3B0VC

Trna-dihydrouridine synthase from thermus thermophilus in complex with trna
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
315
structure length
315
Chain Sequence
MLDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALLALSTKANREIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLMEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of dihydrouridine formation on tRNA
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase/rna
molecule keywords tRNA
total genus 108
structure length 315
sequence length 315
chains with identical sequence D
ec nomenclature ec 1.3.1.91: tRNA-dihydrouridine(20) synthase (NAD(P)(+)).
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01207 Dus Dihydrouridine synthase (Dus)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3b0vC02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3b0vC01
3LHVA 2QCEA 3EX3A 2J88A 4AHPA 1FXQA 4KFNA 1KLYA 3WJWA 2NX1A 1LBFA 1ME8A 3KHJA 4G1KA 1G7VA 2H6RA 2X30A 1LOQA 5I3GA 3BGGA 4MFEA 3EX6A 2YX0A 4ONVA 1TPEA 4OBTA 3STFA 1XCFA 3KFTA 3LRMA 3LV6A 5CPMA 3NGJA 1MEIA 2VOMA 1TRIA 4TR9A 2QUVA 3FYPA 4XTDA 1OFAA 3S1XA 3NXFA 1YDOA 2V2CA 5AHLA 1ZALA 2ZTKA 4AF0B 1YTEA 2X16A 1RZMA 2J24A 1XFBA 1L9WA 2Z0IA 1PS9A 3G0SA 1BKSA 4GNJA 3M7WA 1T99A 4OHQA 2X1SA 1TTPA 1ZAJA 1GVFA 4GUIA 3PC0A 1W54A 1T0OA 2QUTA 1KTNA 4YWIA 4GFSA 4XQ6A 4GUGA 1DJQA 3NEVA 3QMSA 4N4QA 5HMSA 3UWWA 5F4XA 3FIGA 1KTCA 3LGEA 2QUUA 3TIMA 1SZGA 2AGKA 2JKPA 4YXGA 1IGSA 2CLIA 3NPUA 5LNWA 3DHFA 3L67A 3MYPA 3L66A 4O15A 1GG1A 2G5WA 3C2FA 2R8WA 2GJNA 2ZA2A 3ABRA 3HMJG 3S5YA 1A50A 3MYOA 1FCUA 1GVRA 2YZRA 3LOTA 3B05A 3PWAA 1K7EA 3IVTA 2B0MA 1XKYA 4O12A 3W7JA 4UTIA 5D2XA 4WY0A 3LRKA 1Q6LA 1KFCA 3G0UA 2ZZ1A 3B03A 3QQ1A 3Q37A 5F2LA 4WJEA 3CLMA 2FB3A 3WK2A 1KM2A 4NJJA 1S5WA 5D04C 1DORA 1G4PA 1PV8A 4HN4A 2BX7A 5FEPA 2BWGA 3GXNA 4BWLA 5E93A 3BARA 4DBEA 1XL9A 2EPHA 3FYOA 4Q33A 3QW4B 4O50A 5DLCA 2ZYFA 1XDMA 1JQVA 2C0AA 4Z1DA 3TX9A 3ANYA 3GK0A 3IIOA 5F2IA 3TW6A 1OFBA 3L5AA 4YLWA 4MZ1A 3NQ7A 5HINA 3IGUA 1XBVA 2QF7A 4IOTA 1RD5A 1GZGA 2QDHA 1S3HA 3N9RA 4YMZA 1IXPA 2ZRZA 3TMLA 1IXOA 3DKLA 3BGJA 3W7QA 3W7LA 1HG3A 3PM6A 3T7VA 5BRBA 2GQ8A 4O10A 1O60A 4IMEA 4N02A 3TUUA 1VR6A 2NV2A 1FY6A 2VENA 5K4XA 3O16A 3P5YA 1JUEA 1EX5A 1YPIA 1OABA 3O05A 3FA5A 5HUPA 3KVKA 3QYQA 2V5LA 1OFOA 3LTPA 4NJHA 3E49A 2I1OA 4O18A 4MOZA 5EMUA 4O0ZA 4MJMA 3W85A 2FPVA 1H51A 3G1DA 2NUWA 3G1XA 2NXHA 5LNRA 2YXGA 4LW7A 5HR6A 3KVLA 4N4PA 2E09A 4K38A 2ZZ6A 4UC5A 1F74A 4UTTA 3M5ZA 3R5EA 5FF7A 5DBTA 3TFXA 1H61A 4L4LA 1GYNA 1RQHA 4UUIA 4DF0A 2CLEA 2ZQ0A 1KV8A 3P84A 3IIXA 5CZTA 3GZ3A 4O57A 1KFJA 3MBFA 1GPWA 3EWZA 2NWSA 1TSIA 1VS1A 5I3FA 3UZJA 3ABOA 2TYSA 5CPOA 1QO5A 4DO5A 4WY0B 1VH7A 3LCHA 1FQ0A 3CHVA 4N9CA 1YPFA 1PVNA 4O4WA 4BI7A 1V5XA 2HS6A 1TJRA 2A5HA 1KM3A 4JR5A 2G96A 3S5ZA 2V81A 4RXGA 1XXXA 4A21A 2ZDRA 1SW7A 4DBDA 4HPJA 1EIXA 3NG3A 4PFMA 5GVJA 3W2JA 1W0MA 1LORA 3C6CA 5FEZA 4RJEA 1GVSA 2A6NA 3ABSA 2BZNA 4FXRA 3MUXA 2DZVA 4BI6A 1BWKA 3W2LA 1SO3A 1JR1A 3OEXA 3VNDA 4K39A 5HUOA 5F4WA 1XDLA 1TTQA 3G3DA 3S0CA 1MSSA 4UXDA 4EF8A 4H3DA 4ORMA 3WFAA 4GWEA 3H54A 3ZWSA 4FX6M 4DEFA 4DXVA 4E0CA 1I8JA 1AL8A 2G97A 5A8GA 3GAYA 1R46A 3LLFA 1ICSA 1PCWA 3E0IA 4JS3A 2DZPA 2R14A 2C13A 2ABAA 1KM0A 2E5CA 3W7HA 4NXSA 1AG1O 3GDKA 4JGDA 1F7BA 4MYAA 1SW3A 3CU2A 2WQPA 3DENA 2OZ0A 1IXNA 3W70A 1R47A 3I68A 3O63A 3NQVA 3HJZA 3KOFA 1ALDA 4X22A 1WX0A 3EKLA 4O17A 5F1VA 1B4EA 3WJYA 1VCFA 4RZ5A 3CB8A 3W1MA 1W5QA 2OT1A 2UV8G 2ISVA 2R94A 1SFLA 2EAWA 2E68A 2CZDA 4JY8A 5CZJA 3B0UX 3NNTA 1XBXA 3DU0A 2EKCA 4KFOA 3C8FA 1C29A 1RV8A 4ZQCA 4KWWA 3TSBA 3VFLA 3W7NA 3UWVA 4UTLA 5CGQA 3W7KA 2GOUA 4UTMA 2BTMA 4A22A 3B4UA 3I6RA 5K2ZA 4NU7A 3EXTA 5D2TA 4UMBA 3PBUA 2NZLA 3S42A 3M5YA 4X3ZA 4I7WA 4JX5A 1TPUA 3S9YA 4HT3A 4OU1A 4RX0A 3SSJA 3MP5A 3G0XA 5KSWA 1JUKA 3U2OA 1W8SA 1JVNA 2GUUA 1DVJA 3CTLA 3UY7A 1WOBA 1RQBA 3TXZA 2QAPA 4QJ1A 4N6FA 4ADSA 5HWNA 1LLZA 4YL2A 4FIQA 4GUHA 4O4VA 3W73A 1EWDA 1Q6QA 4IGHA 5AC8A 4MY8A 4XKYB 2TRSA 1ZHAA 2YCEA 4NX5A 3NDOA 1K8ZA 3ATYA 1UASA 1TQXA 3W74A 5AC6A 2QJGA 3GDLA 1WBHA 3A23A 1PHQA 2B7PA 1WV2A 4JIPA 4ZQRA 5EA9A 3YPIA 3MI3A 4IPJA 3LBMA 2WV8A 4ADUA 3BK0A 4PEKA 3W7RA 2ISSA 5K9CA 3IIZA 2Z6JA 4K8EA 4J9JA 3WK1A 2A6LA 1WA3A 2O7SA 4HNTA 3A5FA 1LOSA 1NVMA 3SGUA 4K8HA 3HG3A 2GJLA 3FLUA 4OE7A 3CT7A 3MHUA 5EY5A 4NQ1A 4CNPA 1N8FA 3W1AA 4K37A 3FOKA 2E6DA 3O6CA 1B9BA 1SZNA 2CZ5A 1FCQA 3NVTA 3B06A 5D2YA 2Y6ZA 3W07A 2PRHA 3QSRA 3QSTA 3N34A 1TPC1 3EWXA 1YTDA 1F6PA 2YYUA 4BR1A 1SPQA 1LYXA 1ZFJA 1LROA 4MLJA 2P10A 3ZS4A 3CIWA 4UTWA 5LSMA 3G1YA 1YXYA 3KRZA 2I14A 1FWSA 3PY2A 5BW6A 3TKFA 2B7NA 3EKZA 2A7PA 3S8HA 2A0NA 3MI6A 1FUYA 4HSOA 3E96A 5D02A 2QCFA 5EYWA 4XUGA 3TJXA 3WK0A 3A5VA 1P1XA 2E5BA 3W7GA 1HL2A 1QDSA 1VYSX 5D38A 3W1RA 4AXKA 3QMRA 3DH7A 2JGQA 2JKEA 2YFOA 1TRDA 3EWWA 1VHNA 4R53A 3INPA 3I65A 4UTJA 3P74A 4MKNA 2LLEA 4XZ9A 4IPIA 4KWVA 2FDSA 4UNKA 3O1NA 4K7YA 2A2IA 3ELFA 4JTIA 4MYXA 3C2VA 2FFCA 3G8RA 4S1FA 5BNKA 5D32A 4I9AA 5G4WA 4LUJA 4U28A 2NWRA 3LDVA 2Q3OA 4JX6A 1GYLA 2H90A 3UWYA 3N2MA 3RF9A 2A7RA 3RMJA 5AHIA 4X9SA 1ZAHA 2C1HA 1QPOA 3P8JA 3T44A 1K02A 4RK8A 2ISWA 1W5MA 3JR2A 3KAOA 3UPBA 4AVFA 1KBIA 3TXVA 3HQ1A 4TIMA 4HKPA 1GEQA 3E12A 3TCEA 1QNVA 2B4GA 2DJXA 2C19A 1K7FA 2E6YA 3W1QA 5KZDA 1B4KA 1VJIA 1FXPA 2ZCGA 5J5RA 5DCDA 4FXSA 2CZFA 4ZQNA 3TH6A 3B0VC 1K03A 3HPZA 1UB3A 1VQTA 3W7MA 1KM6A 2QJIA 1MEHA 3W75A 4K6AA 1I2RA 5HR7A 3F03K 1TCDA 1OJXA 3PUOA 2YFNA 3LI0A 4R34A 3W2KA 3M9YA 3DFTA 1WYIA 3IVUA 4E2BA 3LV5A 3FKKA 1PHWA 5TBOA 4XKYA 5CZ0A 1VYRA 1W56A 5FF2A 5LNUA 2ZA1A 2DZSA 2WNQA 3LTSA 4Z0JA 2VFFA 2OT0A 1Q6OA 2FPYA 3SZ8A 4LY8A 3NL6A 3GDRA 1VRDA 3EWYA 1Q45A 5AN7A 1A5CA 1A5BA 4A2RA 3C3NA 3OG3A 5AHFA 5EPDA 2NUXA 1Y0EA 1JRBA 3W7EA 3W71A 3K30A 3W1XA 1VCGA 2WSQA 4POCA 4TX9A 2QCDB 3LCLA 3GR8A 2E6AA 1O5XA 5D03A 2WOQA 2YW4A 2Z6IA 3TU9A 3VCRA 3IIVA 3TAOA 4FO4A 3S1WA 2J27A 5FEXA 1WOAA 1DQWA 3LLDA 1SSGA 1OVDA 2NUYA 4D2JA 3U8GA 1LZOA 4S2CA 1VPXA 3L68A 3CPRA 3S1VA 4WX2A 1UUOA 1XUUA 2ATSA 2QCLA 1KFEA 1HUVA 3DXIA 3PR2A 2VEKA 3EX1A 3JS3A 3THAA 3P60A 4IMCA 1GVOA 4XTIA 3HGOA 4JYEA 3S5NA 5BMWA 2Y63A 5LKYA 4IJBA 4GXMA 3W7CA 2Q8LA 1HFBA 3NQAA 2XN2A 1CI1A 3TDFA 4OT7A 3MP4A 3W76A 3W2MA 2CLKA 1G69A 3BO9A 1TV8A 4NJGA 1XI3A 3PB2A 3NQ6A 3EEGA 2VXNA 4JD4A 3PSWA 1SR9A 2VC6A 4MVAA 1GTHA 3P5ZA 3PUDA 1T96A 3V1PA 1ZCOA 5K7JA 4FX7A 3LHUA 4RCXA 4MY9A 3LTYA 3WJZA 2J6XA 3LXCA 2YPIA 3TC7A 3RNDA 3W7OA 4IX0A 1QAPA 2OMAA 3UYCA 1HO1A 3DFQA 2BSLA 3L0KA 5HQEA 4QSHA 1UCWA 3TE9A 3LHTA 3ZR4A 2GVGA 4UFJA 1DQXA 1LOLA 5AOUA 3RU6A 1KW1A 2YYTA 4P61A 1QOQA 5IM51 1R2TA 4OQVA 1OFEA 2Y85A 1D9EA 4CCDA 1KV5A 2RHGA 2I9EA 2J9XA 1BWLA 1XUZA 4M7TA 3BG9A 3F4WA 1X8FA 3W7IA 3DKJA 3W1PA 3MO7A 4WOZA 2ZBTA 4WQ6A 1TPB1 2XFWA 3TMQA 5TQLA 1NF0A 4PH6A 5DCEA 1ZNNA 2DZWA 4Y90A 1KLZA 3G1FA 2BLEA 1T8XA 1OFDA 4Z0SA 2WNZA 3NYZA 1FWTA 3TQVA 4LVAA 1AW2A 3NQ8A 3B0PA 1KBJA 4BFAA 3BG3A 3PB0A 1VLWA 4ZZ9A 3LXAA 4ZMGA 2C14A 3NR0A 3HGJA 4IWWA 2QCCA 4PA8A 1FDJA 1EP3A 1M5WA 1K3UA 4FNQA 3USBA 2V0TA 1EUNA 3G1SA 2P0OA 1GTEA 1OF8A 5IBXA 2GQAA 3HPXA 2QR6A 4LS2A 2FQIA 1OX4B 3QH2A 4UFIA 1DBTA 3N9SA 2DZTA 1LTDA 3M6YA 3STGA 3TW7A 1JULA 4IXXA 3T78A 2NX9A 3O6YX 4JTSA 4ZQOA 1LDCA 3DFSA 4O19A 2P1FA 3LXBA 3QEZA 2EGZA 4EIVA 2VEIA 3KX6A 4DF1A 3CQ0A 1LRTA 4NZJA 4KKXA 1SZEA 1O95A 3N19B 1W1ZA 5AC7A 2C3ZA 3GR7A 1SU5A 3W2NA 2W79A 2QDGA 1IXQA 4LWWA 5I3KA 5C2XA 6ALDA 1EUAA 2CLLA 1N7KA 4JTFA 3PVFA 2QKFA 2X1TA 1KFLA 3DFPA 1SO5A 3I7SA 3STCA 3V75A 5LHFA 4PODA 5FF0A 5ABTA 3TFCA 5CG7A 3MW7A 3LERA 4FNSA 2EF9A 1N55A 4TU1A 5DBUA 2Y62A 2ZFAA 1EEPA 3ZFHA 3L0GA 5FI8A 3SFKA 4JTTA 2H3BA 1R30A 2C15A 2NX3A 3G1AA 4LOCA 4Y8FA 4BI5A 2V30A 3LCGA 3L65A 4XBSA 5L6UA 4LNYA 4DPQA 3NQDA 1KM1A 3P62A 3GDTA 3L0NA 3L9CA 3SI9A 1TREA 1GWJA 2HS8A 4FNRA 1JQXA 3NAVA 3E02A 1L6WA 3P80A 2NXGA 4ZQMA 3R89A 4HNVA 2ATMA 3NPXA 3MP3A 4GE8A 4Z1CA 3CWNA 2VELA 7TIMA 2V82A 3QQ0A 2O7QA 2KZHA 4UFLA 4M6QA 3OVRA 1OX5A 3LHZA 3RLVA 4AMAA 3GXTA 4O52A 2HTMA 1FCVA 2OCZA 1J4EA 3W23A 4PTNA 1XM3A 1TPH1 4R7JA 1ME7A 3SY5A 2X1UA 3LM7A 4Q4KA 4LVFA 5KITA 1X1OA 1LP6A 8TIMA 4FNUA 2ZZ5A 3TK7A 5KMYA 5F1UA 3TQKA 4FNTA 2QCNA 2B7QA 1M6JA 4NUWA 1OK6A 5CKSA 3GIYA 1AW1A 4EOUA 1TPVA 1CW2A 3P61A 1IF2A 2ZRYA 5C5YA 3BLFA 4O11A 4XBKA 1DJNA 2E1DA 4IX2A 2AQWA 1NF7A 3STEA 3SECA 3CEUA 3R8RA 4UFHA 3NQCA 4MFDA 3Q94A 1H7PA 2PURA 3DFNA 3QMTA 1TIMA 4IMDA 3W9ZA 3N14A 1XBZA 4MJZA 1THFD 4UIOA 5D30A 4LS0A 2GQ9A 3EXRA 4GBUA 3PBVA 2JBMA 3QJAA 4O14A 5EBUA 3R13A 4LT9A 4O1CA 1W5OA 3H53A 1F73A 3RLUA 3G3MA 2WSYA 3NPVA 4MLRA 1DKWA 2VFDA 3C56A 3W6YA 1HO4A 4JTLA 4MUZA 1PIIA 3FKRA 3OHIA 1UUMA 3NQ2A 4DPPA 1H7NA 1WQ5A 3D0CA 3EX4A 3PBYA 2F7FA 3ABQA 2GVJA 2Y88A 3DAQA 1B57A 3RFAA 1U83A 1W5PA 4L4MA 5IBXC 3SGZA 1SSDA 3ZWTA 3GLCA 3S6DA 4Z08A 2YSWA 2V9DA 4CCCA 4JTUA 2E5DA 4OV4A 4BF9A 3TROA 2PCQA 4AH7A 1TYGA 3VE7A 1TPDA 1QO2A 4Y9AA 1YDNA 4UFKA 2QCHA 2XN1A 5LGXA 5T26A 3OVPA 4I7VA 5D09A 2ABBA 2DZUA 5DY2A 4Z1AA 3MI2A 1QOPA 3TSDA 5FEWA 4IUOA 2CLFA 4RZ4A 5D2VA 2ZRVA 4JTHA 1L6SA 3P82A 1L6YA 3NL2A 4FEZA 2HSAA 2QCGA 1VC4A 5DXXA 4QM1A 2FB2A 2ZRXA 4WD0A 4R33A 3WK3A 1GOXA 5DN1A 1FX6A 3W7DA 3NM3A 4NX0A 3BW2A 3HO8A 4N9DA 1H50A 3CC1A 1L2UA 3DI1A 3NM1A 3S5OA 5H91A 5AYZA 1I45A 4ICNA 5KZEA 1K7XA 1SO4A 3B8DA 3N73A 3TJLA 3QC3A 3GKAA 1NAL1 3O8AA 3QM3A 1OYCA 4ZQPA 4LTSA 3UZ5A 4O0KA 3LCIA 1EP1A 1QMLA 2RFGA 1EP2A 3N2XA 4HSNA 3W88A 3LCWA 1V7YA 4HHPA 3BW4A 4JTEA 3GYEA 1AW5A 4BWLC 5D37A 3TSMA 3HG5A 1H60A 3UQNA 4O13A 2VFGA 3W72A 4O8RA 2WPBA 1I2QA 3MJYA 2R91A 1MO0A 4AWUA 3HBLA 3L5LA 1G4EA 3SW6A 4JTGA 2Y61A 1ZENA 2ZRWA 4JXCA 2CWNA 4NJIA 2Z2UA 4RXFA 2Z1BA 4JTJA 1ONRA 2YW3A 2BXVA 4JTKA 2G95A 2GPTA 1Z48A 4NNBA 4UCGA 3EB2A 1G67A 3O06A 4JEQA 2ZZ4A 2H3DA 3PG9A 1P5BA 3DGRA 3LRLA 3M47A 4AHOA 5AFDA 4DO4A 1NFBA 2Q8ZA 3BV4A 2D73A 3O07A 5EL1A 2CW6A 4TMCA 4EWND 3A9IA 3C4UA 1LRNA 5CPNA 3VKJA 3IEBA 2TSYA 3LCXA 4H6KA 4W9TA 1KTBA 3BLIA 1DHPA 3P81A 3BVJA 4M6PA 1ZY9A 2YR1A 3WJSA 2PRMA 1FWNA 1JCLA 2VFIA 4OGZA 1SZFA 2VEPA 4B5NA 4LRSA 4O16A 4AWSA 3KVJA 3IRDA 1OHLA 3MMTA 4NXKA 4LC8A 3PAJA 2QEZA 3LHWA 4WY0F 1F6KA 2QAFA 2RDWA 1YYAA 2TPSA 3HOJA 2PE4A 4GC4A 3NOEA 5C55A 2ZTJA 4K36A 3BW3A 3FFSA 4O28A 2FIQA 2H8ZA 4UTTC 3FEMA 2J9YA 3BG5A 3P67A 3W86A 3CWOX 1H63A 5DY3A 1VLIA 1QPQA 5G5IA 3MWAA 3P8IA 1JCJA 3M5VA 3HB9A 1M7PA 1Z42A 3DI0A 3C2EA 5U4NA 1S5VA 2DZXA 1H7XA 5E1QA 1KFKA 3GNNA 4UR7A 2RDTA 3N3MA 4LUIA 2C6QA 3UWUA 1ICQA 1LRQA 4C1LA 4UTKA 4OV9A 4LU0A 1H5YA 4M5PA 2E77A 3QPYA 1W3NA 1KM5A 1U5JA 3LBCA 3VI2A 1O4UA 4Y96A 2DORA 2E6FA 1JJKA 2J9ZA 2DJLA 3M16A 1DL3A 5D33A 3NO5A 1PL9A 2ZA3A 5AHEA 2FPTA 4UMAA 4ML9A 2VFEA 4C1KA 1G4SA 5HWMA 5CSSA 3HG4A 3PULA 2C18A 1D3HA 1UBSA 3DBPA 4LVGA 4AB4A 4E2DA 1G4TA 2YDAA 3VE9A 1LLWA 3M1ZA 3W83A 1H62A 2X2GA 3QRHA 4UMCA 1OFQA 1H7RA 5BMXA 4DQWA 4S2BA 1R2RA 6TIMA 3U6WA 5AHNA 1GJPA 3IV3A 5CZSA 1TPFA 5K3VA 1W37A 3LI1A 4A29A 4N2YA 4FHAA 1EPXA 1VZWA 4CQ8A 4CNNA 1LCOA 4JNMA 4QNEA 4RKAA 2CLHA 1P0NA 3PS7A 5MHBA 3T55A 4LRTA 5F2MA 1LBMA 4E38A 1AK5A 2Y7FA 1UJPA 4Y6GA 3EWUA 5FESA 4JICA 1Q6RA 4PC8A 4CNOA 3CM4A 1K8YA 3W1LA 1RR2A 5G1TA 3PG8A 3TA6A 4LV9A 4PCFA 3L21A 3TQ0A 1TB3A 2Y70A 1O94A 1H7WA 2NXIA 1W5NA 5D2WA 1TTJA 2FTPA 4NNCA 4EF9A 4PL2A 5KZMA 3G24A 1WDWA 1KA9F 5HULA 5AYXA 1NSJA 4AEOA 1X1ZA 3GNDA 2V8ZA 2Y89A 2ZZ7A 4JN6A 3SJ3A 5HNRA 1OYBA 4N9BA 3PUEA 1E51A 1K8XA 2RH9A 4UFMA 1TO3A 4UNLA 1OFPA 2W0UA 3NZ1A 1YADA 4ALDA 1WXJA 4NNAA 4UR8A 3GVGA 2VEMA 2PC4A 1I2OA 1OX4A 3OVQA 4ZVJA 1YLVA 4JDBA 4FB7A 4UTWC 2AAMA 2VKZG 3W87A 4O1BA 3GXPA 3W1UA 4WXZA 1W3TA 1JUBA 3LX9A 4M7SA 1TQJA 3EWBX 4HNNA 3M41A 4CQ9A 1AMKA 1KFBA 1ZJIA 3HF3A 3QF0A 4O53A 1YXDA 2CLMA 1X7FA 2GVLA 1F05A 1Q3NA 5L9FA 5I3IA 3T4CA 2DP3A 3HIJA 4FX8A 3F1QA 4KFPA 3NQMA 3EX2A 2C16A 2WO5A 5I3HA 1VCVA 5LGZA 3NPWA 3AJXA 4NJKA 4JIQA 4BK9A 3QW3A 4O1DA 4O54A 3BLEA 1QCWA 3PBWA 2YGYA 1IIGA 3W2UA 4QAIA 4AF0A 2CLOA 3LCFA 4PL1A 5A5WA 2DU2A 1I2NA 1PCKA 2ZZ3A 4NVTA 4MZYA 3JRKA 1M7OA 3UXDA 3AO0A 4WXYA 3M0ZA 5K4ZA 3F4NA 2A7NA 4Z1BA 3FS2A 4QITA 1C9DA 2Y7GA 1OF6A 1OYAA 1H1ZA 1NEYA 3Q58A 2TMDA 3OA3A 1A5AA 3W84A 1TMHA 3DZ1A 2IQTA 3M44A 3UWQA 3GDMA 1PE1A 1TV5A 5EKYA 3I7RA 4A3UA 3TNOA 4RLIA 1FCBA 1QPNA 2RDUA 3C2RA 2FJKA 1BTMA 3BPWA 3O6DA 1WAUA 3W22A 5LHEA 5H2ZA 5G2HA 1MXSA 5I3JA 5AHMA 1F2JA 4GJ1A 3THQA 4N6EA 4H4IA 2OJPA 4LS1A 3MHGA 3QZEA 4NZFA 4JDYA 1SO6A 3TC6A 3O15A 4FF7A 2NLIA 3R12A 3M5XA 5C54A 5G2IA 3QPZA 5G4EA 1QPRA 3G1HA 4DO6A 5D05A 1DV7A 4LV4A 4OWGA 1KM4A 3IGSA 4N9EA 1VYPX 4ZL1A 1HTIA 2X1RA 1GT8A 5LZLA 3M43A 3DHDA 1OG0A 1I2PA 1F5ZA 3DFOA 1JCNA 4TMBA 3HGRA 1DOSA 3CIXA 4HPXA 4AAJA 3G18A 2V5BA 5LNVA 1R2SA 3KXQA 5KTLA 1Z44A 4I7UA 1Z41A 1FWWA 1RQEA 4IQLA 5U7SA 4UTHA 1JCMP 1ADOA 2A85A 3GAKA 1VGAA 2QJHA 4QQ3A 4QISA 5CPLA 4GRSA 1AL7A 1OFRA 4M19A 4X2RA 5DXYA 2ZZ2A 3TV8A 3PSVA 2A21A 1W31A 3KVMA 3UD6A 4MY1A 3E9AA 3LB0A 2F84A 2A1YA 2W6RA 3NZRA 1JRCA 1WBJA 3TR2A 4MIMA 5FF3A 4YCPA 1TV7A 4XWUA 3UPWA 1GVQA 1LBLA 1TJPA 2H8XA 3P7YA 4YCOA 1EB3A 4IMGA 3GX9A 1EA0A 1BEUA 1FDYA 4Q32A 4CQAA 5AB3A 4GUFA 3FJLA 1TPWA 3G1VA 1A5SA 2NV1A 3W1TA 1S5TA 5F2GA 4K7VA 3W7PA 4NT0A 1FWRA 4QIUA 3NL3A 1QWGA 3OIXA 2CFFA 4ORIA 1A53A 2WSRA 1QFEA 5CSRA 1XC4A 5DCBA 5G1YA 4AWTA 2EHHA 1F76A 1O5KA 1J2WA 4AHQA 5F4SA 1SUXA 5K9XA 4A2SA 1YXCA 1D3GA 3SIZA 4U4MA 4JYDA 1J5TA 1I4NA 1RVGA 4WZHA 1SW0A 1VHCA 3NQEA 4GUJA 1LM1A 3IGXA 4RR4A 3SR7A 3I7QA 1G6CA 2RKXA 1SFJA 2PRLA 4CLMA 3H55A 1CX9A 4LC6A 3C2OA 4JYFA 3MHFA 3OBKA 3ATZA 3GB6A 3PF3A 1GG0A 1X6UA 4FIRA 3Q2DA 5FF4A 3KRSA 3G8EA 1YTKA 1FBAA 2FLIA 4IXHA 4UTUA 3A21A 1EWEA 4QNWA 5KINA 4TO8A 2WKJA 3L2IA 3HPSA 5TIMA 3B04A 1H7OA 2ZRUA 1H1YA 1G7UA 1MZHA 5SWUA 3T40A 1TTIA 4HNUA 2JGYA 2CU0A 2CZEA 1RPXA 4HIBA 3W1NA 4ADTA 2V2DA 5LNSA 1P4CA 3WJXA 5AYYA 1W3IA 1ZAIA 2JK2A 5HWJA 4WOQA 1ICPA 3NQFA 2OX1A 3UY8A 3A24A 2A4AA 4MPQA 4JX4A 3HGSA 1ME9A 1JCXA 3TAKA 2QCMA 3CEPA 4LVDA 3A22A 3HG2A 5G2WA 1B3OA 3G22A 3NQGA 3NL5A 2WJZA 3UWZA 5HJLA 1MEWA 2QCDA 1OK4A 3LHYA 2XN0A 3IIPA 3C61A 1P0KA 4RZ6A 4RV8A 2Q3RA 4IMFA 4CCEA 5C6MA 4LVBA 3W3OA 4M6VA 4DF2A 3RK8A 4JY9A 1SQ7A 2ALDA 1FDZA 4DELA 3S1UA 1JCYA 1YDVA 5BOOA 3UXAA 2JKAA 3QFEA 4FNPA 4O1AA 4EVZA 2Y7DA 3C52A 4P2VA 1ML1A 1XBYA 5DELA 2Y7EA 3UNDA 1QR7A 3EXSA 3R2GA 4WUIA 2VFHA 2V2HA 3MBDA 3KRUA 2B7OA 2WNNA 5E0KA 3GKFA 3NA8A 2HMCA 5K9DA 1GQNA 3IVSA 1OX6A 3C0JA 1C8VA 3L5MA 3FJ6A 5J5DA 4MZ8A 1IIHA
chains in the Genus database with same CATH superfamily
2QCEA 3AWOA 4B3LA 1O5QA 4XEKA 4KFNA 2PDHA 1G4US 1LBFA 1M65A 1ME8A 3KHJA 4S23A 2H6RA 5I3GA 1CGME 4BF7A 2YX0A 4MNKA 4Q7CA 1XYBA 3KL3A 1XCFA 3KFTA 3LRMA 3LV6A 4IISA 1W1A1 4NC3A 1MEIA 5A8PA 2J45A 5DMLA 4XSLA 3FHAA 1DYSA 2QUVA 3A64A 4H1ZA 3LQLA 5ABGA 2HVMA 1N1CA 3S1XA 1YDOA 2V2CA 5AHLA 4ML4A 3SUVA 3SY8A 4AF0B 1AQFA 3KWSA 5AZ0A 4PR9A 1TWSA 3G0SA 2R25A 4O8AA 4GNJA 1T99A 3N2BA 4S3GA 1ZAJA 2PTXA 3AYTA 1GVFA 2Z27A 3PC0A 2PFDA 1UD6A 3BJTA 3G1RA 2ISFA 1KTNA 1W1VA 3THUA 3WD1A 1F3XA 5F4XA 3FIGA 2OR2A 4KBXA 2ESCA 4FR1A 3TIMA 3ASNC 4D8ZA 2OOCA 2JKPA 4YXGA 1TVPA 4ZBCA 4FWVA 1IT8A 2A3BA 4PMYA 5KYXA 2BL2A 3SIMA 2V5KA 2ZXQA 4H8UA 2BGNE 1GPFA 4BCEA 1FH7A 2GJNA 4A3YA 3PCVA 3ABRA 1ISVA 3MYOA 3U2MA 4G7FA 2OELA 1ZJBA 4Y9NA 1GKQA 5C9RA 3KKBA 3KCLA 3IVTA 2GGIA 1XKYA 1HMDA 2F9RA 1BD0A 4UTIA 2R1PA 1XIMA 1R86A 1FA2A 3LRKA 3UZWA 3W24A 1KFCA 2OLHA 3E74A 2G4JA 3EMZA 4PUNA 3SSZA 4L7ZA 3H2FA 4NP7A 3FAJA 3WK2A 1S5WA 1PV8A 1G4PA 2PD5A 4XG1A 2R7QA 4PEEA 1J0IA 1A0EA 4L65A 1Q0MA 5DLCA 3ARUA 3ANYA 4A8IA 4Z2GA 3AMDA 4C6KA 2WJFA 1S2UA 3NQ7A 3WDJA 3QOKA 3QVZA 3VC6A 4JW1A 3EPMA 4W4QA 4IP5A 3UZYA 2CESA 4C6NA 5CAKA 1PIFA 2WXDM 5A95A 5LIUX 3VCCA 3TMLA 1OQFA 4EBBA 2FZMA 3M0XA 4M82A 4X63A 4O10A 1FWHC 4QJ4B 4IMEA 3ZT6A 1UIOA 5C70A 3OLGA 2IXOA 2CCYA 4NTFA 1YNYA 5K4XA 1GS9A 5HANA 1JUEA 1EX5A 1XH0A 3WBAA 1XLKA 1OY0A 3E38A 3KVKA 3QYQA 3LTPA 4WJ8A 3E49A 2YDRA 1UP0A 4HFKB 4J2PA 2OQHA 1AUEA 2INZA 3UNTA 1KO0A 2NXHA 1KXVA 3KVLA 1V0NA 3VGFA 1Z7AA 1NDZA 3TW9A 3AGTA 2WLYA 2G50A 2ZZ6A 4UC5A 4AG0A 1F74A 4UTTA 1QVXA 3M5ZA 3O2LA 5H8UA 4M1RA 3R5EA 1OG6A 1H61A 3CLWA 3UMHA 2OXNA 1FWDC 1KV8A 3IIXA 2AQOA 3UF9A 2Y8VA 3UCCA 2DY3A 3VDCA 3VKBA 4MNLA 1PDZA 3N4FA 5XIAA 4JTQA 1A5LC 4WY0B 4LXFA 3US6A 2Y0FA 1V55C 4EIYA 1TUFA 3VOIA 5BXSA 2QIIA 3WLTA 1IEVA 3LAYA 4EE9A 1LUCA 4BI7A 5CLWA 2G96A 3S5ZA 4RXGA 3CH9A 4BQ4A 1U0BB 1XXXA 3FV9A 3PMRA 4NIRA 3VC5A 2O55A 3LEOA 4DBDA 4K2SA 1SMDA 1JAFA 1Y65A 4WJXA 3UBPC 4F48A 3NRHA 2XGZA 4MMWA 4Z2KA 3OODA 1LORA 3RYSA 4RJEA 1GVSA 2FMNA 3UA3A 2A6NA 3NSMA 1Q63A 4MKSA 2VRQA 3NUKA 3MUXA 2VRKA 3B8SA 2RUSA 3RH3A 2DZVA 3SN4A 1BWKA 1SO3A 3WQVA 1LI5A 5HUOA 1I75A 4L9ZA 1FR0A 5JXQA 3S0CA 1YYJA 4EF8A 3GG1A 3KMIA 3WFAA 4GWEA 4YU1A 3H54A 3ZMRA 3T2PA 1RJPA 1I8JA 2ZXPA 3LLXA 1OB0A 2KSFA 3M0HA 1PDYA 4CVUA 1PCWA 5AGFA 5CPSA 2OWWA 1TMQA 1KM0A 1ZBKA 1MDRA 1VOMA 3GDKA 1I1WA 4MYAA 5L0GA 3SNHA 3S28A 3CU2A 1UA7A 2OZ0A 4PUMA 1JEZA 4GI4A 3O63A 5LXXA 1TWHA 2RAGA 3KOFA 3DC8A 1JPMA 4ZSTA 3WJYA 4P9TA 4XSMA 4UWMA 5A2AA 3W1MA 2Y24A 4L9YA 1SFLA 2EAWA 2QXWA 5CZJA 4DJFA 3KDNA 5COGA 3EGDA 3W8IA 2DT3A 3VKAA 3ZVRA 4FOKA 4KWWA 3VKCA 3LY0A 5GJPA 3GZAA 2MUCA 1R38A 4UTLA 4DRJB 1KKRA 2GOUA 3APTA 3UR3C 3C86A 4UMBA 3GDBA 2EJAA 2QUPA 1CWYA 3VDHA 3M5YA 2JD3A 4LDQA 1RCOB 3G0XA 3MY9A 3BLPX 3U2OA 1W8SA 1JPHA 1HT6A 1C90A 3QKEA 3TXZA 2ZUTA 4N6FA 1HKVA 1LLZA 2FFIA 3W29A 4FIQA 2FZNA 2XVNA 2DYRC 1Q6QA 1WE5A 2OO6A 2TRSA 3UZXA 3OP2A 1ZHAA 3UXLA 1AD4A 3T1GA 4E0IA 1K8ZA 1RLCL 1TQXA 1UASA 2FKPA 4ACZA 3NQBA 5CSUA 4D6EA 3A23A 3N6JA 2B7PA 1VYIA 1KXQA 5FAGA 4JIPA 1Q6GA 3IRSA 3MI3A 4KEUA 3CZKA 5DT7A 1OW6A 1SYQA 4PEKA 3W7RA 3C0SA 2ISSA 3VIOA 4K8EA 1W9UA 3UG5A 1WA3A 2PLCA 3A5FA 2HKVA 2CNCA 2GJLA 3EWDA 3FLUA 4ULWA 3MHUA 4AE4A 2GOKA 3MKVA 1E5NA 2E6DA 1SZNA 3GS6A 3EA1A 4LB4A 4G56A 1TA3B 2R9RB 3BAYA 3L2MA 3NZQA 1TPC1 1OKKD 4H41A 4D9PA 3AISA 4MLJA 1LROA 1UC4A 3L4YA 3H8AA 3ZVIA 1TE1A 4C7GA 2X0SA 3Q45A 4WRHA 2I15A 1UYQA 4LAMA 3KZSA 1WASA 3C0QA 4JEAA 2WSPA 3KRBA 3PTMA 2P7VA 1ONXA 3JT1A 3E96A 2V26A 3ID7A 4XUGA 1M04A 3WK0A 3O6XA 3KBVA 1ZHYA 3A5VA 3ZG1A 1P1XA 3DM9B 4C60A 1HL2A 1EQPA 3TJ5A 4M24A 2BY3A 1VYSX 1HE1A 1GOIA 3W1RA 3CUHA 3OGVA 2JGQA 1US0A 1TRDA 2J6VA 4R53A 3INPA 2PBGA 4UTJA 3CUGA 4XZ9A 3KOYA 1ZS2A 5AYBA 2RGLA 4W8LA 4K7YA 4BKNA 3C18A 4O0QA 3DX5A 3RO6A 2BP1A 5EMKA 2HVNA 3G8RA 2REQA 3HTWA 2ZE0A 4DWSC 2VC5A 2NG1A 5G4WA 4U28A 4Y8EA 3MSYA 4OBSA 3K4AA 4JX6A 2Y3BA 2PDGA 5CJMA 2H90A 4M81A 1Q66A 3CYVA 4P7RA 3M0LA 5AHIA 1NOWA 2WBKA 3G2GA 4L56A 2D22A 4I5RA 1K02A 1AA1B 4W85A 3AHTA 3JR2A 2J62A 3KAOA 1J11A 1BPLB 1KBIA 4LYRA 3HQ1A 1QI3A 2WVVB 4IP4A 3TCEA 2E6YA 3GXDA 3CUFA 4KPLA 4RZBA 3O10A 5J5RA 4FXSA 2A3CA 4D1JA 4V1XA 1UB3A 2HV5A 3KLLA 2XLDA 1Z89A 1Z32X 2V3GA 3N04A 4IIFA 1I2RA 4J5NA 1RY0A 2YFNA 3LI0A 4ROQA 4R34A 2XH7A 3LK6A 4QDPA 3DD7A 3FKKA 1P43A 2O92A 5CZ0A 4JQ1A 1VYRA 5FF2A 5LNUA 2GJXA 4IFKB 2DZSA 3GR4A 4Q6XA 2OT0A 2ICWG 1IWAA 3CL8A 1Q6OA 2FPYA 3SZ8A 3C3UA 3GD6A 3NL6A 5DVWA 1W1IE 1V6UA 5AHFA 1V6VA 4D6HA 1ZJHA 5IXEA 1JRBA 4LH8A 3W1XA 1DWFM 1CGVA 1L6FA 1XWYA 3NYDA 3ZVHB 3ABKC 1C8QA 1PJ9A 1KGWA 4O1FA 3RXZA 1PTDA 4I8DA 1GQKA 4IGMA 3TAOA 2M4EA 5AKQA 3CUZA 3FY1A 3LLDA 1X8CA 4RDVA 5E0CA 1SSGA 3QV6A 3FSUA 4D2JA 1YZCA 3L68A 1U2YA 2X41A 1ZHTA 1UUOA 2ATSA 2QCLA 3H2UA 4X9YA 5HMFA 2VEKA 3EX1A 1EGVA 3MQTA 1SMAA 3P60A 5FSEC 3ZSSA 2P53A 4JYEA 2PDKA 3CIVA 4HP5A 4H9VA 3KWXA 2X7VA 1W2VA 1HFBA 5L0FA 3NQAA 2XN2A 3WF1A 2C04A 1MNSA 3MP4A 4AC7C 5BU6A 4HK6A 2PZNA 3VNJA 3WH8A 1TV8A 3VGEA 4YK5A 1LS4A 1Z9AA 2WZHA 1POKA 1S3TC 1D3CA 1SR9A 2VR2A 2VC6A 1X97A 1T96A 1BKHA 3VK5A 4NAFA 4PJJA 4NQFA 4RCXA 4URIA 4MY9A 1HZYA 4GMEA 4EBJA 3ARRA 3GY1A 4JVSA 3SZRA 4PULA 1FAPB 2OMAA 1HO1A 3L0KA 4AZCB 3TE9A 4OKDA 7PTDA 1W1TA 5I06A 3AXIA 1HQTA 4US6A 2GVGA 3N2ZB 3W25A 5H6HA 4DUOA 2J25A 2HFIA 3WDPP 2XS1A 5M2FX 1QOQA 5IM51 1C7TA 2PFHA 5T91A 2GGHA 4CCDA 5T9BG 1KV5A 2I9EA 2D2JA 4DVOA 2J9XA 1BWLA 1NFNA 4M7TA 3NJ3A 2W4BA 3VNLA 4P9FA 3MO7A 4PMDA 3WUEA 1MUMA 4WQ6A 1OD0A 2IXNA 3JZ0A 4PFHA 4IAOA 4XPXA 3A9BA 3SCRA 4MF4A 1AMYA 1R3QA 4Z0SA 1E2XA 5FJJA 3RX2A 3KBNA 3NYZA 2Z1SA 2Y8KA 1PWLA 1W9PA 1KBJA 4BFAA 4MVQA 3BG3A 4BJ6C 2DFAA 5E6ZA 4O6YA 2YRFA 5I07A 2HQAA 1KB3A 1UWRA 1DE5A 4DLMA 1GGQA 4S3DA 2CLPA 3H2OA 4FNQA 4LDKA 2V0TA 1EUNA 4FAMA 1OF8A 2VVNA 3ALFA 1XLEA 5EMMA 1JI2A 2KAUC 2L81A 2WMGA 1LTDA 4IXXA 2X7WA 1F61A 2NX9A 3O6YX 1FFTC 2D3LA 1YBQA 2VURA 4JTSA 1UD3A 1LDCA 3LXBA 2EGZA 4EIVA 5EFDA 4NZJA 4KKXA 3RRAA 1O95A 1EI7A 1CEOA 1FHUA 2ZADA 4PB4A 2AWCA 4LY4A 4G0HA 1B3YA 2FVKA 3BCJA 1P7TB 1I1XA 3U2CA 1HGYA 1XIBA 2Y3GA 3FOPA 3R1ZA 2QKFA 3O6AA 2X1TA 4Z17A 1VYKA 5LHFA 4PODA 2GGGA 1IEQA 4MJ2A 3T0DA 2Y62A 1EEPA 1M7JA 5CC5A 1UH4A 3L0GA 1FMWA 1RLDA 3DHUA 4ZODA 3SFKA 3DC0A 1RVKA 1E9ZB 1R30A 2C15A 3U9MA 3G1AA 1UP3A 4Y8FA 3LCGA 3WENA 4J7YA 3S9OA 4DPQA 3T6BA 2Y1HA 3H2EA 1F3EA 2TODA 3UYIA 4HQVA 2PU1A 2MNRA 2PDXA 4ZOCA 4FNRA 3RR1A 3P80A 4E3VA 2XH2A 4HNVA 2ATMA 3NPXA 4GE8A 4Z1CA 1DWHM 1VF8A 3QR3A 3V3WA 1YJGA 5T3TA 1BHGA 2V82A 4JHZA 1SJDA 5FJRA 3ZTZA 4M6QA 1S2WA 3LHZA 3ZO9A 5GPRA 3GXTA 5TAOA 2BFGA 1E40A 2GWWA 2JF6A 2ZUUA 3FDKA 2QLYA 1TPH1 1VB5A 3LNRA 4R7JA 4Q4KA 3BTNA 2Q00A 1LP6A 2QV4A 8TIMA 4FNUA 4M80A 3TK7A 2XIIA 4FNTA 3WBXA 3LNMA 1EJUC 2VR5A 3PZGA 1O66A 3I5PA 4L6OA 3G4ZA 1AW1A 3VNIA 2YBTA 3P61A 1XCXA 4D8AA 1LWJA 5CC3A 3UJSA 4J35A 1CXKA 1JDCA 4XBKA 3TOMA 2JPUA 2AQWA 1POJA 1J0JA 3SECA 1E4MM 3GWQA 4XZLX 3R8RA 1CPQA 1HL8A 1XYZA 4UFHA 1IR2A 1ECQA 2ACRA 3JW7A 4C5YA 1TIMA 3LG3A 1WCGA 1THFD 4UIOA 5D30A 4LS0A 4GYJA 2DSUA 1ITQA 4JURI 1GYMA 1VRXA 4KWSA 4O14A 3GVRA 1RKCA 2R7UA 3R13A 4CN6A 4O1CA 1W5OA 4KEVA 5JVLA 3ITVA 4C5ZA 5ECVA 1WXYA 5AECA 3BMXA 4Q8MA 4GBDA 2YHSA 2C1IA 1JF6A 2VRJA 1T41A 2D24A 2NQZA 3C0LA 4PTMA 2EEXA 2GJRA 4DZ5A 3C56A 4LGXA 1HO4A 2J66A 4E8DA 4MUZA 3JU2A 1WXZA 1XICA 4WF7A 3OHIA 3V5CA 3WLLA 4DPPA 2J79A 1ZUAX 3PBYA 3D0CA 3EX4A 2GVJA 1K8CA 1D1CA 3N15A 3DCPA 3RFAA 1BRLB 1TUXA 1Y7VA 3L4XA 4GIYA 1ZCCA 1XG3A 2V9DA 4J3TA 4CCCA 4JHOA 3N2TA 4MTVA 4BF9A 4IH3A 4Q4ZF 4PUJA 4Q8NA 4AH7A 1MI3A 1TYGA 3WG6A 4HZMA 1I0BA 1JGMA 2XN1A 2L6HA 1AH3A 5KYUB 4AUBA 1UD2A 3FK4A 3SQLA 4EPKA 2DZUA 2CPUA 4Z1AA 3X2QC 6XIAA 3IQ5A 4KNVA 3VM6A 1M41A 4RZ4A 1R3WA 2ZRVA 5D2VA 3ITXA 4LCQA 3L23A 1L6YA 4FEZA 2QCGA 5DXXA 1G8XA 2FB2A 4JCZA 4WD0A 4XAPA 1FX6A 4GOAA 4HOZA 2NSXA 5HPCA 3RIKA 3POCA 4WGZA 1SFSA 3VDBA 1RCPA 1I45A 4ICNA 4U5GA 3Q7GA 1SO4A 1KC7A 1H11A 2PC8A 4KC9A 5I24A 3QC3A 4EHPA 1V74B 2YIHA 1GHSA 3AS3A 2XHYA 1OYCA 1FKWA 2XIBA 3BZGA 4DY1A 4O0KA 2Z00A 3TZNA 5H8MA 1EP1A 4E3TA 1OCCC 3OHMB 4QSFA 2XTKA 1E5JA 4JTEA 3U5UA 3RG6A 4PB5A 1H60A 1VFMA 3FCPA 2XIJA 1WATA 1MO0A 5E9XA 3U0CA 3GTIA 1XCWA 4AIOA 2NSFA 1S46A 3VZXA 3KUMA 2Z1VA 2PNOA 4Q22A 2BXVA 5A6KA 3P14A 3QV7A 3GXFA 4MWAE 3H22A 3E2QA 1R3TA 2PDBA 4EWCA 3II1A 3R8GA 3EB3A 3WZ0E 4AYGA 5JT4A 4MWAD 3LRLA 3NSNA 5AFDA 3BV4A 3G77A 3F46A 4B2DD 3O07A 1E4LA 4AISA 2CW6A 3A9IA 2AL2A 4S3CA 3B0YA 3FA4A 4F0MA 4CDAA 5MF5A 3R2PA 4H6KA 1TR2A 4MDPA 4P6IC 5L3QA 5A6JA 1S38A 5CPQA 3TVAA 1ZY9A 3TLQA 3ZR5A 4B5NA 4KGJA 3QTGA 4B90A 3UWEA 4MAZA 4BEMJ 4NXKA 2GZXA 1D1BA 4LNCA 3DG6A 1I5NA 2FZBA 4KF1A 3QQWA 2AL1A 2WCGA 4DJDA 5JBEA 2ZX6A 4QI2A 1VTMP 1OWQA 2R82A 3IUHA 3VX0A 1SM9A 2VC7A 4O28A 1E6SM 3VF0A 3UPMA 3BG5A 4KIRA 3NYLA 1J8VA 3CWOX 5DY3A 1D0XA 1QPQA 3N4AA 5G5IA 3MWAA 1NP2A 1XH2A 5HA7A 3AMKA 3M5VA 1XV8A 3DI0A 1Z42A 4QHRA 1E4IA 1A4LA 1TZ7A 1UG6A 3G50A 5E1QA 3S27A 1OR3A 1CGYA 2RDTA 2HZGA 3ES8A 4K0DA 2FGYA 2C6QA 3O0KA 2QVHA 2PEVA 4LU0A 4BJHA 3W28A 4FA3A 1U5JA 3AXXA 6ENLA 1TFVA 4M3PA 1XISA 2E6FA 1QI0A 1ZSXA 5D33A 1PL9A 2ZA3A 4UMAA 4ML9A 1G4SA 3QGVA 1K4GA 1SF8A 2C18A 1D3HA 1NQ6A 1UBSA 3KM8A 5B7YA 2ZIDA 4AB4A 4QG8A 1MYRA 3VNKA 3QRHA 2YL7A 3R43A 4CJGA 1H7RA 2E9BA 5I7GA 5HQMA 1KCXA 4W89A 1GJPA 3TP4A 5CZSA 1TPFA 5K3VA 3LI1A 2PF4E 4UQEA 4FHAA 1VZWA 1YA7O 1V3HA 3SXKA 3CSKA 3TOPA 4JNMA 3BSGA 4QNEA 4G6CA 2ZWZA 3EDFA 1N82A 4Q8OA 2A6HF 4NRRA 4E38A 1TFKB 4IGSA 4Y6GA 3SCTA 2REQB 3OTRA 2NSGA 4RPQA 3FW6A 1JYNA 1RR2A 4AY1A 1RA5A 1IT0A 4Q8TA 4JIRA 3TQ0A 1Y4CA 4GQHA 1TB3A 2NXIA 3CAKA 3PTKA 1ZP4A 7XIMA 2QPUA 2BOEX 4PL2A 4AX7A 5HULA 5AYXA 4EXAA 1LL7A 4AEOA 2WMIB 4K8GA 2Y89A 2ZZ7A 3WUFA 1WKYA 5HNRA 3VYLA 3KS6A 3HFTA 1K8XA 4UFMA 3GHTA 2W0UA 3N17A 3SCNA 1HKJA 2ZICA 1XRSA 2QNLA 2VEMA 1NIUA 3T8LA 1FMVA 2X42A 3EJNA 4WDWA 4UTWC 3GXPA 3W1UA 3NURA 1DJHA 3EWBX 5DMYA 1UMLA 3DBNA 5M5DA 3SP1A 1Q3NA 5L9FA 3T07A 1BQGA 3UW6A 4FX8A 1RK6A 1UC5A 4H7VA 3W53A 3AI0A 3U8PA 2BE5F 3CQZA 5FCLA 2PI6A 4GC3A 4M6UA 4JC7A 5I3HA 1MNEA 4NJKA 4BK9A 4MG4A 3QW3A 2EG6A 4YTSA 1E83A 1RBAA 2YGYA 4EBKA 3OYZA 1O6IA 4HA3A 3PZQA 5A2BA 1RH9A 3VOCA 2CERA 4BG0A 1GW9A 3AUJA 3BGAA 1JPKA 4BQ2A 4GY0A 2QDEA 4PUUA 1HKMA 4MZYA 4TXEA 4JHMA 3WBYA 5C2GA 4BY3A 1XGDA 4LEQA 5T9CE 4F40A 3OQEA 2QW5A 3CAVA 2W91A 3V5FA 2A7NA 4HGXA 2DUXA 2EPMX 5IOBA 1OYAA 4ANJA 4UDVA 1JFHA 3M79A 4XWJA 1F3TA 4C6JA 3CWHA 5FIPA 2IQTA 3UWQA 1UWQA 2OPJA 9XIAA 4G78A 1R6WA 3HMCA 2OU6A 3IAQA 2WHLA 4RLIA 1FCBA 2D2GA 1GQAA 1HF6A 2XVGA 3C2RA 1OCOC 3PZNA 1J8YF 4DWSD 1IQ8A 1NOFA 1WAUA 2VD8A 1PV3A 3AU2A 1F4AA 1HJUA 4DBUA 5CJ5A 4H4IA 2OJPA 3MHGA 3QZEA 3GU1A 3HV9A 4P7NA 4FF7A 3QPZA 5JH2A 3MB9A 4IFKA 1QPRA 3UT0A 3AOUA 4AD3A 1XIDA 1M9HA 2P76A 2Q71A 1ECEA 1EPVA 1VYPX 1PKNA 4M51A 4GYPA 4ZL1A 3WFLA 5IDZA 3IANA 1GT8A 4L6HA 1W3LA 4YT4A 2Z1XA 1F5ZA 1I2PA 3RF3A 3VD7A 3E9VA 4TMBA 3AMCA 3HGRA 1XF0A 1V6TA 1KKOA 1DTUA 3CIXA 4RV3A 4A6GA 1BXBA 1EC8A 1KU2A 3WKZA 4ER9A 1RQEA 3RM8A 4V2XA 3AG1C 4AEFA 4C6FA 3LZ3A 1VGAA 2QJHA 1OFRA 4M19A 2ZZ2A 1W31A 2BB0A 3H23A 1TWAA 3QZAA 2VZTA 4MY1A 4D4XA 3VZYA 2F84A 4C6PA 3H2VA 5EU9A 4C91A 4H7ZA 1H9TA 1FWEC 2VHLA 3EFOB 1OBAA 1GVQA 1GQJA 1VK5A 2G37A 3I4EA 4PUEA 4REQA 5DMMA 1EYWA 3N6QA 4GH1A 4DYKA 5AB3A 3FJLA 3SEPA 3NIYA 3G1VA 3TONA 3W1TA 1S5TA 4EPBC 4NT0A 2P88A 1DJGA 3NL3A 8XIAA 1QWGA 1PTAA 4ZA0A 4PTDA 1W17A 3AQCA 1NTHA 3P3BA 5DCBA 1WNOA 2PDWA 4XAZA 1J2WA 4WVXA 4GK8A 4JRZA 4UZSA 3PFMA 1NDWA 3R58A 3DYMA 4QCEA 4A2SA 1WDDA 4J3ZA 1YXCA 3VIGA 3R6IA 3CBWA 6TAAA 3VO0A 3HQPA 7CGTA 1I4NA 1SFTA 1UQZA 4D6FA 5HJXA 4QG9A 1X38A 3LBOA 4C7DA 4YL0A 3ATZA 2Z15A 1GG0A 3PTDA 3E2VA 2WC7A 3R94A 1LF1A 2FLIA 5A69A 4JTAB 3K8LA 5KINA 4UR9A 4IJCA 4H54A 1PEZA 2WKJA 4UQCA 3CHEA 5F28E 5HNTA 1O1ZA 2ZRUA 1H1YA 3K8MA 1TTIA 2OJQA 2JGYA 2CU0A 2CZEA 4LFYA 5REQB 3LSCA 4XAFA 1H0IA 4XD4A 3HV8A 3J7HA 2R1LA 2JK2A 5HWJA 1SMYF 4ES4A 1ICPA 2E9LA 1WTYA 2R24A 4P7LA 2Y4SA 2Z1WA 4D4NA 4QQUA 2A4AA 4PMNA 3VIHA 3JTLO 5XIMA 3ZSTA 1WB0A 4NAEB 1IEIA 2E8YA 4LVDA 3ARQA 3A22A 4GO8A 3EWCA 1B3OA 3FN9A 3WDQA 1MEWA 3LNMB 1OD8A 4DO7A 1OK4A 1O7AA 3LHYA 3RW0A 4QDWA 4JFWA 1S7ZA 3GXIA 1DXIA 4IMFA 2RDXA 3QHMA 3QOMA 4OD5A 3U48A 4GZEA 5A94A 3W8HA 2R1NA 1YAUO 3H2NA 4RPPA 3H4GA 2VEFA 3DE9A 1XSKA 1US2A 1EZWA 1B90A 3DMDA 3UXAA 2JKAA 1QUMA 1K40A 2XLVA 1C9WA 5B3IA 3J06A 4EVZA 4GQQA 3WLRA 1OC7A 2EO7A 1KXTA 1ML1A 2PUZA 4NSBA 3EXSA 2V2HA 5CI9A 3KRUA 2WVQA 2B7OA 1E71M 2WNNA 3W4RA 2O0TA 3M0IA 5E0KA 5I02A 4TQTA 4HSHA 4QS5A 2HMCA 2XDFA 2ASRA 4S38A 3C0JA 3L5MA 3FJ6A 1RJ9A 4DRIB 3EX3A 1VBJA 4AHPA 1KLYA 2VOTA 1FHVA 2BOFX 2NQJA 2WVSA 2P50A 3NKEA 4E18A 4HHHA 2QTVA 4S3AA 2A68F 4MFEA 3EX6A 1TPEA 3GW0A 1XLDA 3KCJA 3VABA 2FHCA 4CS9C 3T0BA 3QGKC 3SO7A 2VOMA 1PZ0A 1DWJM 4IM4A 2PF8A 4R88A 1QBBA 1HY5A 4H8NA 3GG8A 2ASHA 2ZTKA 3T42A 2X16A 1RZMA 2J24A 1XFBA 4Q5SF 1L9WA 4UQ9A 2DZAA 3DAFA 2Z0IA 1CGXA 3QW1A 4QEHA 4EK7A 4GUIA 2QUTA 2AL2B 4GFSA 4XQ6A 1I9CB 3WF4A 3LUTB 3QMSA 4N4QA 2YCKX 1KTCA 2GVYA 1XW8A 1WWPA 1SZGA 2AGKA 5CCZA 2YL5A 3FXGA 1LG2A 4HA1A 2XM4A 3GW3A 1ZLPA 4O15A 2KK1A 4PRRA 2J8WA 1PTGA 2PTDA 2OG2A 5L0CA 1W3JA 3WD2A 1US3A 2R8WA 2YBVA 2HDJA 3HTKC 1FOBA 4PMJA 3DJNB 3S5YA 2ZX8A 2DVTA 2EBNA 4XZHA 2F2KA 4PFOA 3AMLA 1TV4A 1ISWA 4FLQA 2E7FA 3PWAA 4U2ZA 1E9IA 3EZ4A 4GYKA 3USZA 3BH4A 3S2CA 4B5UA 4O12A 3W7JA 1GJUA 3M1CB 2CYGA 4MADA 3UXKA 2C03A 1V3JA 4QI0A 3QQ1A 3UG4A 3CLMA 5CI8A 5REQA 3SY1A 4BJ6A 2D0FA 4YPJA 1V6WA 2B81A 1RPKA 2BWGA 4BWLA 4BF5A 3WMLA 1WDQA 3BARA 1MMDA 4DBEA 1Z7Qc 2I16A 5DO8A 1H3GA 1YBQB 2GL5A 4O50A 4ULVA 2ZYFA 1JQVA 2C0AA 4Z1DA 3IIOA 4WR3A 2OZ3A 3WD0A 5F2IA 3SBFA 3L5AA 1CLVA 4WJ0A 4MZ1A 2W61A 3BOLA 3WYZA 3F5KA 4IL0A 2QF7A 4IOTA 4PUWA 1TWIA 1RD5A 1Z3IX 2QDHA 3MA8A 2OKTA 4YMZA 1RKEA 1U5HA 3KOWA 4XTKA 1IXPA 2P0IA 3DYPA 1IXOA 3DKLA 3WH7A 4XZIA 5B3SC 3BGJA 4DJDD 3PM6A 1JAEA 1ZVZA 3MSDA 5BRBA 4ZB0A 4IUGA 2NLYA 4IFOA 3RX3A 3AQUA 3TYBA 2A79A 1FY6A 2VENA 3O16A 3ARXA 3DJUB 1T6UA 2EQDA 1ORSC 1OABA 2BVYA 1XIJA 3TD7A 5I23A 4CU8A 2J8TA 4NJHA 3I3EA 4MWAC 2I1OA 3E2SA 4O18A 4B3KA 1UD8A 3G6LA 2HNEA 3W85A 4NHVA 1EOKA 1H51A 4L1GA 4LW7A 3IJIA 3WEOA 4F4BA 2E09A 1F1MA 3PZIA 4PR4A 3RMEA 5DBTA 2BHYA 4JIIX 1XRTA 3UJ2A 1GYNA 1A3XA 3DM5A 4DF0A 2WWCA 1E1CB 2ZQ0A 4BEUA 2D23A 1ORJA 4AD2A 3WH9A 3UZJA 3PZMA 3CAXA 4KETA 2TYSA 3CMFA 5CPOA 4YS1A 4DO5A 1ODZA 4PMOA 2QZRA 4GGHA 4B3ZA 4YIWA 3UXIA 1QASA 1YPFA 1UR2A 4HHLA 4O4WA 1V5XA 2A1DD 1TJRA 3D5HA 4JR5A 1KM3A 3T09A 4A21A 2POTA 4M1BA 4Z9JA 2KYHA 2QF8A 1BVZA 4PFMA 5GVJA 1W9VA 3GBEA 1H41A 1V79A 3H2AA 1JCTA 5B7ZA 2CWXA 3QGAC 3VUSA 2HS5A 3ABSA 2IKGA 1NZEA 1ZHXA 3PJXA 2Q9BA 2YCJA 4TVDA 2ZXWC 1MMFA 3WDIA 4PMXA 1ZBCA 4H4KC 4D8LA 1L3PA 3VNDA 3GWNA 4X0VA 5F4WA 1TTQA 1S39A 4XPYA 2Z2AA 1VB9A 4H3DA 4LUTB 4DXVA 4E0CA 1BQCA 2QE9A 2G97A 4CD7A 3VXGA 1ICSA 5I0DA 4V15A 4JS3A 2ABAA 3GODA 3MO4A 1V0LA 1OR2A 4NXSA 1UPMB 2VT0A 1F7BA 3R8HA 1RKEB 1SW3A 1ST6A 5ECUA 1Q0GA 1XLGA 1X96A 3DENA 4KH2A 4PB3A 2IW0A 5E5CA 3I68A 4X22A 2J7FA 5F1VA 3ASOC 4RZ5A 1S2VA 2O4QA 2BY0A 1W5QA 2R94A 1WZAA 2XGBA 1UZDA 1PD1A 3NNTA 1XBXA 1NLXA 1YNQA 1LQ2A 2EKCA 3SQMA 5IRPA 4F9JA 3C8FA 3O0FA 1C29A 3MKKA 2CDQA 1AJ2A 3VFLA 3W7NA 4RNFA 4UTMA 3LEPA 4A22A 3THDA 2CKSA 3I6RA 5K2ZA 3CL6A 3D3FA 3SRDA 2WZLA 3LQGA 2WZMA 2NZLA 1Z23A 4RD9A 4X3ZA 3O3RA 1TPUA 4OU1A 3SSJA 2YJQA 3MP5A 4ZTXA 3MDWA 5KSWA 3LMZA 1BR2A 4I90A 3FHQA 4J7TA 4AZIA 1WOBA 5CBBA 3R4IA 3PZTA 3V0UA 4YL2A 3F2CA 1DQUA 4GUHA 1VBGA 3CT2A 1EWDA 4IGHA 4ZO6A 5AC8A 4XKYB 1G4WR 3TZFA 4ENLA 3AMGA 3S3GA 2YCEA 3ATYA 2A3LA 3W74A 5AC6A 3CZ8A 2KJGA 3KL0A 3CQHA 4UOJA 4A8LA 1MW3A 1QW8A 4ZQRA 1AVAA 3YPIA 3WHNA 3NEHA 1RXQA 1NARA 3BSMA 3LBMA 5CG0A 1OGBA 3BK0A 1CXFA 4V33A 5FOOA 1CT5A 5K9CA 1UKPA 4K1WA 3WK1A 4ZXLA 2X05A 4HNTA 4O6NA 1NVMA 2DVXA 3HG3A 4NZ4A 3EKGA 3AIQA 4QEEA 4EAMA 2ZUSA 5ABEA 3RVZA 3IAPA 3LS1A 5D9NA 3M7SA 3GVVA 3W07A 2PRHA 4QJ3B 3BL3A 1YHTA 1QNSA 4EWJA 1F6PA 1LPEA 1SPQA 1LYXA 2WHJA 1HJWA 1EJTC 2P10A 3BSHA 3ZS4A 3CIWA 2DYSC 1F07A 3PPGA 5LSMA 1YXYA 1PZ1A 1JFXA 3R25A 1IWPA 2G3MA 3KRZA 3PY2A 4DBRA 2B7NA 3EKZA 5E6YA 1TELA 4MHBA 1V8EA 4V28A 3WQCA 3S8HA 1S5NA 4KIEA 2QCFA 1UR8A 3TJXA 1OIFA 2NV9A 2J7BA 1LJYA 2E5BA 2IQDA 2W5FA 3B0XA 2B0JA 1AQ0A 3MTWA 2WB5A 1Q2SA 4GCXA 2YB4A 4AE4B 1VHNA 3CEXA 3I65A 2BOGX 3WN6A 4IPIA 4CS7A 2R7SA 1A0DA 4CDYA 4UNKA 3O1NA 3ELFA 5C0QA 3C2VA 3KH2A 3H2CA 1XKJA 4Y9PA 5BNKA 2HJ3A 3FAWA 2DUAA 4I9AA 4ZO7A 4HU0A 2PWEA 2NWRA 3TN6A 3STPA 4CN4A 4GKLA 4DM1A 3N2MA 3RF9A 2BHZA 4X9SA 1ZAHA 3P8JA 4Y7EA 4XVDA 2WMHA 4RK8A 2V69A 3OGRA 4L80A 1W3HA 2HEJA 4U3CA 3R7MA 1VBHA 1WPCA 4HB7A 2TMVP 1J8MF 3WQDA 2YL9A 4HKPA 4LUSA 4JFUA 4TTUA 3CQJA 4ZOEA 4KCVA 1QNRA 4YN0B 3U7VA 1QW9A 1FXPA 1OT2A 5CGTA 1APCA 2GSEA 3TWBA 3CO8A 5C7HA 3B8WA 3B0VC 3M46A 2H8AA 1UUQA 1VQTA 4AZHA 3SCPA 3BXWA 1NSGB 2UBPC 4CD5A 1JAKA 1E6RA 3UGOA 2Z24A 3T4RA 1FTSA 2BXZA 3UVAA 3LN3A 4A4AA 4RBNA 4K6AA 4AZ7A 1DPMA 1DIKA 1LWHA 2LP4A 2HCVA 3PUOA 3F5JA 1UKOA 1LL6A 1E9LA 1WYIA 3IVUA 4XVEA 3T8QA 4R27A 1BXCA 2DIEA 1P1MA 4G7ZF 3HNJA 2HJPA 4ZEPA 1UR0A 4Z0JA 4N0RA 3CAWA 2XG9A 4BQ5A 3DFYA 1IZMA 2XZ7A 4Q3MA 1Z6KA 2Q7RA 1Q45A 5AN7A 1A5CA 4HA4A 4Y9OA 3JRMO 1H5VA 1VEMA 2NUXA 4XD5A 5CXPA 1QTWA 1U33A 3JRTA 3W71A 2R02A 1VCGA 2GYIA 4POCA 3KHDA 2QCDB 2WHKA 3SRFA 2EPNA 3NSXA 3CNYA 1K6WA 3TU9A 1ONWA 9CGTA 3IIVA 4UCFA 2J27A 1KFWA 4OIFA 1WOAA 1CTNA 1XQKA 4DAIA 4FALA 1NM9A 1OVDA 1VFFA 1LZOA 4S2CA 1VPXA 3CPRA 4F0HA 1B5TA 1XUUA 4HN8A 1QI2A 4MWAB 1DJZA 1WDPA 4TUFA 2D69A 3K2GA 4IMCA 3S90A 4MTFA 4XTIA 3S5NA 5BMWA 3D46A 2Y63A 4IJBA 4GXMA 2Q8LA 1A5OC 5BCAA 4OFCA 3TDFA 2CBJA 4QBXA 3W2MA 1CLXA 4AU0A 1P0EA 2FDMA 4NJGA 4KCTA 2CBUA 1OKKA 3EEGA 2PPGA 1J93A 2J78A 3PSWA 3PUDA 3V1PA 1XPGA 4FX7A 3LHUA 3DECA 3OZYA 3WJZA 1CGWA 2YPIA 2AKMA 4XV0A 1B2YA 1A3WA 4RDWA 3TC7A 3JYYA 4QFUA 1C3FA 4L1XA 3URQA 3FAPB 4J2MA 3L4VA 3RPDA 3LU2A 1BZ4A 4TX6A 1IEWA 4UFJA 4E8GA 3KOZA 3W82A 3L8IA 3BV7A 3QZ6A 3VGHA 1ZW3A 2RHGA 1BXNA 2XFYA 4QROA 1JYVA 3E6EA 1M56C 3CMJA 3ZIZA 3HJCA 4I44A 1XUZA 2VCBA 3AIRA 4CEXC 4U5EE 1KRBC 3SXYA 2HROA 2IKJA 1NF0A 2E1WA 1ZNNA 2GK1A 4Y90A 2BLEA 1L8NA 3LGGA 1OFDA 3GFZA 3ISIX 4AZ5A 4WLCA 2OB3A 1XGEA 4IICA 5M1TA 2G3KA 1FWTA 3HPAA 3TQVA 2W4MA 4IG2B 1AW2A 5COMA 1UFBA 1XZPA 3PB0A 4LCSA 3JYHA 2DGAA 4E17A 5RUBA 3LXAA 1UR1A 3V5XA 3NR0A 3HGJA 4H83A 2GUBA 4W86A 1OCRC 3BRJA 1EF3A 1A0CA 1FDJA 3RFYA 3CB3A 4JKMA 1JPDX 1D1AA 1Q13A 4PJLA 3G1SA 4P8UA 2P0OA 2NVDA 5IBXA 1MMGA 1SYTA 4LS2A 1VEOA 1ESWA 4B5SA 1U5VA 1WKEA 2DZBA 1IYXA 1OCQA 3T78A 5A1AA 3B9DA 1EXBA 2D2OA 2P1FA 2DT2A 3EG9B 3QEZA 3BLOA 1UBPC 4ACYA 3VTRA 3CQ0A 1LRTA 1A5NC 4KEMA 2PGEA 2WMJA 3N19B 1KRCC 4S3JA 2C3ZA 4HU8A 3EH1A 1SU5A 1P48A 1IXQA 4LWWA 5I78A 2AOSA 1QATA 4XZBA 2CLLA 1N7KA 3SQSA 4JZAA 1QI5A 3CV6A 3B4YA 1KFLA 1SO5A 3V75A 2G41A 3STCA 2W9YA 1QNOA 3KTCA 5CG7A 3MW7A 1OIMA 3HNLA 4TU1A 2HSBA 2ZFAA 2Q8XA 5FI8A 3ABXA 5KZ6A 1EJWC 1XYLA 4IFRA 3V0SA 4F3HA 2MANA 2ACSA 3PPCA 2NX3A 4FI4A 2V30A 3VMNA 4DUVA 4AIEA 1LQ0A 3DI5A 4DXXA 3NQDA 3VIPA 5LA1A 3BOXA 3VMPA 2WPGA 3SI9A 5AY7A 2P61A 2OSWA 1GVIA 3UG3A 3E02A 1L6WA 3JZUA 2NXGA 1F4HA 3EOEA 4V27A 1J2BA 2W63A 2R7OA 2O7QA 2KZHA 4UFLA 1MQVA 4U2YA 1B3ZA 1EGZA 4O52A 2HTMA 4FZIA 1FCVA 1TMLA 5DS5A 2FGLA 1BRLA 2VWSA 3DUGA 4DXKA 4DVYP 1B1YA 4YL1A 4AX6A 1ME7A 4W87A 2X1UA 1UZ4A 3D3AA 5C7VA 2QUNA 5KITA 5DS6A 1X1OA 2F6UA 4KNWA 3URAA 4R3UA 5HOSA 5KMYA 5DQTA 3TQKA 1O5HA 4OVXA 4HD5A 4PE8A 1XD0A 2V5DA 4GVHA 4EOUA 4AY7A 4QCFA 3S46A 2ZRYA 5C5YA 4JN7A 3BLFA 5CJNA 1DJNA 4F0KA 2E1DA 4IX2A 1NF7A 2PWHA 3AIEA 2XINA 3UJFA 4D71A 3NCOA 3NQCA 1EX1A 3DFNA 4IJRA 4GXWA 3N14A 1QT1A 3VM5A 3CHFA 3EXRA 3WQWA 3PBVA 5EBAA 2PP1A 5EBUA 3AWNA 3GXMA 3F2BA 1KGXA 1IW7F 3U5YA 1FWCC 2OEJA 3RLUA 3WNNA 2G4FA 2WSYA 3TTEA 3NPVA 4MLRA 4DYEA 1NU5A 1R0MA 1OINA 4M29A 3W6YA 4LYKA 3M07A 1VKFA 4C7FA 1K4HA 4IIDA 1PIIA 2XSXA 1FP9A 8XIMA 5TD4A 2J4GA 4WGYA 2NUPB 1EKYA 3XISA 5KYWB 1XGZA 2VCAA 1XLFA 2BBFA 4KERA 3RKOF 2YKZA 1EA9C 3SCOA 2OJED 4L61A 4MSSA 4U5BE 4H19A 4G1NA 4A35A 5IBXC 5COFA 1Z3NA 1YW1A 4FMVA 2E3ZA 2OODA 3GLCA 3S6DA 3VAYA 3HPFA 4Z08A 2YSWA 3FXHA 1K9EA 1PKYA 3TROA 2CHNA 4ZOBA 4MS2A 3VE7A 2CBIA 2HK1A 1TKKA 1QO2A 1FRBA 3OVPA 5D09A 2YCLB 4FXFA 3MI2A 3TSDA 4G7HF 1TIWA 2E8ZA 3GG0A 4PK4A 4GZJA 5CZKA 1L2QA 4DBWA 1VC4A 2XXAB 3EGXB 2VZOA 2YOCA 3GFYA 1UH3A 3QW0A 1GOXA 2BNJA 4QJ5B 2IOQA 4CDVA 5BUOA 1BR4A 1HVQA 4N9DA 1L2UA 4NZ5A 3S5OA 1XIIA 5H91A 1KTMA 5AYZA 2FYMA 4W84A 5KZEA 2OFJA 3B8DA 4GNKB 4HMNA 2W45A 1C8YA 2DSWA 3GKAA 1NAL1 5LIKX 2EKGA 3P6LA 1LKXA 3LCIA 3N2XA 1KRMA 1V7YA 3WLOA 4UTFA 3NMIA 3GYEA 3BAJA 3HG5A 3BLKA 2JE8A 1BGAA 1DXEA 2R91A 2Z25A 1SZRA 3L5LA 5DFAA 2IXPA 1AD1A 3TR9A 1ZENA 2XZ9A 1YA9A 3FHDA 6PTDA 3NYMA 4FP1A 2VJXA 2X40A 3KPHA 3LPGA 1S5MA 3S83A 1GKRA 1XYFA 5CPTA 3ARZA 2GPTA 3H21A 3W02A 1CB7B 1G67A 1DXFA 4JEQA 2ZZ4A 3SGGA 2LCHA 3AZTA 4A8NA 4F79A 3TOLA 5BXTA 5I79A 3PG9A 4D6IA 3M47A 1XIFA 4DO4A 5FZTA 2CITA 2FJUB 3BEHA 4CD8A 1M2OA 2VVSA 4EWND 2OYLA 4GFIA 3C4UA 1LRNA 3RU8X 1FWGC 1QK2A 3IEBA 3VKJA 1EDGA 5LYRA 3GNOA 3SRKA 4TOQA 4W9TA 4Q4SA 1KTBA 3BLIA 3ITLA 4M6PA 1JYWA 4OGZA 1W6TA 4LRSA 2OG9A 4HNCA 1OHLA 1XLJA 2GQ3A 3FEQA 4LC8A 2PX0A 1EJ7L 3ECQA 3QHOA 2PS2A 3LHWA 1NWTA 1Q6EA 1ONEA 1J0YA 4NYYA 4C6BA 5G4HC 3HOJA 3KP0A 2PE4A 4J3SA 4Z9HA 2OOFA 2PSNA 4NASA 2FIQA 1EJSC 2PTYA 3PWGA 3W86A 2DSVA 1H63A 5A8NA 3RM9A 3MYIA 4HPGA 1JCJA 3C2EA 5HDRA 2VX7A 1NWRA 4U5KA 3EGXA 4UR7A 3N3MA 1O87A 4X2PA 3L8JA 2ISDA 1V3LA 2HWGA 1S1PA 4GIRA 4C7OB 4LBRA 3VIIA 1TJ1A 4JOMA 4OV9A 1EYEA 2E77A 1V0MA 2BODX 1H2JA 4GACA 2J9ZA 2DJLA 1DL3A 4FX5A 1HL9A 4ZLCA 3DN5A 4C1KA 3PJTA 4DIAA 4Z2IA 4EAYA 3HG4A 4NAFB 3DBPA 5XINA 2WJDA 1JZ6A 3C8ZA 4LUYA 2WC3A 1VFSA 1LLWA 3M1ZA 5DT5A 2X2GA 5BMXA 4DQWA 4S2BA 6TIMA 2AQVA 4IJJA 4UOQA 4WSJA 4LCRA 4LF2A 4DI9A 3FA3A 3AALA 3OZMA 2QGYA 4HOXA 1P0NA 2G3NA 5FCZA 3PS7A 1NBBA 4ROPA 1JZ2A 3T55A 4AFYA 1LBMA 3V1HA 3NMJA 1ENUA 2Y7FA 1OM0A 1UJPA 1U1HA 4J30B 4K3ZA 1J5SA 1YX1A 3GFXA 1D7KA 3H24A 4C65A 2BVWA 3WIJA 2OSYA 4Y2WA 1A3HA 1O94A 3ZJ6A 3RQEA 1W5NA 5D2WA 5CGMA 2VL4A 4PACA 4I8YA 2FTPA 1F3WA 4EF9A 3G24A 4NL1A 4XPWA 4X61A 4C3DA 3XINA 2PWFA 4JN6A 3MUCA 2J9VA 3VZZA 3S1GA 3GEEA 3WNKA 4N9BA 1HKKA 2GDUA 3PUEA 2RH9A 1XRFA 3T6CA 4L1WA 3NZ1A 1GK8A 2FTWA 1NU9C 1Q2RA 4ALDA 2KQ9A 3QKZA 1MMNA 1YDIA 1CPRA 1FFHA 2RGMA 3WSUA 1V03A 1O68A 3OVQA 1ADDA 4FAPB 1HW1A 4FB7A 2W62A 3PZ9A 2AAMA 3W87A 4OIQF 3TA9A 3QPEA 1JUBA 3IJLA 2CGEA 3CMGA 5ABHA 2BC5A 1AMKA 2EPLX 3HF3A 3QF0A 4PBGA 2FVLA 5I3IA 3HIJA 4Q8UA 1CPUA 4UBPC 4KFPA 3NQMA 3E1F1 3N18A 3EX2A 2Q9CA 1F6YA 1LS1A 2QNEA 1VCVA 4AY8A 3AJXA 3CASA 4O1DA 4XAGA 1IIGA 3W2UA 4E4PA 1PIGA 1RD6A 3H4XA 1XZQA 1KXHA 2Y5JA 2CLOA 3C8GD 4U9DA 3N11A 1PYMA 1ISXA 3MMUA 1L6GA 1PCKA 2QV5A 2WKLA 2ZZ3A 5A2CA 3JRKA 3R0KA 1MXGA 1C91A 3R7CA 3ZZ1A 3UXDA 2PWVA 3AO0A 1EC7A 4WXYA 1WKDA 2CETA 4KWUA 1AVOB 3DG7A 2KNHA 4OOZA 1C9DA 2PLMA 3L1MA 4XO7A 1NEYA 4Q8PA 3IUIA 5FJIA 3CQIA 1NFGA 3ABZA 1M53A 2GWNA 3DZ1A 4DOZA 3MSRA 3RN6A 3GDMA 5BWAA 1PE1A 3DEQA 5EKYA 4A3UA 4NTBA 4XLNF 5F5HA 1QOXA 2OZTA 4JCMA 4DX3A 5C71A 1WZLA 5B1AC 1I4ZA 3BPWA 2VYOA 1MQPA 5LHEA 3UZZA 2ZUVA 2V3FA 2HMQA 4C6OA 3D47A 5GQBA 3V16A 4MW3A 4NZFA 2GDVA 4JDYA 1T6IA 1SO6A 3O15A 2NLIA 3R12A 3M5XA 5AVHA 1YKWA 1UQYA 3U0HA 1DV7A 4LV4A 2HRWA 4ERIA 3IGSA 4YVXA 3ZLHA 1KR0A 3TJIA 3DHDA 1OG0A 4GX8A 4W88A 1JCNA 4XB3A 1K9TA 1DOSA 1MUWA 4HPXA 4P8XA 1X7IA 3G18A 3EZIA 1FWJC 3H2MA 5LNVA 5KTLA 1Z44A 1QLEC 2QJNA 2XYLA 4IQLA 4WKAA 3WMSA 2L6GA 2A85A 3GAKA 3M4BA 2VEGA 1AL7A 5DXYA 1A7EA 4GH3A 3N24A 3TV8A 3PSVA 2A21A 1V02A 3KVMA 2W3ZA 3CH0A 4XD3A 2A1YA 2WZGA 3CV1A 1GZJA 3BQ5A 2HE5A 1XLIA 2GLKA 2EPOA 4KWOA 5FF3A 4YCPA 1TV7A 3MCOA 5JQ9A 1TJPA 2H8XA 2YL6A 3P7YA 1XHGA 1UKTA 3C5QA 4YCOA 2V3DA 4HCHA 1GCYA 2E9MA 1E4NA 4IMGA 5FAJA 3GX9A 5E3CA 1FDYA 4CUCA 3VIMA 3UMIA 2CXEA 1TPWA 3H70A 2NV1A 1GM5A 2GAQA 1EJVC 1A41A 4B4HA 2WQDA 1A53A 2WSRA 3CO4A 2OGYA 1XC4A 4KBLA 1JNDA 4JN8A 4NZ1A 3H12A 4U5IA 3MUY1 5G1YA 4AWTA 2EHHA 1O5KA 4AHQA 1SUXA 1UH2A 4PMQA 1Q8AA 5BU9A 4MVZA 1D3GA 5EMYA 4XIAA 3WY1A 2Q9AA 1Q85A 3CQKA 1RVGA 1G1YA 3WLJA 1SW0A 4GUJA 4GZ7A 1CGNA 3ZQYA 3I7QA 1G6CA 1ZHZA 1SFJA 2PRLA 3RO8A 2ALRA 3OWTA 3TEVA 4ZE4A 3H55A 1CX9A 4LC6A 4B5XA 3C2OA 2XFFA 3W2VA 4I9JA 2J7DA 3WQ8A 4LUSB 4EPEC 4AD0A 4YTTA 1V6YA 4UNIA 3KRSA 3G8EA 1FBAA 3MLGA 1CZ1A 4IXHA 4UTUA 3KS5A 5IY5C 3OLDA 3A21A 1EWEA 2IPJA 3H6OA 2W67A 1C7SA 3QY6A 3B04A 5TJ5E 1T6MA 1MZHA 2YLDA 4GLEA 4HIBA 2HV7A 3A12A 3H4WA 2V2DA 5LNSA 1ZAIA 3OZPA 1XYMA 2OX1A 2FGZA 1XIGA 3UY8A 3A24A 4JX4A 4RE4A 3RCYA 1JCXA 3TAKA 1NFPA 2J7EA 2EILC 2QCMA 4W8PA 1MNDA 2ZXAA 1FWIC 1FP8A 3W0KA 5HSWA 3MX3A 3NQGA 4GA8A 1UHVA 3ANUA 4CVWA 2PGRA 2RJGA 1GNXA 3C61A 3U7BA 4RZ6A 2Q3RA 1WZKA 3UEQA 4CCEA 5C6MA 2HK0A 4DF2A 4JY9A 3W4YA 4OIRF 2ALDA 1FDZA 4DELA 1JCYA 2F6XA 1XG4A 2FHBA 4OZOA 1AH0A 4O1AA 4MDOA 3EH2A 3C52A 4H9UA 3OJGA 5EFFA 3QTPA 1XBYA 4AIUA 5DELA 3QYSA 4H8VA 3LD5A 4DZHA 4WUIA 2BDQA 4CX9A 3WNLA 2VFHA 3XIMA 1JDAA 3DERA 4NTAA 2PP0A 3GKFA 2WYSA 4ECLA 1K9DA 4CSAC 1OX6A 3TQOA 3MV01 3KE0A 3MJMA 3M0YA 4CEUC 5J5DA 1IIHA 4PFPA 3LHVA 3IUDA 4L9XA 2J88A 4X60A 1FXQA 3WJWA 2NX1A 3TJ4A 4I1OB 1VBRA 1XLHA 1ZU8A 4PJMA 4OTKA 3BGGA 2AP3A 1FFRA 4ONVA 4OBTA 1HKWA 2WBGA 2WZTA 4JKVA 4ERGA 4E5TA 3UGPA 3RPTA 3NGJA 3BC9A 3DKAA 1BVWA 1R9XA 4TR9A 1HN1A 2HBXA 3NGFA 2VNCA 3VNZA 4J7RA 4XTDA 3TOYA 1VBUA 3B9NA 4KRTA 4NI3A 1OXKA 1PS9A 2Y2WA 2H7VC 1BKSA 5IDIA 1TTPA 2YLGA 1W54A 2PLJA 1T0OA 4YWIA 1DJQA 3NEVA 1LIHA 2QUUA 3C8GB 3T6JA 3GC5A 2PDPA 4HU3A 3UCQA 3M0JA 3PFRA 2PTWA 1IGSA 2CLIA 3NPUA 2BVTA 3DHFA 2VGGA 4GQRA 3L67A 1TFOB 1GG1A 1EKOA 2P6VA 2DIJA 4E7SA 1VFTA 2O9PA 2ZA2A 3O55A 2QQ6A 3EOLA 1JPIA 3HMJG 2Z4GA 4BEJA 1A50A 3QC0A 3T0AA 3QLLA 1FCUA 4F0SA 4BJ1A 1GVRA 1ITUA 4RE2A 4J28A 1K7EA 1TG7A 1VFUA 2B0MA 2I8BA 2OX4A 4IB4A 4QDMA 4TVCA 2WZIA 5E33A 3BQ6A 5GJMA 2VQTA 1Q6LA 1IZJA 3G0UA 5I77A 4YT5A 2ZZ1A 4H01A 5F2LA 4JTDB 3POHA 1W2WA 2FB3A 2LIGA 1XLMA 3SUTA 4B5WA 4JTRA 3U2LA 1KM2A 4NJJA 1RBOB 1DORA 3DXJF 2BX7A 1AQMA 4HPNA 1H6GA 1E56A 1XL9A 4US5D 2EPHA 3FYOA 5I5RA 1XDMA 1TVNA 3TX9A 6XIMA 2E4TA 3NOYA 3S2NA 4NY3A 1OFBA 4YLWA 2E67A 3IGUA 4S3FA 2PBEA 4TVUA 1GZGA 4GJJA 2OWCA 2I5IA 4B6IA 3W7QA 3W7LA 3QVYA 2XLHA 3T7VA 1KBLA 3FVYA 5KYYB 2GQ8A 4J4KA 1ZRQA 2P1AA 4NCQA 3QZCA 4MW8A 3TUUA 3B8UA 1VR6A 2NV2A 5FL0A 4HZ6A 1YPIA 3FA5A 4IG2A 5HUPA 3BAIA 2UUHA 1OFOA 3AXMA 3ENLA 3LSBA 2IPFA 2OSXA 4MOZA 5EMUA 4O0ZA 4EACA 3FX4A 2HPIA 1G94A 3WDRA 3G1DA 4CIPA 1B30A 5LNRA 4HZ8A 4GIEA 2YXGA 1TX2A 1GONA 4GVFA 1X1NA 3VKKA 4K38A 2XWDA 1YE4A 3IV8A 2VUYA 1UWTA 4L4LA 3PDMP 2A3EA 1RQHA 4UUIA 2IYLD 2CLEA 1A7VA 2VR4A 4G7EA 1KFJA 2DB4A 3GORA 1GPWA 3EWZA 4DZIA 1VS1A 2VDGA 1G0CA 3L4WA 5I3FA 1KBKA 3P0XA 3KDOA 3ABOA 2ZX7A 2PBOA 5FL1A 1JXJA 4H9XA 4LBUA 3H7UA 5FJPA 1KWKA 2CC0A 1B68A 1AJ0A 3WLNA 3N25A 2EIMC 2ZXBA 1Q4NX 2ODOA 5JIPA 3T2OA 3MCMA 3O7UA 3ARPA 3AXKA 3S5SA