3B0VC

Trna-dihydrouridine synthase from thermus thermophilus in complex with trna
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
315
structure length
315
Chain Sequence
MLDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALLALSTKANREIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLMEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA
publication title Molecular basis of dihydrouridine formation on tRNA
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase/rna
total genus 108
structure length 315
sequence length 315
chains with identical sequence D
ec nomenclature ec 1.3.1.91: tRNA-dihydrouridine(20) synthase (NAD(P)(+)).
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01207 Dus Dihydrouridine synthase (Dus)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3b0vC02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3b0vC01
5KTLA 1ONRA 2TYSA 4JTEA 4R53A 2YW4A 3EKLA 4DBDA 1TPWA 2B0MA 2ZA2A 5EY5A 1OJXA 1QO5A 5ABTA 3TW7A 4EF9A 3NR0A 2WNQA 1GYNA 4FX7A 2VEMA 1OG0A 3LRKA 5FEPA 4MVAA 1XCFA 1RV8A 4NNCA 1DHPA 3E9AA 4JX4A 5AYXA 1YADA 4WXZA 3LHTA 2FFCA 5AC8A 1N7KA 5F2LA 2Y7EA 2DZTA 1JCNA 4ONVA 4UTWA 4YLWA 3S8HA 4WJEA 3VE9A 1FBAA 1QPQA 3G0UA 3QEZA 3T78A 4CCDA 1SW7A 3TJLA 4RK8A 1G4EA 2ZZ4A 2NZLA 1XC4A 2FIQA 3DGRA 1HUVA 5KZMA 3QM3A 3TAOA 5EKYA 4O1CA 3SSJA 2TPSA 5GVJA 1PHQA 4HN4A 4PTNA 3QQ1A 3OBKA 3STEA 4OHQA 1Z42A 3B03A 4JIPA 3LOTA 3TDFA 3QH2A 3NOEA 2QCCA 4M19A 2AAMA 1PV8A 3IIVA 5U4NA 5AC6A 4UIOA 3NZRA 3RFAA 1RQEA 1TQJA 3DI1A 3ZWSA 3EB2A 4C1KA 2QKFA 4BR1A 1AW1A 4GFSA 3TNOA 1C8VA 3FYOA 1SFJA 4S1FA 3TU9A 2HS8A 3W2NA 3M5YA 1AMKA 4Q4KA 1W1ZA 6ALDA 1I2QA 4BWLA 3KAOA 1EWEA 2V2DA 5DBTA 2CZDA 2ABBA 4WXYA 5T26A 3HJZA 3C6CA 3NQFA 3DH7A 1AL7A 1KLZA 1T0OA 1PVNA 1UB3A 4DXVA 3UNDA 3TX9A 3W2UA 4I7WA 3W87A 2AQWA 1NF7A 3MJYA 3L0NA 3NEVA 1T96A 2GPTA 4WY0A 3KOFA 4JYFA 1PL9A 5F1UA 3RNDA 3TSMA 4BI5A 4LVAA 4S2BA 3W6YA 4N9BA 3MP3A 5FF2A 4FF7A 3P80A 2DZXA 4KFNA 4GUGA 1OYAA 3STGA 3GKAA 3N3MA 3KVKA 3P62A 4UFMA 1EA0A 3QYQA 3NQ8A 1XFBA 2BX7A 1MZHA 2ATSA 2A6LA 3G1AA 3ELFA 1F7BA 3ABSA 5LKYA 3FJ6A 4Y96A 4K7YA 1TTJA 2CZ5A 3GZ3A 3BPWA 4A21A 3DKJA 3NPUA 2F7FA 4ALDA 1ZCOA 1MXSA 1H62A 4HT3A 4O0KA 3W1NA 3U2OA 5I3GA 4DBEA 1J4EA 4O16A 2DU2A 3HGOA 3NYZA 1O95A 3HB9A 4M7TA 3HGRA 3OIXA 1I2OA 3M7WA 2C6QA 4MFEA 4LVBA 3BW3A 5AHLA 1G7UA 1H60A 2CWNA 4UTMA 2DZPA 1UUMA 3P81A 1JCJA 3EX4A 3MP4A 3I7QA 4UFHA 1KFEA 4HNTA 3WFAA 1L2UA 3W1QA 2Y62A 4P2VA 3WJXA 3LTSA 2QAPA 4M5PA 3TIMA 5J5DA 4OGZA 3LCIA 4N9EA 3UQNA 2QCGA 1LLZA 1OK6A 3W72A 5F4SA 1TREA 4L4LA 3M1ZA 2C3ZA 4PCFA 5G2WA 2A0NA 3A9IA 3NXFA 4RZ6A 1ZENA 4O12A 4TU1A 4I9AA 2GJNA 1G6CA 1W5MA 2JKAA 4IPJA 5LSMA 3UWQA 3E0IA 2J9XA 2GVJA 2HMCA 3W7EA 3IVUA 3HG2A 4Z1BA 4LTSA 1VGAA 4DO5A 5AHMA 4ZZ9A 4NX5A 4AWTA 1ZY9A 3LDVA 3LI1A 3T44A 1AW5A 1GVQA 2Z2UA 3B0UX 2DORA 4GBUA 2ZCGA 5D2WA 2EKCA 2ISWA 4O14A 4FNQA 4K37A 3TAKA 3G1VA 2VEIA 3OHIA 3CWNA 5DCEA 5LNVA 5DBUA 2FTPA 1WA3A 4AXKA 4UTUA 1E51A 2A7NA 3CLMA 4AMAA 1VJIA 4UMAA 1D9EA 5F2GA 3CEPA 3QSRA 3B06A 1PIIA 3RLVA 1YPFA 2ZRXA 3EX2A 2XN1A 4LT9A 1KTNA 4E2BA 1SO6A 1Q6RA 1UASA 4CCEA 3L67A 3QW4B 2E77A 4RZ5A 4JTLA 4M7SA 5C6MA 5DY2A 4XBKA 3RU6A 1O4UA 3LHUA 2FDSA 3TV8A 3DFSA 4X3ZA 1AG1O 5FESA 4HNVA 4ADUA 2YCEA 1P1XA 3TJXA 4U4MA 2NXHA 2ZA1A 4QIUA 1ME8A 1HO4A 3NQCA 2W6RA 5G1TA 1H50A 4CQ8A 2J6XA 4ADTA 3ABRA 1T8XA 3EXTA 1EWDA 3WK1A 3M43A 3KX6A 4Z1CA 3W7LA 3LI0A 1SZEA 3W7MA 5G1YA 4MYAA 2QCFA 3THQA 3GDMA 4O10A 1PCKA 3BVJA 2G97A 4LW7A 1T99A 4GXMA 4LU0A 1S5WA 4QNEA 5FF7A 3BLIA 4PL2A 5D04C 2CW6A 2ZRWA 3STFA 4GNJA 4K8HA 2CLOA 3UZ5A 3INPA 2Y88A 2D73A 2BSLA 4O4VA 3IVSA 3DI0A 1C29A 2NX3A 1TO3A 2P0OA 5MHBA 1VHNA 4RV8A 3DZ1A 5CGQA 3IGXA 3NM3A 3VFLA 5EPDA 2WV8A 3QJAA 2QCNA 1JULA 3P5ZA 3QQ0A 3A21A 3W22A 1HFBA 3W1MA 4MLJA 3O1NA 1P0NA 1XDLA 4ZQRA 1M5WA 2B7PA 5AC7A 1FWTA 1M6JA 2XN0A 1OFAA 4A2SA 4Y6GA 4Z0JA 3ABQA 3SR7A 3L21A 3MYOA 5CZ0A 1GJPA 4DF2A 1C9DA 1HL2A 4GC4A 4DO6A 3S9YA 3FKRA 4JR5A 5LNWA 2CU0A 1JCLA 4J9JA 2QJGA 1OHLA 1KBJA 3HG4A 1R2RA 2V5BA 3OVQA 1K02A 4LS2A 1DORA 3TUUA 1MEIA 3I6RA 3IRDA 4N6EA 4A22A 3SY5A 4IMCA 3O8AA 2OMAA 4N9DA 1ADOA 3C56A 3L5AA 3NPVA 3NQGA 3B0PA 1XDMA 3P84A 1F73A 2EAWA 3W83A 4LRTA 4O54A 2FLIA 3ABOA 1GTEA 4DF0A 2PRLA 3VCRA 3KRUA 1YXYA 2O7QA 1QR7A 3I68A 3L2IA 2YZRA 3G24A 1A5AA 1FUYA 1TPFA 2Z1BA 3SGUA 3KVJA 4A3UA 4K36A 3EX6A 3TSDA 4MJMA 4PH6A 4A29A 5LNSA 3DU0A 4UFIA 1SW0A 2QJIA 3SW6A 1LP6A 2Y63A 1YYAA 1WDWA 1PS9A 3S42A 5I3IA 2X1SA 4O1BA 2H3BA 2ZFAA 4JTUA 3W7DA 5CKSA 4MZYA 3YPIA 3G1HA 1SO5A 2RHGA 2YGYA 1JQVA 4UUIA 1JUKA 1BWKA 1I45A 4ZQMA 3EWBX 1QPOA 1OABA 3PG9A 2YSWA 5FEXA 1K8ZA 2C19A 1VRDA 1TRIA 1GT8A 3MO7A 3NQEA 4YMZA 1TV8A 3E12A 3TC6A 2I1OA 4NJIA 3OG3A 1W56A 2WSQA 3LHYA 4OU1A 2PE4A 4WX2A 1FXQA 3CU2A 3MUXA 3K30A 3GYEA 3S1VA 1SW3A 4WOQA 4MJZA 3PUOA 2DJLA 4WY0B 3HGJA 1QPNA 5BOOA 5F2IA 2E5CA 2GOUA 1YLVA 2OT0A 4YCPA 2QUTA 2OX1A 4JNMA 1ZALA 4XKYB 4LVDA 2C14A 4UR8A 5CG7A 4O11A 1JUEA 3ZWTA 1HO1A 1FCQA 4LC8A 2VOMA 3LCFA 4MY8A 1VYRA 3VKJA 3M0ZA 1OFRA 4MKNA 3IGUA 3L5MA 1O5KA 2Z6JA 2CFFA 2ZQ0A 3C2FA 4O13A 2EPHA 5C54A 5DCDA 1V5XA 5DN1A 3PAJA 4P61A 4JTFA 3M16A 1WX0A 3TH6A 3THAA 4OV4A 1QDSA 3QSTA 4MOZA 2ZZ1A 4X22A 1S3HA 3GVGA 5J5RA 1AW2A 4FIQA 4FXSA 1A5BA 3W85A 3DBPA 3PWAA 5L6UA 1EX5A 5KZEA 4E38A 2XFWA 4JDYA 2Y7DA 3UD6A 4NX0A 4HPJA 3W2LA 4EF8A 4KWWA 2J88A 4BI6A 5HWJA 5HUPA 3NQ6A 4LUJA 3M5ZA 2VEKA 5AHNA 3RLUA 2Y61A 5IM51 3HO8A 4QM1A 3HIJA 3W70A 3NPWA 4NUWA 1ME9A 1FWWA 4QITA 3IIOA 2YXGA 4BK9A 2EF9A 2A2IA 2H6RA 3UWWA 1ZNNA 3R12A 2NUWA 4DPQA 5BNKA 3UWUA 1IXPA 1FWRA 1SO4A 3BGJA 8TIMA 4LS1A 2ZRUA 3I65A 1ZJIA 2RFGA 2W0UA 2QR6A 2E68A 3GXTA 1B4KA 3T4CA 4NXSA 5A5WA 5IBXA 1GWJA 3QPZA 3UY7A 4JTTA 5AYZA 3JR2A 2ZTJA 4KWVA 3SI9A 3QMTA 1PHWA 3O15A 3NDOA 1XBXA 5BMWA 1TV5A 1RQHA 4Q32A 4UTTC 3PY2A 4QJ1A 3W71A 2Y7FA 3FEMA 3GK0A 2QDHA 3DFPA 4ORIA 3PSWA 4W9TA 3QW3A 2KZHA 1DVJA 5LGZA 1TPEA 5L9FA 3O16A 5HMSA 2J27A 4R34A 5EMUA 4ZMGA 3G1XA 3NQVA 1W5NA 1F6KA 3KVMA 3NQ7A 3UPBA 3W7NA 3N2MA 4O53A 3W7OA 5DXYA 4QAIA 3L5LA 3W7KA 4K7VA 4RXFA 4XZ9A 1L6WA 4AHOA 1KFLA 3PM6A 2F84A 1IGSA 3G3MA 3TE9A 3N2XA 3U6WA 1LROA 2ZRZA 4FNRA 1F5ZA 3BK0A 3BV4A 3O63A 4MZ1A 2NWRA 3GNNA 1FCUA 4H6KA 3LCWA 2NUXA 3ZS4A 2RH9A 1WAUA 4FIRA 5KZDA 3MWAA 4N4PA 2ZBTA 2C13A 3CM4A 4XKYA 2R8WA 3HGSA 4EOUA 3GLCA 1S5TA 3NNTA 4K6AA 4ZQOA 1Z44A 1PE1A 2BWGA 4IX2A 2WSRA 4UFLA 5D2TA 3G8RA 2YW3A 4K8EA 3UWVA 4KFOA 1OX5A 3MI3A 3TC7A 3KFTA 1OF8A 3UY8A 4WD0A 2V2CA 4DQWA 5D02A 4N02A 1MEHA 1WQ5A 1FY6A 5FEZA 4JDBA 3EWUA 3M6YA 3S6DA 1F76A 3CWOX 1X7FA 1LOQA 1YPIA 3GKFA 3LHZA 4CLMA 1XL9A 3GDLA 4MIMA 3SFKA 2WNNA 4AVFA 3Q2DA 2C15A 5D30A 3DFOA 1GOXA 4LVGA 2FQIA 3NGJA 4MYXA 3WJSA 3GR8A 4XTDA 4LS0A 3NL6A 4UTIA 1KM1A 3Q37A 4YWIA 3BW2A 1JUBA 1RQBA 4DPPA 3PR2A 2CLMA 3V75A 2QCDB 1XKYA 4U28A 4RCXA 1EPXA 1F2JA 2Q3RA 2FB3A 1LCOA 4JX6A 5AYYA 3W86A 3EX3A 1YXCA 3FFSA 2V81A 2EHHA 3DHDA 5FEWA 3MHUA 1GVOA 1MO0A 3MHFA 1H1YA 3C8FA 3C2VA 1SFLA 3F1QA 3FYPA 2ALDA 3E49A 1SUXA 1NAL1 1TTPA 1VYSX 3C3NA 5D05A 1A53A 5CPNA 2LLEA 3L9CA 2E1DA 2GVGA 3A22A 3W74A 1TPH1 3S1WA 2DZSA 3TMLA 4NNAA 4DO4A 4NU7A 1R2SA 1JCXA 3S5NA 2A5HA 2G96A 2ZZ2A 4HPXA 2WNZA 4JYDA 4OV9A 2DZWA 2I14A 1OFEA 3MBDA 3LCHA 1HG3A 3PF3A 3NM1A 5I3HA 4XWUA 3DXIA 1FX6A 2NV2A 2X1RA 2CLLA 3NL2A 1FCVA 2JKPA 3OVPA 4MUZA 4GUHA 3G1DA 4Y90A 4FNSA 3TQVA 5D2YA 3MBFA 1VZWA 4X2RA 4XQ6A 5EBUA 4UFJA 4QNWA 4AB4A 2IQTA 1GG0A 3RMJA 3HPXA 2BLEA 2FPYA 3P67A 1KBIA 3EX1A 4UTKA 1UJPA 5E93A 3FS2A 1EP3A 3W1RA 4WQ6A 1F05A 1KM6A 4PEKA 1H7WA 1TPB1 1NEYA 4EWND 1JCYA 4LOCA 4C1LA 1JRCA 3WK2A 2FPTA 1Q6OA 3TKFA 4Z1AA 5LNUA 1YTDA 1DBTA 2JKEA 3FA5A 3N9SA 2QJHA 3UPWA 5HR7A 5HNRA 1V7YA 3SECA 1QFEA 2FPVA 4LNYA 5I3JA 3QZEA 4H3DA 1NF0A 2PURA 2E5BA 4B5NA 3W1AA 2ZDRA 1IF2A 2Y89A 3B05A 2JGQA 2VXNA 4NJHA 5AHFA 4GE8A 2V5LA 3E02A 4RLIA 5DELA 3W2MA 2J9YA 3W7IA 3LXCA 3STCA 2WJZA 4HSNA 3P7YA 1Q6QA 4TO8A 1K8YA 2I9EA 3S5ZA 3EWYA 1WOBA 4IMFA 3BO9A 4HNNA 3NZ1A 3G0XA 1KFBA 4ZQCA 2B4GA 2NUYA 4WY0F 3W7HA 3W76A 1QO2A 2E6DA 3W1TA 1G4SA 1W5OA 2HTMA 4BI7A 2ISSA 5CPMA 3WJWA 5BW6A 3BG5A 3LTYA 3F03K 3LXAA 1LLWA 4M6QA 3W1PA 3GDTA 4GUJA 1GPWA 5CSSA 3S0CA 1B9BA 3LCXA 2BXVA 1MEWA 4LUIA 4MPQA 4AH7A 4LVFA 2TMDA 4UTHA 3R89A 4FNPA 1JQXA 4TMBA 2QEZA 3T55A 3LV5A 4HIBA 2QCDA 2QUUA 3H54A 1IXQA 1DOSA 1WBHA 4WOZA 3JRKA 3PBUA 3PBYA 3O6CA 1GVSA 1F6PA 2P10A 1XBYA 3UXAA 2FJKA 2X30A 3TXVA 3TCEA 2PC4A 2ATMA 3M41A 4WUIA 1Q45A 1TQXA 2ZZ6A 2HS6A 1I2NA 2Z6IA 5G4EA 3N73A 2CLKA 3BGGA 1XM3A 1W8SA 2RDUA 4UTWC 2Y70A 1SPQA 4GUIA 5D2VA 1TPUA 2NX9A 5AN7A 3C2EA 1XXXA 1XUZA 5C5YA 1TPC1 4OWGA 3TXZA 3P82A 4YCOA 3KRZA 1AK5A 3PSVA 1SZNA 4NJKA 1SQ7A 3L68A 1VCFA 1W5PA 4R7JA 4XBSA 3W7RA 3FKKA 2WSYA 4PODA 4IJBA 2NXGA 3PB0A 1JJKA 5DCBA 4ICNA 2P1FA 4O0ZA 4RR4A 5CSRA 1U83A 3BARA 1SSDA 3LLFA 4GRSA 1KTCA 1KFCA 4JY9A 4JXCA 4S2CA 1ZAIA 1RR2A 1XI3A 2WO5A 1H7PA 3O07A 5K9DA 4RKAA 1YXDA 1OVDA 1VLIA 2NLIA 1EUNA 3LRMA 1KM2A 2YYUA 3DFNA 5CZJA 4RX0A 1G7VA 4CCCA 3O06A 2TSYA 4IUOA 4LY8A 2VC6A 1CW2A 5AFDA 4MLRA 4IMGA 2OZ0A 4I7VA 5K7JA 2VELA 5AHEA 5HWMA 5D03A 4ZVJA 2Z0IA 2Y85A 1OYCA 5U7SA 3HPZA 2E5DA 3NL3A 4JX5A 3BG9A 3N9RA 3MI6A 3W1UA 2A6NA 4O1DA 4Z1DA 3GAKA 1FDZA 4FX6M 3M9YA 1FDYA 3HG5A 3NVTA 3EXRA 5D33A 3LLDA 3M47A 4LC6A 1JVNA 1TV7A 1ME7A 1ZFJA 3H53A 1KM3A 3R13A 4EVZA 1H51A 1BKSA 1X6UA 3DFTA 4M6VA 1DKWA 1VCGA 3LV6A 3IIZA 1OFPA 1DL3A 1I4NA 4UCGA 3I7SA 3LTPA 4O1AA 1K7EA 5LHFA 5D38A 3OA3A 2VFFA 1KTBA 1M7PA 3I7RA 5BMXA 4UFKA 4IQLA 4XTIA 3LB0A 1FDJA 3SIZA 3CHVA 1TMHA 4DEFA 1LBFA 1MSSA 3TSBA 1WBJA 4JYEA 4TX9A 3C61A 1FWNA 3GDKA 1B3OA 4YXGA 1IIHA 2FB2A 2CLIA 4WZHA 2ZZ3A 2BZNA 1L6YA 1ML1A 3M5VA 2YR1A 1YDNA 1X1OA 3TFXA 3TQKA 1EIXA 3N19B 1LORA 4IX0A 4JTJA 2H3DA 1TRDA 2Q8ZA 4JTHA 4LV9A 2ABAA 2Y7GA 5C2XA 2UV8G 3GX9A 3S5YA 3PUDA 4MZ8A 3HOJA 1KFJA 1TTQA 2ISVA 2C18A 1VS1A 3W75A 1GTHA 3U8GA 1QAPA 2R91A 3O6DA 1W3TA 4HNUA 1TJRA 3LBCA 2CZEA 2VFDA 3LXBA 1SSGA 1TIMA 1H7RA 3EWWA 3A24A 5HQEA 1LZOA 1OX4B 4JGDA 1EUAA 3CQ0A 4AWSA 1AL8A 2W79A 3W1XA 4O15A 4O28A 2WQPA 2GVLA 3G1YA 4YL2A 4AHQA 2QAFA 4KKXA 1CX9A 5D09A 3T7VA 1W37A 1W54A 3FJLA 1U5JA 2X1UA 3GR7A 1IXNA 3SZ8A 4PL1A 1JCMP 3C52A 3QFEA 2YDAA 1X8FA 3R8RA 1TYGA 1K03A 3B8DA 3TMQA 3C4UA 3VNDA 3VI2A 1F74A 3ZR4A 1LOSA 2A7PA 3PUEA 2VFGA 1KW1A 2CZFA 1QOQA 3ATYA 3ANYA 4O4WA 2VENA 2V30A 4CNPA 1JRBA 3KXQA 1H7NA 2R14A 2V82A 3IV3A 3W23A 4QQ3A 2JK2A 3MW7A 4JEQA 2H8ZA 3A5VA 1K3UA 5EL1A 2B7NA 4CQ9A 5C55A 4AHPA 5G4WA 3TR2A 4N4QA 4FXRA 3IGSA 4UNKA 2QUVA 3P8JA 1H7XA 3C2RA 4IXXA 4JN6A 2OJPA 3TQ0A 3SJ3A 3R2GA 4ZQNA 3CTLA 1NFBA 3A23A 4DF1A 2ZA3A 3DAQA 1DQWA 1W3IA 1O60A 3PULA 1G67A 1H7OA 1I2RA 5CZSA 5F2MA 5K2ZA 4JICA 4GWEA 4CNNA 2EGZA 2QF7A 3WK0A 3PBVA 4OBTA 1KA9F 1WXJA 2YYTA 2ZZ7A 4OT7A 3TK7A 4Z0SA 1I2PA 3DFQA 3PG8A 2CLEA 1GZGA 3LHVA 7TIMA 4BFAA 1IXOA 3GXNA 3UZJA 3G3DA 3FLUA 1PCWA 1OFBA 1TTIA 3LCLA 3CT7A 4N6FA 4UTJA 4AAJA 2VFHA 4MY9A 2JGYA 1BTMA 1ZAHA 4IWWA 2GQAA 4JTSA 3BLFA 2Y6ZA 3E96A 2ZRVA 2XN2A 2V0TA 1SZFA 1GG1A 2ZRYA 3NG3A 2E6FA 3LM7A 5CPOA 1ZAJA 4A2RA 2HSAA 3NA8A 5DLCA 1VH7A 3R5EA 2R94A 4O19A 5G2IA 5CZTA 1K8XA 3HF3A 1OFOA 1LYXA 2A85A 4XUGA 3P74A 4CQAA 5BRBA 3LX9A 1LRQA 5K4ZA 3LCGA 3GAYA 2ZZ5A 4AF0B 4CNOA 1W0MA 1VQTA 3N34A 2J9ZA 2X2GA 1KM0A 1OK4A 4TIMA 2J24A 1GEQA 1SU5A 1TJPA 1VLWA 1P5BA 4N2YA 2X1TA 3MYPA 3NO5A 1GYLA 3M5XA 1LRNA 1Z48A 3DENA 1ZHAA 4AEOA 4M6PA 2WPBA 1R47A 5G2HA 5FI8A 2QCMA 5TBOA 4ADSA 4R33A 5LHEA 4E2DA 5F4WA 1OX4A 1UUOA 1NVMA 1ICSA 4X9SA 4UNLA 3PC0A 2Q8LA 4IXHA 2PRMA 2B7OA 1KFKA 4QISA 3W9ZA 4O18A 4AWUA 3EXSA 1QNVA 3AJXA 4TR9A 5AOUA 5H2ZA 4JTIA 3CIWA 2PRHA 5HINA 3BW4A 2H8XA 1RD5A 3EWZA 2QDGA 4TMCA 5K4XA 1QPRA 4L4MA 3T40A 1DJNA 3DHFA 3MP5A 2DZVA 2ZYFA 4Y8FA 3JS3A 3NAVA 2A21A 1KV5A 4LRSA 4FB7A 5AB3A 3DKLA 3W73A 5SWUA 2TRSA 5KSWA 1VCVA 1ALDA 1LBMA 2V8ZA 4NZJA 3N14A 1OFQA 3L66A 4HHPA 3W7PA 2GQ8A 3C2OA 1VC4A 2YFOA 6TIMA 4IGHA 1ICQA 4NNBA 4RZ4A 1HTIA 4JD4A 1J5TA 3P60A 2JBMA 1L9WA 4I7UA 5F1VA 2A7RA 4UTLA 4ZL1A 4NVTA 1GQNA 2VFEA 4K38A 3PB2A 3AO0A 3S1UA 1UCWA 2CLHA 3GNDA 1ICPA 3UWYA 1X1ZA 3PVFA 4LWWA 3W84A 1B57A 1TPDA 1UBSA 2E09A 5LGXA 4KFPA 1SZGA 3G1FA 4ML9A 3Q94A 1TCDA 4G1KA 5EYWA 1DQXA 1XUUA 4JY8A 3NQDA 1QCWA 2G5WA 5KITA 3GXPA 3WJZA 1LOLA 2B7QA 4JTKA 4OQVA 1H5YA 1S5VA 1VYPX 4QSHA 3B04A 1QOPA 4O8RA 1O5XA 4K39A 3M44A 3GIYA 4UXDA 3NPXA 3BLEA 2C16A 2YFNA 1DJQA 4MFDA 1QMLA 5G5IA 3USBA 2GJLA 1OFDA 1Z41A 1KM5A 1K7FA 4UTTA 3NL5A 3HPSA 4AF0A 5TQLA 4POCA 1N8FA 2RDTA 3LHWA 1LDCA 3MMTA 3KRSA 3CIXA 1YDVA 4NXKA 3PS7A 3S1XA 3CEUA 1FWSA 2DJXA 1KM4A 5DY3A 1D3HA 3P61A 3QMRA 3PBWA 1DV7A 1I8JA 1RZMA 4JS3A 3B0VC 1IIGA 3W7JA 3UYCA 3W88A 3B4UA 1GVFA 5HR6A 1G69A 5DXXA 3NQMA 3QRHA 1LTDA 3EEGA 5A8GA 5E0KA 3G1SA 2DZUA 1VHCA 2A1YA 1RVGA 1GVRA 2BTMA 1EP1A 3TA6A 1P4CA 5LZLA 2PCQA 2WKJA 2C0AA 3HBLA 3LERA 4E0CA 4RXGA 1H1ZA 4MY1A 3WK3A 1B4EA 3ZFHA 1Y0EA 2VFIA 4IMDA 4N9CA 3CB8A 4HSOA 4RJEA 1FQ0A 4EIVA 1VPXA 3V1PA 2Q3OA 2O7SA 3H55A 1BEUA 3RF9A 1SR9A 5H91A 1OF6A 2OT1A 3WJYA 4JIQA 3S5OA 3O05A 3TFCA 4NT0A 5D37A 5D32A 3G8EA 5I3KA 3FIGA 2QCLA 3G0SA 3FOKA 1BWLA 5AHIA 5KINA 1NSJA 2NX1A 3EWXA 1W31A 3QMSA 1A5SA 5FF0A 3W1LA 3NQAA 1D3GA 1G4PA 3SGZA 3G22A 2NWSA 4O57A 2C1HA 5K9XA 1TSIA 1YDOA 3W7CA 3KVLA 1WOAA 5IBXC 1H63A 4O17A 3TW6A 4UMCA 3W2JA 4Y9AA 3L65A 1OYBA 3CPRA 3MHGA 5K9CA 2VEPA 1KLYA 1N55A 2V9DA 1YTKA 3ATZA 1XBZA 3L0KA 3IIXA 1P0KA 2H90A 1TB3A 5F4XA 1JR1A 1SO3A 4NZFA 1VR6A 2E6YA 4NJGA 5K3VA 1G4TA 3NQ2A 2G95A 3LRLA 3HMJG 2A4AA 1OX6A 1Q6LA 1M7OA 3LBMA 3P8IA 4BWLC 1W5QA 4O50A 4NQ1A 3VE7A 1O94A 4H4IA 1FXPA 3LGEA 3W07A 1L6SA 3GB6A 1K7XA 5E1QA 5TIMA 5LNRA 1LBLA 4HKPA 5HULA 1LRTA 1FCBA 3Q58A 3F4NA 3C0JA 3EKZA 2WOQA 3W7QA 2OCZA 3L0GA 4BF9A 1EB3A 1LM1A 4FNTA 3IVTA 3D0CA 1EEPA 2YPIA 2CLFA 3HG3A 1RPXA 1R46A 1A50A 1THFD 1WV2A 5I3FA 5HWNA 4GUFA 5D2XA 2NV1A 4PFMA 4UR7A 1R2TA 4FEZA 2ZTKA 3OEXA 4ZQPA 1CI1A 3O6YX 5EA9A 2QCEA 1KV8A 4Z08A 1TPVA 3TROA 4PC8A 5CPLA 3A5FA 2DP3A 2NXIA 1WYIA 4FX8A 5FF3A 3KHJA 4Q33A 2VKZG 1XBVA 3QF0A 4PA8A 2X16A 3F4WA 1W3NA 5FF4A 4OE7A 4FO4A 4UMBA 4UC5A 1J2WA 2QCHA 5HJLA 4LV4A 4FNUA 3IEBA 1A5CA 5KMYA 3QC3A 2AGKA 4NJJA 3W7GA 1Q3NA 3MI2A 3BG3A 1YTEA 1R30A 4O52A 3CC1A 3W2KA 5HUOA 2RDWA 4JTGA 3W3OA 3RK8A 4D2JA 3UWZA 4GJ1A 1QWGA 3P5YA 3G18A 4DELA 3QPYA 4ORMA 3OVRA 4FHAA 2YX0A 4IPIA 1H61A 2GUUA 2V2HA 3IIPA 3UXDA 3HQ1A 1EP2A 2GQ9A 3GDRA 4IOTA 2E6AA 4IMEA 2RKXA
chains in the Genus database with same CATH superfamily
1PIGA 4JTEA 4R53A 3Q65A 4MWAD 5CPTA 5EY5A 1L8PA 1RA5A 1XLGA 5ABTA 1Q0MA 1YJGA 2VVNA 3NR0A 4DB7A 2WNQA 3IJ9A 3TONA 3QV9A 4KEZA 1OG0A 5FEPA 2E9LA 1AJ2A 3A64A 2R7RA 1XCFA 2OQLA 1TUXA 1DHPA 4JX4A 4LF1A 3AHVA 4W86A 2NUTB 3NZQA 4WXZA 2R7TA 4WRHA 1Y5WA 3LHTA 3IJ7A 5I24A 3ZQYA 4ONVA 4D6CA 3V4BA 3S8HA 3HN3A 2VB6A 1QPQA 2FVKA 5EMLA 2NZLA 1S2TA 1TVLA 1HUVA 4JQAA 4V15A 3J7HA 1ADDA 2G50A 2C03A 3FAPB 1PHQA 3VKBA 3BDKA 3H23A 3OBKA 3STEA 3VOFA 4BJ5A 3F4VA 4Q4MA 3ZVHA 3AJMA 3H21A 4BY3A 4CNTA 1AQHA 1K6WA 3VTRA 4B9ZA 1E73M 5GJNA 1GCYA 1FH7A 1TFKB 3KEHA 2OFJA 4GXPA 1BG4A 1HY5A 3RYLA 4LERA 1TJ1A 4PMDA 2WCAA 4MVSA 5DS6A 1JZ3A 4GFSA 4MVRA 1U0BB 3NO1A 1C8VA 1K77A 4F0KA 3FAWA 3TU9A 2HS8A 3W2NA 1V02A 4GPNA 4E3TA 4Q4KA 1W1ZA 6ALDA 1C8YA 2IS7A 2ASRA 5HBFA 2E25A 1J18A 1PKLA 3SBFA 3LLIA 1CNVA 2RGMA 2V2DA 5EMJA 1Q4WA 4OUEA 4E0IA 5JVLA 3TP4A 4WGYA 5T26A 4KRUA 3C6CA 3MX3A 1F6YA 1E6PA 1AL7A 1OKKA 3KRBA 1K8CA 4DXVA 3W2UA 1Q66A 3MJYA 4NAEA 4HPNA 1VD6A 4YTRA 5F1UA 4O8AA 3RNDA 2J9BA 2OOCA 2GFTA 3ICJA 3AG4C 1A5OC 1JZ7A 3QOMA 1ZHTA 1OYAA 1XIGA 2DPEA 3GKAA 4UFMA 5AECA 3ONBA 1MZHA 4FALA 2A6LA 2XSAA 3LNRA 1F7BA 3EMQA 3M07A 4E18A 1TTJA 2G3MA 4U33A 2VGGA 1JZ6A 1A0DA 5KYYB 2FGYA 4O0KA 3U2OA 3WODF 4DBEA 4E2VA 4QHRA 5J04A 2DU2A 4AG0A 3ITGA 3M0YA 4NTBA 5E70A 2IPWA 4MFEA 3KLLA 3EGXB 3ZOAA 2G62A 1W1IE 4M6UA 4ONSA 1T7LA 1TZ9A 5AHLA 4DAFA 1F61A 4UTMA 3RQEA 3LM3A 3EX4A 3MP4A 2BASA 4UFHA 1DIEA 3WBXA 1QNSA 3WFAA 4BF7A 1CB7B 1L2UA 2Y62A 1V74B 1ZLPA 1VFTA 4WVXA 2VR5A 2YDQA 1NU9C 4QFUA 3BUVA 4K7BA 2QCGA 4J3XA 3OOQA 2J13A 3EZIA 3D46A 5H6HA 4I6VA 1A5LC 4U10A 4RDVA 2XVKA 2XJ7A 4K1WA 4I9AA 2GJNA 4PMJA 3AIWA 4WCJA 4IPJA 3POCA 1OC6A 2DH2A 3UWQA 1US0A 1DQUA 2BS9A 3E0IA 1JYVA 2YJQA 2HMCA 3HG2A 5JRAA 4LTSA 1XV8A 5FAGA 3RU8X 1EZ2A 2ZC1A 3PP7A 4ZZ9A 1YQ2A 4ZFCA 4HTBA 1REQA 1FH9A 3T44A 1EBGA 1T5OA 2PAJA 4B16A 2EIMC 3ZIZA 2R1LA 3QTGA 1TJ2A 5A8OA 3RCYA 2Q8XA 5JUAA 2VEIA 4JURI 3CWNA 5LNVA 1GOMA 2LQGA 3AGTA 3UERA 4R5EA 2W62A 1S39A 4UTUA 4UQBA 4HK5A 1CYGA 1VJIA 2WPGA 4MNKA 4HCLA 3VGGA 1XIMA 4U5GA 3M0MA 1UA3A 1PTGA 3EX2A 4DN1A 3PN8A 2HEJA 3QHOA 3CL8A 3DX5A 3QW4B 4RZ5A 3VAYA 3VNJA 2AWYA 5COMA 4C6NA 3B9OA 4NYYA 4HNOA 1YNPA 3AG3C 3AHYA 2FDMA 3S27A 1R3SA 4HNVA 4ADUA 2YCEA 4AW7A 4GNVA 4ZLCA 3FVYA 1HO4A 3X2QC 2PDLA 3WD4A 3NQCA 1F3WA 1D3CA 3WD0A 1YE6A 3ABRA 2R1PA 1EWDA 1K04A 3TNBA 4X2PA 4XAYA 4FI4A 3D3AA 3W7LA 1NG1A 1SZEA 4G7ZF 3B8IA 3VIOA 5G1YA 3THQA 4QTGA 2WQDA 4DUXA 2HE5A 3DAGA 4F79A 1KB3A 4LW7A 4C60A 4CS9C 3EOEA 4J3WA 1E0UA 4IHCA 4QNEA 2ZX9A 1PX4A 4PL2A 2CW6A 3CL6A 2EPLX 4PB5A 2Y88A 3KCOA 1TR1A 4IM4A 4O4VA 2J9WA 2NX3A 2Q02A 1TO3A 3UMKA 4MAVA 5LIKX 2BVDA 4BG0A 1QI4A 1KD0A 3IGXA 1R9XA 3VFLA 4QS6A 2Y3HA 3A21A 3W22A 2QPXA 1M5WA 3WLOA 5AC7A 4YHGA 2PDKA 1XSIA 1TCMA 1UKOA 3ENLA 1YPXA 4X60A 1OB0A 2I17A 2XINA 1GJPA 4L4PA 3FJ4A 4JR5A 1MFVA 5LNWA 1KBBA 2CU0A 1A47A 1JCLA 2J9UA 2VEFA 4J9JA 4QRNA 5G4HC 3PBMA 2QGHA 4IRUA 2XVGA 1XW8A 4JN8A 1W1VA 4M8UA 3MQTA 1BR2A 4N6EA 1TVPA 3SY5A 2HXTA 2XH0A 2OMAA 3QW1A 4CNUA 3D6NA 4ZGYA 3C56A 3L5AA 2DI3A 2ZX5A 1XLJA 3NPVA 1BVWA 1XCWA 3V0SA 3W83A 4LRTA 4O54A 3ABOA 2PRLA 5D91A 2O7QA 1XPYA 3IJ8A 1QR7A 3L2IA 3W28A 1OR3A 3BCDA 3UBPC 3KL5A 1FUYA 3GTNA 5CLWA 3OA5A 3U7BA 4C7GA 3VDCA 4G2DA 5IFPA 1SW0A 1WN0A 2Y63A 3BXWA 5I3IA 3FMSA 3BMXA 3U2EA 3TK0A 3W7DA 1JF5A 2YOCA 3C0LA 3WQ8A 1UR9A 1V6WA 5CKSA 5BRPA 1VK5A 1JQVA 3AQCA 4GQQA 1BWKA 3W25A 4ZENA 5FJOA 1G1YA 4Q7IA 1VRDA 1TRIA 3MO7A 1TV8A 3CAQA 1MQVA 1GVIA 4NJIA 1OIMA 3SCPA 3US6A 5JP7A 3GM8A 1DXFA 3W8IA 3CU2A 1PDYA 3K30A 2OZ3A 1SW3A 1ZBCA 2J4GA 4WOQA 4GI8A 2CDQA 4US5D 5BOOA 5F2IA 3PZMA 5KYNA 2OT0A 2P1AA 4MDOA 2JF6A 1ZALA 2PNOA 4O11A 2ICSA 3THUA 1OCCC 1FCQA 1Q6EA 1EH9A 4BJ6A 3N2OA 2KYHA 1ZHWA 3IGUA 3L5MA 3AS1A 2AL2A 4H8VA 5CC3A 2CFFA 3KM8A 1E83A 4LYPA 3MMDA 3RQGA 1HGWA 4JTFA 3M16A 1WX0A 5B7YA 1L7CA 1BGGA 3QSTA 1ONXA 4JOMA 1R3QA 2GGHA 1C90A 1LUCA 1AW2A 4JTQA 1OW7A 2Q6ZA 3WLNA 5KYWA 4CD7A 5IY5C 3OPSA 2O55A 4RUBA 3EMZA 3W85A 2C8NA 3DBPA 3PWAA 1U1UA 2V6AA 3QTPA 4E38A 4JDYA 2G0WA 4HPJA 4AZ6A 5JSLA 1H5VA 2D4UA 2VTFA 2TAAA 5HATA 4AMCA 5HUPA 3NQ6A 4LUJA 2BVWA 3RLUA 5IM51 3N6QA 4QM1A 3GE7A 1BXNA 2GQ3A 3IIOA 3WKZA 2EF9A 1KRMA 1QBBA 1FHDA 4LB4A 3R12A 2X40A 3O7UA 2XGBA 3S6TA 4A8IA 2Z4GA 4DPQA 3W29A 1HZYA 4W8PA 2HROA 1FWRA 2PWUA 3WIJA 3BJSA 2AKZA 2RFGA 5A8QA 3GXTA 1SM9A 3T4CA 1X6NA 4JFSA 4LBRA 3VGEA 2IXVA 3R94A 5BU9A 1CIUA 4E8CA 4JTTA 3JR2A 3AALA 3EQLF 4RNJA 3SI9A 3GU9A 2DT1A 1D0ZA 2YBTA 1TV5A 3SXYA 1E6XM 5K0IA 3W71A 2Y7FA 1WTYA 2HDJA 1EL3A 3O6XA 3CUXA 5DMYA 1OKKD 4GNKB 4ORIA 4W9TA 1E4IA 3L4VA 3WLIA 1DVJA 1ZJBA 3O16A 4PCTA 3UA4A 2IKGA 5B1AC 4LYQA 3VVGA 1F6KA 3NQ7A 1REQB 4NZ5A 4LBUA 3UPBA 3W7NA 3VOIA 1IEQA 4Y8EA 5REQB 2PB1A 4QAIA 5B3IA 4FF5A 1R3TA 4F8XA 1CBGA 1TWIA 3FHDA 3N9KA 3N2XA 3TE9A 4D6JA 2P5NA 4ANJA 4L6HA 3CV2A 2RJGA 3A9CA 3JSZA 3FA4A 1MWOA 1FCUA 1XRFA 4KF1A 3LCWA 2NUXA 2XFFA 2RH9A 3ARTA 4AQLA 4P7NA 3MWAA 4A05A 2ZBTA 1OG6A 2O56A 4NF7A 4XKYA 3SCRA 3B8UA 2VX5A 1S5TA 2FMNA 4RW5A 3VGBA 2ZXQA 1HVQA 2BODX 3G8RA 3VIFA 4K8EA 3NSXA 1QW8A 4D4NA 3UY8A 5GNYA 3TZNA 1JYXA 4C90A 1UR0A 3WQ5A 1WQ5A 4MQ9F 3LBOA 4L4OA 4JDBA 3M6YA 4MIMA 3SFKA 4AVFA 3DFOA 2FTWA 3S83A 1GORA 4JHMA 3GR8A 1NQKA 3SN1A 3WH6A 2VASA 1H2JA 3D47A 1YX1A 3BW2A 4EXQA 3WF0A 1RQBA 4IP4A 1B9ZA 3VUPA 4DPPA 1XLCA 2CLMA 4F40A 2ISDA 1LCOA 4A6GA 1GJUA 5CI8A 1XLAA 3N4EA 1YXCA 4KESA 2WANA 3DHDA 5FEWA 1MO0A 3S90A 2BDQA 1A7DA 3C2VA 3ITVA 4ZXLA 1BAGA 2RSEB 2V5CA 1WOLA 3RG6A 4PB3A 4M0XA 1TTPA 3UFYA 2YLGA 3UJRA 2W63A 1Z5ZA 2LLEA 3GVQA 5FOOA 3A22A 3W74A 2DZSA 4H4KC 1M2OA 3H2OA 2WVVA 3DECA 2KW3C 1ZJHA 4OV9A 1OFEA 3LCHA 1XRSA 3W0KA 3VKKA 4EAYA 4XWUA 3DXIA 1FX6A 1TA3A 2V3GA 3IS4A 2JKPA 3CUZA 3BSMA 2D22A 4Y90A 4C7FA 9XIMA 4OJYA 4X2RA 1XH1A 2G8ZA 3WLPA 4PUUA 2HV6A 4QNWA 3C8ZA 4AB4A 1QU4A 1IR1A 1A3WA 3RMJA 1UW9A 2BLEA 2XVPA 1L6FA 3EX1A 5E93A 3PPFA 3HQPA 2IXPA 4WQ6A 1JD7A 1F05A 2Q9BA 5DT7A 1H7WA 1NEYA 3A4AA 3WK2A 3DDMA 2H7BA 1YTDA 2JKEA 2QJHA 2HUJA 5HR7A 4O0QA 3CMFA 3SECA 3W00A 3CZLA 3LN3A 5C7HA 2E5BA 4B5NA 3TULA 3L12A 2MANA 3GM2A 6ENLA 3CO8A 3ZVIA 3W2MA 4JFVA 1DXEA 2X8RA 3UXIA 3STCA 2C1GA 4DJ9A 2AWCA 2XL4A 4TO8A 5DLJA 1H9TA 3EWYA 4IMFA 1RK5A 3VA8A 3H2NA 2OCCC 4M63A 1DTUA 3S2JA 4ZQCA 1BHGA 2LIGA 3WELA 1G5ZA 1W5OA 2HTMA 4BI7A 2ISSA 2V3CC 3TN3A 5CPMA 4B5UA 3WJWA 2FH8A 5BRQA 3LTYA 3F4CA 2WXDM 4XEKA 3W1PA 2X0YA 3GDTA 4GUJA 1GPWA 3OYZA 1B9BA 4CU8A 5E09A 4LUIA 4MPQA 5JH1A 4AH7A 2VWTA 2TMDA 3H24A 4UTHA 4XO6A 1ZP4A 3OYXA 3KHDA 1E71M 4RPPA 1V3JA 1I0BA 1SJCA 3T55A 3LV5A 3CZ8A 2QCDA 2YBVA 3JZEA 4YT2A 1XWYA 1BYCA 2OOGA 3UVAA 3PBYA 2DDXA 2CIPA 1GVSA 4KGLA 1F6PA 3I4KA 3UXAA 2FJKA 2PDJA 4R3UA 2X7VA 3M41A 4WUIA 3COTA 3N73A 2CLKA 3P3BA 2RDUA 2J75A 4F0HA 4JEJA 5HSWA 2Y70A 1SPQA 3U5YA 4UTWC 3C8GA 5D2VA 4TTUA 2NX9A 4JFUA 3JCUQ 1XXXA 3RLHA 3PPHA 5C5YA 1U1HA 4JHZA 3TXZA 3KRZA 1VLSA 2HMZA 5B80A 1XIHA 3GWNA 1SZNA 4WDTA 4EPDC 1SVDA 4G7FA 2A79A 1LUCB 2VOTA 5KYWB 3WLTA 1GZJA 3RUBL 1JJKA 1EZWA 4RR4A 1V8EA 1U83A 3LLFA 4JEAA 4JY9A 4JXCA 2WO5A 1DJYA 1BYDA 1S38A 3BL3A 1PV3A 3RMEA 3BCFA 1JDAA 1CDGA 3LRMA 1KM2A 3DFNA 1CPUA 1XQLA 1A3HA 4CCCA 3SQSA 3O06A 3VKDA 1CW2A 3NTYA 1U2YA 4MLRA 3GYCA 2GYIA 2OB3A 5BWFA 1E5NA 5AHEA 5HWMA 3VD9A 4W5ZA 3FX4A 3VPLA 4LGXA 3DC0A 1OINA 4JX5A 1KU2A 2HISA 3BG9A 3N9RA 1QZXA 3VZXA 3MI6A 4NC3A 3W1UA 2WZLA 4H9ZA 3GAKA 1FDZA 1FDYA 2NT0A 1OEPA 3NVTA 3WNKA 3EXRA 5D33A 5CJ5A 1S2WA 4D6EA 2IQDA 2W4MA 4LC6A 1C8QA 5EB8A 1TV7A 1T9KA 2JALA 1ME7A 3DGBA 4XUYA 4HOXA 3W2VA 2I7GA 1UP3A 4EVZA 4Q4ZF 1BKSA 1K05A 3DFTA 4DM1A 1UZDA 5XIMA 3QGAC 3UR5A 3LTPA 3OB8A 4JQ1A 5A8NA 4PFHA 5FAJA 4NKCA 3R7MA 2GJPA 4IQLA 3MLGA 3SIZA 3N04A 4DEFA 5LA0A 3TSBA 1LS1A 3AQUA 3TOLA 2JEQA 5FACA 2PF4E 5I78A 4OOUA 4E5TA 1FWNA 1NARA 3LUTB 4YXGA 5I0DA 2NQ9A 2CLIA 2AOSA 4BQ4A 2BZNA 2CWXA 1E55A 1YDNA 2GSEA 1EIXA 3N19B 2ZXDA 4UTFA 4I8YA 4JTJA 1RXQA 2ABAA 3ZJKA 2INFA 3UGRA 3AJ7A 4P7LA 3CEXA 3R43A 3F7JA 1ISWA 4MZ8A 4PE8A 2KQ9A 3NMKA 1UWTA 1E4NA 1YA9A 2EPOA 1KXQA 3M6DA 1K70A 1GTHA 3GHRA 4GIEA 3M15A 3O6DA 3G50A 4QI0A 1DWAM 4IQJA 2CZEA 1SSGA 2ZX8A 3TVAA 2VX6A 3AMLA 1LZOA 3DJUB 3OEOA 3GVVA 4PMRA 4Y2WA 2Q71A 3JUGA 2R7VA 5C71A 3T7VA 2OU4A 4DZAA 1C3FA 3FJLA 4M56A 1GQLA 1IXNA 1FH8A 1CGWA 3GH5A 2VJXA 1FWAC 3MA8A 1X8FA 3B8DA 3TMQA 3C4UA 2DZBA 3VI2A 1Z3NA 2GFHA 1V6TA 3K4AA 3DESA 3PUEA 3TJ4A 3ABKC 1KW1A 3E5PA 4K3ZA 2CZFA 1F3EA 1OCJA 7XIMA 3ANYA 1YIXA 1X8CA 2VENA 2WVVB 1H7NA 3S47A 3W23A 3AIRA 4QQ3A 1FFHA 3L4WA 1NDWA 4ZTXA 3A5VA 4Z2LA 5EL1A 1KO0A 2FZNA 1NFPA 2YZ5A 4G6CA 3TR2A 2HZGA 3CHCA 1H7XA 4IXXA 2UY3A 1EEXA 3T2OA 4DF1A 4NAFA 3QY6A 5BWAA 4QG9A 3SADA 4U3CA 4EHPA 5LIXX 1V54C 4JIOA 1PZ0A 5CZSA 1B1YA 2BXZA 4A8LA 1WXJA 4YT8A 4OT7A 3GH7A 1JAEA 1ELSA 4ZB0A 4A3HA 3GIPA 1PCWA 3WMSA 4Y9PA 1DYSA 6TAAA 4N6FA 4UTJA 1PD0A 3G5EA 1BTMA 3R0UA 1V6UA 3VIGA 3W8HA 1EO7A 4IQEA 2PA6A 2YCIX 3E96A 2WVQA 1G5AA 2ZRYA 1MVYA 5CPOA 4DVYP 1HE9A 3NA8A 1AJZA 2ZUTA 4IIBA 1OFOA 2A85A 3TYBA 3P74A 2E0PA 5BRBA 3GAYA 2B81A 1JYNA 4C6BA 2PWGA 2J7EA 3AG1C 4JCHA 3GNRA 1OW8A 1P7TB 2X1TA 1E0XA 1E6RA 5DS5A 3M5XA 1MNEA 1RCOB 2GA0A 1F8MA 4LAZA 4AEOA 2WJFA 3ITOA 5D92A 4EE9A 4Q7BA 4R33A 1V3IA 2R7OA 3K8KA 2VUNA 1OX4A 4XPWA 1KFKA 3UG4A 5IXEA 3SUWA 1C8XA 3LPGA 3BLPX 3HURA 4AWUA 5AOUA 1N8WA 5H2ZA 4WLCA 1ZHZA 4C6QA 1HL9A 5HJXA 2ACQA 4BQ5A 3OGSA 3C8NA 5K4XA 1QPRA 1WKFA 3DHFA 3VXGA 3MP5A 2DZVA 2ZYFA 3SUVA 1H4PA 4Y8FA 2A21A 4YN5A 3WQCA 3C8GB 5D8ZA 4REQA 1XRTA 2EJ1A 5KSWA 4FPSA 3RRAA 1DWIM 1ALDA 2FH6A 1K4GA 4F0MA 5A94A 5FL1A 2BNJA 3HU7A 4YTSA 3ZO9A 2P53A 2P6VA 4XSLA 3W02A 3S29A 3O55A 2QUMA 3W01A 2A7RA 4PJLA 2PC8A 4UTLA 2FJUB 1OC5A 3PHF2 3AROA 1ZBVA 4EIYA 2CXGA 3VCCA 1R4TA 1CCWB 4PYSA 3UWYA 4WSKA 3PUGA 3APYA 3K5XA 4ML4A 1JPMA 3DYMA 5IDZA 3WEZA 3IRSA 4BHYA 1K40A 4I90A 1QNOA 3FA3A 4XTKA 4QDPA 1I5NA 2GK1B 3G1FA 4ML9A 4CX9A 1HW1A 1RALA 4G1KA 3VD7A 3FVDA 4PR9A 1DQXA 2G3VA 1CXEA 1S05A 4JY8A 3KYJA 1QCWA 2G5WA 1ZU5A 2P8BA 3B9AA 1LOLA 2B7QA 2HNEA 1MMNA 1H5YA 3V5CA 1VYPX 1V7AA 2BVYA 4QSHA 2BGNE 2ZX6A 3OA1A 4J4KA 5IOBA 3GD6A 4O8RA 3MT1A 2NQZA 4TVUA 1Y4CA 3BMWA 2YFNA 2WC4A 1QMLA 3USBA 1K7FA 3JU2A 3NL5A 4AF0A 1XLKA 1Z23A 4POCA 2RDTA 2FZBA 4CDYA 3LHWA 3OQ8A 2P0IA 2R1NA 1YDVA 1IE7C 3CEUA 2V3FA 1D3HA 3P61A 4GH3A 1DV7A 5GJMA 1LWIA 3UYCA 1OGGA 2OELA 3TLLA 2XUCA 1FHLA 1UOKA 4BJ1A 3KL0A 4DJFC 4GYPA 2DZUA 3CK5A 4R9XA 1VHCA 1EP1A 1HJWA 1J12A 1P4CA 1KQZA 3PWGA 2BHUA 3PZTA 4JW1A 3LERA 3VUSA 4RXGA 1B3YA 3ZQVA 1H1ZA 3WK3A 5GQBA 1B4EA 3ZFHA 4HA4A 4IMDA 3CB8A 3V36A 4HSOA 2OYKA 3FOPA 4H6EA 2RUSA 2Z15A 3UJSA 3UGPA 4JJGA 4W7UA 3V1PA 3T0CA 5E33A 1IZKA 3RF9A 1V6VA 2Z1KA 5BZAA 2JD3A 4MJ2A 4DBSA 3S5OA 2I5GA 2ZWZA 3NQBA 3O05A 2VL4A 3G8EA 1XIDA 3BLKA 3VC5A 2J7BA 2NX1A 4QI2A 1UD8A 1W31A 3UWEA 3W1LA 2GJXA 1CLXA 1D3GA 1FTSA 2WSKA 3G22A 2NWSA 1QHZA 1JZ2A 3LGGA 3R58A 2C1HA 2C71A 5K9XA 5IBXC 1H63A 4UQDA 3W2JA 4Y9AA 3L65A 2PBOA 1KNYA 3MUAA 1OYBA 3MHGA 5K9CA 1GQJA 2V9DA 1UR4A 3APTA 4IPPA 2H90A 2Z7GA 1CGTA 1JR1A 4ERIA 1F07A 1XWJA 1B3ZA 4NZFA 2BG5A 2E6YA 2G95A 5BQIA 1Y7VA 4U5HA 1ZB5A 1Q6LA 2JF7A 1M7OA 2QNLA 1W1PA 1W5QA 1GS9A 7TAAA 1XHGA 4MUPA 3LGEA 4PACA 3BQ6A 3T05A 2NSFA 2LK4A 4GCXA 5TIMA 4BS0A 5LNRA 2B31A 5M5DA 4HKPA 2A3HA 3RJXA 2P3ZA 4R85A 2D3NA 4F2BA 1KC7A 3Q58A 3C0JA 1RK6A 3BJFA 2WOQA 1OCQA 2O9OA 3R6IA 2FZ8A 3SXZA 5A8PA 2FVLA 3VOJA 4BF9A 1TMQA 4J32B 1WKDA 1EEPA 2D2GA 4NAFB 4LYKA 1RPXA 1WV2A 5I3FA 2BP1A 2NV1A 4UR7A 3LZ3A 4BPMA 3H2UA 2F8QA 3S28A 3WUBA 2R82A 4JTRA 4UZUA 3WD2A 3O6YX 2PD9A 1M41A 4Z2GA 3OP2A 3ZTZA 1HMOA 1YYXA 4J3TA 3IACA 4PR4A 2YL8A 1QATA 3M0VA 2X0CA 3A5FA 3AU2A 3E2SA 2DP3A 4FX8A 5DF0A 3ITFA 1W3NA 2VZSA 4FO4A 4MDPA 3HNIA 4JIHA 1T5AA 1UIPA 1J2WA 3KTCA 1MW3A 2TMVP 1SR2A 1PDZA 1NH6A 4LV4A 3IEBA 3PTMA 4DJDD 2XLWA 4EPEC 1PBGA 2F2KA 3VOCA 4CD8A 1R30A 1YE4A 1V6YA 4AL0A 4KC9A 3CC1A 1AQMA 5HUOA 4JTGA 3W3OA 4D2JA 4JZ5A 3P5YA 3K66A 1UH4A 1ISZA 2NQHA 2YA2A 3ZTMA 4C6CA 4AYSA 4FHAA 3FXHA 1D0XA 2GUUA 4UQAA 1R3VA 2Z25A 2V2HA 3IIPA 3JRTA 1Q85A 3UXDA 3HQ1A 1EP2A 2GQ9A 1W3HA 2VQTA 2YL6A 3TW6A 3ARQA 4V2XA 4DBDA 1O5RA 4IIDA 1OADA 2VX4A 4D8AA 4CBEA 2V69A 1KGWA 3IK4A 3MSDA 4D8LA 1UYQA 1QKRA 4KRTA 4QR6A 3FSTA 4N7QA 1RV8A 4NNCA 4J1OA 3AS2A 2BOFX 1UBPC 1YADA 4EWJA 4FLSA 1RPKA 2A3CA 5F2LA 4GVIA 4REQB 2DZTA 3B9QA 2SFPA 3DD7A 2QULA 3VE9A 1FBAA 3T78A 2CC0A 4YWQA 2WHKA 1SW7A 4CCDA 2OU6A 3SRDA 3CZEA 4RK8A 4C1NA 2WKLA 1MMAA 1KXVA 5FJJA 4AZGA 2KJGA 3TAOA 1VJZA 2IKHA 2XH4A 4GZ7A 4O1CA 2NUPA 4A4AA 4LQ1A 1QBAA 3GW3A 3GG7A 4HN4A 4BEMJ 4IFOA 3I4UA 4U5DE 2X2YA 4M1BA 5AC6A 1NJJA 1V3KA 3NZRA 4IH3A 3RFAA 3EA3A 3GHSA 4Q7NA 3EB2A 2OQMA 2QKFA 4JQ4A 3UNGC 1AW1A 1PB0A 1VKFA 4D8ZA 1SFJA 3EOSA 4S1FA 3ARWA 1T6QA 3W82A 3EGJA 4EANA 1Q6CA 1AMKA 3WZ0E 1I2QA 4GJJA 3WF1A 3KAOA 4HYVA 4FP1A 2X7WA 4IAQA 2BY2A 3VZYA 2OLAA 3O9NA 4MWAE 4WXYA 4PCSA 3NQFA 4DXKA 3QV6A 3T4RA 1HN1A 1KLZA 1T0OA 3KPHA 5I6SA 1YDIA 3UNDA 3TX9A 4I7WA 2WMHA 3W87A 3SYNA 1NF7A 1LQAA 2YL5A 3L0NA 4BJHA 2GPTA 1LI5A 2IXMA 3KOFA 3UZXA 4HU4A 1FR0A 4CVWA 2ZPAA 6CGTA 4HMNA 3VIIA 3W6YA 3GODA 1RH9A 2PBGA 3OIHA 1M56C 3WNOA 3WF4A 2VC9A 4KFNA 2XL6A 4G8TA 4MVZA 5EHHA 3ZG1A 3NQ8A 3CTTA 4FESA 1XFBA 3M0XA 4UDVA 2ATSA 6A3HA 3G1AA 1DOVA 3IPWA 1HW6A 1TQGA 2VP8A 3FV9A 3UG8A 3GFXA 4K7YA 3GZ3A 2OODA 3HMCA 3DKJA 3NPUA 2F7FA 3SCOA 1ZCOA 1MXSA 1UD3A 3S3GA 1YARO 1WWPA 2PS2A 3LNMB 1H62A 3CV6A 4IT1A 3W1NA 1NWUA 1UKSA 1GQIA 3U8PA 4U2YA 1YBQB 2D69A 1J4EA 4CD6A 3HGOA 3NYZA 2XXAA 3KOYA 4LY4A 3HB9A 1LWJA 3HGRA 1FRBA 1UUQA 4XWJA 1I2OA 1Z6AA 4YPJA 1O1ZA 3K4WA 5C2GA 3NCOA 1W2WA 3PZIA 2CWNA 2DZPA 1EXPA 1XYLA 1XYZA 3WCZA 3QPEA 3I7QA 3BICA 3T0AA 1RVKA 4MADA 1CGYA 2Q7RA 3C63A 5DQPA 4HNTA 4FOUA 1WAWA 2GJXB 4K1GA 3WJXA 2QAPA 1Q6DA 4J7TA 3SZRA 2QJNA 4M5PA 5HK4A 3TIMA 1ZP3A 4OGZA 2L9JA 1ZW2A 1NDYA 3B40A 2ZXOA 8XIAA 3R79A 1LLZA 3DJNB 1BFNA 2I57A 1OK6A 5FSEC 1E56A 1TREA 5G2WA 1FWDC 3NXFA 1DWHM 3VNYA 5MKGB 3NYDA 1ZENA 4O12A 4TU1A 1JPHA 4LBSA 2CBUA 6XIAA 1G6CA 4ZODA 3RCMA 5LSMA 4C6OA 2OO0A 5IFTA 1TVNA 2HPMA 3ZMRA 3AYSA 2A6EF 1XF0A 3W7EA 3IVUA 4Z1BA 3T6CA 3RFYA 4AY8A 1V0LA 4NX5A 4AWTA 1ZY9A 3LDVA 3D3FA 4L1WA 4F48A 3LI1A 2GDQA 2VQUA 2Z2UA 3B0UX 1QT1A 2Z00A 3GXIA 4IGGA 2EKCA 3LESA 4FNQA 4IL2A 2VO5A 2ZXAA 1ZHXA 1GJWA 1UJQA 3POVA 3N17A 4AXKA 1E51A 3CLMA 3WBWA 1OT1A 3EMCA 3VIMA 2VC7A 1TKNA 3B06A 3BAXA 4OKDA 4K8GA 1YPFA 2ZRXA 1MW1A 3TYDA 4LT9A 1KTNA 2OXNA 4LAMA 4WKFA 4B3LA 1SO6A 1Q6RA 1UASA 4HOZA 2WZEA 3HNJA 1QASA 4DZHA 2E77A 5DY2A 4XBKA 4XZHA 2AGTA 3LHUA 1UC4A 3TV8A 1OXBA 4X3ZA 1XIJA 4YK5A 3H4GA 1QRQA 4I9TA 2YQYA 4U4MA 3TJXA 2NXHA 2A1DD 4IB4A 4H83A 3SCUA 5IHSA 3AXXA 3PWIA 3CXOA 4CQ8A 4ADTA 1SYTA 5T8GA 5I5RA 3N0TA 1CXKA 3IHUA 3KX6A 1JDCA 2GVYA 1KKRA 3VF0A 3W7MA 1Z63A 3PBGA 3GM3A 1W9PA 1PIFA 2XDFA 3ZT7A 5BXPA 4C3EA 4JTDA 2JPUA 2WCSA 1PCKA 3BVJA 2IPGA 2CKSA 4KWUA 4QEEA 1FWGC 4LU0A 3WF3A 3U2LA 3C0SA 2GWWA 3BLIA 2QLAA 2QE9A 2UUHA 2ZRWA 2CLOA 3UZ5A 1EIBA 2PGEA 2OEMA 1EI7A 1EF2A 3FXGA 2J45A 1XIFA 2HSQA 3JYHA 1VBJA 5MHBA 1TR9A 1VHNA 2P88A 3KBSA 1G4US 5AVNA 5C9XA 3DZ1A 4X61A 3NYMA 2PODA 3NM3A 3TR9A 3Q6MA 2KX9A 1FTXA 1NWRA 4O1EA 4AL1A 3RGTA 4NRRA 1ORSC 1HFBA 1Y6DA 4B5VA 3VDBA 1BQGA 4ZQRA 1XDLA 3W4RA 1EJSC 2B7PA 1E9IA 1M6JA 1IHIA 2CCYA 1I9CB 3UZZA 3F2CA 3MYOA 5CZ0A 2PF0A 3SP1A 4DO6A 3BAIA 1OHLA 1H11A 3OVQA 1K02A 1DORA 3TUUA 1MEIA 4B4HA 4W8KA 2GGGA 2XM2A 1UQYA 3MMWA 2ZUWA 4A22A 2NLYA 4IMCA 3O8AA 3EH1A 3B0PA 3KOWA 1DJWA 1F73A 1O3UA 1TMLA 3B9DA 2WAGA 2FLIA 4KRZA 1GTEA 3VCRA 4FZIA 1UMLA 3REQB 3T1GA 4W93A 4OECA 2DGAA 2YXOA 2YZRA 2HJMA 5C70A 2WB5A 4LSBA 4PMZA 2OZTA 3SGUA 3PZGA 4A3UA 4GEHA 4HK7A 4MJMA 3DU0A 2G4FA 3SW6A 2YA0A 1LP6A 1YYAA 1WDWA 1ZRQA 2H3BA 2OZ8A 2QNEA 4QE1A 5A69A 3EKGA 4D6DA 4MZYA 3G1HA 2RHGA 2XM1A 4NG3A 3OVGA 3CUIA 1IWBA 2YL3A 3ZYZA 4B5TA 4ZQMA 4ULWA 2YIHA 3ZSUA 1OABA 5ENLA 4NZ4A 2EIJC 1XLLA 5HPOA 5FEXA 2F2HA 2DSWA 1GT8A 3PAOA 2CESA 3NZPA 3E12A 2I1OA 2D0HA 3OG3A 1GGOA 2BFGA 2PX3A 3ECSA 1J9YA 3THCA 4WX2A 5BQGA 4AYGA 4ATLA 2WBKA 2JE8A 2QTVA 1MDLA 3HGJA 3WAQA 4L56A 4JEBA 2E5CA 4EUKB 4UQEA 3VKAA 1J2BA 4XZIA 3N2CA 1I1WA 4LVDA 1M57C 4HSHA 2XM4A 3I5QA 2D2HA 2C79A 4PN2A 1F9CA 1OFRA 4GQHA 3UZYA 5A2BA 1A4LA 2TODA 3C2FA 2Z6JA 1AUSL 1Q63A 2ZQ0A 1C03A 2EPHA 1E3XA 4O13A 5C54A 1ZU8A 5DCDA 1V5XA 5DN1A 1KTMA 4PTMA 4OV4A 4N06A 4H9TA 4KQNA 3H12A 1HKWA 5F5HA 2QPSA 3GVGA 5LIYX 3K8MA 3S84A 5J5RA 4DNHA 4FIQA 4JIRA 4KGJA 1TX2A 3K1IC 2YBUA 5L6UA 3UD6A 1E3ZA 4EF8A 4F0SA 1IW7F 4DOZA 4DLFA 5HWJA 2VEKA 1RJ9A 3R8HA 2POZA 4OBRA 1CGNA 2Y61A 1XRVA 1RBLA 2VT0A 3HIJA 1KWGA 9CGTA 4NUWA 1ME9A 4Y7EA 1FWWA 2YXGA 2XLHA 3GG0A 2EIKC 3UWWA 2NUWA 3URAA 5BNKA 3UWUA 3NKEA 1IXPA 4Q8NA 1SO4A 8TIMA 4LS1A 4MWAA 4WGXA 2E68A 2PDPA 4M81A 3AIQA 2YCLA 2WC3A 3EB4A 2WHMA 4IJJA 5AYZA 3MUCA 1NFNA 3QMTA 3O15A 1XBXA 3FSUA 4HMCA 3VU2A 4Q32A 2HE8A 4UTTC 2LD6A 1WB0A 1XS2A 2ONEA 3PY2A 3GK0A 3FEMA 1KRAC 4FOJA 2QDHA 3DFPA 3SY8A 4H7CA 3LMYA 4AZ5A 4B91A 3ITLA 3IANA 2R1MA 3AS3A 2JX0A 2PP4A 1FFQA 3BURA 1UD6A 1U89A 3N15A 4IFKA 4ZMGA 2YZSA 1W5NA 2HS5A 3KVMA 1QNQA 4L61A 3RM8A 4O53A 3EA2A 2GLKA 3WDIA 3W7KA 4RXFA 4AHOA 1L6WA 1KFLA 1KWKA 5BROA 4L9XA 3ARSA 4GCAA 2O0TA 4DYKA 1ZJAA 4DVZA 2PTWA 4TVDA 1F5ZA 3BK0A 3SB0A 3CL7A 5DMLA 3LQLA 2W67A 3Q7GA 2VDIA 4KEMA 1J11A 3CM4A 1POKA 4EOUA 3HGSA 1RP9A 4H1ZA 2Z1SA 4IJRA 4LEFA 3EYPA 1F4AA 5E9AA 2XFYA 4CDAA 2Y3BA 1WCGA 4UFLA 5KYXB 2YW3A 4I5UA 3I5PA 3PZQA 4MAZA 1RAKA 3OGRA 1ISXA 4DXXA 2ZICA 4WD0A 3GU2A 3WUGA 4DQWA 4HOWA 4N02A 3TYZA 1MEHA 4UQ9A 3UCCA 4QG6A 3WH5A 3S6DA 3E9VA 1LOQA 3GKFA 5KYUB 1XL9A 2GWGA 2WNNA 3Q2DA 2C15A 4LVGA 1Z7AA 2PD5A 3BSHA 3NGJA 4QJ3B 5GPGB 5L3VA 3N2TA 1KM1A 3Q37A 4JNYA 1QW7A 2Z29A 3KCLA 1V51A 3KCJA 4JTDB 4CJOA 1X97A 4RCXA 4YNGA 4QGCA 1MMDA 4PK4A 1PWMA 2FB3A 3UETA 1TWCA 5AYYA 2XL8A 2Y5EA 2FGLA 3S46A 2V81A 2EHHA 2F6KA 5I3DA 1J8VA 3DOPA 3MHFA 1H1YA 3K2GA 4E4UA 2NG1A 3C8FA 4L64A 1YZCA 4DI9A 4QCEA 3F1QA 3FYPA 3QGVA 3E49A 3K33A 2MHRA 5T1DB 1VYSX 1A53A 5CPNA 3L9CA 2E1DA 4IQDA 4NNAA 2WC7A 3P93A 3W4YA 3Q4DA 3HLZA 2CBJA 1JCXA 3S5NA 2A5HA 2J6VA 2G96A 2WNZA 4JYDA 4JIIX 3WENA 2I14A 2WVSA 4P7OA 1HG3A 2QQ6A 4WJ0A 3PF3A 3A13A 3ABZA 4PUJA 2VR2A 1HJSA 5EFDA 2X1RA 1LS4A 3NL2A 2GVEA 4ZB2A 4MUZA 3G1DA 1Q8JA 1YEYA 3GXMA 2V3DA 3TQVA 3QZCA 4R27A 5FCZA 3N6JA 3QOKA 1HX0A 1M7XA 1IZMA 4Z2IA 2FYMA 3P67A 1J93A 4PBGA 2L6GA 4UTKA 2W27A 2QT3A 5A6AA 4JBRA 1KM6A 4N4WA 1JCYA 4LOCA 3ARVA 4C1LA 1XINA 2FPTA 1Q6OA 3TKFA 4Z1AA 1QPUA 2KAUC 1DBTA 2W9YA 2PWFA 3N9SA 4RDAA 5HNRA 2YL0A 3KZSA 1QFEA 4LNYA 5JUVA 1BSIA 4H3DA 8A3HA 2PURA 6XIMA 2ZDRA 1IF2A 4IL0A 2VXNA 4NJHA 3RW0A 2WM0A 3N12A 4GE8A 1E40A 2YKZA 4RLIA 2G37A 3O3RA 1GW1A 1CECA 3K4DA 5A1AA 3LXCA 1RKCA 4DBQA 4LYRA 4YVVA 3A4JA 5AGFA 1K8YA 1WDRA 3S5ZA 3RPMA 2WWCA 4HNNA 3TYEA 2H7VC 3ARYA 2B4GA 4WY0F 3W7HA 1EHNA 3W76A 3H2VA 4WF7A 3W1TA 1WDQA 1G4SA 1X7IA 1WDPA 3AG2C 2XGZA 2XZ9A 4YYFA 5BW6A 1TWAA 5JIPA 2BHYA 1M7JA 4M6QA 3RDKA 2HBXA 3G77A 1A0EA 5CSSA 3S0CA 3LCXA 3G6MA 4W7WA 5ABFA 3R89A 4FNPA 1JQXA 4E4FA 3WG7C 4HIBA 2QUUA 3H54A 1DOSA 3ZJ7A 3PBUA 1QVXA 1M3UA 2IYLD 3RVYA 4Q4OA 3M0LA 1EGVA 1U5HA 3LD5A 1CPRA 4YT5A 2X30A 3TCEA 3MKVA 1WXYA 4C6IA 2GOKA 1Q45A 2HS6A 4MTGA 1NP2A 2ACUA 5G4EA 5E3AA 3BZGA 3GG1A 3BGGA 1XM3A 2ZXRA 4LAUA 4ZCWA 3LAYA 3I6TA 2CITA 4GUIA 4J27A 3U3HA 1W1TA 5AN7A 3C2EA 1OCZC 3DG6A 3VNLA 3WQEA 5L0HA 4YCOA 1PX8A 2VNCA 3PSVA 2PDXA 5BOEA 3URQA 3L68A 1VCFA 1W5PA 4R7JA 3EH2A 4CSAA 4XBSA 4C7OA 1B54A 2WSYA 3WQFA 4MKSA 1X96A 3KDNA 1RY8A 1J0YA 1DPMA 3QKZA 1EO5A 4YYCA 5DCBA 3UESA 4JKMA 2P1FA 1VB5A 1WATA 3DG7A 4H01A 1L0PA 1SSDA 1W3KA 2E9BA 1KFCA 3RAOA 1ZAIA 3IJDA 3BEHA 1RR2A 3AI0A 4PMQA 3NGFA 4PUWA 2NLIA 1OCRC 1EUNA 3SAZA 3TTQA 5CZJA 3T2PA 1HKJA 2DFAA 1XLHA 4CU6A 3ZC4A 3MCOA 5DX7A 2EKGA 4MB5A 3MYIA 4LY8A 3AWOA 4XD6A 5AFDA 2D20A 1LI7A 1VJSA 4IMGA 4MWAB 3G4XA 5DRIA 1XG4A 4MVOA 5K7JA 1ZU4A 5D03A 4NTFA 3CV7A 1SYQA 1OYCA 1FKWA 5JIWA 4WKHA 3CQZA 2E5DA 3PZ9A 5DFAA 3XIMA 3SXKA 1LF1A 3N29A 2A6NA 4ZBCA 3EOLA 4FX6M 4DWSA 3HG5A 4LANA 1BRLA 3AXKA 2CEQA 1JVNA 1OGSA 3DERA 4S3EA 3UJEA 2R05A 3TJIA 2JEPA 2WMIB 4AZ7A 1XICA 3UF9A 4JJFA 3H7RA 3H8AA 3N11A 3VIKA 2PLJA 4QSFA 3R13A 1VFOA 1X6UA 5HQMA 2FFIA 1R3WA 2PDNA 1OFPA 4O1AA 5LHFA 2DT2A 4YVPA 1UD2A 1M7PA 1DJXA 1J0HA 4GLEA 3CJPA 4E4PA 3L2LA 2NW0A 3WEOA 1TMHA 3ANUA 3UG5A 4JYEA 2XIJA 3AMCA 2O9PA 4H04A 5EFFA 1T6IA 1TG7A 5ABGA 2FB2A 3GO2A 4A8NA 4WZHA 1E5JA 2ZZ3A 4XZNX 1Y8BA 3GBEA 1A5NC 1ML1A 1XQKA 1XG3A 1X1OA 3TFXA 3TQKA 1LORA 2H3DA 3NKDA 1TRDA 3LMZA 4PBFA 3ALFA 2J47A 3DE9A 2UV8G 2QIWA 3PANA 2D2OA 2QVHA 4Z2JA 3S5YA 1RXOB 2EG6A 3WD1A 1NTHA 4F2UA 4C6LA 4JKKA 2Q9AA 2ISVA 4MTOA 1HKKA 3MC5A 1VS1A 3IV8A 3U8GA 1QAPA 3A6OA 5F28E 2CHNA 4OBSA 4HNUA 4ERGA 2BOEX 2VFDA 3LXBA 3EDJA 1XLEA 4PUKA 3QYSA 4E8DA 1RY0A 3AHZA 3H6OA 3GXFA 4UR9A 4EKWA 1EUAA 4Q4SA 4RV3A 4AWSA 1DJZA 2WVOA 3W1XA 4O28A 3AGUA 4C6JA 1CTNA 4YL2A 1AMYA 1WDDA 3RX4A 5EGYA 4YT4A 1JL8A 1CX9A 3LPFA 3VOHA 1W37A 4M3PA 2PP1A 1R87A 2W9MA 4O6MA 2FHFA 3GR7A 6REQB 3ZLFA 3NEHA 5CGMA 2DQWA 3QV7A 3QFEA 1MQPA 2YDAA 3TN4A 3R8RA 3VCNA 5C9UA 2YLLA 2ZC8A 2POTA 3ZR4A 4DY1A 2A7PA 4GYFA 1IR2A 2X1IA 1W1YA 2VFGA 5FJIA 1AVAA 2PGWA 1VP5A 4O4WA 4CNPA 1JRBA 3KXQA 1O66A 1E0TA 4CCZA 2JK2A 2QF8A 2ESCA 3HQOA 2KK1A 1LPEA 3WQ6A 3WY1A 3EGDA 2OJQA 2B7NA 3NOYA 4HPGA 4CQ9A 1D1BA 2DSZA 3CUFA 3WLJA 4UNKA 1A5MC 2QUVA 3WSUA 3P8JA 4LX4A 3C2RA 1NFBA 3PJWA 2ZA3A 3TA9A 1O60A 1I2RA 5F2MA 5K2ZA 3QHNA 1DP0A 4JICA 2AMXA 4GWEA 5GJPA 2E8ZA 1UG7A 3KS6A 3PBVA 3VNKA 4AZBA 1FNTc 1EJVC 2Z1VA 2IUZA 1ZBKA 1EJUC 1TELA 3PG8A 3LHVA 4E8GA 4JTAA 3OG2A 3AQBA 1OFBA 4LUSA 2HCVA 4AAJA 2VFHA 1X6LA 3L1MA 4U9EA 4CIHA 4JTCB 2GQAA 2Y6ZA 2JIEA 4J5NA 4EACA 4DRHB 1HMDA 2V0TA 3ERPA 3OU8A 2YA1A 3KL3A 3GHTA 3LQGA 5D9OA 4O19A 1PZ2A 2UBPC 4WGHA 3ES7A 1FWJC 4PGLA 3HF3A 2P0NA 4DHGA 4PB4A 1GOIA 4GIAA 1CXIA 1LRQA 4HA1A 5K4ZA 3ALGA 3R4IA 4NCQA 2PZ0A 3EDDA 4PTDA 3N6HA 3N34A 2J9ZA 1OK4A 2QDDA 4DBWA 1GEQA 1SU5A 3BE7A 1XLFA 1TJPA 1VLWA 4US6A 1P5BA 1W6TA 4N2YA 2PWEA 4S38A 3MYPA 1GHRA 1LRNA 4GIYA 3EA1A 3ZR6A 2WZMA 4OIPF 2WPBA 1R47A 5IHRA 3T6JA 3UEQA 3GW0A 1BQCA 5LHEA 4CS7A 2BOGX 2UY2A 1NVMA 3PC0A 4S3CA 2JQXA 4QISA 3ZJ6A 3WLMA 4J3VA 3JZUA 1CT5A 1J01A 4TR9A 1W17A 3LS9A 1LM3B 1V08A 2PDIA 3CIWA 2PRHA 5HINA 4H41A 2H9AB 3VAVA 3GC4A 1RD5A 3EWZA 3KKBA 3ITCA 2BC5A 4L4MA 4LNCA 1DJNA 1XISA 1HKMA 1FWIC 3VK5A 3DYPA 3EEZA 3WQOA 3S0XA 5EMKA 4FB7A 5AB3A 3DKLA 2DIEA 2BB0A 4L80A 3UCQA 4AWEA 3QHMA 1NFOA 3RVZA 3N14A 4F9JA 4K2SA 2ICWG 1UC5A 3W7PA 1IZJA 3AIBA 3OLIA 1A7EA 4GINA 4HHHA 4S23A 4C7OB 1NOUA 4IGHA 1VENA 1ICQA 3UA3A 1HGYA 2YDSA 4NNBA 1E1FA 3CYJA 3P60A 4G9PA 1L9WA 4I7UA 3CGTA 1C7SA 5F1VA 4DZIA 1RD6A 5D8WA 1GQNA 2CXEA 2HZ8A 3PB2A 3UT0A 3G4ZA 3AMKA 4BEJA 3AO0A 1QHPA 1UCWA 3MZ2A 1HQTA 1ICPA 2Y3DA 3PVFA 4PMVA 3DMDA 2FHCA 3LENA 2VX7A 4C5ZA 3ARUA 4OIOF 1TPDA 1ZL1A 1B31A 2UY5A 2XS8A 4J30B 6PTDA 2E09A 4O7GA 1SZGA 2ZOXA 3L8JA 3PFMA 5JBEA 3TOYA 2WLYA 1Q5MA 3MMUA 5AC5A 1WZMA 3EHMA 5FJUA 5CC6A 2FVMA 2YHSA 4MTVA 4UXDA 4H9YA 3N4FA 3BLEA 2C16A 1DJQA 3LK6A 2IKIA 5G5IA 5FJTA 2A0UA 4ZOBA 3UU0A 5A3HA 4IARA 3ITTA 3AXMA 4CQBA 3HPSA 1BRLB 2W5FA 2VRJA 4GVHA 1TWHA 1FWSA 5DY3A 4BJ6C 5CC5A 3BWWA 1JZ8A 3WQVA 4AC7C 3EHNA 3UZWA 4G78A 2IPFA 2QVNA 4FS9A 3W88A 3KBMA 3B4UA 1IEXA 2ETSA 1RKEB 3MV11 4CIPA 3EEGA 3G1SA 1PWLA 3VMNA 3M4BA 1E1CA 1RVGA 3E2RA 3A9BA 3CHDA 2AP3A 2XSXA 4E0CA 3WG6A 5BOFA 3QVZA 3UXKA 1R7OA 1KGUA 1GW9A 1R9YA 4N9CA 5PTDA 3L4YA 1EDQA 4RJEA 1FQ0A 1YKWA 3E0VA 1H49A 1YNYA 2M64A 3H26A 1OQFA 3RR4A 3AU6A 1H3GA 1OF6A 3JT1A 2OT1A 3WJYA 2PLCA 4JIQA 3RKOF 1UMYA 3TFCA 5D37A 4KEVA 2R7XA 1LT8A 3T6GB 3FIGA 3B9EA 4MTFA 1IZCA 4F66A 3G0SA 3FOKA 1BGAA 2VZVA 4AIUA 1NSJA 2ZUNA 4UOZA 3BQ5A 5C7VA 5FF0A 2F9RA 2CZVA 4FA3A 7A3HA 2DSUA 3AHTA 1ECEA 4YU1A 4U5FE 4O57A 1K9FA 4MMWA 1YDOA 1WOAA 3GTIA 4W88A 3VD3A 1OXKA 3SY1A 3GS6A 1R8LA 3I3EA 3HZ3A 3CPRA 2OO6A 1I0DA 4MM1A 4S3FA 3RJYA 1P0KA 3IIXA 1B2YA 3B8SA 2X05A 4Z2HA 1SO3A 3H70A 3BAYA 1G4TA 5K3VA 4A35A 1RMVA 3SCSA 1MUWA 2CNWA 2NVDA 1QWKA 4M24A 4GMEA 1V79A 2KGOA 3IEEA 3P8IA 4O50A 1O7AA 3VE7A 1O94A 4DWSD 1NOFA 4RD9A 1XJBA 3W07A 1KBKA 3M64A 4R88A 2P7VA 3GB6A 1IEWA 4W7VA 5A6TC 2BY0A 3T2QA 4D6GA 3U4AA 1WKEA 4CD5A 3EGDB 3PZUA 5BXRA 1M01A 3EKZA 4ES4A 1QNPA 3KH2A 4JIEA 3ZVHB 4CQDA 1QI3A 3SJNA 3ZSSA 3L0GA 2R03A 1EB3A 3M0KA 4FNTA 3D0CA 1C93A 2J25A 3GNPA 2WJEA 4PFMA 4J40A 1FWEC 2VD9A 3OEXA 4HZ8A 2J66A 3C0QA 4ZQPA 1GKRA 5A6SA 4DI8A 1ZZPA 1JGIA 4JVSA 1B3WA 3F5LA 5JMUA 1KV8A 5FA5A 2C1IA 3UG3A 3TROA 4PC8A 4JTAB 1AODA 5CPLA 2PU0A 4EPKA 1FAPB 4PTWA 3RILA 1R5ID 2NXIA 4I1OB 4LUSB 2L6FA 5FF3A 2V26A 4PSRA 5FL0A 1BZ4A 3SO7A 3ARXA 2HK0A 1BF6A 2MWQA 4UMBA 2X0SA 2YXXA 1XH2A 1GVEA 2EXOA 4MB1A 1EYEA 2NSOA 2QCHA 3UVIA 4D9PA 5KMYA 1MW2A 4NAEB 4HCDA 4UOQA 4NJJA 4E17A 4IIFA 3VGHA 4H9MA 4CDVA 2D0GA 3W7GA 1Q3NA 3MI2A 4YTQA 3WQGA 4O52A 3T0BA 2Q01A 3IARA 4B2DD 1VFFA 1Z8AA 2PI6A 2RDWA 1ZUAX 2XYLA 3UWZA 1QWGA 3E38A 2XHYA 3WLHA 4DELA 4ORMA 3WH7A 1MMFA 3E6EA 3JVAA 1Q4NX 1KCLA 1H61A 3WDRA 1B30A 3SURA 4KBXA 2PCEA 3SRKA 2NSXA 4QEHA 4IP7A 4MF4A 1PYFA 3PNUA 1EJ7L 4I6KA 5KTLA 1ONRA 4P8VA 3EKLA 4H00A 1TPWA 2B0MA 4ZOAA 2ZA2A 3CNYA 3TQPA 4IIGA 1J0KA 4MW3A 2G41A 3TW7A 1XGDA 5FZTA 1GYNA 3OLDA 1WZAA 3FN9A 1PCXA 1P6WA 1XLBA 3W27A 3E9AA 3EOUA 4ECLA 5AYXA 2HSBA 1EGMA 1N7KA 1JCNA 2V38A 1U1JA 3UPMA 3QR1A 4YLWA 3K1HA 4WJEA 3U5UA 4MKVA 2R02A 3G0UA 3GEIA 2HBVA 4ZE5A 2VCCA 3H7VA 2ZZ4A 1UP0A 1I60A 2FIQA 4MNMA 1K9TA 4JKVA 4R7WA 3QM3A 4HFKB 4K1OA 1LT7A 3SSJA 4F4BA 5GVJA 4BCEA 4PTNA 4OHQA 1Z42A 3USZA 2XFRA 4JIPA 3LOTA 3TDFA 4ULVA 3MVTA 3QH2A 5T9BG 2AAMA 3IIVA 3VZZA 4PJNA 2JFEX 4UIOA 4F9DA 3ZIBA 2PDFA 2VH3A 4P5UA 4E2OA 4XZLX 4O6NA 3X1OA 4I5XA 5L3QA 2OEVA 2D3LA 2NSGA 1RQEA 1LQ0A 1TQJA 3DI1A 3ZWSA 4C3BA 3W53A 2ZE3A 1AZ1A 4N6CA 1EDGA 4BR1A 3IJ6A 1IQ8A 3FYOA 2J0WA 1VYKA 2R6OA 3JZ0A 3M5YA 2VGFA 4C6EA 4NHVA 3A3HA 3TCSA 1GHSA 1ONEA 1CLKA 3MSGA 1X1NA 2CZDA 1W91A 2ABBA 4LEQA 4PMNA 4FWVA 3DH7A 4KMQA 4Q8PA 1HW2A 4C6PA 3V1HA 5A6MA 4MVUA 1PVNA 3LU2A 4Z17A 1J6PA 3E0FA 3NEVA 1GGQA 1JPIA 1PL9A 3Q7LA 5JS5A 1C9WA 2D5RB 4LVAA 4TQTA 4S2BA 1UPMB 4N9BA 4DAIA 3MP3A 5FF2A 4FF7A 5A6BD 4WHBA 3N4AA 3BOXA 3AXIA 4MB3A 3M4HA 5L0DA 4GUGA 1VBHA 3N3MA 1C02A 3KVKA 1E9LA 3VFCA 3BGAA 3OJGA 2BX7A 4AX2A 4DRJB 2OEKA 3VD5A 2XSEA 3VNMA 3WLRA 1MNDA 3ELFA 3TTSA 1M68A 3FJ6A 4Y96A 3R10A 2CZ5A 2HVOA 1E1CB 5FSDC 3BC9A 3PZOA 4HT3A 1DWJM 3I6EA 2PWHA 5I3GA 2PPGA 4O16A 1GNXA 3R25A 1MDRA 1O95A 4M7TA 3PCVA 3OIXA 2ON3A 3M7WA 2C6QA 3WDPP 1PEZA 4YS1A 5LXEA 1H1NA 2EO7A 4X0NA 3BW3A 2VGIA 4H7ZA 3T08A 2FGBA 4TV5A 1A4MA 4D6IA 3TJ5A 4S3BA 2B0JA 4B3ZA 4HA0A 2J7HA 4GXWA 2I15A 1AJ0A 2YL1A 3KWXA 3W1QA 3KBVA 4XIMA 2QMJA 1VTMP 3LTSA 3GUGA 5J5DA 1GKPA 1XIBA 1QOXA 1G0CA 3LCIA 1EF3A 1M1BA 3UQNA 4H6RA 2OSWA 3JSEO 1HJUA 3BCJA 4X63A 1VPQA 1X98A 5CQ1A 2W4BA 4HVXA 3QTHA 2J74A 1SJAA 2CHRA 4PCFA 4OUIA 1RSCA 4F2TA 1OM0A 3VX1A