1QXLA 1C8QA 5T3WA 3WNLA 1T8QA 2AMXA 3K33A 2ZTJA 1OIMA 4W7UA 1J8YF 1OX4B 4NZCA 1P0KA 4L7ZA 1T41A 3V5XA 3QOKA 4ZE4A 1HJUA 1VCFA 4CQ9A 1P6CA 1DWFM 2KC3A 3RW0A 3PS7A 4UTTA 3T0CA 2CHOA 3NGFA 2JF7A 3QW4B 3VDBA 4DF0A 4TTGA 1OX4A 4FF7A 3SZRA 3CO8A 2XIIA 1E6QM 1QKRA 2C15A 1FMVA 4OVXA 3GS6A 2DGJA 3WFZA 4U9DA 2QULA 3WQOA 4S23A 1YHTA 4C6OA 5E2QA 3VGBA 4YWSA 2EINC 1P6WA 3TXZA 1L2UA 1PBGA 3WUFA 1DHKA 3DEQA 1KU2A 1EB3A 3T0DA 2BY2A 1NFOA 3EPOA 3KRZA 1VEPA 3KTSA 5I77A 5FJUA 4IPJA 4RW3A 5DQZA 1ML1A 3EDKA 4XAGA 2XHYA 4JY8A 3SCUA 3O6XA 2BV9A 1QBAA 3DFHA 3ITXA 1ZHXA 3TOPA 3OA1A 3PG8A 2DB4A 2W4MA 3FLUA 1Y4CA 4GIRA 1E5JA 3N14A 2XZ7A 3CZGA 2R9RA 3CHFA 1U5VA 4DWSA 5I06A 2WNQA 1Q6RA 4BZYA 1KR1A 2BHUA 4NAEA 2NX9A 1UROA 1O95A 4AL0A 3HGRA 4S3DA 1YYJA 7REQA 3LEOA 2HSBA 4CCDA 3GX9A 4HT3A 3M0KA 3IJ9A 1D2KA 3LLKA 1LQ0A 1E0UA 4QHRA 5DCDA 4A2NB 3S0XA 1XYCA 1JCLA 3ANVA 3PZUA 4JN6A 3EEZA 1PHQA 4GH3A 4LQ1A 4N7QA 2XXAA 3AYSA 4B5TA 3VRCA 3AHVA 5HULA 2PBGA 4WSKA 1BRLA 2ZZ6A 3PWIA 5CG0A 2IW0A 3PR2A 1T6QA 4QSHA 1AW2A 4ZZ9A 2Y3GA 1W5OA 2B4GA 3M9YA 3B0PA 4I7WA 2G3FA 5F7UA 2NLIA 4P2VA 1S2VA 2H9AA 4NTAA 4NAFA 3IGSA 4UR9A 2WSPA 3MBGA 3R58A 3N2ZB 2IQ0A 1JGIA 5I79A 2IKGA 5AZ1A 3R13A 1PYFA 2J0XA 3W7KA 1ZL1A 4LW7A 1QZXA 5L6UA 5HJXA 5C71A 4Y8EA 4URIA 3E0FA 3UZJA 5D09A 4HNLA 2Z7GA 4OD4A 2DUXA 1HVQA 5CSYA 2GQ8A 4FI4A 4HTBA 2G41A 1JPMA 1PYMA 2BY3A 4IFKA 3DKJA 4EPKA 1PS9A 4WD0A 5XIAA 2HISA 2R05A 4S3FA 5AYZA 3QMRA 3P84A 3ASNC 2Q7RA 3GDRA 3U2OA 3PZOA 2IXUA 3GXTA 1ICSA 3SEOA 1YJGA 2HXTA 3PZQA 1TV7A 1RXOB 5IHSA 1H1NA 3MP4A 1WTYA 3T6BA 5C9XA 5COGA 1AJ2A 2Q71A 3RH3A 2CLHA 5GNXA 4D8LA 4MJ2A 1W1YA 3AOUA 3B4UA 4PRTA 3UGOA 5ABFB 4LLCA 4UFMA 2ZZ2A 1E1EA 5GNZA 1H61A 1HJXA 2IKHA 4GABA 4E7SA 4AX6A 2DDXA 3O1NA 7TAAA 4D4XA 3DWWA 4HPHA 2D22A 1XGEA 2XH4A 4Q4ZF 5HR7A 3K1GA 1SZIA 3W2MA 3UPBA 2VI0A 3I4UA 2J9ZA 4AIBA 5FF3A 4CS7A 4NL1A 2PTDA 2X1IA 4ADSA 3LTYA 3PB2A 4JX5A 3MO7A 4KESA 1TELA 5BRBA 3S5ZA 1KD0A 3BW2A 1BTCA 1ISYA 1JPKA 3T2QA 5B7YA 4BWLA 4JQ1A 4RE4A 1QW7A 4R7WA 1YX1A 4GBDA 4F9DA 4I3GA 1B68A 2PMQA 1T40A 4A35A 4QNWA 3QJAA 2ISSA 1OZMA 4GWEA 4CU7A 2PA6A 4JHMA 4OWGA 5BRQA 3N13A 3TUUA 3MBDA 1OT2A 7PTDA 1ZGDA 3NZQA 1Q7QA 4HPJA 4IPNB 3VZZA 5C9RA 4YTTA 4TQTA 4MVQA 2WC3A 5FF4A 3GM8A 5DY2A 3RIPA 1G0CA 2V3DA 4MJ4A 3LGEA 3TAOA 3KTCA 4JHOA 2CFFA 2VR5A 4HA0A 4DB7A 5CSRA 2GQAA 1NM9A 3DE8A 4YT5A 3C2EA 2O9XA 1QPKA 4J3ZA 3O15A 4XV0A 4JX6A 1TJ2A 1V8EA 1XISA 3TYCA 3IAQA 3FAWA 4XD5A 2DIJA 2VO5A 5A5WA 5AC8A 3OIXA 1Q6QA 4AZIA 2PF4E 1R5YA 3CV1A 1IEXA 4WJXA 1KRMA 4JXCA 2VDHA 1IZKA 2AWCA 3QC0A 3QTHA 3LNPA 1E3XA 5D4YA 1S39A 4DELA 4CN6A 3B9DA 3LCXA 3U8PA 6ALDA 3AXHA 3T6CA 3APGA 3V75A 1K8YA 3PZIA 4UB9A 1XS2A 4JAWA 3GYCA 4Y9NA 3OLGA 3E0WA 3UG5A 3SURA 4MKVA 1EBGA 4KFNA 2R7SA 1VP5A 2Q9CA 5FEPA 1CGNA 3UYIA 3UEQA 5IDIA 1RBLA 1EP1A 2A7NA 3NQVA 3UCDA 4IMGA 1G7UA 5KSWA 3H54A 4US5D 1ZP4A 2FZBA 1EC9A 4ADTA 3KCLA 2CHNA 1FFQA 4LLEA 3R2PA 1BYDA 1KLYA 2Y6ZA 3DHDA 1X7IA 3FMSA 3GW3A 4JNZA 3ES7A 5BXPA 3W7PA 3QR3A 3HU7A 1IEIA 1YNYA 4ZOBA 2E87A 2FPVA 2HK0A 2WJEA 3MHFA 4RCXA 1IT0A 3E49A 3SM0A 2E9BA 3THQA 1UBSA 1M57C 2YDAA 1F9CA 3AIVA 3R4IA 3W1PA 4HU0A 3Q2DA 1KXVA 2XFRA 4PUWA 3CK5A 2FVLA 4KERA 4G7ZF 3WDHA 4F48A 3B03A 2IQDA 4EWND 1G4US 2E25A 3PM6A 4NP7A 2WW5A 2OQLA 4IIHA 4JC7A 4UR8A 1UKTA 4TVDA 3PAJA 3POCA 3VMNA 3TR2A 4DEFA 3CEPA 2EPKX 2A79A 2XSBA 3PPFA 4J4KA 1S5TA 2KW3C 1RLCL 2FJUB 1FFRA 1M04A 1NDWA 4DVOA 3AG1C 4QITA 1PIIA 3Q4DA 3G1SA 4PYSA 4CCCA 3CAWA 1KM1A 2A3CA 2V2HA 2WB7A 2BP1A 3OQ8A 1HJQA 3AS0A 3L5MA 3LV6A 3HFYA 4GZJA 4RZ4A 4W5ZA 4D6IA 4LV4A 1TPFA 1HX0A 3B05A 4MLRA 4Q4SA 3WK3A 3RCYA 4ZQOA 3DFTA 4TO8A 2RGMA 2TSYA 5D92A 2JEQA 3ONBA 1JRAA 4D1IA 2WZTA 4E0CA 3G1DA 3TYEA 5K7JA 4CD5A 1F8MA 5D2TA 1A5UA 4MWAE 1QHZA 2WMIA 1XFCA 1FVPA 1XLKA 1SM9A 1R3VA 2IBFA 1TWIA 2LLEA 4N9BA 5JUAA 2DGAA 1CWYA 3BW4A 4W5UA 4IH3A 4CS8A 4HTYA 3SCQA 4XVDA 2IKJA 4PBEA 2B0JA 3B9NA 4JIPA 3SN0A 1OBAA 1GTEA 4Z42C 3C8GD 1X38A 2VQUA 4B5VA 2XLMA 4C6KA 1JYNA 3VD4A 2X1UA 5LA1A 3ZIBA 2WANA 1MNSA 3FA3A 4CNTA 4DQWA 3GY1A 3AG2C 3FNDA 1OIFA 4NZFA 3LS0A 4UTHA 1GJUA 2D3NA 3WL1A 3ZXWA 1UR2A 2WSKA 3I7QA 4P9FA 5CC3A 1EDGA 4AIUA 3T6JA 2A6EF 3AG4C 2YOCA 1XLBA 1FA2A 2C0AA 5E70A 1DJWA 3CS2A 2YXOA 1I8JA 2FTPA 2GUUA 1HKVA 5IFTA 4IXXA 1FTSA 3VX0A 1W3HA 1C29A 1ME9A 2PRLA 3WK1A 3QPZA 2DZAA 3HGOA 1XDMA 5DS6A 1ESWA 3OBKA 1UG7A 4LVDA 4YVVA 3MANA 3OYZA 3WUEA 3RK8A 3J06A 3DYPA 1VBJA 2BBFA 4C6LA 2VGGA 3UWWA 5AHMA 2CLOA 2F22A 5G4EA 5JS5A 3STEA 2XFFA 3V5ZA 1KA9F 1QT1A 3EWWA 1LT7A 2BOEX 1FNTc 3U5YA 1G5AA 3F7JA 4XZBA 4GISA 3W1LA 1FH9A 1OQFA 1TWGA 4R9XA 4NZ1A 1ZHAA 2W62A 4QEHA 4XO7A 1E15A 4XZWA 3HQNA 3OBEA 1TREA 3P7YA 2PDQA 3UG3A 4ROPA 3AMKA 1BWKA 2WZFA 2JGQA 3WJWA 4AEFA 2EG6A 2CERA 3M0LA 3W2JA 3LERA 2AGTA 3CWOX 4MPKA 5AVHA 3KBNA 1NIUA 5C2XA 4KGLA 4GRSA 4C60A 3S46A 2FFIA 1EGZA 1GYMA 5AFDA 5BQGA 2CLLA 3W7MA 1BR1A 4CEUC 5EA9A 2AWYA 2ABBA 1PKNA 1RP9A 5FZTA 2CBUA 2ZXBA 1MW0A 3EGXB 2J77A 3USZA 1BSIA 3PFMA 3CASA 1KV5A 1GVFA 4UMCA 1SZNA 4JVSA 1VQTA 1J01A 3MTWA 4O15A 3VKJA 3QR0A 4IB4A 3W7DA 3W26A 2C19A 4QDWA 2E9LA 2FZ9A 2YFOA 3E2VA 1Y65A 1DVJA 3BL3A 5FF0A 1U22A 3URNA 4MVRA 1PVNA 2V67A 2WSYA 3DESA 3FHDA 3PZMA 3CQZA 1UH4A 2X8RA 4DXVA 4OKDA 3BAWA 4JEJA 4O1DA 3O0KA 5HQLA 2XISA 3T09A 3CWHA 1SJCA 4TVCA 1LE4A 1HKIA 3ECQA 2FQIA 3NZPA 5IFPA 1ZUAX 1TR9A 4PE8A 1JPHA 1EI7A 3UZWA 6PTDA 1MI3A 1RK5A 3ZLHA 4WIWA 2ZICA 4YHEA 1OINA 3ITOA 3U2EA 2ZD9A 4GG9A 2YRFA 1KTBA 5B1BC 3W37A 2WVSA 2YX0A 3TJXA 3G0SA 4PMXA 1BXNA 4AIEA 3GYEA 1G8XA 1X8CA 4R88A 2RDUA 2CKSA 1EX1A 4JBRA 3LXCA 1WKDA 3PZTA 4Q7IA 4P8XA 1BEUA 4O1BA 2QCDB 2HJ3A 1OW6A 1E6SM 3H21A 2DZVA 4GXPA 2GA0A 4CGTA 2OSWA 2A68F 4JYDA 4U5DE 3QSTA 2XIQA 4D6CA 2Y63A 2QGHA 4YT8A 3RILA 3P61A 3DENA 3LI1A 4LBSA 1FH8A 3W82A 2QCDA 4JTUA 4IIFA 4LCQA 1S1RA 4D1JA 3LHTA 3RLGA 1XXXA 4RDAA 2WB5A 3EXSA 5E5CA 5JQ9A 4E4FA 1RCOB 2BGQA 4WZHA 3W3OA 3IK2A 2ZA1A 4DUVA 2QLYA 4UFHA 2XDFA 3NURA 3F5KA 2J7DA 3NOYA 3ZC4A 1GG0A 3NJ3A 3AIUA 1EQPA 1S2CA 4BEMJ 2EPLX 1LOSA 4FX6M 2Z2UA 4AAJA 1XUZA 2PDXA 1BR2A 3KRSA 1Z7Qc 4LXFA 2O9OA 5F1UA 2OOGA 3TCEA 2QJJA 2FMOA 3TK0A 4CNUA 4LUJA 3MUIA 3MI2A 3OO2A 5CBJA 4HOXA 4MHBA 4W88A 4ZL1A 5PTDA 2NW0A 3V16A 2OQYA 4K1WA 2I5IA 2ZDRA 2LQGA 3PPHA 3N0TA 4WR3A 1QOQA 1EWEA 1FTXA 1X39A 4JCZA 1QPUA 1VJIA 2I15A 1D1CA 2P0NA 4AX2A 4EXAA 3MUAA 2YLDA 1U1HA 3SRHA 1F6KA 3G1XA 1B5TA 3TXVA 3REQA 1FY6A 4RE2A 1SW0A 1SMAA 1B3XA 4AYGA 1KM4A 4HSOA 2AVKA 1EBHA 1L8PA 3KYIA 3PF3A 3SJ3A 3QKEA 2QS8A 1EO5A 4FA3A 3SI9A 3GWNA 1J0KA 2AAMA 2PZNA 2QVNA 2Z7KA 3MP5A 4H9TA 5M03A 2NT1A 1EXBA 4M8UA 2G3VA 5BCAA 1JDCA 1XGZA 2BZNA 3TQKA 2GJRA 3MB9A 3R0UA 3L8JA 3KL3A 2KNHA 4JIIX 4UUIA 1W1TA 1QDSA 4IAQA 1OQCA 1SU5A 4M6PA 1KC7A 1MW2A 1ZAJA 5A1AA 4H6QA 2GGGA 4IP7A 2XLDA 5EBAA 2E8YA 4WGYA 3H23A 3S1GA 2QJHA 3MVTA 1U89A 1V3HA 1D3GA 1X96A 2ODOA 3CPRA 3M0YA 3L0NA 4KRUA 3PUOA 4L9ZA 4GH1A 3RM9A 2AGKA 1LBFA 4LUTA 1JNEA 1OWQA 5HNTA 4EKJA 3URQA 1WYIA 4IOTA 5LNRA 1XYMA 3VGDA 1H50A 2F6XA 4PB5A 2E0PA 1UH3A 2R1LA 2J7FA 1GOKA 4GMEA 4RLIA 3HBLA 4X22A 1LQ2A 5EYWA 2VYOA 4Q8PA 4ENLA 4IHCA 5F2GA 4H8UA 3TSMA 1R8LA 4Z9IA 1GW1A 4ZQPA 3EX2A 2ZE3A 4H7ZA 2C8NA 1VH7A 1AW1A 3CHCA 4RE0A 4MQ9F 1VBGA 4MAVA 1XM3A 2GOUA 1O12A 5AC6A 1VLSA 1LOQA 2J7GA 4UFIA 3WLTA 1JD9A 3CL8A 3FHAA 3DI0A 1Q8AA 1W2WA 3RVYA 1H1YA 1E4LA 1VLIA 5LA2A 3EA1A 3L0KA 1Y5XA 4L1XA 1TV3A 2VX6A 5CZSA 2D0HA 2WCSA 1JAEA 1D0XA 3S28A 4JQ4A 5F5HA 4DZIA 4FMVA 2P1FA 3L23A 1Q2SA 4TTUA 5EHHA 4KWSA 3VM5A 3TA6A 1XJBA 5DRCA 4DM1A 4GZ7A 4MYAA 3RMJA 1B3YA 3DAFA 3OGRA 1XQKA 2NQ5A 2J75A 1HKKA 2A5HA 4ATDA 3N12A 1VYPX 4HNNA 2GSHA 3CAXA 4QFUA 1OCRC 1R3SA 5LIYX 2P3ZA 3H4GA 1I2OA 1BVZA 3TJ6A 2FFCA 1KWGA 2R7OA 3HJEA 3SRFA 5HUOA 1TV8A 1V0MA 1IT8A 2VVSA 4KC9A 2GDVA 4Z17A 3VC5A 3WLRA 2VL4A 3EX6A 2WBKA 4PFHA 4ZVJA 2ATSA 1GGOA 2J66A 1GOMA 1HQTA 2E09A 1XF0A 1H2JA 3DFSA 3SR7A 4P8UA 1IXPA 3FEMA 2WM1A 1FRBA 3AXMA 1RR2A 4BI7A 4Q8UA 4CSAA 2OFJA 4C3DA 1J12A 1XZPA 1JAKA 1CXFA 3VUSA 4I9TA 4HYWA 1CX9A 4F4RA 3IK4A 2O4MA 4J40A 3KHDA 3L5LA 2VKZG 2E8ZA 2ZVRA 5K9XA 3JRKA 1KXHA 3WDRA 3RPMA 3GKFA 3V5CA 3UFYA 1TFOB 5D2VA 3SO7A 3QZAA 3SSZA 3QM3A 5IHRA 1W1VA 1Z7AA 2PCEA 4DM2A 1UR0A 1QASA 3BGJA 2EIMC 4A6GA 1OCQA 3PHAA 4W8LA 4U3AA 3S1UA 3IIXA 4MNLA 1US2A 1PV3A 3N15A 3BGGA 4GIYA 3VNKA 3BICA 1FHUA 3B9AA 3IARA 4TMCA 4IFOA 3M6DA 5COMA 3EWXA 4ZQCA 3NSXA 3W25A 5HSWA 2VXNA 2CZEA 1H7RA 4A4AA 1BGAA 1KXTA 3P14A 3VOGA 4G7OF 2KQ9A 5A6TC 3HFTA 4DBSA 1VBUA 4GIAA 3F5JA 3GTHA 4QJ4B 4B5SA 3IJ8A 4Y6GA 1Q0DA 2KSFA 1UA7A 2XLHA 3MBFA 5AHIA 1ONXA 1E83A 3T0TA 5FACA 3QH2A 4KKXA 1LT8A 3VKAA 1D3HA 1KTMA 5DMYA 2GSJA 4GOAA 2JF6A 5AHLA 1V0NA 2EKGA 2OX4A 1VYKA 1XR2A 2OEJA 2CXEA 1VR6A 1BPLB 1N8WA 1I75A 1ONWA 4YN5A 3GAKA 2WC4A 1W56A 4MUPA 1OFOA 1D9EA 1XFBA 4KBLA 5DBUA 2ZWYA 1E9LA 1X1ZA 4UTIA 1ORSC 4ZCWA 2R82A 3KM8A 2JEPA 3FSUA 3W83A 3S47A 5FI8A 1MSSA 2BL2A 1BXCA 1IE7C 3I65A 3M0IA 4MVAA 1WE5A 3AROA 3PSVA 1LBMA 4Y8FA 4Z1BA 4C6NA 1NAL1 5F4WA 1V7AA 2CNWD 1G4EA 2JK2A 2BASA 4BK9A 4JTDA 4RDWA 4O28A 2VTFA 4LNCA 1CGOA 3H26A 1VENA 5CCZA 2X7VA 5E1QA 3BC9A 5AN7A 4L4LA 1JZ5A 3K46A 4R33A 3DMDA 5A6JA 3IQTA 1HE1A 1SW7A 2FZMA 4XO6A 3ZT5A 3PBVA 2XVLA 2VR2A 1EXPA 3TAKA 3LCIA 2QAPA 4ZO7A 3GNNA 4ZOEA 1V3KA 3COTA 5LNUA 4NZJA 5M17A 1T6IA 1J93A 1K6AA 4XEVA 1N1CA 1EDTA 2DPEA 3GKAA 3ABMC 3WFAA 3FJ4A 2VJXA 2IMRA 3ZLGA 4QI2A 5TJ5E 1UWQA 1G1YA 1TWWA 3SCVA 4ZTXA 4GVFA 4NJGA 2GQ3A 2QUPA 3S83A 2L6FA 1KFLA 2YYUA 4PFPA 1XBZA 9RUBA 1A3XA 5FOOA 4IAOA 1JNDA 5FCZA 5C70A 4NTFA 1LBLA 5L0FA 1XZQA 1GOWA 2HZ8A 1GT8A 3MCOA 2V6AA 3QZ6A 5C55A 2Z29A 1FWSA 1PCXA 4JTQA 3CB3A 4B5WA 2CWNA 1GOXA 1EF2A 5FSEC 4GUHA 4J7RA 2E6YA 1XLEA 3UXDA 4LEFA 1NF7A 1FBAA 1VBHA 1EFZA 5FAGA 4EANA 4FX5A 4HBKA 3W7HA 1UR1A 3SW6A 2LP4A 3PPGA 3QKZA 3P0XA 4MVZA 3ANUA 3SY1A 1DJGA 2R8WA 5CGQA 2ACSA 4MKNA 3EKLA 2EF9A 3UMIA 4IQEA 1VHNA 3BOLA 4LYPA 2XN1A 4HA1A 1QRQA 5E0KA 4HCDA 3QVZA 1IWPA 3TYUA 4WUIA 3WMSA 1LG2A 2V82A 3DFOA 3H2CA 6TIMA 4JNYA 2VC7A 3ZJKA 1SJDA 2XYLA 2EILC 5HDRA 1EOMA 3TW9A 2KGOA 4ZFMA 3EDEA 4C6FA 3FOOA 4HD5A 4KIRA 1ZHTA 3S9IA 5JIPA 3WO8A 1WKFA 2D69A 2DUZA 1NOUA 3BLKA 5L0HA 2ESCA 3GDKA 3GQYA 5BOEA 2W5FA 2YLGA 4MWAC 1ZYRF 2DJLA 3W74A 2VFEA 2MUCA 4KRTA 1W0MA 3VYWA 4F66A 1HP4A 4RUBA 4WF7A 4H9UA 3EBVA 4K7BA 3PZVA 1F3WA 3IEEA 3LN3A 1AVAA 3WLMA 1X1OA 3L4VA 3OG3A 3H2VA 1HL2A 2DW7A 4FOJA 2Q8ZA 3PTDA 4AZ5A 1GG1A 1PIGA 3J7HA 5FF2A 1S2AA 2QNEA 3UNGC 3BSGA 2P7VA 1TKKA 2A0NA 2ZC1A 2ZYFA 1KQYA 3O16A 5FL0A 2GVYA 2P5NA 1TYGA 1HTIA 4S3BA 3MMTA 1XHGA 4TV5A 2F8QA 5EMKA 4C3EA 5E0CA 5K0IA 1O1HA 3UWVA 1SR9A 2QT3A 1H62A 4LYQA 3SDOA 3ABKC 3T05A 1A0CA 4C6MA 4DF2A 4MAZA 2J7CA 4ML4A 1UD4A 2L5HA 4GJ1A 4Q33A 3DJNB 1GVYA 1TV5A 1K9TA 4E2BA 1PXGA 3NMJA 2VGFA 1SO6A 4CS9A 2UWFA 5JT4A 1US3A 1HFBA 3TYZA 3MV01 3BQ5A 4V1XA 3SQLA 3JCUQ 1R9YA 5TIMA 2LFFA 3GNRA 3TLQA 1NJJA 1NFNA 2DSWA 4Y9MA 3OBAA 2C79A 2Y88A 3VD3A 3OA3A 2ZQ0A 3SCSA 2YW4A 1PB0A 3CZKA 2QCCA 4D9PA 5LHEA 1V54C 3VCRA 4TVUA 2L81A 1G4WR 4DZ5A 5BROA 4B3LA 3SXYA 1FR0A 5FJRA 5EKYA 1GS9A 4FALA 2J79A 1D1BA 1YDIA 2QTVA 3CAKA 4AHQA 4KNVA 2CLMA 2XLVA 3GORA 4TR9A 4M81A 4CQ8A 1CPQA 2X16A 3UGRA 1TRDA 1SZRA 4NILA 2E67A 4O1EA 3M0JA 4QISA 2J27A 2EPMX 5GJMA 5D9NA 4LV9A 1SYQA 3M4BA 2PLKA 4LB4A 3T78A 2XH0A 3VE7A 5C9UA 2YBUA 5HWMA 5DMNA 5M3WA 3BLPX 2VWSA 1UZ4A 1W3LA 4GHRA 2D1ZA 3SJNA 1A0DA 2MYSA 2BTMA 3I7SA 2R02A 3CLMA 3KS5A 3M4HA 1QK0A 4ONVA 3UERA 5E33A 4AWUA 5A6MA 4O19A 5FL1A 2PDJA 4N9EA 1EPVA 3QGKC 4EBJA 4DJDD 1PZ0A 3B0YA 2CCYA 4O6NA 1AMYA 3RG6A 2NVCA 2G62A 2H7VC 4RNHA 4I90A 2J8FA 1POKA 7ODCA 4QNEA 1EPXA 4NKCA 3NWRA 4DVZA 5FCLA 5HNNA 2OJPA 4BF9A 4PRRA 2DZXA 2DUAA 3KBWA 1TR2A 3IRSA 2A2IA 1LG1A 2VRQA 1WUEA 2BHYA 3QVYA 2AP3A 2G3IA 2Z6JA 4P7NA 2AL2B 3VGEA 5DY3A 2VH3A 4I1OB 1ZJAA 2XIBA 2AQVA 3NQ7A 3RX2A 2V5CA 1W8SA 3MUY1 2OT0A 3V1HA 2NWSA 1DJQA 1EGVA 5I0DA 4AYSA 3S1XA 3OJGA 2AL2A 3ZR5A 1I6NA 1OW8A 3ZSUA 5AKQA 1JI1A 3GIQA 3NQ2A 5CEWA 5TD4A 1YW1A 2WOQA 1H51A 4M29A 3SYNA 5F5FA 2HWGA 3K8KA 1M68A 3FHQA 1XIGA 2A6LA 4X2RA 1UOKA 2R1KA 1KGWA 2QUNA 2XN2A 3UZYA 4K38A 4JL2A 4K8EA 4D6GA 1A7EA 4TXEA 3C0JA 1BD0A 3NIYA 4CD6A 1UWSA 4PA8A 1AW5A 1PJ9A 4YCPA 4D71A 2ZX7A 3GZAA 4ALDA 2R7RA 2V68A 3WJYA 1FWBC 2YBTA 3X2QC 4OGZA 4WY0B 5DLJA 3DFPA 1R46A 2D73A 4LF2A 3STPA 3UW6A 3TSBA 2WZGA 1C90A 4YTUA 4FNSA 3D6NA 2GUYA 4EVZA 3QZCA 2A21A 3LNMB 1NARA 3TTYA 2E5BA 1XI3A 4J35A 3VM6A 2W6RA 4GIEA 1JRCA 3UXLA 3GK0A 1GOOA 4WY0A 1RH9A 2XIJA 5LXEA 2I8BA 1HW1A 4KFPA 2VM8A 3LAYA 3VI2A 4WABA 3V3WA 3MHGA 4GVIA 3CUHA 3N18A 4QR6A 4DJFC 1F74A 1DQXA 4JTEA 2XVPA 2QPXA 2V5JA 3GTIA 1GQLA 3EB3A 1P48A 1YXYA 2CYGA 3IJ7A 4NXSA 4XBKA 5FSDC 4GQBA 4HPXA 1JYWA 3NM3A 3OEXA 3WENA 1RVKA 2E6DA 1YDYA 2XH7A 1ZCOA 1ZNNA 4UCFA 1RA0A 3AQUA 3EPVA 3HPXA 3KBJA 4DPQA 1PSCA 1YTEA 1VB5A 1FX6A 5AC4A 2XVGA 1GZGA 1VYSX 1JUBA 2RHGA 3MYFA 2VX7A 5CZKA 3TYBA 5KZDA 4MZ8A 3V0SA 3WUBA 2A3BA 3NKDA 2PGWA 3SGZA 1OR3A 4F0KA 1OYAA 3SGGA 2J45A 2ZZ1A 1W2VA 2O9PA 3DERA 1ZS2A 1XIHA 1K8XA 3H2UA 5CC6A 4ZENA 1O4UA 3GIYA 5GVJA 5GQBA 2HV7A 4XEFA 2GDUA 3PNUA 1E6RA 1B54A 2ZUNA 3M7WA 3VOHA 2Y3BA 1F05A 4XTKA 4TX9A 5D2WA 3FAXA 3Q94A 1QW8A 1BLIA 4NX0A 3G2GA 3W7OA 1UD8A 3W2NA 2VVNA 5J5DA 1XYLA 1SSDA 4OECA 1F8IA 2CPUA 2DEPA 4HZ8A 2ZZ7A 1WDPA 1R3QA 4FNQA 1JZ4A 2POTA 4BHYA 3C5QA 1OC5A 4WSHA 4QBXA 5FJTA 2FVMA 1PO9A 3HQ1A 4KMQA 2P8CA 1XCFA 3VNMA 2PP1A 4IFRA 5H1WA 2OWWA 3RMEA 3AC0A 2FB2A 4IJBA 1EJXC 2XG9A 1TUXA 1C91A 3I6EA 4MTFA 1FCUA 2FPYA 4X9SA 4JIHA 3RHGA 3NTYA 3TTSA 3VYLA 1LQAA 1KB3A 1LCOA 4JYEA 4HU3A 1M5WA 5F2LA 4YWIA 4RX0A 1HGWA 1FUYA 3RF9A 3FAPB 1PL9A 3VK5A 2OYLA 2PTYA 3KRUA 3NO1A 1VRDA 2PS2A 4UBPC 2DYRC 3G24A 1JQVA 5DLCA 2IPJA 2WMKA 4G7FA 1XLHA 2EG8A 3L7RA 3WJZA 1FDZA 4ZEPA 1WUFA 2RFGA 1E0WA 3AS3A 3NSNA 4AG0A 3G6MA 3NUKA 2QHAA 3BUVA 1M1BA 1TWHA 5HBFA 1A0BA 2HVNA 3W28A 4H9ZA 3AUOA 1GJWA 1DIKA 3UMKA 1E84A 1B1YA 3O6CA 1IGSA 4DO4A 3KWSA 2BXVA 3DC0A 3TJIA 5A8NA 2YDSA 4GE8A 3OYXA 3FDKA 3R2GA 1T5OA 4NC3A 4AL1A 2Z0IA 1L6FA 2PWVA 4DHGA 2ONEA 2G3JA 2WWDA 3R8GA 1F3XA 2ISWA 2J7EA 3AIBA 3QFWA 1ONEA 4PFMA 3PUDA 1KBKA 3APYA 1O60A 3K6BA 1PV8A 2PDUA 1QHPA 3VOCA 3JU2A 3N2OA 3UU0A 4M82A 1IZJA 3LUTB 4IMAA 4PH6A 3HNIA 2VB6A 3A9CA 2PUZA 2Y3DA 4QG6A 1QNSA 4LYRA 1U83A 1O3UA 2V9DA 4YL2A 1CLXA 4HVXA 5DXYA 4JFTA 2CESA 2PWHA 3GEIA 1SZFA 3QPYA 3PPCA 3LUTA 4HIBA 4F40A 1QPOA 1GONA 4GXMA 3D47A 3ITYA 5BUOA 3AICA 4P7LA 3VO0A 1FFHA 3HO8A 4QXIA 1IXQA 3HG4A 8XIMA 4RXFA 1ORYA 3BQ6A 1S5MA 3AUJA 3RXZA 1XYFA 4QAIA 2OU4A 2BGNE 4O11A 3WH8A 3IUDA 3ZQVA 4JJGA 3UG8A 4CNNA 4ICCX 1AMKA 4HK5A 3EOUA 3U0HA 3NQ8A 2WMHA 2X1TA 3I10A 4BQ2A 4GLEA 4ZQMA 5AYBA 3W4RA 4QJ3B 1RAKA 3AZSA 1QI2A 3CT2A 2HK1A 4QDMA 3SNHA 1SJAA 3WK2A 4ZOCA 4S2BA 1VFUA 4AISA 8TIMA 1CDGA 4NUWA 1E70M 4JGDA 3W2LA 3R0DA 2YZRA 1UR4A 4QGCA 1S3TC 3WQ8A 1A5KC 1G4PA 3EKZA 1H09A 2ATMA 2D2GA 4PCNA 4GJIA 3TN6A 1JXKA 4WVXA 5DT7A 2WLYA 1E73M 3ID7A 1M2OA 4GQGA 3IVUA 4V27A 1NLXA 3LESA 2NV2A 3T2PA 7A3HA 3HLZA 3DG3A 3MJMA 5DFAA 2G3MA 1IGWA 2WHJA 3P62A 4AZHA 1I5NA 1DWGM 2P0OA 1FP8A 1V3IA 1X8FA 2HVMA 3BG5A 1MRAA 1BYAA 4H7VA 1O5RA 2HTMA 5C9WA 4ICMA 4PK4A 4LT9A 3NZ1A 3DFQA 1PZ2A 4XD4A 3Q67A 4B6IA 4M63A 1UA3A 2IXVA 4PUJA 3DXIA 4S3AA 4YLWA 5B3SC 3QVQA 4A05A 2P6VA 3NM1A 4ZTYA 4H2CA 3VKDA 3ME3A 1TFKB 4B9YA 2CBIA 4LU0A 5CIVA 4C65A 2WMFA 1GKRA 3C2VA 3ELFA 4AZ6A 2W63A 1QSPA 4B2DA 3GO2A 2ZADA 5T3TA 1N55A 1EWDA 4EX4A 4WJ0A 4K36A 4WSJA 4MDOA 2Q02A 1LRQA 2FVKA 2DP3A 1JMWA 1W3KA 1JPNA 2PI6A 1LJYA 2FGBA 2A3LA 3G1VA 4WGHA 2WCGA 2AKZA 4PGLA 2O0TA 2OG9A 4DJEA 4E7ZA 1VFMA 3FYYA 5JH2A 2W79A 2ZWZA 3CL6A 2ZUMA 1MW1A 1NZEA 1OXKA 5JP7A 3S0CA 4YXGA 2E77A 3S9YA 3NL2A 3EOEA 1D8WA 2QDEA 1GM5A 1WPCA 3TTQA 2J7BA 1RLDA 1CZ1A 4L1GA 3O7UA 4NT0A 3SECA 3RVZA 4AMCA 4AZBA 3WQVA 6REQA 3T6GB 1VCVA 5JXQA 5C54A 1OFEA 4LTSA 3FKKA 3WLJA 4AD4A 1J96A 2HNHA 2DIKA 4XPYA 1VEOA 2DZPA 3NDBB 1H9TA 1VD6A 2GGJA 4AWSA 1WDSA 4BEJA 3EG9B 3M15A 4MDPA 4YL1A 4PMZA 3UNTA 2ZA2A 5T1DB 3RITA 2NSGA 2DYSC 1APCA 1J2WA 4D4NA 4JTLA 3VGHA 2LSEA 3BJSA 5C7VA 2VRKA 1S1PA 4DBRA 5L3QA 3IJQA 4JHZA 1M56C 1P4CA 3TC7A 3UNDA 4MW8A 2OZ8A 3RUBL 2J4GA 3FS2A 1BBHA 3AAMA 4ZODA 2JQXA 1RKEA 3W1QA 2VFFA 3TE9A 4RW5A 3F2DA 1R5ID 1OZQA 4MFEA 4A8NA 3JR2A 3GD6A 4DXWA 2PWUA 5KZEA 2FGYA 3KH2A 2BFGA 4L4MA 4ASTA 2YDRA 4FWVA 3VKBA 4KNWA 2X1SA 3F03K 4YYCA 2G5WA 3POVA 4ATLA 4HKPA 4JKLA 2L6HA 3NZRA 5E93A 1TCDA 1KWKA 3PJUA 3W38A 1TPVA 1M2VB 5KZ6A 2WHMA 4ERIA 3W2VA 2VEKA 1J6PA 3GZ3A 2YQYA 1D1AA 3L65A 2PLCA 4RNFA 4HHPA 3MS8A 1SJBA 4TOQA 1Q63A 1GZ1A 1QW9A 3P0WA 3C7JA 4Q8WA 1KNWA 1W9VA 1M2VA 1AJ0A 4MB5A 1UQYA 2J9XA 4DRSA 3WMBA 4ONSA 3ORWA 1SR0A 3EGDB 1XYZA 3CV7A 3C8FA 4HGXA 1R7AA 4G1NA 4CDYA 4HNCA 2O56A 3MMUA 4CN4A 3W1RA 3LHVA 3BARA 3RYSA 4PJLA 3MCMA 5EMUA 4G0HA 4CN1A 5REQB 4QROA 3A21A 5EFDA 2GQ9A 5LIWX 1H7XA 2ZZ3A 3EGDA 1MMAA 3EH1A 2ZRXA 3ITFA 4MNKA 4PC8A 3MLGA 1KKRA 1HW2A 4S3JA 3S27A 3UGPA 2AL1A 1KV8A 4L65A 3DH7A 3CU2A 3IUHA 2W0UA 3C0LA 1MW3A 5M1TA 1GNXA 4I7VA 5REQA 4PN2A 3H2MA 1T5AA 1OFDA 1T7LA 5J5RA 1Z42A 2QNLA 3FVDA 5A6SA 3V36A 3FKRA 5L3VA 1WQ5A 2XFYA 2R7UA 3OWTA 4WQ6A 4Z1CA 4JCHA 3IUIA 4QE1A 3G6LA 5A8PA 4NNBA 4O10A 4IWBA 3KS6A 1Q6EA 2Z24A 5I3GA 3ARUA 5TAOA 1KBIA 1ST6A 1MDLA 3TZFA 2GK1B 3AHZA 4ZR8A 2QIWA 4R9OA 1EIXA 2ZPAA 1HJSA 3EGJA 4HHHA 5HMEA 2VQTA 3CHDA 3S2MA 2FLIA 4MJMA 2WJZA 3WYZA 1K9DA 3HB9A 2XM1A 1R3YA 4RNIA 2NUTB 2GK1A 2M4EA 3JYYA 2IXNA 2G4JA 4HJFA 1WP6A 1EZ2A 3BLOA 4RDZA 4AW7A 5G4WA 4AZCA 4XG1A 3KTXA 4GUFA 4LAUA 3W75A 2H8AA 1FCQA 1TUFA 5TF0A 2AOSA 4UXDA 2YB4A 4J27A 5HQEA 3BURA 3WL0A 3HQOA 1EA0A 2OODA 3FYPA 3L1MA 4IZGA 2INZA 4LS1A 2ZRUA 4ZFCA 2VX4A 4XQ1A 3LPGA 1C17M 3ZZ1A 2OWXA 5HJLA 1HN1A 1OC6A 2QF8A 2NV9A 1KRBC 2YLIA 3ANYA 4QI0A 1UWTA 3KLKA 3Q6NA 3FFSA 1Q3NA 2CNCA 1L2QA 1S3HA 3MWCA 3KOFA 5KZMA 4OV9A 2ZIDA 3ECSA 3RLUA 2CLEA 4Z0SA 4DXKA 5CC5A 5BXTA 1QO2A 3V5YA 1TQXA 1YAUO 5D8ZA 5TBOA 4NCQA 5CGMA 2CCRA 5F4SA 2QV4A 2O9TA 1KW1A 3TV8A 1DPMA 1XSKA 2G0WA 4JTKA 3C6CA 4QE5A 4DOZA 1DIOA 2A1YA 4BI6A 5AYIA 3S3GA 3RQFA 4J32B 2YL5A 3ZWSA 8A3HA 3GVGA 1FH7A 2A69F 2OZ3A 4PEEA 3U2ZA 3BWWA 3AIWA 3AXXA 1TPUA 3KCOA 3LRMA 3KLLA 2Q3RA 2C13A 2Q8XA 4LALA 5A6LA 2ZRZA 1FWTA 2VZOA 5I2UA 3SFWA 1P0DA 4XZIA 2WVTA 2WPBA 1GUVA 1KFKA 2GZXA 4Z08A 3KKBA 3UXAA 1ZW3A 2DT2A 1F4AA 3WQGA 2E5DA 2VEGA 4PACA 3ITVA 1TA3B 1GK8A 5LIKX 3EZHA 4H9MA 2QIIA 2XVKA 3RLHA 4L6DA 3RPDA 3BZGA 1X7FA 2PGFA 3WBXA 2WKLA 3N9KA 3AYRA 5RUBA 2JKPA 4Q3MA 1DEDA 3UF9A 4GXWA 4YTRA 5FD0A 1TA3A 5EMJA 2QCNA 1R30A 1XIDA 5JBEA 2XL8A 2WVQA 1QFEA 3M7SA 2IYLD 4MY1A 3W6MA 1YYXA 1SFLA 3SXZA 4EIVA 1JJKA 2ZRWA 4CLMA 1K1DA 1H63A 2YXXA 2P3EA 3THAA 1I1WA 1EQ1A 3QY7A 4DBUA 1OX5A 1FCVA 1XPGA 4PSPA 3IQCA 1VFSA 3CWNA 1ICPA 2CLPA 3F4WA 3HJZA 5HQMA 3IPWA 3P82A 3POHA 5M2FX 3HPAA 4DRIB 4G8TA 2F2HA 3KRBA 3U3HA 5C2CA 3UR7A 2QDDA 3I3DA 1W1PA 3MZNA 1O87A 3GEEA 4IGGA 4US5A 3GTXA 4LY8A 1JDEA 4H19A 3W9ZA 4B4FA 2Y8VA 1QVBA 1PZ1A 3GBEA 2NXGA 2Z27A 4JZAA 1XW8A 4UTTC 4UQAA 2X05A 3AXIA 1Y7VA 2EIJC 4GGBA 1YXDA 4F2UA 2F7FA 1XLDA 3WCZA 5BYWA 2E7FA 1OFPA 1C93A 4DBQA 1E40A 2WNWA 3OB8A 4UZUA 4U5EE 4FLQA 3S6OA 4AF0B 1WBJA 1J0JA 1O5KA 2XL4A 1C3FA 2H8ZA 3RO8A 1KM6A 3DCPA 3Q37A 4JURI 5D37A 4WKHA 3F1QA 3TOLA 2J13A 4X0NA 1DTUA 4FNRA 1NU9C 4TV6A 4P61A 5F4XA 4JEBA 3N9SA 4AF0A 4C91A 4H4KC 2NUYA 3EXRA 4EWJA 4FNTA 1AJZA 2CW0F 2CITA 4CU8A 3M46A 3KDOA 1VFTA 3LENA 1PD1A 2XM2A 5MHBA 3GFYA 4DWSC 3FJNA 3M6YA 1M6TA 2IKIA 4RZ5A 3M0ZA 1M53A 1Q6LA 3O9NA 3ARQA 3WDJA 2VRJA 3MV11 1OFBA 1F61A 3MKKA 3N3TA 2Y0FA 1C8VA 3AU2A 3QSRA 2L6GA 1JF5A 2D5RB 2PP4A 4I5UA 4K7VA 2OKUA 1GVEA 3E0VA 5EFFA 3AU6A 3AYTA 1OD8A 3O06A 2HNEA 4YU1A 3SRKA 4EXQA 2ISVA 3ZWIA 1OGBA 4N6CA 3CUGA 3TN4A 1OKKD 1ITUA 2EBNA 4GK8A 1QOXA 4BJ1A 4BFAA 3JRTA 5AC5A 4J2PA 4WGZA 3M1CB 3EX4A 3IS4A 4N4QA 4JPGA 2NWRA 2VURA 1NTHA 2VENA 1S5NA 4Q4QA 1OADA 4LFYA 2V5DA 3MSGA 4C1LA 1QTWA 1YTKA 5DMLA 3WF0A 3C8GB 3NQBA 1GTHA 1PCKA 2WKGA 5I00A 5EY5A 3RU6A 2I9EA 3W29A 2ZX5A 3QV9A 4FESA 1OR2A 3LQGA 3R6IA 2JPUA 4NXKA 1MEIA 3C8GA 1W3IA 2CU0A 1M65A 1TE6A 5LZLA 4MPQA 3ITTA 4FXFA 4A3RA 2Y7FA 3T42A 4AWTA 4E3VA 5JIWA 4OIQF 3TOMA 1J11A 1E9YB 3NDOA 2NX3A 4D8ZA 4QSFA 3QFEA 2GVGA 4GQHA 2ZXPA 1QO5A 4LERA 1LL6A 4L5ZA 1PTDA 3KBMA 2QPUA 2V2DA 3LB0A 2R1PA 3KOWA 2WSQA 3KDNA 2HJPA 2ZKMX 4WRHA 4IMEA 4GD0A 3VIJA 4AE4B 5TNVA 4HN4A 1T0OA 3R43A 3WFLA 4V28A 1Z3NA 4RJEA 1VYIA 5AHFA 4A22A 4MNJA 4E8GA 1QWKA 3NL3A 4Z0JA 1M7JA 3T9OA 1I1XA 2FGLA 2B7NA 4MKSA 4AE4A 1TTJA 3CQ0A 1DKWA 1EEXA 3UGVA 3NZGA 1OFAA 3MKCA 4LEQA 3IWPA 1AL8A 1LRNA 1SUXA 4IP5A 3T1GA 4BWLC 3LBMA 2R91A 3TD7A 2HBXA 1EZWA 2CEQA 2V69A 4PJMA 4U3CA 1ZLPA 1SVDA 3HM7A 4L1WA 4E2OA 4HPGA 5HMSA 1K8ZA 1HVXA 3WQ6A 1LI5A 1MZRA 3VF0A 1RQEA 1QI3A 5I3HA 5DMMA 3T4RA 5EMLA 3GSMA 2YXGA 3UWYA 3UVAA 1WN0A 2QUUA 4BF7A 3WUGA 1UG6A 2F2KA 3ABZA 2OCCC 2B7PA 5COFA 1XDLA 3GH4A 3H7UA 1JCYA 4JFUA 3H24A 4ECLA 3GDLA 4YS1A 2O7QA 3NFUA 1TWAA 2YA1A 1PCWA 1FWIC 4H3DA 1OXBA 3LM7A 3L9CA 5GPRA 1MEWA 3PUGA 4YT2A 3BDKA 2PDLA 2PLJA 1Q0MA 4GZEA 1FWAC 2QV5A 3SIMA 3R12A 1OCCC 2R6OA 3U9JA 3GUWA 2QGYA 5A94A 4US6A 4CIHA 2J78A 2VNCA 1H0IA 4GPNA 4R32A 3GG1A 4IMCA 3MKVA 5CPOA 4BEUA 1K03A 3ABLC 1KLZA 1V6VA 3UYCA 3SCNA 5KYWB 2J24A 1E0VA 1IEWA 1KCKA 1UIPA 4ACZB 3O2LA 4O1CA 4AXKA 5L9FA 3UXKA 4GYTA 2WNNA 3GHSA 1OG6A 2VFGA 1KFCA 3O6DA 3ARXA 1IHIA 3EDJA 4BQ3A 4L6RA 3B8TA 3RR4A 2FGZA 3U4FA 4Q8NA 3W2KA 4ACZA 1OYBA 3G0XA 1EQCA 2NXHA 1DOSA 4TX8A 4JEAA 3UWZA 3VGFA 2HEJA 3BAKA 3B0XA 4R7JA 2OQHA 2RD9A 5D91A 2XGZA 3DHUA 4H00A 3GXPA 2OJQA 1Z32X 2JGYA 4CIPA 5A69A 1JCTA 4WX2A 1J8VA 5GNYA 4Q4MA 1CTNA 3L2MA 2D24A 1VKFA 4BS0A 1MMFA 2NXIA 3UBPC 3NG3A 5I78A 4ILSA 5JBFA 3B29A 2ZCGA 1US0A 3EQLF 2DVUA 1ONRA 4QQ3A 3RFYA 1TSIA 3MYPA 4DXXA 4AMAA 3U3BA 4B4HA 2Z1VA 1TWDA 2Z25A 3BCFA 1EDQA 1RD6A 3M64A 1WATA 4U5BE 4DF1A 2DQXA 3H2NA 1NF0A 3UR2A 3BEHA 2DI3A 2CYDA 4ULVA 1JI2A 4LS0A 4XISA 3TQ0A 5CH9A 3W76A 1RPKA 2CZDA 5IY5C 1TV2A 4UTJA 1F6PA 1ZJHA 2R7XA 2RSEB 1XIBA 1EJTC 4U10A 3BLDA 2OO0A 1CLKA 4RBNA 2VFIA 1WCGA 3GM1A 2X42A 3TVAA 3WSUA 4LS2A 4PJNA 5FJJA 1MQPA 3WQEA 4UFJA 2VEFA 3NRHA 3EOOA 3BLFA 1ISXA 2DQWA 3BAIA 1LVKA 2KAUC 2NV1A 3IJ6A 3DYOA 5HPCA 1BKSA 2DT1A 2XSXA 2DW6A 1A4LA 2OTDA 4ML9A 2HVOA 2R7WA 4A8IA 1C02A 3LD5A 3I5QA 2UBPC 2R14A 4YPJA 3KOXA 4UCGA 2QCEA 3GR8A 1EP3A 3BAXA 2QUTA 1CNVA 4LVBA 4E0IA 3ZT7A 5A2BA 1ORJA 2XGIA 5HWJA 1NEYA 1DWIM 3B4YA 4BCEA 2WXDM 2UZ9A 6XIAA 4IQLA 4O8RA 3FVYA 2Q4FA 1QNQA 2OEKA 4HZ6A 4JQ3A 4CS8C 5BOFA 4XKYB 4QJ1A 3VNIA 3VAVA 4D6HA 4K7YA 5CAKA 5DVWA 3VM7A 4JE9A 3V4BA 3PAOA 3WDIA 3FXHA 4XUYA 3UR8A 4GY0A 4P8VA 1UUMA 3VU2A 4B5XA 4L6HA 4XKYA 1BKHA 2P76A 4JIRA 1HF6A 5I02A 2F6KA 3RNDA 2IXOA 2DJXA 1MMNA 3UWEA 5ABFA 3OODA 1SFSA 5CPTA 5L0JA 2OLHA 2OGYA 3LCLA 1Y6DA 3CO4A 3TCSA 3AJ7A 4NX5A 5GPGB 2PAJA 2YZSA 2H3BA 6TAAA 1E9IA 4O0ZA 3NQAA 4PTDA 4HJWA 1JYVA 1LUCB 4FIRA 3UZXA 1VJSA 2NZLA 5ABEA 3U2LA 4H83A 1CPUA 2WZLA 2EKCA 1DJYA 3SUUA 4L61A 1UD5A 2EPNA 3QPEA 3QYQA 4FHAA 4LUSB 3TU9A 4E38A 3BCJA 4A29A 4XPXA 1DBTA 3SCTA 5DCEA 5LGZA 2BB0A 3G22A 1KM3A 3JSZA 4XZLX 3CUZA 1LUCA 1QK2A 4JQAA 1B0IA 1KXQA 2HRWA 4KRZA 1ZCCA 3VVGA 4YNGA 1FQ0A 4I1MA 1JPDX 4IXHA 5KYUB 3NA8A 4LUSA 1KO0A 4MM1A 5G1MA 4GYFA 1ZZMA 1UIOA 2VCBA 3VD9A 1W17A 3RM8A 1M03A 1UC4A 3G77A 2A1DD 5FESA 4J3XA 4B5NA 1SYTA 5E3AA 3UXIA 1DORA 2D23A 1VIWA 2INFA 2A0UA 2EHHA 3LGGA 1T6MA 3NDZA 5KYUA 5D30A 2J8TA 2INEA 5CQ1A 2YCLB 3B0UX 4DYEA 3M0HA 2A6HF 1RA5A 1JL8A 3C2OA 5ABHA 1A5MC 5ENLA 4TX6A 5DS4A 2OEXA 1FWNA 3LMYA 1A5NC 3A9BA 3CL7A 3UG4A 4IJCA 2J9UA 2V3CC 2XWEA 4JTAB 4RKAA 3EAUA 3R5EA 4OHQA 5FF7A 5BU9A 3C52A 4NTBA 1FKXA 2C1HA 2YCLA 3R25A 2PP0A 2QCMA 2Y39A 3EYPA 3ZVHB 3CQIA 3L0IA 1M01A 4HFKB 2ACRA 1F2JA 4UWMA 2C91A 1JPJA 1U0BB 3OZMA 3Q45A 1W37A 4JTAA 1I2NA 4PTNA 2NVDA 3E2QA 3NQEA 1W3JA 3LI0A 3ZVHA 1W5NA 2J46A 5B7ZA 4WDUA 4F79A 2W67A 1L6WA 3BOXA 4A3YA 1XIIA 4WHBA 3O63A 5KINA 1H5VA 4REQB 1TPDA 3CMJA 3KVLA 1J2BA 4AEEA 4BPMA 3W27A 4W86A 2NSXA 2BX7A 3LRKA 1Q8JA 5A8GA 2A3HA 2POZA 1CGXA 3FA5A 2WNZA 2DSKA 4GZIA 1QBBA 3B9QA 5HOSA 4LUIA 1VTMP 4GQQA 4M24A 4AD2A 4KF1A 4C6PA 3AJXA 4EKWA 3RCMA 5H8MA 1XKJA 4KEMA 4IMDA 2LCHA 2FKPA 2HSAA 3N6JA 3T44A 3IGHX 3P60A 5AOUA 1G6CA 4AD5A 2VP8A 3KFTA 3QHOA 3TW7A 5C0QA 3NPWA 1FCBA 1B4KA 3NYMA 4M0XA 3GH7A 3MJYA 1VF8A 1TX0A 2GYIA 3KOYA 3MW7A 4GA8A 3ZSSA 3QZEA 1A53A 1A5BA 1J10A 2WHLA 1Q6CA 4PCTA 2VASA 1KNYA 5D8WA 3KP1A 4QIUA 1QNOA 2PBEA 1SGJA 1ZTVA 1V0KA 2HZGA 4U33A 2FH6A 3KE0A 1MO0A 1NDZA 2DT0A 2QKFA 1Q65A 5AYXA 3LLFA 4EUKB 4Q6XA 4YVXA 1W1A1 1W5QA 1E0XA 2WHKA 4MOZA 3TLLA 3CC1A 1A3HA 1EF3A 3ITCA 4WXYA 5CAHA 2PURA 3TMQA 3WHNA 3PWGA 3K1IA 1MZHA 1FWWA 4WJ8A 1UASA 5HUPA 3LPFA 5G2HA 3VIKA 1UMYA 3E9AA 1MQVA 2WZEA 2PDGA 1DJHA 4DBWA 3M5YA 2ZUVA 2HCVA 1E4IA 2KJGA 3WLPA 3KHJA 1CENA 1VMAA 5LHFA 4OU1A 1SO5A 1N7KA 3HNLA 4HNUA 4XEKA 3C62A 4JDBA 4CQDA 4RZ6A 1L6YA 1THFD 1Q5MA 2IOQA 1JZ7A 1GEQA 3NQ6A 3L0GA 2PNOA 3LEVA 4W4QA 3VC6A 5BRPA 1WB0A 4K0DA 1ZBWA 4KH2A 3RRAA 1DHPA 3BJTA 1E6ZA 4AD1A 2GWWA 1JGMA 2OSYA 3BO9A 3AS1A 4H41A 4ZB0A 4GACA 3VE9A 2YDQA 3GAYA 3USBA 5A2CA 1AZ1A 3CH9A 2GWNA 4G5DA 4F9JA 4JTGA 2Q6ZA 3CTLA 3GH5A 3OZOA 3KYJA 3TA9A 3AG3C 2CZFA 4H2HA 3AZTA 3ZTMA 4A2RA 1XLAA 2OYMA 3I6RA 2CNWA 1NP2A 1RQHA 3NAVA 3EX3A 4G7HF 3JZEA 1JPIA 3R8HA 2A7PA 1P7TB 4LDQA 3P80A 5AHNA 3LGDA 4M56A 7ENLA 4GQ0A 3KUMA 4XIAA 5JVEA 3CAQA 3FGCB 1MUMA 4AB4A 1HY5A 2GGEA 3FEQA 1GORA 1IWAA 4W85A 2VOMA 2BVTA 1E0TA 4XBJA 1P7TA 2GGHA 2QMKA 1KBBA 1W3NA 1MMDA 2RDWA 4WGXA 3QHMA 4AWEA 2CWXA 3T4CA 2V30A 4M19A 4TIMA 4YN0B 1QQ3A 4Q4OA 4YTSA 1CBGA 2CLFA 1XLIA 1H11A 4G9PA 4ZA0A 4MVSA 3UWUA 2PGRA 3LV5A 1K3UA 3EWBX 1GGQA 4AQLA 1ELSA 2Z1BA 2WVVB 2UUHA 1DV7A 2WZIA 8XIAA 2VGIA 1O66A 3NQFA 4GVGA 1IYXA 2Z1KA