3B0VC

Trna-dihydrouridine synthase from thermus thermophilus in complex with trna
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
315
structure length
315
Chain Sequence
MLDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALLALSTKANREIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLMEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA
publication title Molecular basis of dihydrouridine formation on tRNA
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase/rna
total genus 108
structure length 315
sequence length 315
chains with identical sequence D
ec nomenclature ec 1.3.1.91: tRNA-dihydrouridine(20) synthase (NAD(P)(+)).
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01207 Dus Dihydrouridine synthase (Dus)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3b0vC02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3b0vC01
1W54A 3NEVA 2A5HA 2DZSA 2WKJA 2YR1A 1TJRA 2DZVA 4BFAA 3DKLA 2CLKA 2VEIA 1W1ZA 4XZ9A 5D2VA 3QQ0A 3TJXA 1XBZA 4AHPA 5HR6A 1DKWA 4N9EA 3KOFA 2QCHA 1JR1A 3L2IA 4JNMA 3NL5A 2B4GA 3NA8A 3TK7A 1RQEA 1VJIA 5DCEA 5CPMA 1RZMA 4A21A 3C56A 5HUOA 2IQTA 1V7YA 1KM3A 3S5ZA 2CFFA 4JTFA 4M6PA 3CHVA 4MJZA 5I3GA 3I6RA 1D9EA 2C0AA 2X16A 3W1XA 2PURA 5G1TA 1W56A 5EL1A 1DV7A 3ZR4A 4BI6A 3P7YA 5AYXA 2ABAA 3T40A 1RV8A 3CIXA 2Y63A 3LCXA 1MXSA 3S8HA 5AC6A 4JTTA 2QJIA 4RKAA 1ADOA 1ICQA 3JS3A 2VOMA 5EYWA 4UNLA 1ZENA 1AW2A 1TB3A 1F6PA 2V2HA 3GDTA 3OG3A 2OMAA 3LHTA 1FUYA 3F03K 3Q94A 1HL2A 2GVLA 5KZEA 4EOUA 3TMQA 1Z41A 3L5MA 4ADSA 4QISA 3NZRA 2BLEA 4IMGA 1F73A 2KZHA 3LLDA 4MVAA 5F1UA 2NX3A 5K3VA 4O15A 3LDVA 3SR7A 3MP4A 3WJWA 3GX9A 2YDAA 1YPFA 5KMYA 4O1BA 3TJLA 2YYUA 4IX0A 1LOLA 4P61A 3SY5A 3ZS4A 4UFKA 1TMHA 3GDRA 3QF0A 1IXNA 3NR0A 1PL9A 4MZ1A 5U4NA 1TV7A 1G4SA 3PBYA 3QZEA 3GKFA 2YW4A 1AW5A 3LLFA 1SFJA 3NQ2A 5CPLA 3W1NA 5EMUA 4LVGA 4HNTA 3W2NA 3W7HA 2VFGA 3G1DA 1JCNA 1ME7A 4LU0A 2FQIA 3BVJA 1I2QA 1RVGA 3SIZA 3UXDA 4JIPA 4IMCA 1H5YA 2I14A 1OFEA 5C6MA 3IIZA 2FPVA 4R7JA 2WQPA 3M7WA 4IWWA 4JEQA 4LY8A 3QSTA 1TSIA 1R2RA 1QR7A 3C6CA 4A2RA 2NV2A 3DKJA 5EY5A 1GQNA 3C2RA 2VFFA 3P8JA 2X30A 3G1VA 1PV8A 5KINA 1SR9A 2FTPA 4UFHA 2ZZ6A 4LOCA 2HS8A 3TQKA 4O16A 3BARA 3CIWA 1WOBA 1XDMA 3NQ6A 1GYNA 3W1TA 1WBHA 5CGQA 4QITA 1ME9A 2I9EA 4HT3A 3S1VA 4ADUA 1W5MA 1SZFA 5CZJA 3RFAA 3A5FA 3O15A 1VCGA 1O95A 2A85A 2NXGA 3VNDA 5HR7A 1G69A 1FDZA 3M43A 2WPBA 4L4MA 3TCEA 3OVQA 4Z08A 3PS7A 3PY2A 5DLCA 1ONRA 4YXGA 4QIUA 3CPRA 3UZJA 5D09A 3A24A 2FPYA 2QF7A 3HMJG 4PEKA 5E1QA 3C2OA 3P5ZA 4DPQA 2A7NA 2O7QA 4O0KA 1W31A 3W7IA 4LTSA 4AHQA 4DO6A 3K30A 1Q6QA 1H63A 2Q3RA 3HGRA 1B4EA 5DY2A 4GUGA 2E77A 2BWGA 2J27A 3HPXA 3NNTA 2ZZ4A 3RLVA 4K39A 2R14A 4LNYA 4LWWA 3HG2A 1O4UA 4Y6GA 3L9CA 1DQWA 1FXQA 1MZHA 4WX2A 3TE9A 4AWSA 3WK0A 2JKAA 4NJKA 3W76A 3ANYA 4MY8A 5CSRA 1LOSA 3FFSA 3N9SA 3W23A 4O52A 3G1XA 3NPXA 2E6DA 5LHFA 1JUEA 3WJSA 1WX0A 4J9JA 3LX9A 4KKXA 4O4WA 1L6WA 2ZA2A 3L5LA 3B0PA 4BK9A 3STFA 5BMXA 1KM1A 4WOZA 3L68A 2WJZA 4LVFA 1XCFA 1KV8A 1SPQA 5I3IA 1M7OA 1SU5A 3TAKA 3W7NA 1Q3NA 4FEZA 3WK3A 4HPXA 3W83A 1C8VA 3EX4A 2PCQA 2TRSA 5D2XA 3KX6A 1TJPA 1T0OA 1A5SA 3QSRA 3MW7A 1XL9A 4LC6A 2RDUA 1LTDA 3LCGA 3MMTA 3LCHA 7TIMA 2OT1A 1LBFA 3LI1A 1GPWA 3KAOA 1UUOA 3PBVA 3I68A 5CKSA 3UY7A 4D2JA 1ICPA 3NL6A 3QMTA 4O50A 3G24A 4FIQA 4TX9A 5AYYA 4K37A 3ELFA 1P1XA 5CZSA 5G2HA 5HWMA 4I9AA 5HULA 3LERA 4YCOA 4OV9A 3GK0A 1O5XA 1S5WA 2QUTA 4KFOA 3NO5A 1TV5A 4M6VA 1W0MA 2J6XA 1XC4A 2OJPA 1TQJA 2WNNA 4AEOA 2JKEA 4MOZA 3W7OA 1VGAA 4NZJA 1RQHA 2V81A 4JX4A 4JIQA 4Z0JA 1KM0A 4IGHA 4XKYA 3S5OA 1YADA 4GUFA 1O60A 4LUJA 2I1OA 1F74A 5C54A 3L5AA 4YLWA 4Z1DA 3GR7A 1ML1A 3H55A 3OVRA 1TTPA 1QWGA 3LRKA 1VZWA 2NX1A 4JTGA 3LI0A 3R89A 1EIXA 1TIMA 2Z1BA 2W0UA 3UPBA 3LGEA 5G4EA 3B0UX 2H90A 4UTIA 5H91A 4JY9A 1B4KA 2E1DA 4E2DA 3FIGA 3FJ6A 4MLRA 4U4MA 4HSOA 1ZALA 3CU2A 3PUDA 2AGKA 4NU7A 4UMBA 3L65A 3C61A 3LB0A 1PHQA 3FEMA 2YFNA 4UTMA 3EB2A 2JGQA 3A21A 3W07A 3NDOA 1GEQA 5KZMA 1ZY9A 1K8ZA 1F7BA 1R30A 2Y7FA 1TTQA 3S1UA 1BKSA 3W2KA 2YPIA 2WNZA 3L0NA 3TC7A 2W6RA 4UFIA 2Z6JA 3UWVA 5AN7A 4B5NA 3PBUA 2YSWA 2ZZ2A 1SW3A 1OK6A 3W88A 2EPHA 3CEPA 1PS9A 2Z2UA 4ICNA 5K4ZA 2RDTA 1KTCA 3NVTA 1G4TA 3S42A 1GVOA 4FB7A 4JDYA 1UCWA 4YCPA 3FYOA 3A22A 1KBIA 2QCLA 1W5QA 4N9DA 1K7EA 1FWRA 1PCKA 1M6JA 3EKZA 3FJLA 3NM3A 4MKNA 4UCGA 3NQGA 5DN1A 2QDHA 1K7FA 4M6QA 2PC4A 5HINA 2NZLA 1EP3A 4O4VA 4AWUA 3FOKA 1XUZA 3LTYA 2FPTA 3NQFA 1G4PA 3T4CA 1OFBA 5D03A 1DORA 1G4EA 2ZQ0A 4U28A 5CG7A 3SFKA 3W1LA 5LNUA 3M5ZA 5A8GA 1W5NA 3HG3A 4ZQOA 3PBWA 3I7QA 2GVJA 5AC7A 1GYLA 5G1YA 3GVGA 2CLOA 4LVBA 3NGJA 5IM51 3S5YA 1X6UA 1FXPA 1W3IA 2V30A 1KLYA 3THQA 3QH2A 3DBPA 1XKYA 3HB9A 4KWWA 1FY6A 3MP5A 2RH9A 1BWLA 3LHWA 3LXCA 2CZEA 1QPOA 4O1AA 3RF9A 1QPNA 1IIHA 4AVFA 4TO8A 2G96A 2H3BA 3V1PA 3HJZA 1SW7A 5AHIA 4DF0A 3TIMA 1YXDA 3NQMA 4UR8A 3BLEA 4UFLA 4MY1A 3N34A 3TMLA 1TPUA 2C6QA 3D0CA 5ABTA 3TXZA 1QAPA 3PSWA 3G8EA 5C55A 3BV4A 3W2UA 2BXVA 3W1AA 3KXQA 1IIGA 3TXVA 1OYAA 2ATMA 2RHGA 3P5YA 2QCCA 1QPRA 3W86A 3NOEA 2CLHA 3OHIA 2XN1A 3Q37A 1XBVA 3LHYA 4NUWA 3DAQA 4S2BA 1OX4A 3T55A 1T96A 4RLIA 4ADTA 2RKXA 3MI3A 4K7YA 3W7PA 2J88A 4CNNA 1YDVA 3W71A 1T8XA 3TC6A 2YCEA 4AF0A 2G95A 3EWZA 3SJ3A 4UTJA 2WSRA 1OFPA 2V0TA 3GIYA 2ISSA 1P5BA 5D2TA 2EF9A 1Q6OA 1W5OA 5FESA 4DEFA 3QPZA 3DFPA 4CCDA 4UTTA 3NYZA 1JRCA 4JTJA 3EWXA 1A5BA 3ATZA 3S1XA 2B7QA 1YXYA 4RJEA 4C1LA 3M5XA 3QJAA 2GQ9A 3O05A 2DU2A 5FEZA 3G0SA 3TQVA 1H51A 3W7KA 5BNKA 1F76A 2RDWA 1U83A 1FCVA 5LSMA 5BMWA 5CSSA 4CCEA 3QRHA 4PTNA 1R47A 1Y0EA 2OT0A 3KVLA 3QC3A 3BG9A 1OVDA 3KVKA 3LHZA 3ABSA 3NQVA 3L0GA 3BO9A 1HG3A 4N9CA 4X3ZA 3G22A 4RZ5A 1KFLA 2WSQA 3P60A 2NXIA 1I2NA 2J9XA 4HNVA 1KTNA 4UTTC 1G6CA 3UXAA 2H8XA 2XN2A 3M0ZA 4ORIA 4QAIA 1VCVA 2CZFA 2C18A 3TDFA 3LOTA 5G2IA 1SO3A 2E68A 1E51A 1DHPA 3DH7A 5LNSA 3BLIA 4H3DA 2C19A 1PHWA 3PUOA 3USBA 4CQ8A 3HG4A 3O63A 4RZ6A 4ZQMA 3QYQA 1N7KA 1GVQA 1BEUA 4N6EA 5E93A 4ZQPA 1YXCA 5T26A 2VKZG 4W9TA 4QSHA 3HGJA 2TSYA 1W37A 1J5TA 1GG1A 3W7JA 2DP3A 3MUXA 3W22A 2ZBTA 2TPSA 3TSDA 4N4PA 3KVMA 1VH7A 3BGJA 4NNAA 2ZDRA 1LRQA 1WQ5A 2ATSA 2E5DA 3W1MA 1OABA 4DF2A 3BG5A 4JYEA 1KW1A 4PH6A 1U5JA 3NQ7A 5K9XA 3HGOA 3MBFA 3R13A 5LNRA 1XBYA 3TW7A 5I3FA 3CC1A 2H6RA 3S6DA 1I2OA 3INPA 2GJNA 4JTSA 2FIQA 1LCOA 4UXDA 3W7EA 1DL3A 5HMSA 3TNOA 1TTIA 4ZZ9A 4JN6A 3IGSA 4O11A 1H7PA 1QMLA 2ALDA 3VE9A 3L0KA 3C3NA 1YDOA 4RXGA 4TIMA 3HPSA 3A5VA 4JTKA 2QKFA 4MZ8A 3W9ZA 2A6NA 3EWBX 2CZ5A 3GLCA 2Y61A 5FI8A 4O54A 3IVSA 3KVJA 1Z42A 5L6UA 5HWJA 3TSMA 3C2FA 4IPIA 3B4UA 1OF8A 1K02A 5EBUA 2A4AA 3STCA 1FWTA 1JUBA 3BW3A 1LBLA 1QNVA 2TMDA 2GPTA 1SSGA 3PWAA 5HUPA 3CTLA 3NQDA 1GT8A 2A1YA 3ZFHA 4ALDA 1I4NA 1IXPA 5HNRA 4TMBA 3S9YA 5F2IA 3ABOA 1X7FA 1GVRA 3I7RA 4ONVA 3G1SA 4HNUA 2C14A 4XTDA 2J9YA 4CLMA 2B7PA 4O12A 4RXFA 3A23A 4FO4A 2R94A 4LS0A 2GUUA 3QMRA 1C29A 4NT0A 4HIBA 1V5XA 4UTKA 2X2GA 3IRDA 3PC0A 1ME8A 4HPJA 4Q33A 5BW6A 4O10A 4G1KA 2NUYA 2FLIA 4LV9A 5DXXA 4DXVA 3E49A 1M7PA 1KLZA 2TYSA 4XUGA 3LRLA 4DBEA 3W7GA 1HUVA 2GQ8A 2WNQA 5KITA 1VLWA 1SUXA 3UWQA 4JS3A 3W3OA 1AMKA 2E09A 1GG0A 2WO5A 2F84A 1OFDA 1S3HA 3TH6A 4NXKA 5BRBA 4O1CA 4OWGA 4LS1A 3E96A 3MHFA 2C16A 4RCXA 4BWLA 1GVSA 2CWNA 4Z1AA 5J5RA 3C2EA 1HO4A 3W73A 1AG1O 4DELA 2Z0IA 2ZA3A 3LBMA 3PULA 2PRLA 3WFAA 3EWUA 3LTPA 3LXAA 2P0OA 2X1UA 5A5WA 5D33A 2C3ZA 3B04A 4FNTA 4O14A 1I2RA 1SO6A 4OV4A 4PFMA 1SO4A 3MO7A 2BX7A 3DFQA 1FWSA 1XI3A 1KTBA 1FQ0A 3LRMA 5U7SA 3B03A 1HFBA 3FKRA 2A21A 2ZRWA 3UWZA 1TYGA 5DCBA 3BW2A 1QCWA 4OQVA 4GNJA 5EPDA 1WOAA 4GRSA 1OJXA 4GFSA 4NNBA 3IIVA 1IF2A 1YYAA 1KM2A 4HSNA 3P74A 2CLLA 1GJPA 3THAA 3W2JA 4IXXA 3C52A 4BWLC 2QCGA 1NFBA 3W70A 1YTDA 4Z1CA 4GE8A 5I3KA 4NX0A 4TR9A 1H7RA 1TPVA 1EUNA 1H7XA 3HO8A 2P1FA 3EKLA 3RK8A 4JR5A 3TFXA 4FNRA 4L4LA 3HBLA 2Y6ZA 3TROA 1DQXA 3GNNA 4NJJA 2VFHA 3DFSA 2B7OA 1YTKA 2CLFA 1OFAA 5K4XA 3HIJA 1KM6A 2BSLA 1OYCA 3W7MA 2WSYA 5H2ZA 4FX7A 2X1TA 3BW4A 3O6CA 4ZQCA 5KTLA 3TFCA 3LXBA 1ZAJA 1VS1A 4ZL1A 3M5VA 1RQBA 1ZHAA 4FHAA 3BK0A 1UJPA 4AMAA 1W3TA 4WXYA 4JYFA 2BTMA 1HTIA 1NSJA 1XDLA 3DI0A 4HN4A 3ABRA 3W7DA 1Z44A 1Q6RA 1UUMA 1ICSA 4XKYB 5HJLA 4FXSA 2QJHA 4LW7A 1LOQA 4NJGA 3T44A 4IXHA 3NQCA 4WD0A 3E9AA 1FBAA 3M5YA 1FCQA 1NAL1 2VFIA 4LV4A 1DJNA 3DENA 3MYPA 1FCBA 1LRNA 3PG8A 3PSVA 2DZWA 1SO5A 3HQ1A 3GAYA 1KM4A 1L6YA 1CX9A 5AYZA 1IXOA 3YPIA 5K2ZA 1F5ZA 2C13A 4RV8A 5AHNA 4JD4A 1K03A 1KFBA 2QJGA 5K9DA 1TRIA 3MHUA 3GB6A 3W7CA 3C8FA 3HOJA 5DELA 1TPDA 2WOQA 1R2TA 2DZUA 1LP6A 4IQLA 2ZZ1A 3O8AA 4WY0A 1H7NA 1IXQA 3IGXA 2WV8A 5FF4A 3P80A 4CNPA 3FKKA 2ISWA 2QUVA 3CT7A 2QCMA 4OGZA 1JUKA 4DF1A 3GKAA 4GXMA 3EWWA 2C1HA 2P10A 2EKCA 2DJLA 2DZXA 8TIMA 3W1RA 3MWAA 3LCLA 5GVJA 2NXHA 3O16A 1NF0A 3O06A 1A5AA 1Z48A 4BI5A 3QPYA 1J4EA 4YWIA 3AJXA 3M6YA 1AL7A 4JICA 4Y8FA 5DXYA 1OHLA 3NAVA 4O13A 1K7XA 3F1QA 3IV3A 3OA3A 2A7PA 3IEBA 4I7WA 2D73A 2X1SA 1X8FA 2HS6A 1FDYA 2QAPA 4X9SA 1DJQA 3B0VC 3W7QA 2VC6A 4O53A 4XBSA 3FA5A 1KFCA 1OFOA 3L66A 2FFCA 1NVMA 4N02A 3DGRA 2CZDA 3M1ZA 4EIVA 1VQTA 1OX5A 6TIMA 4UUIA 4MZYA 3PF3A 3LV5A 5D38A 3DFOA 2A6LA 4KWVA 1MEHA 1HO1A 1G67A 3B05A 3M41A 5E0KA 3IVTA 2O7SA 5C2XA 1R2SA 5D05A 1TPH1 1DVJA 2DZPA 3P81A 2A2IA 4FIRA 2GOUA 4DBDA 4M7SA 1QOPA 1UBSA 3F4NA 3TQ0A 3P62A 4OHQA 1JQVA 3UQNA 3H53A 1YDNA 5F4XA 3TX9A 2OX1A 3ABQA 3DI1A 1XM3A 3C0JA 4FNQA 1GZGA 2VEPA 5DBTA 3CWOX 2NV1A 4EF8A 1GWJA 5CZ0A 3PM6A 5KZDA 4XWUA 3DZ1A 4RK8A 2Y70A 4N4QA 4FNUA 1THFD 1H7OA 1OX4B 3W7LA 1MEWA 4MJMA 1ALDA 2XN0A 5D2YA 1H61A 1ZCOA 1JCMP 5AHEA 3L21A 1GOXA 4TU1A 5CZTA 4AF0B 2ZA1A 4MUZA 5I3JA 1TO3A 2NUWA 5AFDA 4UFJA 1I45A 1L2UA 1DBTA 1ZAIA 1WV2A 4QJ1A 1C9DA 1RD5A 3M47A 4ZVJA 3QFEA 2V2CA 5HQEA 5I3HA 1I2PA 4WUIA 4EF9A 1LDCA 4FXRA 2DZTA 4JXCA 4NJHA 4EVZA 5FEWA 3SZ8A 3EXTA 4GUHA 4MYXA 2E5CA 2GQAA 3A9IA 4ZMGA 4PL2A 4OT7A 1LLZA 3SSJA 4E0CA 5DY3A 3T7VA 3RNDA 1CW2A 1JRBA 2Y89A 1F05A 1EUAA 3GXTA 2OZ0A 2ZTKA 3GNDA 1QO5A 3P82A 4O1DA 3PB2A 1EP2A 4A3UA 5D32A 3OBKA 4O28A 2VELA 2NX9A 2ABBA 3G18A 4KFNA 4O19A 5LNVA 1TRDA 3IGUA 3QM3A 1JCJA 2YFOA 3HF3A 3G0XA 2FB3A 2E6YA 1K8YA 1VHCA 4Z0SA 3W1PA 1VR6A 3LV6A 3GXNA 1DOSA 2VENA 3NZ1A 3G0UA 3QW4B 3DXIA 3DFTA 4GUIA 4UTWA 5D37A 5F2MA 4MYAA 3I65A 1P0NA 1OFQA 1A50A 2CLMA 3HPZA 4X2RA 5IBXA 2Z6IA 4K36A 4CNOA 5LKYA 2RFGA 4LRSA 3NL3A 4M7TA 1SFLA 4PODA 1JCYA 1QPQA 2C15A 1W3NA 3GXPA 1KFKA 3SI9A 3GDLA 3VFLA 3LM7A 1KM5A 3NQAA 1A53A 3MBDA 4CCCA 4HHPA 2YZRA 2ZTJA 3C2VA 3N2MA 3PG9A 3B06A 2Q8ZA 3BGGA 4LS2A 2A7RA 2ZCGA 1QO2A 4N6FA 1UB3A 3QW3A 4JTLA 2EHHA 3O07A 1SW0A 2JBMA 4A29A 3O6YX 3P61A 1TPB1 3W7RA 1B57A 2Y7EA 2PE4A 3N2XA 3EX3A 4RZ4A 4MFDA 3E02A 5F4SA 3TW6A 5AOUA 3NPVA 2PRHA 1KV5A 2UV8G 4UTWC 1T99A 1RPXA 4JTIA 4RX0A 4AH7A 4K8HA 4C1KA 5IBXC 1BTMA 4LC8A 2BZNA 3NQ8A 3W74A 1FDJA 1ZAHA 1TPWA 2ZRYA 4WY0F 4GBUA 1F2JA 4K38A 1ZNNA 4UTLA 4IJBA 5LGZA 2ZZ5A 4LT9A 1VHNA 3RU6A 3UPWA 4O18A 5G4WA 1TPC1 3W87A 4R34A 2FJKA 3Q58A 2A0NA 3MP3A 3W85A 1JULA 4M5PA 2G5WA 2QCEA 2ZRUA 3QQ1A 1MO0A 3STEA 4POCA 5J5DA 2E6FA 3PR2A 4DPPA 1G7UA 3RMJA 4NNCA 5F1VA 3Q2DA 4PC8A 3CWNA 1L9WA 2YXGA 4MPQA 3GAKA 3STGA 3IIPA 4DQWA 2FDSA 1ZJIA 3GDMA 1A5CA 1LORA 3R5EA 3S1WA 2QR6A 3G1YA 1H62A 3KFTA 1TPFA 2ZZ7A 4S2CA 3U2OA 1W8SA 2EGZA 4QNWA 3TA6A 4WOQA 1OFRA 3G1AA 4E2BA 4M19A 5LGXA 4KFPA 1GTHA 5FF0A 5K9CA 3VE7A 1MSSA 3M9YA 4HKPA 3R8RA 4OE7A 3TUUA 1KFEA 3B8DA 4IX2A 4XTIA 2ZRVA 3QMSA 3MJYA 5DCDA 3WJXA 2Y62A 4JYDA 4Z1BA 4ZQNA 4IMDA 2VXNA 3M44A 3DFNA 4Q4KA 2ZRZA 4FNPA 2F7FA 3CB8A 1CI1A 2EAWA 4UMCA 4AAJA 4JX6A 4UNKA 3VI2A 3W1UA 2VEMA 4JTHA 2NWSA 4FNSA 3QEZA 3H54A 2Y85A 1SZEA 4MFEA 5KSWA 1N8FA 1VYRA 1FCUA 2R8WA 1LRTA 3GZ3A 1PE1A 4IPJA 3F4WA 2QAFA 2VEKA 1NF7A 4ORMA 3BPWA 4WJEA 3G3DA 1LZOA 4NX5A 3FS2A 3W2LA 2QCDA 5FF7A 1TREA 3N9RA 4TMCA 3DHDA 1G7VA 2JKPA 1WYIA 4NXSA 5TBOA 2QCFA 3O1NA 2E5BA 1LYXA 3L67A 3WJYA 4IMEA 1XFBA 3E12A 3O6DA 4A2SA 2R91A 3TKFA 3ATYA 1OYBA 4Y90A 5LHEA 1PCWA 5LNWA 4UTHA 1SSDA 3RLUA 3UWWA 4UFMA 5MHBA 2QCDB 4IOTA 3WK2A 3N14A 3G1HA 4UTUA 1O5KA 1BWKA 1QOQA 2G97A 1YLVA 2ZFAA 4N2YA 3TV8A 3NPWA 4GJ1A 5AHFA 2V8ZA 2VFEA 2YW3A 3UZ5A 2V9DA 3FLUA 5SWUA 2AAMA 3PUEA 1GVFA 1UASA 3GDKA 1X1OA 1WXJA 3IVUA 1KBJA 4PL1A 1EA0A 2Y88A 3HGSA 3PB0A 4JDBA 4XQ6A 3UY8A 5HWNA 5AC8A 5AB3A 2Q8LA 3W75A 3UNDA 4BR1A 4RR4A 4O57A 4JTUA 1VLIA 3LCWA 4H6KA 4YMZA 1VC4A 4AWTA 1M5WA 1MEIA 2QDGA 4JTEA 1VYPX 4CQAA 3GR8A 1EWEA 4OBTA 4NJIA 4EWND 4ZQRA 4JY8A 3G1FA 1OF6A 3EXSA 2V2DA 1D3HA 3TSBA 4LRTA 1EB3A 5F4WA 4MY9A 1F6KA 2JGYA 4IUOA 3NXFA 3LHUA 1AW1A 3I7SA 3U6WA 1XBXA 1FX6A 4K6AA 5EKYA 1YPIA 3W6YA 4JGDA 2ZZ3A 1JCXA 2HTMA 1LM1A 5D04C 3AO0A 1K3UA 4K7VA 3TAOA 3KRSA 2LLEA 2HSAA 3W84A 3NL2A 2HMCA 1L6SA 4E38A 1Q6LA 3EX2A 4LUIA 1SZGA 4BF9A 3N73A 3BG3A 3M16A 1FWWA 4O8RA 3KRZA 1PIIA 3KHJA 2B0MA 5K7JA 4MLJA 2QEZA 3G8RA 1JJKA 1QFEA 1YTEA 2H3DA 1Q45A 3JRKA 3EXRA 2CLIA 1J2WA 3C4UA 2X1RA 2Q3OA 4O17A 4AHOA 1TQXA 3WK1A 2ISVA 2YX0A 1PVNA 1H1ZA 5DBUA 1D3GA 3CM4A 5TQLA 3TU9A 3OEXA 3PAJA 4OU1A 4PA8A 4YL2A 3E0IA 3NG3A 3NQEA 1IGSA 3EX1A 4FX6M 3UD6A 4P2VA 2CLEA 3SECA 3EEGA 1KA9F 1LLWA 5D2WA 2GJLA 3FYPA 4AXKA 1B3OA 4CQ9A 4UC5A 2CW6A 4UR7A 4QM1A 1W5PA 4K8EA 5LZLA 1LBMA 3VCRA 3CQ0A 3OVPA 3CEUA 2ZYFA 3T78A 2CU0A 3IIXA 1LROA 2NWRA 4MIMA 3GYEA 2DJXA 4R33A 1EEPA 3ZWTA 3V75A 1SQ7A 4LVDA 1VYSX 3HG5A 4QQ3A 1FWNA 5F2GA 1TCDA 1OG0A 1AL8A 5BOOA 2Y7GA 4UMAA 5D02A 5CPNA 4H4IA 2J9ZA 3MYOA 1X1ZA 4WY0B 2OCZA 1EP1A 3ZWSA 4A22A 2E6AA 5G5IA 4Y9AA 2V82A 4Y96A 1K8XA 4PCFA 1NEYA 3P8IA 3W1QA 3S0CA 2V5BA 4O0ZA 2V5LA 1JQXA 2J24A 4WQ6A 5D30A 2NUXA 4XBKA 3MI2A 2FB2A 3N3MA 3SGZA 4I7UA 1JCLA 1H50A 2VFDA 1P4CA 3MHGA 1VCFA 1TPEA 1H1YA 1O94A 1OX6A 3NM1A 2NLIA 5C5YA 5F2LA 1B9BA 1GTEA 1WA3A 2DORA 5FF2A 4JX5A 4DO5A 4IMFA 4WZHA 1ZFJA 3IIOA 3OIXA 3S5NA 2QUUA 4GWEA 2ZRXA 2JK2A 3KRUA 1XUUA 1TTJA 4I7VA 4NQ1A 4GC4A 2AQWA 3LHVA 6ALDA 1EWDA 2PRMA 2B7NA 5L9FA 3PVFA 1VRDA 2GVGA 4BI7A 4ML9A 3DU0A 2YGYA 1OK4A 5FEPA 1AK5A 3DHFA 1S5TA 3P84A 1I8JA 3N19B 3LCIA 3LTSA 3CLMA 3W72A 3EX6A 3R2GA 4X22A 3LBCA 4HNNA 1H7WA 1XXXA 4Q32A 3W2MA 1VPXA 5AHLA 5CPOA 1EX5A 1KFJA 3UYCA 1P0KA 4N9BA 3G3MA 3EWYA 2Y7DA 4R53A 1JVNA 4LVAA 2QCNA 3SW6A 3R12A 5G2WA 2W79A 1TV8A 3VKJA 1EPXA 4FF7A 4GUJA 4WXZA 3WJZA 5FEXA 5AHMA 3SGUA 3BLFA 1N55A 4NZFA 4FX8A 5EA9A 1WDWA 1SZNA 4AB4A 3MI6A 4UIOA 4QNEA 1WAUA 1QDSA 2H8ZA 3JR2A 1S5VA 3NPUA 2XFWA 5FF3A 4DO4A 3P67A 3U8GA 3UWUA 1H60A 2YYTA 1RR2A 3TR2A 1R46A 3LCFA 1WBJA 5TIMA 4NVTA 3UWYA 4S1FA
chains in the Genus database with same CATH superfamily
4IIDA 1JFXA 2XPKA 2DZSA 2WKJA 3DJNB 2DZVA 3BLOA 4BFAA 3DKLA 3W8HA 4S3AA 1LL4A 2DT1A 3BLLA 4AHPA 1UKPA 5GQBA 4IARA 3IARA 5HR6A 1DKWA 1JR1A 1SFTA 4BQ5A 3ZT5A 4HU8A 3NSXA 3NA8A 4AMCA 4A35A 4P8XA 3TK7A 1S1RA 1JZ5A 3A3HA 2P61A 3IQCA 3LG3A 3S4TA 2VL4A 4E4PA 1HQTA 1TVNA 2B0HA 3T4WA 4RE2A 5DX7A 1YVIA 5HUOA 3ZR5A 1CTNA 1ONWA 1KM3A 3S5ZA 1V4YA 3CASA 4NYUA 1B31A 3VOFA 1R86A 2V68A 3PAOA 1OGGA 5G1TA 2ONEA 4UQDA 1JRAA 3CQHA 1DJZA 2QGYA 4E17A 1T41A 3P7YA 2ABAA 3QN3A 3T40A 3CIXA 2Y63A 4NC3A 5EFFA 3N9KA 3S8HA 4RKAA 3CAVA 2J7PD 2QLYA 4UNLA 5EYWA 1ZENA 3MCNA 3C8GB 4ZXLA 1FUYA 1HL2A 2GVLA 1UP3A 2Y5EA 3EHNA 4XKMA 2ZUVA 1Z41A 4M51A 3EDEA 2J25A 2P3EA 2DW7A 3GM8A 3SNHA 1LUCB 3O10A 4WABA 4O8AA 5EB8A 1QBAA 4O15A 3MDWA 3LDVA 3SR7A 3TW9A 3EBVA 2A0UA 2HDJA 3WJWA 2ZUNA 1C02A 1UWIA 1QPKA 3K5XA 3TJLA 2RSEB 3UVIA 5G1MA 4IX0A 2QYGA 1RXQA 3MYFA 3QF0A 3NR0A 1DYSA 4ATLA 3KYIA 2PDGA 3SFWA 4MDOA 1OW6A 1G4SA 3PBYA 3QZEA 1T8QA 4P9FA 3GQYA 4WHBA 5CPLA 1QXLA 1QW8A 3KL4A 2P1AA 1FWIC 4HNTA 1UD2A 3C8NA 3W7HA 2VFGA 1ME7A 1A5LC 4LU0A 2Q01A 2Z24A 2BDQA 4NIRA 4JURI 4IMCA 2PDWA 2I14A 4YHEA 1EC8A 1ZZMA 4C7GA 4R7JA 1TSIA 1R2RA 4NSBA 1QR7A 3IS4A 1WGWA 1J79A 2WMFA 2HKVA 1GQNA 4A6GA 4ZLCA 2CITA 1GOQA 3G1VA 4IFKA 3LSCA 1Z3IX 3CZ6A 1MNEA 1A5NC 1SR9A 3GBEA 4LYPA 2WM0A 3JT1A 3UXKA 4LEFA 5T1DB 4H83A 3CL8A 4KEZA 3KE0A 3ARYA 4CN1A 2ZZ6A 3AZRA 1WOLA 4ACZB 4MF4A 1AUSL 4U2ZA 4HNLA 3W1TA 3GYCA 2V5DA 5CGQA 3RX4A 4GC3A 5CAKA 4QDWA 1W5MA 4V2XA 1O95A 2A85A 1FWJC 1JZ4A 4PUJA 3S2JA 4TTGA 1FDZA 4IGMA 2YZ5A 4L4MA 2DSZA 3TCEA 1A5UA 5A6KA 4Z08A 1O5QA 1XKJA 2E40A 4WJ8A 4WSKA 3VDHA 2LFDA 4XG1A 2FVLA 3A24A 1K9FA 1W32A 2IPJA 4PEKA 1DP0A 3C2OA 1PO9A 3PZMA 3P5ZA 4DXWA 5IHRA 1LQ0A 2O7QA 3W7IA 2ZKMX 1PWLA 2OR2A 4XSMA 2INEA 2PFDA 3V0SA 2WKGA 3HGRA 1F1MA 1B4EA 2BWGA 3QOKA 1R3YA 2ZZ4A 3RLVA 3PMRA 2R14A 1VEMA 7XIMA 2ETSA 1OD8A 1A7EA 5LIWX 3H4XA 4JIEA 5HDRA 2A6EF 4PRWA 3VINA 5KZ6A 1JUEA 1DJYA 3AIBA 4O4WA 3BDKA 1LG2A 4MS2A 5COMA 5IY5C 1PSCA 3DYOA 3L5LA 4BK9A 3H2CA 1KM1A 1R9ZA 3WD2A 2MYSA 2QDDA 1M7OA 3RX2A 3W83A 1R87A 1XPYA 3EX4A 3SY1A 1A5SA 2C91A 4LC6A 1F4HA 4PR4A 2ZVRA 1MNDA 3LI1A 2VOTA 3UY7A 1XD0A 3SJNA 1E9YB 2GFHA 1ICPA 4PRTA 4EAMA 4O50A 3H70A 4TX9A 2QV5A 4K37A 3TP4A 1FNTc 2BGNE 4ER9A 1P1XA 5G2HA 4P9TA 1E0UA 4HYRA 5HWMA 4PTDA 4IQJA 3CJPA 1OCRC 4C6JA 3GK0A 3AAMA 3CUHA 3OODA 4C3BA 7CGTA 1LQAA 3WKZA 1ZU5A 3RR4A 3GFZA 4Y9NA 4M6VA 1Z6AA 1XLLA 2EJ1A 3PZNA 4L6RA 4XPXA 2IMRA 4AK9A 2WNNA 1BYBA 1GOKA 1VGAA 3U4FA 1SF8A 1RQHA 1BYAA 3GXMA 2E1WA 2AL2A 4OIOF 4FP1A 3GE7A 3NO1A 1LI7A 4H8NA 2OJQA 3RKOF 1YADA 4GUFA 4LUJA 4XV0A 3L5AA 1GQIA 2FTYA 4J27A 4YLWA 2PDKA 4Z1DA 1J96A 3GR7A 3OVRA 1TTPA 3XISA 2J7GA 1W9PA 3GWLA 5CJ5A 3RO8A 5HPOA 2NX1A 3ZJKA 2W9YA 1GEHA 3N04A 4JTAB 4D8AA 1D2KA 3WD1A 2QNEA 1CLVA 1EL3A 3N4AA 4LAUA 4ATDA 4UTIA 1Q13A 5I5RA 3FJ6A 4L4OA 2EG6A 2DSKA 4PUDA 1JZ2A 3PTKA 3PJUA 3CU2A 1LE2A 1KQYA 2AGKA 1QATA 4UMBA 4C3DA 3O0FA 1HMOA 2W5FA 4MAVA 4B15A 4QSFA 4Z9IA 1A3XA 2E8YA 3FJ4A 4DJDA 2QQ6A 5HQMA 4CNTA 1EJVC 4I8YA 1AH0A 1E6PA 1F7BA 4BJ5A 3S1UA 2GGIA 1BKSA 3G77A 2CHOA 2YPIA 1MNSA 3SCNA 3S9ZA 2WNZA 1S46A 4HD5A 1E43A 2Z6JA 4MHBA 1XYMA 3E0FA 5JLIA 1OK6A 3JYYA 4ZLDA 4H01A 1J6OA 4KWSA 3HNJA 3RCMA 2Z2UA 4R27A 1YE4A 2BY1A 1G4TA 2A1DD 2XIOA 3WBXA 3IQ5A 5ECUA 1C8XA 3WUGA 1ORJA 3FYOA 5DLJA 2QCLA 1W5QA 4OIQF 1PCKA 3VIFA 1K7FA 3GIPA 2VNCA 1S05A 2NZLA 1J2BA 2D4UA 4XEKA 3LTYA 4AYSA 2ZQ0A 1U89A 2C0HA 3SFKA 2R1MA 4J4KA 1GHRA 1DEDA 4F0MA 3B9OA 2OQYA 4KGLA 3EMZA 4L6HA 2NUTB 3HG3A 3WH9A 1FWEC 2XM4A 3RPMA 1M57C 1K40A 1OINA 5AC7A 3AIUA 4EXQA 2OU4A 1M2VB 1SYQA 3K1HA 1GQLA 4PUMA 2V30A 3B8WA 1QI5A 4HMNA 1KLYA 3C62A 2PDBA 3DBPA 3OA5A 4KWWA 2Y3BA 3UCDA 1T7LA 2RH9A 1F3WA 3LHWA 3CQIA 4B9YA 1QPNA 1EBGA 3D46A 4IP7A 4YL1A 1VJSA 3IRSA 3TIMA 1YXDA 3NQMA 4OIPF 4DNHA 1L7CA 1VIWA 3DE8A 2PWGA 3N34A 4GHRA 2CEQA 3TXZA 4WCJA 2G50A 5HNTA 1R85A 4QCEA 1IIGA 3TXVA 3TJ5A 2POTA 2UBPC 4I9TA 2PDMA 2X0HA 1R5YA 4GOAA 3B8VA 5D8ZA 4F0RA 1EJXC 2VQTA 3OHIA 1ZHYA 1E2XA 2XN1A 3LM3A 3Q37A 2HCVA 3U3FA 3K1IA 3A4AA 2IXMA 5TAOA 4QLJA 3T55A 4RLIA 1W1A1 4TVDA 4JPGA 1K6WA 3MI3A 4WSHA 3W71A 1LLOA 4AF0A 2VWSA 3EWZA 1GYMA 1QVBA 3H2EA 1P0DA 3VFCA 3GTNA 2IBFA 2YCKX 1Q6OA 1W5OA 4ZGYA 4LUTA 3AS0A 3QPZA 3T9PA 1H9GA 3MMUA 4UTTA 3SXKA 3VNYA 6CGTA 1J8MF 2YCLB 4UDVA 1JRCA 1B9ZA 1MRAA 3U5SA 3IUHA 1YXYA 4C1LA 2BV9A 3M5XA 4Z42C 3F2CA 2GQ9A 5FEZA 4FLSA 3DEQA 2XH0A 5BCAA 4PEEA 1ORSC 3EDKA 3DFYA 1ZS2A 2VC7A 4Q3MA 2RDWA 4LH8A 2WBKA 1ODUA 1FCVA 5LSMA 3L2MA 2O55A 5BYWA 4HMCA 5A69A 3KVLA 1OVDA 3KVKA 1KB3A 2EEXA 1QU4A 1G1YA 3K4AA 1DTNA 1HZYA 4ZTYA 2YIHA 3AGTA 3BO9A 1TELA 1OW7A 3Q45A 2YLAA 5J8LA 1NP2A 1FVPA 1I2NA 3WDHA 3SEPA 3UBPC 2BE5F 1BTCA 1YNYA 2IUZA 3CK5A 3VILA 5D92A 1V3HA 4NHVA 3TTEA 1ISVA 1GM5A 2CZFA 2C18A 1QUMA 5G2IA 2JEQA 3SUUA 1FH7A 4AY8A 1UG6A 1DHPA 5LNSA 3LJBA 5AC5A 3VCNA 2P5NA 3UW6A 3N3TA 4G1NA 4F2BA 1Z7Qc 1TE6A 4ZQMA 3UG4A 4C6LA 3WDRA 2ASHA 5E93A 2WMHA 1QNPA 2VKZG 5T26A 4MVSA 3X2QC 2TSYA 2DVTA 2DP3A 1NSGB 1U2YA 2VHLA 3SRHA 2VWTA 1G4US 3TNBA 1XIIA 3GU9A 2PF4E 3AJMA 3OB8A 3PZVA 2ZDRA 2DYRC 5C70A 2AAAA 1LRQA 4HHLA 1Y5XA 2BFGA 1E4NA 2ATSA 1YX1A 2IKJA 1OABA 1ENUA 3WLHA 3BG5A 5A1AA 4PH6A 5I02A 3DAGA 5K9XA 1YKWA 1B3WA 2AU5A 1YJGA 3VK5A 1WKEA 1O68A 1TV2A 5LNRA 1IZCA 3TW7A 1E85A 5I3FA 2Z26A 4BEQA 2ZPAA 4ZFCA 3ONBA 2REQA 3EZIA 3S5SA 1PKYA 3UESA 3S6DA 2H6RA 3N2ZB 1V74B 1ITQA 3LPPA 3C0LA 5L0JA 1LCOA 1R3QA 2A3LA 1PWMA 3A9CA 3CS2A 3IGSA 4GCAA 4PB3A 4O11A 1QMLA 2ALDA 3VE9A 1NWTA 3L0KA 2VZSA 4CVWA 1B1YA 1YDOA 3LA4A 2MNRA 4TIMA 3HPSA 2WSKA 4MZ8A 2W4BA 1KRMA 4QLLA 4J3WA 1KO0A 2GSEA 3GLCA 2Y61A 4C6KA 3CQJA 1E4LA 3E74A 4GVFA 4XTKA 1Z23A 2PDNA 1LIHA 1OF8A 3DC0A 3STCA 2A68F 3UMHA 1LBLA 5T9CE 2Z1XA 1RPKA 5HUPA 1SVDA 2A1YA 3ZFHA 3AWNA 1IXPA 1PJ9A 4JCLA 1ST6A 2GA0A 3S9YA 5F2IA 3ABOA 1X7FA 3I7RA 4HP5A 1W3KA 4IFKB 3WL0A 4CBEA 2C14A 2YB4A 4W85A 3V1HA 1HE9A 1AD1A 2GJRA 1HKIA 1QNSA 2W3ZA 4XIMA 2ZXOA 1NQKA 3EJNA 1Q8AA 4N42A 4LS0A 2R94A 3H8AA 2J62A 3AS1A 4LX4A 2J8GA 3WMSA 1EBHA 4C7OB 4KEMA 1E9ZB 3WBAA 2IPGA 4O10A 3KUMA 2PA6A 2YKKA 4HFKB 1JPHA 1HUVA 1L0PA 2OZ3A 5KITA 1V6YA 3S90A 1M04A 4J7RA 3NOYA 4UQBA 2F84A 4K68A 1OFDA 2VRKA 3GNPA 3PJTA 1KNYA 2OU6A 3IJQA 3RVZA 2X41A 2C16A 3MHFA 3OJGA 3VD9A 1GVSA 4FLOA 3W73A 5FAGA 4XBJA 3G5EA 2Z0IA 1HF6A 2ZA3A 3PULA 3EWUA 3QYSA 2P0OA 3V5XA 4CDYA 1K8CA 4QLKA 2WWCA 4DWSB 3DIPA 1AFSA 2VX6A 4IGNA 4OV4A 2IPFA 3MO7A 3VZZA 1FWSA 2L81A 1FQ0A 1FTXA 2ZUMA 3LRMA 2D2JA 256BA 3B03A 1IE7C 3ARPA 4G7FA 3CBWA 6XIMA 2GLKA 3BW2A 3HURA 3CQKA 3W4RA 3BQ5A 5AGFA 3UG8A 3ECSA 3H22A 4NNBA 2V69A 2L7AA 4AIOA 4YN0B 3W2JA 3RDKA 2QCGA 4BWLC 2AWCA 2JD3A 3GO2A 4KEVA 4S3JA 4GE8A 3MX3A 1OG6A 4NASA 3JUGA 4TR9A 1TPVA 1EUNA 3GXDA 3TFXA 3QTHA 5A6BA 3N6JA 3FW6A 3DFSA 3DN5A 2B7OA 3WY1A 1YNQA 3GRIA 3HIJA 2CCRA 3CZLA 2BSLA 1BG4A 4PUKA 3W7MA 4WVXA 1JF5A 1RY0A 3PJXA 2PWVA 3O6CA 4ZQCA 4PE8A 1XR2A 1V0LA 3S29A 4Q4SA 4ZL1A 3QV8A 2DUZA 1ZHAA 1EEXA 3MSGA 1UJPA 3BAXA 1I6NA 4JYFA 1IV8A 2AL2B 1NSJA 3QV6A 4I1MA 3W7DA 1Z44A 5C8BB 3MZ2A 4FXSA 4LF2A 1PV3A 3E3HA 3UP8A 1LOQA 2QXWA 2CKSA 1EC7A 4IXHA 2VDHA 3V4BA 3M5YA 1TR9A 4V15A 4A8RA 2VFIA 1E4MM 1X38A 4MNMA 4B5VA 2HV5A 3VNIA 3MYPA 3B0XA 5A8MA 1LRNA 2I57A 3PSVA 3A3WA 1Q2SA 4AD4A 4EBBA 1CX9A 5AYZA 1IXOA 5K2ZA 4RV8A 4WJ0A 1NDZA 1KFBA 1TRIA 3RX3A 5M03A 1RK5A 1ZBWA 3HOJA 1EJWC 1ORYA 2WOQA 4GH3A 4GD0A 2PTWA 3MUCA 3K46A 2ZZ1A 4L64A 4WY0A 2PPGA 3SBFA 9CGTA 3QMKA 2WV8A 4QDMA 1TJ0A 1IT7A 3M0VA 1AZ2A 2NVAA 3B8IA 4C6MA 3JRMO 2PBOA 3ZDLA 1A3HA 4L80A 1JOGA 1G0CA 2P10A 1PB0A 2OKTA 5HMDA 3CXOA 4GZ7A 2DJLA 8TIMA 1JD9A 4N6CA 1YW1A 3MWAA 3LCLA 4YT4A 5DQTA 1A5AA 4CNUA 4BI5A 3SB0A 4YWIA 3NMIA 1JXJA 4GIAA 1A0DA 1FFHA 1JD7A 3VIIA 1Q8JA 4JICA 1EGVA 3TLLA 3WQ6A 4C6OA 1WP6A 2HMQA 3GSMA 2GGHA 5DXYA 1K7XA 4GZJA 2XTKA 4AVOA 1BWVA 1H2JA 3CUIA 2ZADA 2VR4A 1M3UA 2D73A 4I7WA 9XIAA 3S6TA 3S2MA 2X1SA 1EQ1A 4YL3A 1FDYA 1UIOA 1RP8A 4OIRF 4REQA 1XLCA 1GK8A 3BLKA 4B5SA 1FA2A 2P0IA 1NVMA 1D8WA 1CENA 3GM1A 5TJ5E 4LALA 3KHDA 1F3EA 2G0WA 3LSBA 3EGDA 3HLZA 4KWVA 1MEHA 4PCSA 2RAGA 4FI4A 5E0KA 4S3KA 3KS5A 2J78A 1DVJA 3U4AA 3VABA 4JFVA 4DM1A 2A2IA 4S3GA 1PCXA 1HMDA 4M7SA 3AMDA 1ZJHA 3RN6A 1JMWA 4F2UA 2RJGA 1XIHA 4W8LA 4OHQA 3UEQA 2ZUUA 3WMLA 4L9XA 3ABQA 4QJ4B 3MJMA 3DI1A 4FNQA 2VZOA 1XH1A 5DBTA 4UBPC 4EF8A 1NFOA 4IGSA 5F28E 2HFIA 1Y65A 5CZ0A 3PM6A 3FN9A 3SN4A 5KZDA 4EAYA 3N2TA 3T08A 2CWXA 3EGJA 2AOSA 4JHMA 1RCOB 1XLAA 5E0FA 3P2VA 5DQPA 3SXYA 1TFOB 5EK0A 1GOXA 2XLHA 4AF0B 2ZA1A 4XO7A 1TO3A 3KDOA 2OPJA 1L2UA 1W9BM 3SCUA 1C9DA 1RD5A 4LUTB 1PKLA 2I7GA 3BJFA 4JQ2A 4R3UA 5I6SA 5I3HA 3D5HA 3RHGA 3C18A 4MAZA 2OKUA 5FCLA 3KWXA 4MVRA 2DZTA 4NJHA 2AL1A 1BQCA 3WYZA 2YRFA 5ABFA 3CUFA 3M46A 2FZBA 2X7VA 4E0CA 3H4WA 4GVIA 1EUAA 1OR2A 1GS9A 4W93A 4EKJA 3BL3A 3NKDA 1BYCA 3EEZA 5CBJA 1EP2A 4A3UA 3WEZA 2E9LA 2VELA 2NX9A 5EU9A 2HSQA 2VGBA 1N1CA 4WGXA 3USZA 3G0XA 2E87A 3W1PA 3OPSA 3LV6A 4TOQA 1MZRA 5DMYA 4RW3A 4EACA 3NZ1A 1OC6A 3G0UA 3TWBA 1ZBCA 3DFTA 4GUIA 2V5KA 4UTWA 4LLEA 4EHPA 4JCHA 3NEHA 2P8CA 1OFQA 1A50A 3HPZA 1ONEA 5HBFA 4CNOA 3CYJA 2RFGA 3M4HA 4M7TA 4PODA 3SCVA 4X63A 2PAJA 2F8QA 1QPQA 4CEUC 4FAMA 2ZXPA 1KFKA 2XH2A 3VFLA 4DJFD 3JZUA 4XVDA 2GDVA 5KYWA 3NQAA 4HE8D 2OOFA 2QHAA 3H2OA 2X40A 2QE9A 4M3PA 1LM3B 1CGME 1YBQB 4WF7A 4KCTA 3ARUA 2A7RA 4ICCX 1QO2A 3LNMA 2X0CA 4N6FA 1FFQA 3GXFA 2EHHA 2ZUSA 2JIWA 1OCNA 3W4YA 3OLEA 5FJRA 4E7ZA 1TPB1 3W7RA 1SM9A 2W9MA 3OA1A 1JPDX 3HJEA 1CECA 3N2XA 1K05A 4RZ4A 4U33A 4WR3A 1XIMA 1NTHA 2X7WA 1NZEA 3QFWA 2UV8G 5C9WA 2CKRA 2FKPA 2E67A 4P7OA 2XWDA 1WKDA 1HX0A 4NILA 3URQA 3A4WA 4MNJA 4A3QA 1O7AA 2BZNA 4Q6JA 3L4WA 1HKVA 3UVAA 1Y5WA 2R02A 1YIXA 4GBUA 4K38A 4I3GA 4X0VA 3ITOA 3PUGA 3KPHA 3UMIA 4U3AA 4IJBA 1OQFA 5CI9A 4DJEC 4LT9A 3VTRA 5MF5A 1QNOA 5L3VA 1KR1A 2D0GA 3CUJA 2REQB 5MKGA 1EH9A 2QGHA 2ZE0A 3STEA 4OD5A 1UPPA 5BRPA 2PF0A 5HOSA 2DQWA 3CH9A 3VDBA 1BVWA 2YXGA 1VBJA 3O7UA 2X42A 3IIPA 2UY4A 4Q7IA 3VGGA 1A5CA 3ZT7A 3DMDA 4G0HA 1GJUA 3GVWA 3S1WA 4GVHA 4J2MA 3KFTA 1TPFA 2ZZ7A 3K7DA 3G1AA 2OQHA 3MQTA 2QTVA 4DBRA 3K13A 3AWOA 3RYSA 4KRUA 4XX6A 2FGZA 2VDGA 1W2WA 4HKPA 3R8RA 1KFEA 4GJIA 1VB9A 4GYKA 2ESCA 5DCDA 3MJYA 2Y62A 4QX4A 4Z1BA 2BG5A 3M44A 4Q4KA 3GXIA 1IQ8A 4FNPA 2EAWA 5I79A 2NQZA 2GVEA 3VI2A 1R38A 3B9EA 2QJJA 2WCSA 4X61A 4G5DA 2Y85A 5CSUA 1FCUA 3VMOA 2R8WA 3A9BA 3OLGA 3FDQA 1WKYA 4LCQA 4B3LA 3AQBA 2VEKA 1NF7A 3L7RA 3GHSA 4WJEA 4NQFA 3L1MA 1VBRA 3EPNA 3G1RA 2KC3A 3W2LA 1J01A 4B5WA 2I16A 2P76A 1XIBA 4TMCA 3DHDA 1BR2A 1UR0A 5CH9A 1NM9A 3BLPX 1PZ2A 2QCFA 4JKVA 1XRTA 4UZSA 4HYWA 4IMEA 3O6DA 4A2SA 2R91A 3G2GA 1M01A 3AYSA 4H9MA 1JDEA 1J5SA 1OYBA 4Y90A 5LHEA 3MV11 4UFMA 3GEIA 3ABZA 3N14A 2V3EA 4UTUA 2X8RA 1BWKA 4QP0A 1KBKA 2FH6A 3A4JA 3TV8A 3NPWA 1D0XA 3THUA 5AHFA 3VC6A 2V8ZA 2VFEA 3UZ5A 4A05A 4L65A 1EQCA 5CJMA 3NYLA 1RLDA 4W86A 3GDKA 2GK1A 1KBJA 3UY8A 4S23A 5HWNA 3EH2A 2YCIX 3W75A 5CCZA 2O92A 4O57A 3RPDA 1RJQA 4H6KA 2MUCA 2QIIA 1M5WA 1MEIA 1MFUA 4JTEA 2YBVA 5RUBA 3ZOAA 1CGNA 3T07A 5CC5A 3F2DA 3KTCA 4NJIA 4EWND 1UROA 4JY8A 1B54A 1OF6A 3MMDA 3WH7A 4J2PA 3VIJA 3TSBA 1Q4NX 3ARRA 1JGMA 2BHYA 4IUOA 4BF7A 4C7FA 5BQGA 1W3LA 3I7SA 3MVTA 4FWVA 3WNOA 4PTMA 3JTLO 4W88A 3CGTA 2GDQA 1JCXA 3EFOA 1LM1A 5D04C 2QIWA 3KRSA 2R7RA 1RCXB 4NCQA 2HJPA 3NL2A 4ZR8A 1L6SA 5CZKA 2GWGA 4FS9A 4RPQA 5KYYA 3EX2A 3RLGA 2XSBA 3N73A 3BG3A 4GQQA 5HMFA 1PIIA 3KHJA 1DJIA 2C79A 1BQGA 3NURA 3Q6MA 1T6QA 3BC9A 2CLIA 3C4UA 1J2WA 3AOFA 3L8JA 2Q3OA 3TTQA 4PJMA 4GINA 2V5JA 3ZM8A 3WK1A 4B4FA 2ISVA 3BSMA 3PANA 4RDYA 3TU9A 3CM4A 5TQLA 2YLDA 3S3GA 1CDGA 4YL2A 3SP1A 2YWAA 3NQEA 3DI5A 3TTYA 3EG9A 1UC4A 1UR4A 2H7VC 5C9UA 1ZJAA 4NY2A 4Z17A 1FKWA 4WGZA 5D2WA 3FYPA 3S27A 3OGSA 5A8OA 2CW6A 2E8ZA 4K8EA 4MJ2A 3PFMA 3VCRA 4QXIA 1WKFA 1NDVA 2GWWA 2GJPA 2ZYFA 3T78A 4XZMX 3IIXA 1LROA 2W67A 5EMKA 4R33A 2EBNA 4OZOA 2XH4A 2BVYA 3BOLA 1F3TA 1OG0A 1IWAA 1NG1A 3M0MA 3AXHA 4ASTA 5D02A 3ZJ7A 5FACA 4WRHA 1X1ZA 4WY0B 3AFBA 1BR4A 1A4LA 4HCDA 4A22A 3SDOA 3RAOA 4Y9AA 2VZUA 3V7OA 3AXXA 4JQAA 3ABLC 2J24A 3ZMRA 4J32B 3N3MA 3EOUA 3SGZA 1L6FA 3T6BA 1P4CA 1OW8A 1VCFA 4MPKA 1TPEA 1UOKA 3NM1A 2NLIA 5C5YA 4XPWA 5F2LA 4GA8A 1WA3A 3RILA 8CGTA 2OJED 3I4EA 3IIOA 1AVOB 4U2YA 2OYMA 3KRUA 1TTJA 2BGQA 4NQ1A 4D8LA 1LVKA 2VCAA 5ECVA 2P53A 3KBJA 1P6WA 4Q8WA 2J9BA 2B7NA 2CPUA 3PVFA 4U5IA 5E70A 1AK5A 4K1WA 2INZA 2R24A 3TJ6A 1S5TA 4REQB 3N19B 5DVWA 6A3HA 3CLMA 3W72A 2WMIB 4GNVA 2NV9A 1E83A 3CEXA 1TV3A 4C6EA 2W66A 2VQUA 4HA3A 3VOHA 3H7UA 2W79A 1TV8A 3BOFA 2AGTA 3VKJA 1EPXA 3WJZA 5FEXA 3P0XA 3KKBA 5T3WA 3SGUA 1DIKA 1UOZA 2DT3A 4NZFA 4DY1A 1CCWB 3H12A 3H2MA 4JVSA 4QNEA 4CN6A 1WAUA 4E7SA 8A3HA 4Q8NA 5H8MA 3HPAA 4DVZA 3LD5A 3EZHA 3UWUA 4Q4RA 1EHNA 4PTWA 1V6UA 3M0IA 3TR2A 1BRLA 2J6VA 4RE0A 3SCPA 3KZSA 2WZIA 2ZD9A 4HTYA 5TIMA 1M7XA 1OC7A 4BZYA 3NZGA 3ABXA 1YYJA 2PDCA 2J9VA 1H09A 2HPMA 4RNHA 2B31A 1KXTA 1LL6A 1HNYA 2HSBA 4D1JA 2ZUWA 2CLKA 1LT8A 4XWJA 3WLLA 3VMNA 3TJXA 1AQHA 1E55A 4PUUA 4N9EA 2VEFA 4C6NA 4DZHA 1JZ7A 3SRKA 4HPGA 4JNMA 3VNJA 2WXDM 5B7ZA 1S38A 1RP9A 1VJIA 4QRNA 2PX3A 3UFYA 4MNDA 1VFMA 3B9AA 3LLKA 2FZMA 1V6XA 3V35A 1E40A 1AJZA 1RZMA 3CMJA 4MQ9F 1BG9A 2V38A 4JJGA 2J7DA 4LNCA 4LEQA 1D9EA 4MJZA 2C0AA 5ABFB 1NBBA 1TUXA 2VJXA 1QI3A 2PS2A 5EL1A 3ZR4A 4CVUA 4XK2A 3QY6A 1RV8A 3T0DA 1TWDA 5AZ1A 3BAYA 4JTTA 1E1EA 2QJIA 5DO8A 4PCTA 1QASA 1ICQA 2UY5A 3JS3A 1W1PA 3OOQA 2VOMA 3HQOA 1AW2A 1TB3A 3I5PA 1TKKA 2DGAA 1JFHA 1Q6FA 3T0BA 1QK2A 3ARXA 2OB3A 3GW0A 2GGJA 1UR1A 2DPEA 1H49A 1PEZA 1OGBA 4QISA 5FIPA 4XAYA 4ADSA 3N24A 4JIRA 4AD1A 2BLEA 2BODX 4IMGA 1F73A 2J7CA 2KZHA 1XWJA 2TODA 4PBGA 1DWFM 4HK6A 5F1UA 4MG4A 5K3VA 2EJAA 3QHNA 3W00A 8RUCA 4W89A 5CPQA 1ELSA 3GX9A 3VIHA 1YPFA 5EMYA 3MO4A 4O1BA 3CHEA 1HKWA 3VKBA 6ENLA 2WBGA 3SY5A 1QLEC 3GIQA 1RALA 1TV7A 3PTQA 2TMVP 4XD3A 3WLSA 3LNMB 1QVXA 3LLFA 1SFJA 4NF7A 1MW3A 1MUMA 1UR2A 3BJTA 2PP0A 3W2NA 4IISA 3E0WA 3G1DA 1QI4A 1IT8A 2VD8A 1MMDA 2FQIA 1K04A 1F3XA 4HU3A 3CZ8A 2YBUA 1XQLA 1MRQA 2A3HA 3TTOA 4HZ6A 3M7WA 4JEQA 4DBUA 4LY8A 2WPGA 3BAIA 3QSTA 2F6KA 1GHSA 3RW0A 2NV2A 2G3VA 3TTSA 2YDSA 1O87A 4H19A 5EY5A 1TFVA 4LDKA 4V1YA 4UNIA 1F61A 3H4GA 3P8JA 4XAPA 1J10A 1PV8A 4J40A 3BUVA 2OOCA 4HOWA 1SGJA 3NQBA 1JL8A 1LQ2A 2FTPA 4QDLA 2VR5A 1HW2A 4KGJA 1H41A 2GJXA 4LOCA 3H23A 4RDWA 3TQKA 4NAEA 3GEEA 2AKMA 1ONXA 4O16A 3AQCA 3SIMA 1WOBA 4E2OA 1Q6EA 1WBHA 2NSFA 3BAWA 3ITTA 3HA1A 1TV4A 4FR1A 2OYKA 3SCRA 3TYBA 5CZJA 3TJ4A 3LPFA 3O15A 2NXGA 3EMCA 1JCTA 5HR7A 2RDXA 2WPBA 4MVUA 3PS7A 4OBRA 3I3BA 5D4YA 2D2GA 3PY2A 2QUPA 4YXGA 4QIUA 5CC3A 1MI3A 5D09A 4RPPA 2ZXDA 1TX0A 3H2UA 4LF1A 1TVPA 3BAJA 1P6CA 1XIEA 3UF9A 4E6MA 4LTSA 4HA4A 3FVMA 4Z2KA 4AHQA 1H63A 2WVSA 3QQWA 2B0JA 5AYBA 3AI0A 3NNTA 1YDIA 1J8YF 3HG2A 5CGMA 3RM8A 3F46A 3FDGA 1H0GA 3P6LA 3PHAA 4MVMA 1BVZA 3L9CA 2HBVA 4C91A 3AROA 3TE9A 4MY8A 3FFSA 3WCZA 3NKEA 5CLTA 4Q4MA 2LD6A 3G1XA 1WX0A 3JU2A 3VCCA 2J9WA 4P8WA 1L6WA 3UGRA 2ZA2A 1CPQA 3DZAA 3N12A 3VGBA 3ZO9A 3B0PA 4DRIB 4IIFA 4BEUA 5BMXA 3L68A 2WJZA 1XCFA 1JG9A 1I60A 5I3IA 3TAKA 3WK3A 1Q3NA 2G3FA 1AMYA 1JZ6A 1MQRA 3QSRA 3MW7A 1Y6DA 2RDUA 4PMQA 1IT0A 4Q8VA 4IAQA 2BY3A 4PZVA 4D2JA 3I68A 1SMDA 5AYIA 3NL6A 1YE6A 1O5HA 3CV2A 5B7YA 2HE8A 5CIVA 2PDYA 5CZSA 3ANVA 3M7SA 4I9AA 1HJVA 5HULA 3LERA 2GK1B 4YCOA 4K2SA 5I77A 1XYLA 2GDCA 3NO5A 2IKIA 2XXAA 4WGHA 1XC4A 3M4CA 1MW2A 3V18A 4CGTA 4M80A 4AEOA 2JKEA 3W7OA 2QPXA 2VUYA 5KYXA 4JX4A 2D0FA 4JIQA 2XWEA 3ARVA 4JFSA 1TZZA 4XAFA 4IGHA 4XKYA 3S5OA 1UWRA 4WKAA 1O60A 1F74A 1US3A 3DG7A 2WNWA 5HA7A 3H55A 5I7GA 4FA3A 4RNJA 1H11A 1JYNA 1QWGA 4X60A 4Q8OA 4JTGA 4EK7A 4GQHA 3EFOB 3R89A 1YA9A 2OEXA 2PUZA 1TIMA 1WE5A 1K9TA 3RITA 1R9YA 2FZ8A 1YNPA 2XVLA 3B0UX 2H90A 3VNLA 3LUTA 1B4KA 3KTXA 4E2DA 3FIGA 4MLRA 5KYYB 4U4MA 1A47A 3HTWA 4HSOA 4HOZA 3APGA 1NOWA 2PTXA 4NU7A 4YTQA 3REQA 1VB5A 3LB0A 1PHQA 4B16A 4DRSA 1ZZPA 2DEPA 3AIRA 5CXPA 2JGQA 3W07A 1XYAA 4AD5A 4XUYA 1GEQA 4PMRA 5KZMA 2BB0A 1Q7ZA 3IK4A 3N13A 3UGVA 3A13A 2GDUA 4N4WA 1M41A 3L0NA 3AIVA 4D6JA 5AN7A 4O0QA 3PBUA 1SW3A 2R05A 1RJ9A 3W88A 1A41A 5IFPA 3CEPA 1D1CA 2VX5A 9RUBA 4ICNA 3HKKA 2DSWA 4IJCA 3II1A 1KCXA 4ZSTA 3NVTA 3S42A 4JZAA 2WVVB 3VX1A 4YCPA 5GJNA 2R82A 3OG2A 3QTGA 4F4RA 4MKNA 4UCGA 3NQGA 5DN1A 2WLZA 2PC4A 4M6QA 4O4VA 3KCOA 3MS8A 2D3LA 1YARO 1XUZA 3W24A 4RD9A 3NQFA 3T4CA 5D03A 5CG7A 3CPGA 3RRXA 3W1LA 2GQ3A 4HPHA 4FPSA 3WDPP 4ES4A 4RNIA 1R0MA 1EF3A 5H6HA 1V8EA 3GVGA 3PZUA 3TOMA 4DM2A 1CLKA 3NGJA 1OXBA 1X6UA 1W3IA 3IQ6A 2NQ9A 3THQA 3W27A 1XKYA 2JPUA 1NU5A 2Q6ZA 4AUBA 5FJOA 3LXCA 4E0IA 2PWDA 1W1YA 2Y69C 1S2VA 1G94A 3W53A 2H3BA 2ZC8A 1MMNA 1Z63A 5AHIA 4EE9A 2J47A 2WANA 1NFNA 1RKEB 2A3EA 4TVUA 4QTGA 3CWHA 3BLEA 2YJQA 3ZYZA 4M81A 3SUVA 2AQOA 2C6QA 2EIKC 3OU8A 1EOKA 1QAPA 3PTDA 1US2A 1Z3NA 1JI2A 3WQ5A 3CL7A 4XEVA 4I1OB 2ATMA 1QPRA 2VGFA 2O9PA 2Y8VA 4J5NA 3N2CA 3NUKA 1FOBA 1UR3M 1XBVA 4UQAA 4K0DA 3LHYA 4LY4A 4NUWA 3DAQA 3H65A 1OX4A 1T96A 5DS5A 4K7YA 3W7PA 2Y24A 2J88A 3NYMA 3ZQYA 1YDVA 4I5UA 2OLHA 2WSRA 4UR9A 5D2TA 2A0BA 3IGHX 3WQOA 3O9NA 2Q9CA 3VNKA 4RDVA 1GQJA 1ECQA 2XVGA 3EWXA 2J8FA 3ATZA 3BCFA 1KFWA 1UR9A 4LCRA 4CKQA 3NFUA 5DRIA 3S1XA 2NQLA 1PIFA 4ZE4A 1R4TA 1BRLB 5EGYA 5A6LA 4GI9A 1KC7A 3WBYA 3TQVA 4JEAA 1XX1A 3W7KA 1V6TA 3V7PA 1BXCA 3T4RA 1U83A 3U2EA 1SJBA 3QRHA 4IB4A 2BP1A 3BG9A 4JQ1A 4HU4A 1GZ1A 1OZMA 3LHZA 4Y9MA 3FAJA 3ABSA 2HEJA 1IWBA 2YXOA 3PWGA 1UD3A 1GJWA 3L0GA 5AZ0A 4X3ZA 2G4FA 2EPOA 3WDQA 3S6OA 3P60A 2NXIA 7A3HA 3GWNA 1KTNA 1FMVA 3ARZA 5AVHA 1EA8A 2XN2A 2XLDA 4QAIA 1VCVA 2I8BA 1CXHA 1FAPB 2Y4SA 3QGVA 4C6IA 1CB2A 1UMLA 1VFTA 2YCJA 5I03A 4GI6A 4JKMA 1M53A 3KMIA 3CUGA 3BLIA 1U1JA 4H3DA 1WPCA 3HG4A 4NTFA 1EO7A 5C2GA 1GVQA 1GUVA 5LIYX 1M03A 4ZQPA 1YXCA 1C3FA 1PIGA 3GUGA 1ZBKA 3W22A 4DUWA 5EFDA 1VH7A 3CYVA 3U9MA 3ITLA 4HGXA 2X0YA 4DYKA 1J0IA 2PCEA 3ZIBA 1PKMA 4PJNA 1E4IA 4C6QA 5BRQA 4MNKA 4K3ZA 1R3RA 4LBUA 2Y5JA 3WLRA 1QI0A 4FLRA 3G6LA 1UH4A 4LQ1A 4PCPA 2JE8A 2VASA 3WLQA 3US6A 3KRBA 3CMFA 4KQNA 1K9DA 3WLKX 3HN3A 1UWQA 3INPA 2GJNA 3WHNA 1DL3A 3VO0A 5HMSA 4JN6A 4MGGA 3PPHA 3ZLHA 5FL1A 4G9PA 1XF0A 2ZXBA 4BPMA 3A4XA 3OLIA 5BUOA 4B92A 1M2OA 4RXGA 5CI8A 1E3ZA 4EXBA 1J0HA 1U22A 2Y0FA 3W9ZA 2A6NA 3ZVHB 4C60A 3JSZA 3KTSA 2P3ZA 2H7OA 5FI8A 2A69F 1XIFA 2G3IA 2VO5A 4ZOAA 1Z42A 3WLMA 3TSMA 3W28A 1K02A 5EBUA 4I3MA 1UZDA 3BW3A 3E2VA 3UJEA 2GPTA 3B29A 2DZBA 3NQDA 1E5NA 4AIEA 1GT8A 3C5QA 3RO6A 3TONA 1D3CA 4TMBA 1ZU8A 3RQEA 3V3WA 4L7ZA 3DWWA 4XTDA 1LS4A 1QNQA 4L6OA 4QDPA 4CLMA 1A0EA 3ABKC 2GUUA 1FHLA 2PD5A 3VZXA 4KCUA 2BOFX 4NAEB 3QMRA 2CERA 4JN8A 4HHMA 1VFOA 2FMOA 2HVMA 5CJNA 4ZO6A 4UTKA 2Z1KA 3IRDA 4HPJA 4Q33A 4G1KA 2NUYA 3RGTA 2FLIA 4LV9A 4PFHA 3WFZA 1M7PA 2XYLA 2TYSA 4XUGA 5I2UA 3URNA 4UTFA 1LE4A 3WUBA 2XLVA 4DBEA 3W7GA 5BXPA 5IDIA 2GQ8A 1PTAA 2OZTA 2WNQA 1W1IE 1DIEA 1ZRQA 4JS3A 3BRJA 4IIHA 1AMKA 4IF2A 4AY7A 5TNVA 4U9EA 3WG7C 4U5FE 3D3AA 3S2CA 3OZMA 3TH6A 4NXKA 5BRBA 1OT2A 4O1CA 4OWGA 1LI5A 1T6MA 3DG3A 4BWLA 4DAIA 4Q8QA 5J5RA 1EXPA 1J11A 2BNJA 3WELA 3LTPA 2R7WA 4PMUA 3GHUA 4YN5A 1RH9A 1XLMA 5D33A 3JZ0A 3VIMA 3Q7GA 3B04A 4FNTA 4NTBA 2HK1A 1SO6A 4PFMA 1TQGA 2CHRA 4J3UA 4E8DA 1Q2RA 1SO4A 2F6UA 4EPBC 4UCFA 1XI3A 2UZ9A 1UD8A 4WIWA 1HFBA 3UWZA 1CGVA 1MMFA 1QCWA 3LEPA 4DWSC 4H7VA 4OQVA 4US5D 3QR3A 1I1WA 1OJXA 3NWRA 4GFSA 4AZIA 1YYAA 3FHDA 3S46A 3I10A 3THAA 4MUPA 4IXXA 1NFBA 2PP1A 3DHPA 5GJMA 3IACA 5I3KA 4NX0A 1H7RA 5CC6A 1HJXA 1VIZA 1H3GA 3CTTA 1MVYA 2DSVA 4TX8A 4MWAD 3GM2A 1YPXA 4FNRA 4K8GA 3HBLA 4NZ5A 2Y6ZA 2D69A 2KAUC 1XJBA 2PGRA 4NJJA 4XZIA 3U2ZA 1YTKA 5D8WA 3MDUA 3MUZ1 4BCEA 4KW2A 3UXIA 2WSYA 3DJUB 3EA1A 2DQXA 4PTXA 3MSRA 3BW4A 4W8AA 2DZAA 3TFCA 3LXBA 3W38A 2XXAB 2V26A 2OCCC 3GM3A 1UH2A 3TZFA 4I5RA 3M5VA 1RCPA 1W3TA 5DMNA 2BTMA 1HTIA 3FJNA 3DYMA 4LYRA 1Q6RA 1ICSA 4XKYB 2QJHA 3T44A 1G01A 4PUEA 5LA2A 3VOJA 1ZCCA 4BS0A 5L0HA 1FCQA 1QPUA 1O1HA 1NAL1 5C9ZA 4XVEA 4YT2A 1XH2A 1CGWA 4LYQA 4QJ3B 3PG8A 2DZWA 1SO5A 4LUYA 4B2DD 1XLEA 5K9DA 3QOMA 4PULA 1JYXA 2WKLA 3EKGA 1G4WR 5DELA 1TPDA 1E72M 1R2TA 3V5FA 3WNMA 4IQLA 1DWAM 4FOKA 1TIWA 3MSDA 3NSNA 1IXQA 3IGXA 4GACA 4CNPA 3DD7A 1GQAA 3E0VA 5GNXA 1PBGA 5E3CA 3CT7A 2QCMA 3T6JA 1WDDA 4OGZA 4WDXA 4GXMA 3KOWA 3EWWA 2C1HA 2EKCA 4Y7EA 3KOYA 2DZXA 5GVJA 1SZIA 1BYDA 3O06A 1R9XA 3VNMA 3NO3A 1Z48A 3RIKA 3QPYA 1J4EA 2WHJA 2YXXA 4KMQA 3AISA 1S2UA 5BU6A 2XINA 1E6RA 3AJXA 1J18A 1TG7A 1XLGA 1Z7AA 3LK6A 3RFYA 3I5QA 3IJIA 1E70M 2PLKA 2J8TA 4Y8FA 4D6CA 3ZTZA 2Z4GA 1OHLA 2FVKA 3F1QA 3OA3A 1EF2A 2YZSA 3DECA 2ADAA 1OSEA 3WQDA 1UQYA 1CYGA 5CBIA 3ES8A 1WZLA 3IEEA 1DJQA 3B0VC 1Z8AA 4D6HA 1W1VA 2ASRA 2ZUTA 3L66A 4MTFA 2FFCA 1FHDA 4N02A 3PDMP 1QK0A 4Z2JA 1XIDA 4UUIA 3T0TA 4W8PA 1D0YA 1OBAA 4C90A 2Z7GA 4IJRA 4QJ5B 4QHRA 4HZ8A 1XSIA 4MVQA 3BQ6A 4WDWA 1VF8A 1TWHA 4GX9A 1TPH1 3EA3A 2AP3A 2DZPA 4QCFA 3P81A 4CNSA 1H0IA 1DJXA 2YA1A 3VYWA 3ARSA 3R7MA 4JCZA 3H53A 3RYLA 5F4XA 3TX9A 4YL0A 5B3IA 2XHYA 4XEFA 4JKKA 1LJYA 3PPFA 5L0GA 4AIUA 1GVIA 4JOMA 4IWBA 3BANA 4GIYA 3DZ1A 3IPMO 4RK8A 2HS5A 1KGWA 3QHMA 1Y4CA 2Y70A 2XLOA 3QLLA 4FNUA 1EDGA 4ZOEA 1THFD 1H7OA 2YL1A 2ZX7A 1OX4B 3LLIA 3VA8A 4P8UA 1EO5A 3OGRA 3W81A 5D2YA 3EH1A 3M64A 4CN4A 2WLYA 2XL6A 1ZCOA 1JCMP 6REQA 3CL6A 1N8WA 2Z7KA 4ZEPA 1PDYA 1BD0A 1ITCA 1ZAIA 4QJ1A 1YRRA 2PMQA 3M47A 4ZVJA 3U7BA 4DJFC 1XCXA 2LCHA 4LLCA 3GTIA 4WUIA 3EOEA 1LDCA 3UCQA 4EF9A 1WTYA 4JQ4A 4FXRA 4U5BE 2QW5A 4EVZA 4GYPC 3PPGA 4MMWA 3SZ8A 3EXTA 3PNUA 3MPGA 4MNLA 4MYXA 3MZNA 2GQAA 3UT0A 4OT7A 1CW2A 3GU1A 2Y89A 3VDCA 2WMGA 1QO5A 4H9ZA 2WB7A 1TWIA 3M0JA 5LA1A 2GSJA 4HVXA 3SN0A 4O28A 1K6AA 2WYSA 3HFYA 5L0DA 1W91A 5I0DA 2OZ8A 3IGUA 2VGIA 3BURA 2YFOA 3OZPA 3WG6A 2M64A 3OZYA 4ONSA 3N11A 4CD6A 3MC5A 4Z0SA 2RGLA 3GXNA 4PMNA 4F4BA 2X51A 5BOEA 4DLFA 3I65A 4PR9A 3XINA 2CLMA 1F8IA 3WX7A 1OR3A 1SFLA 3RVYA 4H9TA 1OKKA 4BQ3A 2C15A 3UXLA 1XIJA 3RQGA 3FEQA 1IZKA 4Q4QA 4FOUA 4DJEA 1A4MA 5JVLA 3N2MA 3PG9A 3B06A 4FOJA 3BGGA 3EZ4A 1ZQ5A 2VGGA 4JTLA 3O07A 1SW0A 4CCZA 1G9HA 2JBMA 3P61A 1M7JA 3VOIA 4Q8TA 2AKZA 1O66A 1JDCA 2W92A 3IUIA 2BL2A 4DI8A 2C8NA 4AH7A 4K8HA 4C1KA 5IBXC 2OWCA 4GQBA 5C0QA 3BJSA 4JBRA 1PD0A 1FDJA 2HV7A 1ZAHA 1TPWA 2ZRYA 3JVAA 3L34A 1B3ZA 1F2JA 3ICJA 4WGYA 4UQ9A 4C1NA 1MYRA 4BEMJ 3W87A 3ABMC 1DQUA 1ECEA 3Q58A 2A0NA 4AE4A 3W85A 4GYJA 4C5YA 2JALA 1RCQA 2QCEA 1EJTC 2PWHA 3PR2A 4DPPA 4AD0A 3RMJA 1E6SM 4JTDA 1V3KA 3Q2DA 2J7BA 4PC8A 3CWNA 2CBJA 2PF8A 2NUPA 3C8GD 3GAKA 4EKWA 2HJMA 3WNLA 3SQLA 3AHXA 4R5EA 2J4GA 4JL2A 3GDMA 4ERAA 3M0LA 1LORA 3U3BA 4QFUA 2V3CC 3QGAC 3NRHA 4HMDA 3OBEA 3U2OA 1KU2A 1W8SA 4HQVA 4QNWA 2CIPA 3TA6A 5LGXA 4KFPA 5K9CA 1DIDA 4OJYA 5KYUB 4IX2A 4UZUA 4EANA 2ZRVA 4LANA 2XJ7A 3R7CA 4N06A 4JYDA 3KP0A 2VXNA 2ACSA 5HMEA 1R5ID 3DFNA 3DC8A 2ZRZA 4YWSA 7REQB 1XSJA 1L6GA 5JMUA 1LKXA 2VH3A 2IQ0A 2VEMA 4AY1A 3RH3A 3SQSA 4E5TA 2NWSA 4FNSA 5E9AA 3SXZA 3EPVA 3H54A 5FAJA 3V36A 2EIMC 3CSKA 4FLQA 1N8FA 1LRTA 3MWCA 4H9UA 3GZ3A 1PE1A 4IPJA 2QAFA 4DUXA 4LXFA 4XZNX 4ORMA 4B3ZA 3G3DA 1E6ZA 3RU8X 1H7IA 3FS2A 1QWKA 3LEVA 2QCDA 1JR8A 1UYQA 3EA2A 1G7VA 5T8GA 1BLIA 3WNPA 4OFCA 1WYIA 1W1B1 1UWSA 3CUXA 3KOXA 3QKZA 4Z2GA 2XH7A 5LXEA 3O1NA 2E5BA 3RLHA 3AG2C 3WJYA 3GVRA 1X6NA 1XFBA 3FGCA 3UJSA 3G4XA 4UWMA 1PCWA 3V16A 4W7WA 5LNWA 1SSDA 1VFHA 3RLUA 1TWWA 1ISWA 3AALA 4AZCA 3UGOA 2OKOA 3T8QA 1ZW2A 1QOQA 3UCCA 4NZ4A 1YLVA 2ZFAA 4B3KA 4DI9A 5C7HA 4J35A 3FLUA 4E3VA 3VC5A 2FYMA 2DFAA 1UASA 1EA0A 1WXJA 3IVUA 2PB1A 3TN4A 4JDBA 1RY8A 4CDAA 2C1GA 3QY7A 2M4EA 3UNDA 1Q66A 3UYIA 5C7VA 1ZU4A 3V5YA 2ZXAA 4E2VA 2JF6A 1VC4A 2QDGA 3FY1A 1VK5A 4NTAA 1CXKA 4CQAA 3EDFA 3G1FA 1E1FA 4PBFA 5FJIA 3FVYA 3ZSTA 4LRTA 1EB3A 3OLDA 4KESA 1F6KA 3CV7A 3LHUA 1QNRA 3ZSUA 2VT0A 3Q67A 1AW1A 4TVCA 1FX6A 3LPOA 3CHCA 1K4HA 5EKYA 5FOOA 1R3WA 3W6YA 4QGCA 4ZB5A 5I23A 2Y3HA 1N2VA 3AO0A 1ZHTA 3MCOA 4K7VA 1CXLA 1ZJBA 4MJ4A 2LLEA 1V6WA 1V55C 2HMCA 1Q6LA 2VEGA 1V3MA 2BBFA 4HEAJ 3GNOA 3NYDA 1UFBA 1ZL1A 3M16A 3LNRA 1POJA 1FWWA 2B0MA 3SRFA 4AG0A 3ARWA 3BSGA 2E28A 3G8RA 2Z1WA 1FWFC 1QFEA 2H3DA 1OCZC 3EXRA 1H9TA 4GIRA 4Q8PA 4O17A 1JNEA 4OOZA 1TQXA 4Q4ZF 1D3GA 2JQXA 3HTKC 4WDTA 1VPQA 5EHHA 5BQIA 3K8MA 4FX6M 5FA5A 3UD6A 2Z15A 3SECA 1KA9F 2PGWA 1LLWA 1JPMA 3IAPA 4GK8A 1OM0A 3OZOA 4CQ9A 5E5CA 4UR7A 4YTUA 4LSBA 1LBMA 2ZXQA 4QEEA 4L9YA 3OVPA 2ISDA 5HQLA 4DWDA 3CT2A 4AIBA 2CU0A 2NWRA 3GYEA 2CNCA 2IXNA 1EEPA 3ZWTA 2HJ3A 4OTKA 3WF3A 2V6AA 4LVDA 1VYSX 4N6HA 2WC3A 1FWNA 2ZX5A 4MB3A 4GQGA 4DN1A 4NKCA 1QOXA 3GC4A 1EPVA 4H4IA 2J9ZA 1YA7O 2V3DA 5JXQA 5HPCA 5ABGA 1JZ3A 2E6AA 5G5IA 4Y96A 1P7TA 1K8XA 2EPLX 1RAKA 3W1QA 2V5BA 2V5LA 2OO6A 4IAOA 2NUXA 2FB2A 1EGZA 1DXIA 3UA4A 2VFDA 3MHGA 3JYHA 3VF0A 6TAAA 2HE5A 8XIMA 1H1YA 2QDEA 3W6LA 1OX6A 3PJWA 4XZBA 4MB4A 3I3EA 4MKSA 4JX5A 3SM0A 1ZFJA 3W02A 3OIXA 1FWAC 1HKKA 2A3BA 1KR0A 2ZRXA 2JK2A 2GVYA 2XIBA 1E9LA 4GC4A 4XPYA 3LHVA 1OCQA 6ALDA 1XISA 2PRMA 5L9FA 4PMVA 1VRDA 3KW3A 3DU0A 5T91A 4YTTA 4IGGA 5L3QA 1I8JA 1Q0FA 1QJWA 1IHIA 3EX6A 4DOZA 1EIBA 4HNNA 2J7PA 1XXXA 4Q32A 1VPXA 5CPOA 5B1BC 1WATA 5B80A 2V67A 4KETA 3H2FA 1WDPA 4TV6A 3UYCA 1P0KA 2YQYA 4N9BA 3GC5A 1JVNA 2Q3TA 5G2WA 1U30A 1S5NA 2LK4A 3WLIA 3QV9A 4FF7A 4WXZA 1I0DA 4X2PA 1VBUA 2ON3A 5AHMA 1N55A 4FX8A 4LGXA 1NFPA 4ZSUA 4IZGA 2C04A 3MI6A 4UIOA 1Q6GA 1QDSA 2WK2A 2H8ZA 4J1OA 3K6BA 4RNFA 1EHAA 5FF3A 3MKVA 2ZXWC 4Y9PA 3GNXA 2Q9AA 2GWNA 1X8CA 5CG0A 3TULA 1R46A 1UKOA 3EAUA 4NVTA 3UWYA 4S1FA 2HZ8A 1W54A 3NEVA 4CDVA 2A5HA 3OO2A 2YR1A 2BMBA 1TJRA 4U31A 3DG6A 4QAWA 4ZBCA 1TFKB 1QHPA 5CPTA 1CIUA 2IS7A 3CHFA 3OYXA 3QQ0A 5EMMA 1XBZA 1UMYA 3O6AA 2AWYA 1AQMA 2KJGA 6REQB 2PD9A 1BXNA 2B4GA 4OUEA 2C71A 1XGZA 1RQEA 1RJPA 2YHSA 3VOGA 2DB4A 3A47A 1JYVA 3SXMA 5DCEA 5HSWA 2E25A 1WUEA 5CPMA 2A6HF 4A21A 4BJHA 4CS8C 4AC7C 2CFFA 1S2AA 4M6PA 1HT6A 2XLEA 3IK2A 3I6RA 1X96A 4Z1YA 1OIMA 2OO0A 4WJXA 2D1ZA 4BI6A 3K4DA 4DAFA 3ARTA 3DUGA 5AYXA 3R58A 1NWUA 5FSDC 3LCXA 2VCBA 1JIBA 5DMMA 3GORA 5AC6A 1ADOA 3M6DA 4YK5A 1G5ZA 3ANUA 1F6PA 1UA3A 2JIEA 4GBDA 3UG5A 3GW3A 3OG3A 3LHTA 2VR2A 3E2QA 4H4KC 2QMJA 3F03K 3Q94A 4EOUA 5GPGB 1YDYA 1BKHA 4JTRA 3FOPA 5HV9A 3NZRA 4W5UA 1R3SA 4YT8A 2IPWA 4BQ2A 4U5CE 1E71M 3H26A 2PX0A 2XVNA 3LLDA 4MVAA 3CV6A 4BKNA 1DXEA 5CGTA 2OGYA 3AIWA 2J79A 3LENA 4MTVA 2JX0A 2Z27A 1XYBA 1HKMA 3NYJA 3MUIA 3B9DA 3LMZA 4NRSA 4AZ5A 3MCMA 3MB9A 4C7DA 4P61A 3PZ9A 3VNZA 3ZS4A 1IXNA 4DRJB 2DH2A 1E0WA 5U4NA 2ZX6A 1UZ1A 5L0CA 1XFCA 3GS6A 4WK9A 5FZTA 3MT1A 1VYIA 1AW5A 3CAQA 4LVGA 2CYGA 1VP5A 5DF0A 2Y1HA 2BGSA 1JCNA 4PYSA 3BVJA 1P48A 1I2QA 1RVGA 3OTRA 1UQZA 2JFEX 1RXOB 4GCXA 4F3HA 1WNOA 3EOLA 2YA2A 5BOFA 1OFEA 1WUFA 3B8UA 3IIZA 1XG4A 1KKOA 2J66A 1HVQA 3M1CB 3AYRA 4A2RA 1A7VA 1FWGC 2YL5A 3DKJA 1QHOA 3OBAA 2GL5A 2R7XA 3C2RA 3GH5A 1HN1A 2V5CA 1CPRA 3TYAA 2DW6A 4C1NB 2X30A 1C90A 4BJ6C 4AE4B 5KINA 3UMKA 3N2BA 4MVZA 1JGIA 3WQ8A 3NCOA 4PMZA 3KBNA 4ROQA 3COTA 4M8UA 1PAMA 3E0LA 4CEXC 1XDMA 4LCSA 3NQ6A 5JH1A 4ICMA