3B0VC

Trna-dihydrouridine synthase from thermus thermophilus in complex with trna
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
315
structure length
315
Chain Sequence
MLDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALLALSTKANREIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLMEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of dihydrouridine formation on tRNA
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase/rna
molecule keywords tRNA
total genus 108
structure length 315
sequence length 315
chains with identical sequence D
ec nomenclature ec 1.3.1.91: tRNA-dihydrouridine(20) synthase (NAD(P)(+)).
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01207 Dus Dihydrouridine synthase (Dus)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1460 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3b0vC02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3b0vC01
3QMRA 3GDKA 4UNLA 3PY2A 1ZAIA 1THFD 1LYXA 5CZJA 1J4EA 1VJIA 3B03A 1OG0A 1VR6A 3PM6A 5AHEA 1V5XA 3UZJA 3WJSA 4UTWA 3OEXA 4JTSA 4GUJA 2CWNA 4EF8A 3N2MA 1OFOA 3JS3A 4FXSA 4KWWA 4WQ6A 4O54A 3MHFA 3W07A 3GKFA 2FB3A 4KKXA 4JYDA 4HSOA 4O0KA 4O1CA 4GUGA 3DI0A 4QM1A 1FCUA 1R2RA 3NM3A 3GR8A 3W71A 1AK5A 4IOTA 3LERA 2R94A 3TJXA 4PL1A 4DBEA 3Q58A 1TYGA 2ZYFA 4YWIA 1EPXA 2H6RA 2YYUA 2A21A 1ZY9A 3DFTA 1NFBA 3TX9A 3UD6A 1H5YA 5LKYA 4JXCA 3MJYA 1AG1O 2FIQA 5HR7A 4UTKA 1K8XA 2WO5A 3QMTA 3HGJA 3G18A 2YW3A 4Q33A 3KVJA 2X1TA 2YYTA 4Y90A 1ADOA 4N6FA 3LI0A 3C0JA 3W7JA 1XDLA 3IIOA 5FI8A 4UFIA 1LRNA 2EKCA 1DHPA 5K2ZA 1A5SA 4K7VA 5FF3A 3TQVA 5DCDA 4UMBA 1B4KA 4CNOA 2ISSA 1K7XA 1EUNA 3HOJA 3GZ3A 5G5IA 4I7VA 1EP2A 2P10A 1VC4A 1RQHA 4IUOA 3S42A 5AN7A 1W5NA 3LCXA 4RZ5A 1LOLA 1LRTA 3O6DA 2QCGA 5D2XA 1SU5A 4QAIA 2CLLA 2TSYA 6ALDA 3B06A 4BF9A 1T99A 2YX0A 4HPXA 1RV8A 2QF7A 3FS2A 2BSLA 2JGQA 2NV1A 2DJLA 2ISVA 2PRLA 5I3KA 2CW6A 1Q45A 1A5BA 1KFLA 5I3JA 3W1NA 4PH6A 1QMLA 2B7OA 5HR6A 3C2VA 1IXPA 1WQ5A 3HMJG 1KM6A 3PBVA 4JYFA 4ORIA 2EAWA 4XTIA 1W56A 3STFA 5F2GA 3LCLA 4CQ8A 1TTIA 5CG7A 3T7VA 1O4UA 4NUWA 2R8WA 3S1UA 5H2ZA 1KM0A 5DY2A 4M6VA 4R33A 4WUIA 1NSJA 1UUOA 3F03K 5LSMA 2HS8A 2V82A 5EMUA 3QF0A 1VHNA 1XUZA 4NXSA 3MI2A 3HGSA 1XBVA 4WXZA 3CC1A 1JR1A 2CLHA 3HO8A 2QDHA 2GVLA 2DZVA 3S6DA 3BV4A 3D0CA 3W7DA 1HG3A 3KAOA 3LXAA 4O11A 3CM4A 2EF9A 1IXQA 3SI9A 4HNNA 3ATYA 4OQVA 2VC6A 4DPPA 1SO3A 5E0KA 3PB0A 1KFKA 2VEKA 4K7YA 4D2JA 1XCFA 1PCKA 1EB3A 3A5VA 1LOQA 3DU0A 2YFNA 5HUOA 4JIPA 4WXYA 3WJWA 2J9ZA 4HSNA 1KFCA 2VEPA 1SO5A 4MY1A 5D09A 3W83A 2O7QA 1TTPA 1GVRA 3PVFA 4WD0A 1C29A 2FPTA 3NEVA 3INPA 2YZRA 1NAL1 1XKYA 3BPWA 3DXIA 1TTJA 1FDYA 3HIJA 3N73A 3NL2A 1VCFA 3AJXA 2WOQA 4M6PA 4YXGA 3AO0A 4O50A 4QITA 1GVFA 5BMXA 2YSWA 5DXYA 3GXTA 2A7PA 3PBUA 3ABRA 4TR9A 2X30A 3W7CA 3LM7A 4NT0A 1H1ZA 2CFFA 5HWMA 1PCWA 1OABA 3EWXA 3EWUA 1VH7A 3KRSA 1GQNA 1VCGA 5A8GA 1FDZA 4MLRA 4R53A 3G8EA 5HNRA 3KX6A 1RR2A 2I1OA 3LCGA 3C2FA 3DFOA 2CLOA 2C13A 5D32A 4TMCA 1G4EA 3VI2A 1LP6A 2NWRA 4HN4A 1EP1A 2ZRXA 1X8FA 1KM2A 3UXAA 2VENA 3GNNA 3P81A 3LB0A 1BWLA 1ZHAA 2VFIA 1KA9F 1B57A 3W9ZA 2Z0IA 4NJIA 3STEA 3TH6A 3WK1A 5G4EA 5FEPA 2EGZA 5F1VA 1YXCA 1AW5A 3QQ1A 4BI7A 1L2UA 3DAQA 3QJAA 3RF9A 1Z44A 1YDVA 2EPHA 1UJPA 3MHUA 3DZ1A 3W1PA 4WZHA 5KINA 2GPTA 3W2JA 3QW3A 4AHPA 3C61A 3L9CA 3BARA 1O94A 5AYXA 1OFPA 1LROA 3YPIA 1YTKA 4I7WA 4LT9A 5DELA 3L0GA 3HJZA 2Y6ZA 2NUWA 5FF2A 3TROA 1QWGA 1UB3A 4PCFA 2BX7A 4JD4A 4R7JA 4S1FA 1YADA 3CIWA 2GQAA 4AHQA 2GVGA 2LLEA 4RX0A 3L0KA 4N4PA 1BKSA 4R34A 1RQEA 5LGXA 1WBJA 3B05A 4LW7A 4G1KA 3L68A 2ZA2A 5DN1A 5AHFA 3T40A 1M5WA 3DHFA 2YXGA 5K9CA 1FXQA 3UPWA 1G7VA 1TO3A 3DFPA 4ICNA 3W7GA 4BWLC 4LV4A 2QCHA 3M7WA 5A5WA 3W1AA 4C1KA 4N9DA 1ZCOA 4JTIA 5D38A 4FX6M 3TNOA 1SW3A 4PTNA 2V2HA 3EX3A 3C52A 4NX5A 1VPXA 3PSVA 3LHWA 4RXFA 4IXXA 3C6CA 3VNDA 1G6CA 2ZQ0A 3L5MA 1KM1A 4FO4A 3B04A 1H7OA 2CZDA 1SFLA 4O0ZA 2RFGA 2FDSA 2VOMA 4H6KA 5DXXA 3RMJA 4IQLA 4UUIA 4FNRA 3A22A 2FTPA 1XM3A 2QAPA 3NOEA 3PG9A 5LGZA 1YXYA 1S5TA 4NU7A 3H54A 3IGXA 4I7UA 4K37A 1LZOA 4Y8FA 1SSDA 3CB8A 3NQEA 2A1YA 4Y6GA 2VXNA 3NG3A 5LNVA 5EKYA 2RKXA 3C2OA 4UR7A 4ADUA 2R14A 4BI5A 2CZEA 3LLFA 3UNDA 3M41A 1W5OA 1TPC1 4AHOA 1H63A 1RZMA 3IVUA 5HWJA 4DF2A 3C3NA 3THAA 2B7PA 5D37A 1I8JA 1L6WA 4PC8A 3UWVA 4NJHA 1K8ZA 4CCCA 3NQMA 4Q32A 4HPJA 2GVJA 2Q8LA 3UY7A 4U4MA 4LVBA 4O4VA 3LRKA 5GVJA 1XC4A 1TJPA 3NQ6A 3LHYA 4GC4A 2VFGA 4HNUA 1KFBA 1QAPA 2C19A 2CU0A 3CIXA 4UFJA 1TRDA 2X1SA 3CWNA 4LC6A 4ADSA 4MJZA 3FOKA 3O1NA 3S0CA 4WOZA 3LTYA 4M7TA 1N7KA 2NUYA 4JTLA 5EL1A 4IPJA 1FWNA 3MP4A 4ZQRA 3G24A 1G4PA 4UFMA 2Y62A 3P5ZA 5G2IA 5BW6A 3S5ZA 3W7EA 1OFAA 1DV7A 2V30A 3HGOA 3LX9A 4FNTA 1OHLA 3UZ5A 2ZZ7A 4KFPA 4XKYA 4ALDA 4GBUA 2ZZ2A 3OVPA 1H7NA 3FYOA 1F7BA 3GXNA 2RDUA 4PFMA 2DORA 3W75A 3L67A 2YFOA 1TPFA 1ZJIA 5L6UA 1C9DA 2DZTA 4IMDA 2ZZ6A 4RCXA 3E0IA 3NQ7A 4K39A 4NNCA 1I4NA 4ML9A 4UTLA 4DO5A 3O15A 3KXQA 1GYLA 3F4NA 5AHLA 1EUAA 1JJKA 1LLWA 3NQVA 2B7QA 4HT3A 1T8XA 4N4QA 2CZFA 2ABAA 3QZEA 1F5ZA 4PEKA 3UWQA 3LHVA 4JGDA 5K7JA 3EB2A 4Z1CA 3W2UA 1TQXA 1RD5A 1SZEA 3QW4B 3LDVA 3IVTA 4O57A 5HINA 1PL9A 4UTTC 4RXGA 2F7FA 1YDOA 5HWNA 3UXDA 3LCFA 3ELFA 1PV8A 2V0TA 1ME8A 4ZQMA 2E6FA 3UWWA 2JK2A 4UTWC 2W0UA 1M7OA 3UPBA 1JUEA 4XBSA 4DELA 2DJXA 5CGQA 3G3MA 1W54A 2VFHA 3F4WA 5K9DA 4E2DA 5AC6A 4N9EA 3I65A 2ZRYA 5KZEA 1EIXA 3HG4A 5IM51 7TIMA 5J5DA 4ZMGA 3USBA 4UNKA 3B4UA 2GJLA 3PG8A 3LRLA 3P62A 3FJLA 3NL5A 3QPZA 3FIGA 5G1YA 4E2BA 2QJIA 3MI6A 3P80A 5HMSA 3TDFA 1HFBA 4LRTA 4DEFA 3NPUA 4OBTA 4H3DA 3BGGA 2GQ9A 3NL3A 4S2BA 3CTLA 3RU6A 4XKYB 1JCNA 1W37A 3P74A 3OIXA 3N2XA 1JCXA 4DXVA 1WOAA 3CT7A 3T4CA 5D02A 1UASA 4LVGA 4AB4A 2C16A 1F73A 5C2XA 3DFSA 4HNVA 1ICPA 2Y85A 3W7OA 3CU2A 4FEZA 4MFEA 5AHMA 4GUFA 4JTTA 1W1ZA 2E77A 4MYXA 5I3FA 1GT8A 3SW6A 3B0VC 5BOOA 5G2WA 3KFTA 1TJRA 4S2CA 2QCEA 3ZFHA 2QJGA 1VGAA 3DGRA 4BK9A 1MZHA 3G1DA 4OE7A 1GZGA 3TW6A 3IIXA 1TPDA 4UTUA 3NQFA 1G7UA 1SPQA 3NQDA 1C8VA 2C1HA 2Y7GA 3NM1A 3JR2A 4M19A 1N8FA 3FEMA 3BLEA 2NZLA 3Q37A 1I2OA 3GLCA 2ZRUA 1DKWA 2JKEA 4JTJA 4LTSA 4UIOA 1SQ7A 3LHUA 2NV2A 1MEHA 2WV8A 2PRHA 1CW2A 4JICA 1P0KA 2WPBA 2GUUA 5IBXC 3P60A 1AL8A 2OT0A 2Z1BA 3W7LA 3LLDA 4YMZA 1T96A 2E5BA 3CLMA 1QR7A 1W5MA 3R12A 4AWTA 1RVGA 1XI3A 2H3DA 2QUUA 3G3DA 1OF6A 3ZS4A 1W5PA 2JKPA 1QO2A 5CSSA 4Z1DA 3M5VA 1VLWA 3CPRA 4MUZA 1W3IA 3HQ1A 3EWWA 5LNRA 3TU9A 3IIPA 4IMGA 2J27A 4RJEA 2TMDA 3OVRA 1H1YA 1LM1A 3EXRA 2E6YA 1MEIA 1DVJA 4JDBA 3GIYA 4MZ1A 4QIUA 4UFKA 2XN2A 4LU0A 3TUUA 3M5ZA 1OYAA 4N6EA 1W0MA 3SIZA 1DQXA 3OVQA 3GDLA 1SSGA 1TIMA 1ZENA 4YLWA 4Z0JA 3I7RA 3THQA 5LNUA 1KTCA 3L5LA 3L66A 2E6AA 1DJNA 2RDWA 1P0NA 4AEOA 1YLVA 4O28A 3EKZA 2YR1A 1K7EA 4LVAA 2QCDB 3B0PA 2XFWA 2QCLA 3DENA 2DZSA 3EWZA 3W84A 2QCFA 3FFSA 5AFDA 5FF0A 3KRUA 3PUDA 1I2PA 4KWVA 2ALDA 1TPUA 2JBMA 4O13A 1W5QA 4NNAA 4FNPA 1KFJA 2WKJA 3W22A 3ZR4A 3GK0A 3T44A 5I3GA 3W6YA 3W2MA 3TFCA 3M9YA 3W85A 4BFAA 3NNTA 3G8RA 3G1SA 1JVNA 1GVSA 3LCHA 1ML1A 2J9XA 4QNEA 4LVDA 2FB2A 3HGRA 1QPQA 3P84A 5CPNA 3WFAA 1MSSA 1SZNA 3BG9A 1TCDA 5DCEA 1KM4A 4O14A 4NQ1A 2QCMA 3ABQA 4LWWA 4JY9A 4JEQA 3L2IA 3S1WA 3S5YA 4IMCA 1K02A 3TCEA 2X16A 5IBXA 1P4CA 1W8SA 2A6NA 3GYEA 2VFDA 1R2TA 3W2NA 2ZZ1A 3RLUA 4MVAA 2NXIA 1V7YA 1OX5A 1I45A 5C6MA 1Z41A 2FPVA 3G1XA 3GX9A 1WOBA 4MY8A 3LHTA 2G5WA 3DFQA 3PAJA 4MPQA 3KVMA 5D33A 2RHGA 1IXNA 4UTHA 3W86A 1YDNA 3WJYA 1OK4A 4JIQA 5F2IA 1S3HA 3P5YA 1KV8A 3M16A 1H7WA 3TJLA 1F2JA 1FWRA 3UQNA 4RZ4A 4O15A 4PL2A 3PULA 3IGUA 1ZAJA 1S5WA 2J9YA 3W73A 1ZAHA 4AF0A 3QSTA 3TFXA 3PWAA 4GWEA 4JY8A 1EEPA 1OFRA 5EBUA 4UMCA 4O12A 2AGKA 1Q6RA 3EX6A 3N14A 1KM3A 2TRSA 2A0NA 5J5RA 3BVJA 1EA0A 2ZRVA 2C14A 1Y0EA 2V2CA 1QPNA 3EKLA 4AWSA 5AC8A 2OT1A 4UCGA 2BZNA 4Z1BA 3BLFA 3SY5A 2ZZ5A 1I2NA 2Q3OA 4OT7A 4NZFA 4QISA 4QQ3A 4JX5A 2WJZA 3HG3A 1PS9A 1LTDA 4EVZA 2A7RA 4XBKA 3STGA 3IRDA 4PODA 5K4XA 3FA5A 4ORMA 5G4WA 3M5XA 1VHCA 5H91A 2ISWA 2X2GA 5EA9A 1EP3A 1QFEA 1YPFA 5AHNA 2NXGA 3LBCA 4JTUA 3QPYA 2V5BA 4UR8A 4MFDA 2A2IA 3QQ0A 3MUXA 2JKAA 3IGSA 5CPMA 4M5PA 4CNPA 4YL2A 3NDOA 3EWYA 5EYWA 1VQTA 4FNQA 1RPXA 4AXKA 1TV8A 1X1ZA 4X3ZA 1N55A 4O19A 3L21A 4IPIA 1F6KA 1VCVA 1YXDA 4DPQA 1O60A 4NX0A 3VCRA 4JR5A 2HTMA 1AW1A 3QYQA 4DF0A 2C6QA 2RDTA 4UMAA 5FESA 3PBWA 3G0SA 3VE9A 3TAKA 5EY5A 4JNMA 3GR7A 2Q3RA 2PURA 3K30A 3LGEA 3G1VA 5DBTA 1E51A 5CZ0A 3W72A 3NQAA 1JCJA 1ONRA 1SFJA 2WSYA 1GYNA 5E1QA 1TPVA 3G22A 1YTDA 3S5NA 1G69A 1TB3A 3O06A 4KFOA 4IMFA 3O05A 3O07A 3W76A 3LTPA 3BO9A 4JDYA 3C2EA 5LHEA 3CEUA 3BG5A 2WNZA 2C15A 1WAUA 4O52A 1LBFA 3ZWTA 3I7QA 2EHHA 3LOTA 3A24A 2XN1A 3FJ6A 3W7KA 2Z6JA 1UCWA 1Q6LA 1H50A 3VFLA 1TV5A 3TMLA 1X7FA 4LY8A 3GVGA 1KTBA 5AHIA 4GXMA 1EWEA 2E09A 4JTKA 2DU2A 1HTIA 1KLYA 3BK0A 3MMTA 4MLJA 3FKRA 2Y7EA 3PS7A 4CLMA 2Y63A 1SO4A 3W23A 1IXOA 3NL6A 2DZXA 2I14A 1SZGA 5DLCA 3Q94A 4JYEA 1KBIA 1XBXA 1JQXA 3L0NA 5CPLA 3ABOA 3SGUA 2BLEA 1YPIA 2QAFA 1ZFJA 4DO4A 3NXFA 8TIMA 2QCNA 4OWGA 3R8RA 3NZRA 4MJMA 4MY9A 2VKZG 1VYPX 3RLVA 1Z42A 3EX4A 3M43A 4CCEA 1JCMP 3A5FA 3V75A 3I68A 3GDMA 3NQCA 4CCDA 2ATSA 6TIMA 5MHBA 2DZUA 4AH7A 4ZVJA 3S9YA 4GUIA 1TPWA 3G1YA 2VFFA 1L6YA 3RFAA 4WY0A 2DZWA 1G67A 3N34A 2CLFA 1VYSX 5F1UA 2NXHA 5FF4A 1W3NA 2G97A 2WSRA 3EXSA 4LRSA 3W1MA 4MZYA 4OV9A 1U5JA 3M1ZA 1OFDA 4N2YA 4Z0SA 4FX7A 5DY3A 5TIMA 1M7PA 4FIRA 3LXCA 2H8ZA 3N9SA 5F2LA 2NX1A 3TC7A 4A22A 1TRIA 1FBAA 1L6SA 1GTHA 1QOPA 4ZL1A 3GAYA 2C18A 2XN0A 3QRHA 1QOQA 3U6WA 2HS6A 4ZQOA 3IIVA 3MW7A 4JX6A 3R13A 3N3MA 4E38A 2V8ZA 1O5XA 4NVTA 1VLIA 3HB9A 3WK3A 3OA3A 1GG0A 4UTIA 2B4GA 3G1FA 3NPWA 3NO5A 1YYAA 2KZHA 3HG5A 2Y70A 3LHZA 5D30A 4UTMA 1H60A 2A4AA 1KTNA 3PF3A 2QEZA 1TPH1 1WDWA 1B4EA 2V9DA 1F6PA 1MXSA 1KW1A 2QCDA 1PHQA 3LCIA 4K6AA 3DKJA 4J9JA 4RR4A 4NZJA 1ME9A 2OX1A 4L4LA 1XUUA 4EWND 1R46A 3H53A 1BTMA 2PRMA 1ZNNA 4N9CA 2DP3A 2J24A 1PIIA 4O18A 5F4SA 3P8IA 3O63A 4WY0F 2E68A 2R91A 4O17A 1VRDA 3KRZA 4ZQNA 1XXXA 2GJNA 3LV5A 1FCVA 4BWLA 3SSJA 4N9BA 5CPOA 4O16A 3PC0A 1WX0A 3KVLA 4Y9AA 3W1QA 3SZ8A 4K8EA 2P0OA 3EEGA 2D73A 1M6JA 4M7SA 4Y96A 4IXHA 2NX9A 3W7HA 1W3TA 3TKFA 3R5EA 3B0UX 2PE4A 2ZRWA 1KV5A 2CLIA 3C8FA 1ME7A 4I9AA 4JN6A 2E5DA 2Z2UA 1A50A 1UUMA 3VE7A 1ALDA 1KFEA 1FX6A 2WNNA 3L5AA 1PE1A 4IX0A 4MZ8A 3W1TA 4YCPA 2ZZ4A 4FNSA 4XWUA 3O8AA 1G4TA 3G0UA 3R89A 2Y89A 2WSQA 2ZTKA 4ADTA 3TW7A 3U2OA 2IQTA 3W1RA 1DOSA 1OFBA 4IGHA 3GDTA 2V2DA 1HO1A 5FEZA 1QPOA 4TO8A 4NNBA 4UTTA 1LRQA 3W1LA 2BTMA 2B7NA 3CQ0A 4MOZA 4HNTA 3TE9A 1EX5A 2FJKA 4KFNA 1OF8A 1F05A 1O95A 2QJHA 4POCA 1VYRA 3GAKA 5FEWA 3LBMA 1HL2A 3A9IA 4O1AA 3QC3A 4A2SA 3PSWA 4LS0A 3TQKA 3KHJA 4RV8A 5HQEA 3NVTA 4WOQA 3W2LA 1H51A 1AL7A 3TMQA 3O6CA 2ZBTA 1R47A 1W31A 4IWWA 1WXJA 3HG2A 1QO5A 3MWAA 1X1OA 4RKAA 3NZ1A 4WX2A 5K4ZA 2A85A 5D2TA 1A53A 2B0MA 3QH2A 3C56A 1GG1A 3DH7A 1Q6QA 1SW0A 3P7YA 5C54A 1RQBA 1TTQA 5BNKA 3WK2A 4TIMA 3EX2A 1OYCA 1H7PA 2BWGA 2CLEA 2GQ8A 2NLIA 2TPSA 2ZFAA 3TA6A 1FXPA 3TR2A 3LRMA 3KOFA 1GWJA 2FPYA 3HBLA 3E02A 1FQ0A 5K3VA 1VS1A 4LUIA 4JX4A 3FLUA 3CWOX 5FEXA 3UWUA 1Z48A 4AMAA 1SW7A 4NJKA 1B3OA 2YGYA 4K36A 1B9BA 1VZWA 4GE8A 3BG3A 5E93A 1AW2A 1BWKA 1QNVA 2QUVA 3LTSA 3MP3A 5U7SA 3QM3A 2A6LA 1CI1A 5D04C 4JTEA 1LBMA 3DHDA 4H4IA 2Y88A 3MHGA 4QNWA 4FIQA 4MYAA 2VEMA 1K7FA 4P61A 3G1HA 5LNWA 2UV8G 4EF9A 3OHIA 1HUVA 2PC4A 4CQ9A 2AQWA 1FWWA 2H8XA 3N19B 1FY6A 1K03A 4K8HA 2WNQA 3A23A 1J2WA 1F74A 1NEYA 4QSHA 2A5HA 3P8JA 2NX3A 1BEUA 1GJPA 1GOXA 5DCBA 3M6YA 3LCWA 5AOUA 3I6RA 3HPZA 2QUTA 1R2SA 4X9SA 4IX2A 2ZDRA 3P67A 4ZZ9A 3Q2DA 4UTJA 5F4WA 1LDCA 3G0XA 3NQGA 4Z1AA 2HSAA 4OHQA 3QEZA 4JTHA 4NJJA 1HO4A 4O1BA 1DL3A 3U8GA 1XBZA 1TPEA 1FUYA 3NQ2A 4TX9A 3CEPA 3A21A 5LZLA 4QJ1A 4A2RA 4TU1A 1DQWA 3TXZA 4Q4KA 2ZRZA 4XQ6A 2ZCGA 4FXRA 3SFKA 4X2RA 4RK8A 3ANYA 3FKKA 5C5YA 1EWDA 1S5VA 5CZTA 5G1TA 1FCQA 4LS2A 4DBDA 3SECA 4CNNA 4EIVA 1ICQA 5D2WA 2YW4A 3HPSA 1D9EA 1OJXA 1I2QA 5EPDA 1NF7A 4L4MA 2ZZ3A 3MYPA 3HPXA 4JTGA 1AMKA 3RNDA 4M6QA 1A5AA 4C1LA 2G96A 3TC6A 1TSIA 5KSWA 1XBYA 5T26A 3DI1A 1OX6A 4O8RA 1NF0A 2P1FA 4OV4A 1OYBA 3MBFA 5HULA 1H7XA 1KBJA 2CLMA 1OVDA 3QSRA 4GJ1A 2E6DA 5F4XA 4RLIA 5CKSA 1MEWA 1QCWA 4O1DA 1QDSA 3S5OA 2QKFA 1TQJA 2FFCA 3M44A 4O4WA 5DBUA 1SR9A 1F76A 3LV6A 1A5CA 3EWBX 3GNDA 4ZQCA 3M0ZA 1FCBA 2ZTJA 5G2HA 1LOSA 3NPXA 5AYZA 5TQLA 1ICSA 1PHWA 3UYCA 1IGSA 4W9TA 4YCOA 2H3BA 2C3ZA 5KZMA 4AF0B 1R30A 4LC8A 3W2KA 2ABBA 3RK8A 1WV2A 2YCEA 2HMCA 1WA3A 3GB6A 3W7QA 3W1XA 3DFNA 3BW2A 1OX4B 2C0AA 1SUXA 1I2RA 1TV7A 4BR1A 3TIMA 3E49A 3BW3A 3SGZA 2OCZA 5TBOA 5BRBA 2Q8ZA 3EXTA 1CX9A 3S1XA 3W74A 3T55A 3NR0A 2CLKA 4GRSA 5LHFA 1ZALA 2E1DA 1OFQA 4AVFA 3WJXA 4MKNA 2FLIA 4JS3A 2V5LA 3MI3A 1K8YA 2J88A 4XTDA 2AAMA 4A21A 3R2GA 4GNJA 4LUJA 3ABSA 2F84A 3PR2A 4O53A 2ZA3A 1LBLA 4NJGA 3W7RA 3E12A 3W7NA 1OX4A 3O6YX 4DF1A 4UFLA 3W70A 4PA8A 4EOUA 2YPIA 5AC7A 2Z6IA 1P5BA 1GPWA 1JRBA 3ZWSA 1JULA 4K38A 1TPB1 3W7IA 4DQWA 4XZ9A 2PCQA 1XL9A 1JUBA 3S8HA 1OFEA 2OZ0A 5HUPA 5KITA 3TQ0A 5K9XA 3GKAA 4JTFA 3UWZA 4TMBA 3FYPA 4OU1A 4UC5A 3S1VA 2E5CA 3PUOA 3CHVA 1J5TA 4XUGA 1H7RA 1XDMA 2OMAA 2W6RA 4HHPA 4ONVA 1LLZA 4LNYA 3HF3A 1XFBA 4RZ6A 3OG3A 1P1XA 3P82A 2DZPA 3G1AA 1LORA 1K3UA 3IEBA 4HKPA 3TSMA 5I3IA 5KMYA 1DJQA 3NPVA 2J6XA 1Q6OA 1JUKA 2Y7DA 3GXPA 2VEIA 3BGJA 2QCCA 2Y61A 3B8DA 4NXKA 3QMSA 4ZQPA 3TAOA 1TREA 1JQVA 3C4UA 3TSDA 2X1RA 3W87A 3PUEA 5C55A 2A7NA 3NQ8A 3WJZA 1DBTA 2NWSA 4CQAA 1L9WA 3TSBA 2QDGA 3H55A 3JRKA 1D3GA 2NUXA 3GDRA 4WY0B 3M5YA 2TYSA 5U4NA 1WBHA 4Z08A 3TV8A 1H62A 3OBKA 5AB3A 3UWYA 3I7SA 3W88A 2I9EA 5D2YA 2BXVA 4LVFA 4B5NA 2X1UA 1GEQA 3SR7A 3MO7A 1U83A 3PB2A 4UXDA 1QPRA 3LI1A 3M47A 3TK7A 4FB7A 3W7PA 3EX1A 3T78A 4FHAA 4A29A 2OJPA 3BW4A 4X22A 3ATZA 1JCLA 3PBYA 2RH9A 5LNSA 3E9AA 4GUHA 5KZDA 4N02A 5D2VA 1O5KA 3MP5A 3SJ3A 5KTLA 2ZA1A 4WJEA 5I3HA 3V1PA 3W7MA 1GTEA 1KM5A 3F1QA 5ABTA 4OGZA 3NA8A 4DO6A 1X6UA 3DBPA 1Q3NA 1NVMA 4HIBA 1IF2A 1IIGA 4FNUA 4LOCA 1GVOA 2G95A 1FDJA 4P2VA 1PVNA 1UBSA 3MBDA 1WYIA 5BMWA 5FF7A 1LCOA 4FX8A 3O16A 1DORA 2VELA 3E96A 5HJLA 5D05A 4UFHA 2YDAA 3WK0A 3IV3A 2FQIA 3KVKA 2JGYA 3MYOA 1G4SA 4O10A 3STCA 3NGJA 2CZ5A 1SZFA 3W1UA 3N9RA 4A3UA 5CSRA 5F2MA 4IJBA 3TXVA 1YTEA 1IIHA 1GVQA 3NAVA 1JRCA 4FF7A 4AWUA 1OK6A 5L9FA 1T0OA 1JCYA 5CZSA 1TMHA 4LS1A 4GFSA 3QFEA 3DKLA 4IMEA 3LXBA 2WQPA 2QR6A 2W79A 2O7SA 1MO0A 4E0CA 3P61A 5SWUA 3C2RA 3L65A 2GOUA 4AAJA 1D3HA 1FWSA 3UY8A 2V81A 3W3OA 5AYYA 2H90A 3BLIA 1SO6A 4LV9A 3IIZA 2Y7FA 4U28A 5D03A 3VKJA 3IVSA 3NYZA 1H61A 4MIMA 4BI6A 1FWTA 2VFEA 2ATMA 1KLZA
chains in the Genus database with same CATH superfamily
3LPOA 3GDKA 3SSZA 3WX7A 5D91A 1LJYA 1TWDA 5HAOA 1VJIA 2E7FA 3CQHA 3PM6A 3B9QA 2PDCA 4ZCWA 5JP7A 4UTWA 3OEXA 4JZAA 3TD7A 4H41A 4K0DA 4GYFA 4KBLA 1KNWA 3GKFA 4QM1A 4O0KA 1QT1A 3KL0A 1EOKA 1AK5A 3QOKA 4RUBA 4IOTA 3ARRA 3TJXA 4J3SA 1B68A 1UZHA 1DTUA 5I79A 4LEQA 1TYGA 2ZYFA 4DJEC 2HFIA 4IZGA 1OR2A 4KRZA 3DFTA 3CUHA 5CH9A 3TX9A 5LKYA 4JXCA 3MJYA 3CK5A 1CTNA 3AMCA 5HR7A 4UTKA 1K8XA 4LBSA 3S3GA 2YYTA 1FMWA 3W7JA 1KWKA 3NKDA 1XDLA 3IIOA 5C7HA 1LRNA 4NASA 3Q67A 2EKCA 3ZZ1A 2PZ0A 2FJUB 4V1XA 3UXIA 9XIMA 2Q71A 1K7XA 3VMNA 3UA3A 3APTA 3LA4A 4L9XA 2Y8UA 4I7VA 2ZXQA 4N7QA 3RO6A 2DIKA 1U89A 1YNYA 1RQHA 3GNRA 3H4XA 1V51A 4C6DA 5F5HA 3ITCA 3LCXA 4RZ5A 2D3LA 3O6DA 1XLIA 2L6HA 2CLLA 1M7XA 2J78A 4GYJA 4U9EA 3B06A 2YX0A 1DJXA 4DAIA 2QF7A 2WPGA 1YA7O 5L3QA 2BSLA 5I3KA 4B9ZA 4AE4B 4OJYA 1A5BA 1PWLA 1EI7A 5I3JA 1E1CB 5HR6A 4MKVA 3HMJG 3VD9A 3PBVA 4XAYA 1ISXA 1W56A 5F2GA 4CQ8A 3WQCA 4TVCA 5CG7A 4H8NA 2R8WA 3S1UA 4KRTA 5DY2A 4R33A 3AXKA 1NSJA 3SQSA 5E0FA 3GXIA 1APCA 4CQBA 2Q4FA 3RXZA 1DWFM 4RL3A 2XLWA 5E9XA 5EMUA 5A94A 2XDFA 1TMQA 4NILA 1AVAA 3HGSA 4R7OA 3CB3A 3AXHA 3DGBA 3QQWA 1UR0A 3O6AA 1GQLA 2ZC8A 1V0LA 2GVLA 2QDHA 4L1WA 3S6DA 3D0CA 1HG3A 3CM4A 2EF9A 2ACQA 4OQVA 2WZLA 1YKWA 2VO5A 2RGMA 2VEKA 5JBEA 3AQCA 3EA1A 5E09A 1QVBA 4K7YA 1X8CA 1QKRA 1W1PA 4W86A 7TAAA 4EUKB 1EB3A 3N1AA 2BNJA 1OM0A 1E0VA 2X42A 4QROA 1ZBCA 3G6MA 3AIWA 1FWBC 1KFCA 1SO5A 4R3UA 2F61A 2CNWA 4HZ7A 3AOFA 2O7QA 1GVRA 2J9VA 256BA 1HW2A 1PIFA 2FPTA 2Y0FA 2INFA 3NEVA 2PWEA 3AC0A 1J11A 4EP8C 1XKYA 4E3TA 2CKSA 2NSOA 1RLCL 3NL2A 1VCFA 1J12A 3NQBA 2WZMA 1S46A 4NL1A 3VIMA 3L4UA 1CGME 4B91A 1HJWA 1YZCA 1HT6A 1GVFA 4CEXC 4A3YA 3M1CB 4FLQA 2OKUA 3OTRA 1UPPA 3ABRA 2DQWA 1Z7Qc 1PCWA 3SXKA 3T0TA 5C9UA 2ZE0A 3EWUA 3FGCA 3KRSA 3UGPA 1GQNA 1VCGA 5A8GA 3RAOA 4H2CA 1FDZA 2RD9A 2D2JA 3WQPA 2Q7RA 3GIQA 3SYNA 1XLJA 5A8PA 4A05A 3QLDA 5MKGB 2C13A 3SB0A 3S28A 3COTA 2GJRA 4BPMA 1EP1A 3N4FA 2GGEA 3AMKA 4MVSA 1EHAA 2PUZA 3T8LA 4BQ2A 3LB0A 1BWLA 1ZHAA 3BGAA 2VFIA 3EHMA 1MVYA 3A3HA 4NJIA 1YE4A 2R7SA 3STEA 2NSFA 3TH6A 4KEZA 4HZ6A 2EGZA 2PTWA 2VX7A 1YXCA 1LIHA 1B90A 1PTGA 4PR9A 5B1BC 2OLAA 1XCXA 1YMYA 3CGTA 3MJMA 3KBSA 3OLEA 1WTYA 4BI7A 1RJ9B 2WMFA 4WDXA 1VFMA 1ZTVA 5DS4A 2GWNA 2EPHA 1UJPA 3WBEA 4CS9C 3LEOA 3O39A 1ZJAA 3DZ1A 4KEVA 5KINA 3OU8A 3MCMA 5LXEA 3V5XA 3TULA 4AHPA 3BARA 1LROA 3BCFA 1RPKA 1YTKA 2R1LA 1OT2A 3L0GA 5GQBA 2NUWA 3MVTA 1MW2A 3ITFA 4S1FA 2Y3HA 1YADA 1XIJA 4AHQA 3L0KA 4GEHA 1Q2SA 2J7CA 4RW5A 1WASA 3LG3A 3L68A 4WRHA 2L6GA 4BEMJ 3RUBL 4GJJA 5K9CA 1XQLA 4IIDA 1G7VA 3DFPA 4JTQA 4AMCA 2KAUC 2QCHA 3A6OA 5A5WA 4N9DA 6XIAA 4HPNA 3U7VA 2CYDA 3WL1A 1SW3A 4PMVA 1NQ6A 4GYPC 1P0EA 4W8PA 4LCQA 5EMJA 1HKKA 1V08A 3PSVA 1DJHA 3LHWA 3VNDA 6PTDA 3HMCA 4AIUA 1G6CA 3N25A 1V6VA 3ZVHA 4DJEA 4E4UA 2X0HA 4O0ZA 2VOMA 2PDKA 2EPNA 4YU1A 2ZICA 5DXXA 4IQLA 2BL2A 5TD4A 5C9WA 3CQJA 4DXXA 2R6OA 1XM3A 3AYSA 3PG9A 5LGZA 1B3WA 1OCZC 3IGXA 4K37A 5HMFA 1C7TA 1E6PA 1AH4A 2J74A 2NQZA 2A1YA 2ZUNA 4AK9A 2VXNA 3NG3A 5EBAA 3WG6A 5EKYA 2XH4A 3FVDA 2RKXA 1UZ4A 3M07A 4UR7A 2YCJA 4HHMA 2QULA 4QEEA 4YTSA 3V7PA 3M41A 1R6WA 4AHOA 3SDOA 5G4HC 3MKCA 4BA0A 3CL7A 3UWVA 3OB8A 3CAXA 2J13A 3D3FA 3P0XA 4PMRA 4Q32A 4HP5A 5FL0A 4U4MA 4NAEA 2J9BA 2B0HA 3DM5A 2C7FA 1NOFA 5GVJA 4F2TA 1CGYA 3AXMA 4GNKB 1ZHZA 1LG2A 4GZJA 5FOOA 3RVYA 2WHJA 3BZGA 1UJQA 1GW9A 2W66A 1XPYA 2Z1VA 2C19A 2XLEA 4DBQA 3H21A 1LPEA 4NZ3A 5L0IA 3SRHA 1H09A 1JF5A 2GVEA 3VGEA 3WBXA 3BE7A 3WLLA 5DS6A 2VDGA 3O1NA 3S0CA 5AYIA 4JJGA 1PZ1A 2R1MA 4H54A 4TOQA 1MMGA 3L4ZA 3AG2C 3DOPA 1RJPA 3PUGA 1O66A 1XH0A 2XIBA 3IJ7A 4C90A 1AJ0A 3IJDA 3NGFA 3WF3A 3AMGA 3MP4A 4KC9A 3MANA 4UFMA 2Y62A 1DV7A 3WF4A 2V30A 4Q5SF 2HJ3A 1J0KA 1J6PA 2QIIA 5ECVA 1IWPA 2HROA 4KFPA 5CSYA 2A3BA 5AY7A 1EJSC 2ZZ2A 5KYYB 2BBFA 4LXFA 2CHNA 2PP3A 3VIHA 1BRLB 1UR3M 3OZMA 2DORA 4H01A 2XUCA 2OO0A 4PTVA 3AI0A 3MO4A 3VTRA 1ZW3A 5BROA 5L6UA 1C9DA 1Y5VA 3CLWA 4IMDA 3NQ7A 3GG1A 4ML9A 3WELA 4F2UA 3B8IA 1BR1A 1T8XA 3LEVA 3LPFA 2QTVA 4N4QA 1JNEA 4M24A 2QV5A 2BGNE 4JGDA 1QSPA 4HA0A 1WZAA 4AG0A 3AIBA 1FKWA 1WZLA 4Q8TA 1SZEA 3QW4B 1P7TA 1HF6A 4JEAA 2OEVA 5TAOA 2XSXA 3E9VA 4UTTC 2PNOA 3KDOA 3VAVA 5HWNA 4MF4A 1XD1A 3PTDA 3VDGA 2V26A 3ZJ7A 3IEEA 1ME8A 3TW9A 1X1NA 3ARTA 4IICA 3OOQA 1U30A 5C9ZA 2GA0A 3O10A 3AJ7A 3CL8A 2WBKA 1M7OA 2OZTA 4EWCA 3UPBA 1JUEA 4G78A 3K4AA 2DJXA 1QPUA 1AUSL 3F4WA 3I65A 5KZEA 3HG4A 4GK8A 3LBOA 3Q6MA 3AGUA 3VZZA 3BTNA 1KXTA 3B4UA 1U0BB 3P62A 4DRIB 3FJLA 3NL5A 3QPZA 1EFZA 2PGWA 5I6SA 3SUVA 4WGXA 4E2BA 4DLMA 2PMQA 2AQOA 4LJ3A 2BVDA 4LRTA 3HN3A 3NPUA 4MG4A 5D9NA 3ZIZA 4ZFMA 1W1A1 4XKYB 4OVXA 3K13A 2DW6A 3EWDA 1AODA 2G3FA 4JKVA 2VD8A 3WLKX 5BXSA 1OINA 2PDYA 4DM1A 5D02A 3O6XA 5HANA 3OGSA 4AB4A 2C16A 1E84A 2A1DD 4D6HA 2Y85A 3CU2A 4FEZA 5AHMA 3PPGA 4MYXA 1GT8A 2EPMX 3KFTA 4HA4A 1EJUC 2QCEA 3VDHA 5IHSA 4GIEA 3PAOA 4W93A 2CC0A 4BK9A 3DKAA 1QK2A 1IYXA 1WN0A 4EIYA 2O9PA 3NQFA 1VEPA 1SPQA 2C1HA 3PHF2 4M19A 2GFHA 1LKXA 1DKWA 2B0JA 4EXAA 2G3JA 1BBHA 2C79A 4LTSA 4UIOA 1QNRA 2ZXRA 1Q0KA 1MEHA 2PCEA 1U22A 2WPBA 3HQPA 3LNMA 3P60A 1AL8A 3W7LA 1T96A 1VFTA 3ZR6A 3LLXA 3CLMA 1MW1A 4Q4SA 2E4TA 3EKGA 4YT8A 3WUGA 4NTBA 4EX4A 1RVGA 2QUUA 2GAQA 2JKPA 4Z1DA 4MUZA 3HQ1A 1XLMA 3GO2A 4C6OA 1V74B 5HA7A 2R05A 2J27A 1M03A 2JFEX 2EO7A 2YCLA 3KOYA 1E0WA 4JHZA 2D69A 1TVPA 4LU0A 5A95A 4X0NA 1GQKA 2EEXA 3W01A 4H7ZA 5L0HA 1OYAA 4N6EA 2I9UA 3GWNA 2Q09A 2OX4A 1DQXA 4NF7A 3S2MA 1KXVA 1TIMA 4N42A 3RX4A 4Z0JA 4RBNA 3THQA 1KTCA 3L5LA 2LFFA 3SY1A 1DJNA 3ZJ8A 3FNDA 2WM1A 1YLVA 3AIQA 3T08A 1ECQA 1K7EA 4YYCA 3DENA 2DZSA 5AFDA 3FFSA 3TTEA 3EOOA 3KRUA 1EO5A 2P61A 1TPUA 1W5QA 1BG9A 1W2PA 4NNAA 1OCCC 1EH9A 3W22A 2YLGA 1MFUA 1N82A 4FAPB 4YJWA 1J8VA 3W85A 2ACSA 3GU2A 4NZ5A 3G1SA 5CC3A 1JVNA 2CBUA 1ZQ5A 2VM8A 2HXUA 3M0HA 3ECQA 3SGGA 1GVSA 3BWWA 2FB2A 3BLLA 1KGXA 1SZNA 2J75A 3BG9A 1EXPA 3KOZA 2VC7A 3WQWA 3GC4A 2XTKA 4JEQA 1XGDA 2F6XA 3T0CA 1K02A 1DPMA 3TCEA 5JVLA 1VMAA 4UCFA 4GABA 2VFDA 1W9PA 1IR2A 5LYRA 3KL5A 2ZZ1A 4MPKA 3RLUA 4MVAA 2NXIA 1XSIA 2CBJA 1LQAA 2FPVA 2XM0A 5FJRA 1NDVA 2V5CA 4MY8A 3BLOA 3NO1A 3PAJA 3WMCA 3KVMA 4MTVA 4YHGA 1LS1A 2D24A 1IXNA 4F2BA 4UTHA 4Z9JA 1A5OC 3W86A 4HPHA 1YDNA 1XWJA 1OK4A 5F2IA 1KWGA 4YT4A 2MNRA 3GHTA 4G9PA 1H7WA 3ZLGA 3RJXA 2X0YA 2R1KA 4BEUA 1QU4A 3VIGA 4TV6A 1ONXA 4FXFA 3ZM8A 2BFGA 3R10A 3MB9A 4GVHA 4O15A 2PDXA 1S5WA 3TWBA 1H6GA 2VJXA 3W73A 1ZAHA 2O92A 1YNPA 1D2KA 4EBBA 4JY8A 1OFRA 3A13A 3EX6A 3N14A 1KM3A 3C86A 4K68A 1X96A 1RK6A 3HPFA 4AY1A 1LI7A 1G01A 2C14A 1C8QA 5DMLA 2VDIA 3AALA 2ZVIA 1QPNA 2FZDA 2LQGA 1XSKA 3SO7A 5GJMA 5KYUA 4YWQA 3MVIA 1KFWA 2EG6A 2Q3OA 4W7UA 3VOJA 3UGOA 4QISA 3JT1A 1GQJA 2WJZA 1TELA 1PS9A 3N2ZB 2J7PD 2EXOA 1BRLA 4QG8A 4H9XA 2HWGA 3M5XA 5H91A 5KYYA 2ISWA 2X2GA 1QFEA 2FYMA 1UR2A 4JTUA 3QPYA 2YCLB 5E6YA 4E7ZA 2QMJA 2V5BA 2O56A 4ZOAA 4IL0A 1X6LA 1GQAA 2PDUA 1PKYA 1ISVA 3MUXA 2JKAA 4NG3A 2E9BA 1KR1A 3H2CA 1A41A 1G8XA 2HNHA 2OQLA 2NUPA 4K2SA 3ES7A 1RPXA 5HNUA 4WR3A 1KXHA 1FWAC 1X1ZA 1BF2A 1N55A 3E2QA 3H2EA 3V3WA 5EGYA 1O60A 1T6MA 3GW0A 1JGMA 3SEOA 4JR5A 4Q4OA 1VTMP 4KQNA 5CEWA 3AXIA 1S39A 3G0SA 3GTHA 3AHVA 3U0CA 3GR7A 2Q3RA 2PURA 3G1VA 4JFSA 1E51A 3EYPA 4Q4ZF 1MDRA 2BY1A 3VNKA 1NJJA 3WD1A 4B5SA 3WQ6A 1YTDA 4XX6A 1TB3A 3O06A 2XS8A 4MB1A 4J30B 4D4XA 2PDNA 2J7PA 4BG0A 4JDYA 1TKKA 1XRSA 4GCXA 3GTIA 2WNZA 1A0EA 3CHDA 2C15A 4BJ1A 1H5VA 4KEUA 4O52A 3ZWTA 2RDXA 3I7QA 3S6OA 3CO4A 3OBEA 3W7KA 2Z6JA 5DX7A 1H50A 4O7GA 1O68A 4Z1YA 3PCVA 1RJQA 3EDEA 3APYA 4ERGA 1KBBA 1QI5A 1WE5A 1EWEA 1WKDA 3GFXA 3GU9A 1HTIA 1KLYA 3MMTA 4MTOA 4V15A 2IPGA 4X9YA 1RP8A 2Y63A 2DGJA 3W23A 1H41A 2I14A 4FSAA 4HNOA 3EDKA 1XBXA 4MB4A 3P93A 1DHKA 2PBEA 3C0SA 4GQQA 3NXFA 2R03A 3V0TA 4FP1A 4QR6A 4S38A 2RJGA 2ZDSA 1CYGA 3M0JA 1H2JA 1TVLA 3LQGA 4MY9A 3WUBA 4HD5A 1AEPA 1VKFA 3SQMA 1Z42A 4CCEA 4MW3A 1JCMP 3V75A 3I68A 1FWEC 2ATSA 3C63A 1DJYA 2VCCA 6TIMA 2NQHA 3QV6A 1TE1A 4U5FE 2DZUA 2DT2A 3R0KA 3S9YA 2W4MA 3BQ6A 1JPIA 4GUIA 1Z32X 4ZEPA 3GH4A 2M64A 4ANJA 4WY0A 4DRHB 3R8GA 3QMKA 3N0TA 2NXHA 4ZE5A 2G97A 2WSRA 5AC5A 4GX9A 4L1XA 5CPQA 1Q7MA 3W1MA 3U5YA 4I1OB 4PBFA 1CGVA 4BHYA 3BXWA 5AYBA 1U5JA 4PJMA 1OFDA 3KLLA 5BQIA 1M7PA 1VFLA 4FIRA 5AECA 3N9SA 4HE8D 4A22A 1VOMA 3DYPA 1L6SA 3KPHA 3QRHA 3QTPA 4MWAD 2XIJA 4YVPA 3U6WA 3R11A 1UOKA 1YIXA 2R24A 1XD0A 5L0FA 2ASHA 3R13A 4ZODA 2V8ZA 9CGTA 4ZB5A 4H19A 5D92A 3DJUB 3MPGA 1C02A 3JYYA 1VLIA 1XIIA 1GG0A 1GONA 4H4KC 1EL3A 3AIVA 3P14A 1EHNA 3RO8A 3NPWA 3D5HA 1E9ZB 2J7BA 2PWGA 3LHZA 1KTNA 2QEZA 1PKNA 1WDWA 4JL1A 2W91A 1GW1A 2ZD9A 2CCRA 2OJED 3FDKA 4J3VA 1FOBA 1XR2A 1UA7A 5EFDA 4I1MA 1K05A 4LLEA 2OX1A 4F79A 2OEMA 4L4LA 2OLSA 4EWND 1M1BA 4LB4A 5FIPA 3P8IA 4O17A 3WUFA 4ZQNA 1XXXA 1RKCA 3FAWA 3GVWA 4PRWA 1X7IA 2QPXA 3BAKA 2PLCA 2F22A 2YL6A 4DXWA 3KVLA 4Y9AA 3SZ8A 5JT4A 1J93A 3W8HA 3UR8A 2P0OA 3TA9A 3RLGA 1RBOB 2NX9A 3LAYA 4D6JA 3R5EA 1UC4A 4ZO8A 3VOIA 4C6NA 2NV9A 1Q66A 1YX1A 2BOGX 4IGMA 2ZRWA 2VL4A 4JQ1A 5CPTA 3C8FA 4O8AA 4JN6A 1S05A 2H8AA 1O7AA 2E5DA 4ONSA 3NUKA 4BKNA 2Z2UA 1A50A 1UUMA 4JFVA 5I06A 1KFEA 5AZ1A 2XH0A 2WNNA 2GDVA 4IX0A 4D8AA 4UQBA 5CLTA 1C7SA 1A7DA 1MDLA 3W1TA 3WLJA 4YCPA 1PCXA 3G5EA 4FNSA 3S2NA 4E0HA 1G4TA 3G0UA 3QY6A 3GXFA 3VOGA 2GSEA 4ADTA 3TW7A 3W1RA 2VZSA 1OFBA 4IGHA 5FEZA 4O6YA 1GOKA 1OC7A 3U7BA 4A3QA 1QPOA 4NNBA 1T40A 4ZXOA 4UTTA 2YKKA 3CQ0A 4HNTA 1ZGDA 1EX5A 4KFNA 4HYWA 4R9XA 4POCA 1OW6A 1OQCA 3EMCA 2YA1A 3GAKA 4E8DA 4EE9A 2GGJA 4O1EA 3WH5A 2PGRA 1UWIA 2J7HA 1M2VB 3TQKA 4MWAC 3MTWA 1XISA 3AS2A 3IJLA 3U4AA 2X05A 1Z8AA 5GJPA 4UDVA 4EAMA 2ZBTA 2PDWA 4QJ4B 3TC3A 1E55A 1HP4A 1WXJA 3PTQA 3MWAA 5DMMA 3GBEA 2MHRA 4B3ZA 4FS9A 5K4ZA 1AQMA 3QH2A 4N06A 2P88A 3C56A 3DH7A 3MCNA 4L6RA 1J8YF 3C5QA 4QCEA 5BNKA 3WK2A 2J8TA 2CLEA 1ZL1A 1WP6A 2GQ8A 5IY5C 2CPUA 4R5EA 1TWCA 2TPSA 4KESA 1EGVA 5K0IA 1FXPA 2GYIA 3TR2A 2FPYA 4FAMA 1FQ0A 1UP3A 1FHVA 5F7UA 5I0DA 2Z28A 3BH4A 1F61A 1A0BA 2R7RA 3PBMA 1JYXA 4AMAA 1SW7A 3KDNA 2BMBA 4ZE4A 1B3OA 3E0VA 1JPJA 2YHSA 2XVNA 2DIJA 3HJEA 1ZBVA 2QUVA 4HMCA 2V3DA 2GSHA 3QTHA 5U7SA 5BU9A 3NDBB 2GOKA 3DI5A 3SAZA 1N8IA 1YARO 5FJJA 3DHDA 4UQ9A 1SR2A 5M1TA 4QNWA 4FIQA 4AC1X 2VEMA 2KW3C 5LNWA 3H8AA 6ENLA 4EF9A 3OHIA 5I02A 2KSFA 4JTCA 3C62A 4F66A 4JTRA 1BYAA 2VQTA 3ITTA 4I9JA 1HGWA 2XINA 4D6IA 1MNDA 4TQTA 3QPEA 3C8NA 4HYVA 1J2WA 1RCXB 1QNPA 4IB4A 3PK7A 3RDKA 2NX3A 1J9YA 5DCBA 3JSZA 3T6GB 2EPLX 3BAWA 5AOUA 3I6RA 3HPZA 3T81A 4W5ZA 4JIEA 2FMOA 1K77A 4S3EA 3VXGA 1R2SA 4H9MA 4AZHA 1HJVA 5F4WA 3THDA 2Q9BA 3TQOA 2GDUA 3MQTA 4DBRA 1OW7A 1NELA 1Z6AA 1CCWB 2NUTB 3KLKA 5LZLA 1FWJC 4H2HA 4U5HA 1R8LA 4LUSB 4PUJA 1KRMA 4RDZA 1E9LA 5XIAA 4TU1A 1DQWA 1EDTA 1XGZA 1QBAA 3IRSA 1DEDA 3D47A 2G3VA 2BGQA 5HOSA 3GVQA 5DF0A 4QE4A 3FKKA 4PGLA 1EWDA 1LLOA 4YIWA 4L61A 1S5VA 2XYLA 5G1TA 2I5GA 4L6OA 4DBDA 1BGGA 4CNNA 3WFZA 1D9EA 3MYPA 1HN1A 4AZCB 2CXGA 1UR8A 4Z42C 4ERAA 1JDEA 4GY1A 2WZEA 1A4LA 3GWLA 3IAPA 1OX6A 4OV4A 1OYBA 3HFTA 3MBFA 1H7XA 1KBJA 3CT2A 1OVDA 2E6DA 5F4XA 1VYKA 4QBXA 5CKSA 1MEWA 1HNYA 5C9RA 1UKQA 1BVWA 2ZUVA 3KCOA 4PTMA 3S5OA 2QKFA 1TQJA 3V5ZA 1A5MC 2HZGA 3DG7A 1QK0A 3QC0A 1E71M 1F76A 1UG6A 4GKTA 2P0IA 4PUNA 4P7OA 4HCLA 5B1AC 3M0ZA 1ORJA 3BDKA 1FCBA 5AYZA 1PHWA 4W9TA 1P0BA 3DM9B 1R30A 4JFUA 3WDQA 3OA5A 2ABBA 3T0AA 1TIWA 1WV2A 2HMCA 3HTWA 5D9PA 3BW2A 2YKZA 1V54C 1FWGC 4RNIA 4NI3A 3E49A 1K4GA 1VD6A 3SGZA 2VYOA 1JPNA 4R85A 3R94A 4J4KA 3K66A 4AVFA 1RD6A 4XLNF 5HQMA 2FLIA 1M01A 1K8YA 2J88A 4XTDA 5FJIA 2VTFA 3FAXA 3R2GA 4ER9A 5KYXB 3U3BA 4LUJA 3MMWA 3EMQA 1NY1A 3ZSSA 1LBLA 3W7RA 1JDDA 3W7NA 4U3AA 1B31A 1EO7A 2Z7GA 2Y2WA 3E70C 4KWOA 3UCQA 3A3XA 1S5NA 2PCQA 3S8HA 2YL5A 1W9UA 3MYIA 3V5CA 2OGJA 5KITA 5FJPA 2A3AA 2EBNA 2XVLA 2YBTA 4TMBA 2AL2B 3VO0A 2G3KA 2WLZA 1SYQA 3VUSA 5KYNA 3MMDA 1H7RA 2E40A 3DAFA 3ALGA 2IPJA 2NPUA 1LLZA 4LNYA 5I23A 1XFBA 3U2MA 3OG3A 2DZPA 2WCSA 2CLPA 2I16A 1LORA 2A3EA 2LSEA 5C7VA 4B2DA 2GUYA 1DJQA 4H8VA 1BXBA 4J7TA 3DC8A 3ZVRA 2AMGA 3GXPA 5M3WA 2Y61A 2OLHA 4XPYA 2DEPA 1UMYA 1HKWA 2HPIA 3TAOA 3VGGA 1TREA 3VC5A 1JQVA 1QHZA 3AHTA 3SN0A 4D6FA 3W87A 3PUEA 3MUAA 3WD4A 3RH3A 1LS4A 3SURA 2A7NA 5KYUB 3NQ8A 1MNSA 3TLLA 2DZBA 1L9WA 4JBRA 4BCEA 2QDGA 3DHUA 2IKHA 1F07A 1HKJA 1ZJHA 2VNCA 4D72A 1B1YA 2QIWA 3OBKA 5AB3A 4AFYA 4Q22A 2R7QA 3I7SA 1ELSA 3G50A 2YCKX 1ZHWA 2D20A 1FTXA 1CXHA 4OECA 4FK9A 3CZLA 4REQA 5HV9A 3EX1A 3AICA 4U5EE 3T78A 4DBWA 4LYRA 4FHAA 2REQA 4HTYA 2E8YA 3BW4A 4X22A 4AY7A 3GU1A 4G7ZF 3TOLA 4GUHA 3PTMA 5KZDA 2PFDA 3WZ0E 3V1PA 4C7OA 1KM5A 3LS0A 2PEVA 3F1QA 5ABTA 2FHCA 2BXZA 2P3EA 3VOCA 1YDIA 4DO6A 1X6UA 2W62A 4HIBA 3AUOA 1ZB5A 1V79A 3TJ5A 3CAVA 3RM8A 4LOCA 5H8PA 1DWHM 1FDJA 1XW8A 3H4WA 2BY0A 1H9TA 1UG7A 3OPSA 1XLFA 4UFHA 4O0QA 2NW0A 2IKIA 5GNXA 3KVKA 3QKEA 4B90A 3NGJA 5LIWX 1KNYA 4CDAA 1SZFA 3MYFA 3W1UA 1V6TA 5CSRA 1YTEA 3E5PA 1TZZA 1GVQA 1W9BM 4IGNA 4Q4QA 1FFHA 5L9FA 1T0OA 4LERA 1JCYA 2MUCA 3BSHA 3O3RA 4DJ9A 2DH2A 4IFRA 2PTYA 4XZHA 2QR6A 2W79A 2O7SA 2BP1A 3ITXA 3A11A 5B7YA 2X0CA 1IE7C 3E2SA 2LD6A 1Y6DA 4M63A 2O9RA 3L65A 4XZIA 3ARVA 1IWBA 4GI9A 1FWSA 3NYDA 3W3OA 3RN6A 3UT0A 3IIZA 4U28A 3VIFA 5DS5A 1YW1A 3IVSA 3NYZA 2AGTA 2LFDA 4BI6A 1F3XA 4XO7A 1RBLA 2VFEA 4W7VA 2GUBA 3N6HA 3FHDA 5EFFA 3MUCA 2F6KA 4UNLA 2ALRA 2FHFA 1THFD 1LYXA 1OKKD 4Q8UA 1UA3A 1TV3A 1J4EA 2PPGA 5AHEA 3WJSA 1B54A 4JTSA 3J7HA 3ABMC 4EF8A 3N2MA 2Z24A 2X7VA 1J5SA 1OFOA 3FX4A 4FXSA 4KWWA 5I09A 2D5RB 4F0LA 3UGRA 1Q0GA 3W07A 3W38A 3PP7A 4XVDA 1W3KA 4GUGA 2CW0F 1FCUA 1WZMA 2D3NA 3WO8A 3GR8A 5T1DB 4PRTA 3UU0A 3AQBA 3UNTA 1M53A 5CGTA 2D0FA 3R0UA 4LSBA 4ZLCA 1AMYA 2A21A 1ZY9A 3B9EA 1BZ4A 4ATWA 4EKWA 2DUAA 1S38A 2WVQA 1O5QA 2ZIDA 5DMNA 3HGJA 3G18A 4G7EA 2X1TA 1YYJA 2IPFA 5A2AA 3GC5A 3RRXA 4N6FA 3ZT7A 3LI0A 3C0JA 1RXOB 4AIOA 3AQUA 3OA1A 4N6HA 4KWSA 4UFIA 1ISWA 3OGVA 4RDVA 4KT2A 2WMIB 5GPGB 1DHPA 3Q6NA 2BOEX 2HUJA 7ENLA 4PSPA 3ATPA 3TQVA 5DCDA 5MF5A 2ISSA 1XLBA 3KZPA 5G5IA 1EP2A 1F4AA 1UKTA 4C65A 3S42A 4YN0B 5AN7A 3EGJA 1MZRA 3IV8A 3TN6A 5H1WA 2QQ6A 3IUDA 3C8GA 2TSYA 1T99A 3CWHA 3CXOA 3OYZA 4HPXA 1UBPC 2UY4A 1BG4A 1K9TA 3FS2A 2JGQA 2FGLA 4RNFA 3M6DA 2DQXA 3QW1A 3CQZA 1Q45A 2R7VA 3W1NA 2A0BA 4PH6A 2B7OA 3C2VA 2D23A 2GL5A 1XX1A 1CT5A 2EAWA 3WENA 2YIHA 3M4BA 2ACUA 1LE4A 2OO6A 1O4UA 5CLWA 2DSWA 1BSIA 1UUOA 3F03K 3AWNA 3UJ2A 3ABKC 3DFYA 1Y5XA 2HS8A 3WDPP 3WH8A 1VHNA 4NXSA 2HNEA 4ZO9A 1XBVA 1JZ2A 1I9CB 4PJLA 2WK2A 3QY7A 1E5JA 2OU4A 2CLHA 2OQYA 4WCJA 1QOXA 3K4WA 1C93A 2DZVA 2Z1XA 3LXAA 3C0QA 2AKMA 3CMFA 1SO3A 2Q01A 3PB0A 4B5VA 3CIVA 3NO3A 3T09A 4W4QA 2HVMA 4WJXA 4MJ4A 1XIDA 3IJQA 1VIZA 1S2VA 1T5AA 5HUOA 1M68A 2WJDA 3GH5A 4JIPA 4GYPA 3WJWA 4XD4A 1NWRA 2VEPA 3W00A 3W83A 2QGHA 4RDYA 2QJMA 2JEPA 1EC9A 3EA2A 1V7AA 1JAFA 1K04A 4LH8A 3INPA 3ONBA 4X61A 2YZRA 4K1WA 1Z89A 2VGFA 3FHQA 3N73A 1R9XA 1HP5A 4LLCA 3PMRA 1IT0A 4KERA 4M6PA 2OZ3A 4O50A 1TFOB 4AD1A 4QITA 5BMXA 1RBAA 5DXYA 4D6EA 1LG1A 1LWIA 2A7PA 1QW9A 3MWCA 3LM7A 1GGQA 1H1ZA 2CFFA 3VMPA 3B8UA 1ZW2A 3DYMA 3G8EA 1TA3B 3KX6A 1RR2A 2W9YA 4WDTA 3C2FA 3NSNA 5BZAA 3LLIA 1T6IA 1K40A 4ZTYA 1BLIA 2WL8A 3U5UA 3UYIA 3BMVA 3RQFA 2Y39A 3RM9A 3AS0A 3GNNA 4IGGA 4NKCA 1GS9A 1SVDA 2H7BA 7A3HA 1KA9F 2ICSA 2UY3A 3QV7A 1NP0A 4IP5A 3R4IA 3A12A 3C2YA 1GHSA 5A8NA 2W3ZA 4B2DD 1XIEA 2FFHA 3EZHA 1ZU5A 1AW5A 4MVQA 3QQ1A 5HPOA 3DAQA 3ARZA 2NVDA 3BAYA 3FJNA 4JTCB 3EOSA 3P3BA 5CC7A 3RF9A 1MQRA 2TMVP 4L80A 4MAVA 4L64A 1KCXA 2D22A 1UWUA 4GBDA 1UR9A 2BXYA 4C6PA 1E6NA 3QW3A 3C61A 2G4FA 1O94A 5AYXA 2WLYA 2PX0A 1OFPA 4XZBA 3YPIA 5ABEA 1B3ZA 2HQAA 1DWIM 1QWGA 1GOQA 2HRWA 4PCFA 4R7JA 3KUMA 4Q4PA 1E3ZA 1J01A 3IACA 4YTQA 1D0XA 2Q9AA 1EGMA 1BKSA 2PDMA 4X0VA 4L6HA 2XSEA 2BVYA 3B05A 1QNSA 4G1KA 2B31A 4GZIA 2NQLA 5DN1A 1Q63A 4DUVA 2YXGA 1BPLB 1FXQA 4ICNA 4L1GA 2DIEA 2XGZA 4YNGA 4DRJB 4DZIA 4JZ5A 4JTIA 2VVNA 2OCCC 3BJTA 4QLJA 4IUGA 3EFOB 3TNOA 4PTNA 3WNKA 1Q8AA 4LUTB 2V2HA 3EX3A 1IEWA 3C52A 4NX5A 1MUCA 4L5ZA 4PB4A 4RXFA 4IXXA 4WKFA 1PZ0A 2HEJA 4KS0A 2ZQ0A 4UTFA 1GORA 1KM1A 4FO4A 4AZCA 3O7UA 4DYKA 1EF3A 3FK4A 1EJRC 4UUIA 3A22A 4M51A 2FTPA 3DG3A 3MSDA 4NU7A 3H54A 1SSDA 3S2LA 4D8LA 3HTKC 4DIAA 3NQEA 2DV0A 4BJHA 2WC7A 2A79A 1IZKA 5EB8A 1EQCA 3UNDA 3DZAA 3FOPA 5GJNA 3V1HA 1W5OA 4CNUA 3ASOC 1I1XA 3AZSA 1H3GA 4HOXA 3THAA 5BCAA 2PU0A 5A8MA 2EG8A 3QW0A 1K8ZA 4NJHA 4CCCA 3NQMA 3OQ8A 3QZ6A 4YYFA 2GVJA 3QTGA 3I4UA 3ZQYA 2C1GA 3TK0A 2DYSC 4LVBA 4FALA 2J47A 3VNZA 5JU6A 3LRKA 4MADA 1XC4A 3QVQA 3WH7A 4DBUA 4OINF 4JTDA 1PTDA 3U9JA 4HNUA 1KFBA 2NT0A 3CWNA 3APGA 4ZSUA 3K2GA 5AKQA 2CZVA 3PZGA 4PJJA 1DIEA 4ADSA 5BXRA 3B9OA 1EYWA 3GEHA 2HBVA 1YPXA 1EJTC 2VZOA 1N7KA 5HNTA 3ENLA 4JTLA 4LFYA 4XBJA 4R9OA 1KKRA 1GPFA 1J6OA 1RY0A 3UVAA 3VKAA 1PXGA 5BWAA 2P1AA 4MHBA 3P5ZA 2NG1A 3S5ZA 3W7EA 3EBVA 3U2CA 1X39A 3HGOA 2OG2A 1EDQA 4WGYA 4E18A 1BVZA 4Q4MA 4CD7A 4LANA 4XKYA 1UWTA 1J79A 3N17A 1DIOA 3I4KA 4GBUA 3VNMA 4Z9IA 4GVGA 3GXNA 2RDUA 2QJJA 1REQA 4JEJA 3S27A 1B3XA 5E9AA 3L67A 3W75A 1TPFA 5CQ1A 1ZJIA 1Z69A 3E0IA 1K8CA 3T2QA 3K5XA 1OW8A 1I4NA 4UTLA 2O9XA 3O15A 4DO5A 1GYLA 3F4NA 1JJKA 3NQVA 4AYSA 3L4VA 2W27A 3QLLA 3MSGA 3MBGA 2J7GA 4J32B 1OC6A 4PEKA 3UWQA 1S7ZA 4QG9A 1LF1A 1YEYA 7XIMA 1EEXA 1FP8A 2P8BA 3W2UA 2WZFA 1RD5A 2FH6A 2W9MA 4NZCA 4PTXA 4J40A 3VC6A 2XRHA 3EPVA 4LYKA 1CLVA 3B97A 3JU2A 3UXDA 1I1WA 3LCFA 3ELFA 3KMIA 1PV8A 4DJDC 3CEXA 4C6MA 3WQVA 1NDYA 1TWIA 3IANA 2JK2A 4CVWA 4X0RA 2YA2A 1TX0A 4J2MA 4AC7C 3DE8A 2IKJA 1FVPA 1ZSXA 1LE2A 4DELA 4I9MA 1W54A 2VFHA 3X1OA 5BOFA 4ZB2A 2H9AA 1AVOB 1ZZPA 2EPKX 3FV9A 3EJNA 4MS2A 3LSBA 2D0HA 1PB0A 3PFRA 1OSEA 2YL7A 1UROA 3FIGA 4YK5A 5CCZA 4Q7IA 1V6XA 4OBTA 4H3DA 3BGGA 4C6FA 4S2BA 3CV6A 4MQ9F 1BXNA 1W37A 2HK0A 4HZ8A 4C7GA 5C2CA 3OIXA 4REQB 3N2XA 4KCTA 2DZAA 4QTGA 4DXVA 1WOAA 3CT7A 3UBPC 4LQ1A 3T4CA 4LVGA 4Y7EA 4XZMX 3H23A 3B3DA 1ICPA 4XQ1A 3W7OA 1UR4A 2E77A 2ON3A 3SW6A 4LF1A 3DJNB 3W53A 4IF2A 3B0VC 2V67A 1TJRA 1ONEA 1QNQA 3SFWA 3DGRA 1MZHA 1ADSA 3G1DA 3UPMA 1GZGA 3MUZ1 3IIXA 1QW8A 1VB9A 3FEMA 1UOZA 4PYSA 3Q37A 3UVIA 2OEKA 4JURI 3V0SA 2KC3A 2KX9A 3LHUA 4M1RA 2W5FA 3WQ5A 4E8GA 2PRHA 1EJWC 5IBXC 4YMZA 4OFCA 5HMDA 1PKMA 1PX3A 3GC2A 2EINC 3LY0A 2QMKA 1W5MA 2YZ5A 2DDXA 2G41A 2ISFA 4M80A 1W3HA 3AYVA 4Y9OA 2A68F 3UG3A 1J0JA 1VLWA 1W1IE 3QR3A 2H7OA 3TVAA 5LNRA 4UQDA 4Q8PA 2TMDA 1H1YA 1MEIA 1DVJA 3ZSTA 3GIYA 3R58A 4MZ1A 1V6YA 1Y5WA 3B40A 3TUUA 3ZWIA 3M5ZA 1V3HA 1W0MA 3VD5A 3SIZA 4G7OF 4FF5A 4IL2A 1SSGA 5BUOA 4CS8A 1ZENA 2YB1A 5A6MA 2E6AA 2RDWA 1P0NA 5LXXA 4O28A 5HQLA 3DAGA 4P7LA 4LVAA 3TP4A 3PDMP 3B0PA 3EWZA 1WDRA 3VFCA 3I5QA 3GANA 2JBMA 3UMIA 2P5NA 3ANUA 3KOWA 3ZR4A 3T44A 9RUBA 4OKDA 3W6YA 2WWDA 3TFCA 2E3ZA 2G37A 4KEMA 3GM1A 1ONWA 1VAHA 3AGTA 1T9KA 4QFUA 1E6RA 2OJQA 2GZXA 5HATA 4OOZA 1Q0MA 3LCHA 1LWJA 4QNEA 4TV5A 4CU8A 1XQKA 2VOTA 1QPQA 2Q02A 1MSSA 3IARA 1LQ0A 2OSWA 4JRZA 3O9NA 3SXMA 1CXEA 2QCMA 5KEZA 3ABQA 1Q2RA 3WD0A 1O1HA 3UJFA 4FPSA 1IWAA 1QHOA 3A4AA 2PDQA 5IBXA 2A6NA 3P0WA 3W81A 2ZXOA 1UH3A 1R2TA 3W2NA 4PMZA 3LNRA 3TN5A 2WVSA 3BJFA 1OX5A 2OPJA 1QBBA 1I45A 4DVZA 5C6MA 1ESWA 2PP1A 3RU8X 4AZ6A 4DZAA 1WOBA 2R7WA 1XFCA 2G5WA 4MPQA 3OP2A 4NRSA 3K1DA 4UBPC 2RHGA 4LPCA 3EAUA 1E6QM 4JIQA 3LSCA 4UZUA 3P5YA 1A49A 1U1HA 3PHAA 1EOMA 4JHMA 3PJTA 1S2CA 1BVNP 3NYMA 1FHLA 1T01A 3UQNA 2ZUTA 3PULA 2L81A 1ZAJA 1TVNA 2DFAA 2XL6A 4ZGYA 3AZRA 3QSTA 3M15A 4JNZA 1XLEA 2V6AA 3PWAA 4QGCA 4F0HA 1TCMA 3NTYA 5I00A 3PZ9A 3F7JA 4J7YA 4D6CA 1Q6RA 2FVLA 2TRSA 4X63A 4GI8A 1H49A 2Z7KA 3C0LA 1EA0A 3UJRA 1C92A 2ZRVA 4P9TA 1E6ZA 5T9BG 3OVGA 4G6CA 1Y0EA 5DQZA 3ITVA 2NUPB 3EKLA 2BZNA 3SY5A 1HX0A 4H8HA 2ZZ5A 4NZFA 1A80A 4QQ3A 4XEKA 4NTAA 1IEQA 2WW5A 1WO2A 3GNXA 1XLGA 4EVZA 2A7RA 4PE8A 1Z3NA 3IRDA 2Q8XA 1JD7A 1TG7A 2JD3A 5G4WA 4W88A 1VHCA 2QV4A 2XS1A 2OU6A 5EA9A 3EDDA 1EP3A 2NXGA 2V38A 3E2RA 3W25A 2EG7A 1HW6A 4UR8A 3BV7A 3HNIA 1IQ8A 1K1DA 1KCLA 3QQ0A 4DN1A 4OD4A 1PDZA 4CNPA 4M5PA 2I56A 3EWYA 4QLLA 4G8TA 4BJ6A 4OZOA 5DVWA 1PDYA 5I2UA 1ITXA 1A7EA 3VCRA 1F1MA 1Q8JA 2ACRA 4Y9PA 4AISA 1TWWA 2GWWA 2UUIA 2V3GA 4U31A 1X97A 1EA8A 5GNZA 4H1ZA 3PBWA 1NLXA 3TAKA 5DBTA 3L34A 1CWYA 4HGXA 4NYUA 3OZOA 4HOZA 1RK5A 4DUWA 5E33A 1KB3A 1TPVA 4FLOA 4TTUA 1XZQA 1TWGA 5IOBA 1P1MA 2E9LA 1UFBA 3W76A 1B2YA 2XFFA 2FZ9A 1C8YA 3C2EA 1Y8BA 2FTWA 5A8QA 4GISA 3NCOA 2X0SA 1LBFA 3JYHA 3UCDA 2DSVA 4AD2A 3VIIA 3BZJA 1Q6LA 2D4UA 2WWCA 4IARA 3HKKA 3H7RA 5DT5A 2GFTA 4C7OB 3RCNA 2E09A 4WEVX 4Z9HA 4MLJA 2UBPC 3FKRA 4W8BA 1JZ4A 1B0IA 3C8GB 1IXOA 3NL6A 3ABXA 2DZXA 1SZGA 4NRRA 4DJFC 4AZ5A 1SR0A 1JCTA 4H9ZA 1PUDA 3Q7GA 4QRNA 3NJ3A 8TIMA 4JTAB 2O9TA 4EHPA 4CN6A 4UOZA 2R7TA 3W37A 2WSPA 3NZRA 2VKZG 2OODA 3U9MA 1CPUA 4GYTA 3FYYA 1M65A 3RLVA 3WUEA 3THUA 2IXPA 4WSKA 4CCDA 5KYWB 1YHTA 5MHBA 3TJIA 4OIPF 4A4AA 4AH7A 1KGUA 2OGYA 3VIKA 5JQ9A 3G1YA 1Q6GA 2DZWA 3US6A 2D0GA 2CLFA 1VYSX 3ARQA 5FF4A 4IPNB 1PZ3A 1NOUA 3W29A 1Q6CA 4LB3A 4S3CA 4Z0SA 4FX7A 5DY3A 4MNDA 1GOWA 3LXCA 2H8ZA 2HZ8A 1V03A 5D4YA 4ACYA 3TC7A 4MNKA 2VR4A 1J0IA 3GAYA 4HU8A 4CDVA 4FX5A 4DWDA 1RJRA 1CNVA 1NARA 1XIHA 3TYUA 2WYSA 4YTUA 4E38A 3KTSA 3GZAA 4PMOA 2QHAA 4U9DA 1J2BA 3CMGA 3IPMO 1B30A 4NVTA 3OA3A 2B4GA 3POVA 4IIGA 3GTFA 1ZU8A 3B0XA 4JNYA 3NO5A 2KZHA 4LUTA 1AD1A 1UD8A 2Y70A 3HG5A 2RSEB 2A4AA 3RHGA 5HBFA 3PF3A 1TPH1 4NHVA 2V9DA 4CIHA 1XYMA 1F6PA 3S0XA 1KW1A 2QCDA 3KEHA 1PHQA 3DKJA 4J9JA 4NZJA 1ME9A 1E0UA 1R46A 3H53A 3KE0A 1V3JA 4N9CA 4UNIA 4KMQA 2CEQA 3O63A 3MUY1 2E68A 1L6GA 1JYNA 1VRDA 1S1RA 2E28A 2EKGA 4BWLA 5CPOA 2Z4GA 3QGKC 1WX0A 3TOYA 2D73A 1PIGA 4X60A 4EK7A 3CZJA 1W3TA 1I6NA 4LAKA 3TKFA 1R3VA 1VF8A 4CKQA 3B0UX 5M5DA 2PE4A 3T4WA 1KV5A 5COMA 1UMLA 1KXQA 4I9AA 5FCZA 4NP7A 3WNMA 3MA8A 2WVOA 3BC9A 4FOKA 1XYBA 3M0IA 1X6NA 5D9OA 2VB6A 4DJED 2XFYA 1E4MM 1BGAA 1NP2A 3NDZA 1WGWA 2NSGA 4E17A 3VMOA 2IMRA 3R89A 5LIXX 2OEXA 2Y89A 5L0JA 3U2OA 2IQTA 4RNJA 1DOSA 1LT8A 3B9DA 1ZHXA 3TCSA 2A3CA 3NIYA 2BTMA 3GY1A 2YCIX 1R3YA 2B7NA 3SUTA 4MOZA 5LA1A 2G4JA 3WHNA 3F5KA 2BVTA 3OLGA 3LMZA 3W28A 2QJHA 1LUCA 3EFOA 4EBKA 1VYRA 3A4JA 2HISA 5ABFA 4ICCX 3A9IA 4O1AA 4LAZA 3EDJA 2HE8A 4BEJA 4A2SA 2LCHA 2DT3A 3KHJA 5C71A 4RV8A 1DIDA 3AXXA 3GFZA 3NVTA 1JI1A 2WB5A 3W2LA 2NUTA 1AL7A 5IDZA 4FWVA 3O6CA 1R47A 3U48A 1W31A 2PU1A 1VYIA 1SF8A 3HG2A 1JF6A 1QO5A 3II1A 1X1OA 3E0WA 2X40A 4WX2A 5CJNA 1MMDA 2A85A 1A53A 1DYSA 2MYSA 4Q8VA 1Q6QA 3S6TA 4ROQA 5C54A 1TTQA 3UZWA 2FGYA 1H7PA 3WNNA 2KGOA 2VURA 3LEPA 2V5KA 3K8MA 1UZ1A 3AOUA 5HJYA 4W7WA 3N6QA 3IK4A 4LUIA 4JX4A 1FR0A 1ST6A 1VB5A 5FEXA 4JAWA 3UWEA 2XLDA 4NJKA 1B9BA 1VZWA 3V5YA 3BG3A 5E93A 1E15A 1K9DA 3WAQA 2TODA 1NWSA 3QM3A 2A6LA 1S2TA 4D9PA 5D04C 1LBMA 4H4IA 2Z2BA 3CMJA 5ECUA 1OCRC 4P61A 3G1HA 3EH1A 2UY5A 5G1MA 2PC4A 1O6IA 2R25A 2AQWA 3N2CA 1WKFA 3CH9A 3RF3A 1FY6A 1J0ZA 3ICJA 3P6LA 1PO9A 3GIPA 4DY1A 3A23A 3WDJA 1NEYA 4QSHA 4A6GA 3M0YA 4PMJA 3TLQA 2I7GA 3M6YA 2XLMA 2C91A 3WQGA 4Q6XA 3GDBA 4B92A 1EA9C 5LA2A 4IX2A 3P67A 5JSLA 4Q8WA 2CHOA 4F0KA 1WDDA 3G0XA 3NQGA 3R6IA 3NKEA 3QEZA 1AH3A 3B0YA 1HO4A 4O1BA 3KRBA 3U8GA 1TPEA 4BJ5A 4QI0A 4TX9A 3CEPA 3A21A 1OD0A 3LU2A 4QJ1A 1ZUAX 1MQQA 3TXZA 1V02A 3OIHA 4CX9A 2ZRZA 4XQ6A 1M56C 2ZCGA 1E43A 4GY7A 3T1GA 4X2RA 2J0XA 2F6UA 5C2GA 1TJ0A 3ANYA 4MNMA 1AH0A 4IFKB 5CZTA 5HPCA 4YS1A 2P53A 1CBGA 4MWAB 5CBIA 3AISA 1Q85A 2QYGA 1XPGA 3WNLA 4EIVA 1ICQA 5D2WA 1B3YA 3RKOF 4Q7BA 4JTGA 1Z3IX 4R88A 5FD0A 2AAAA 4M6QA 1A5AA 1V3IA 2G96A 3KWSA 1SZIA 5T26A 3PN8A 2FHBA 4O8RA 1NF0A 4IQJA 2CLMA 1D8CA 3QSRA 1IEXA 3CSKA 4RLIA 1RVKA 1RA0A 2WQDA 3U5SA 4I8YA 1OCBA 2GGHA 3T6BA 2P76A 2GK1B 4Z2GA 3T0DA 4PBGA 4O4WA 4GKLA 4W5UA 4LDRA 5DBUA 3W6LA 4AVOA 1UH4A 1G94A 1E83A 2WB7A 5TQLA 3NPXA 5E5CA 3QVYA 1JRAA 1TA3A 3CUJA 3H2NA 3W2KA 1P48A 3W7QA 3LS9A 1GOOA 3W1XA 1SUXA 1I2RA 5FACA 8XIAA 3BW3A 5TBOA 2HK1A 2PWDA 4J3ZA 2YL3A 2YBVA 3HQOA 3NEHA 2Q8ZA 1XLKA 1CX9A 2RJHA 2NLYA 3NR0A 3NOYA 1S1PA 4KCVA 4GO9A 1JGIA 1ZALA 3V4BA 1U33A 1A7VA 1Q7QA 2QXWA 1DXEA 1XYCA 3VD4A 1ZS2A 2VRKA 5D9MA 2AAMA 4HZMA 1R87A 3LNPA 2F84A 4B3LA 4O53A 1R38A 4Z2LA 4CDYA 1XIFA 4RE2A 3HNKA 3CAKA 4UFLA 4PA8A 4EOUA 2YPIA 5AC7A 2Z6IA 1P5BA 1TR1A 1JRBA 1JULA 4K38A 3W7IA 3S9OA 4XZ9A 4JJFA 1XL9A 1KBKA 1JUBA 2OZ0A 4MGGA 1V93A 1R0MA 3TQ0A 5K9XA 3GKAA 1SJCA 4JTDB 3UWZA 4G5DA 3T9OA 3S1VA 2XZ7A 2PB1A 4H83A 4KETA 3PUOA 3RM4A 3VGFA 1J5TA 1UIOA 4XUGA 4CQDA 1W1B1 3FA4A 2Z00A 2OMAA 3GSMA 1HJQA 3CNYA 1OEPA 3EOEA 1E85A 1A5NC 3MSRA 5TNVA 5DQPA 3G1AA 1FWCC 3ERPA 1P6CA 1K3UA 4HKPA 4I5RA 3NMKA 2ZE3A 4CN1A 5KMYA 3NPVA 1UD5A 4ZB0A 1Q6OA 1JUKA 3BL3A 1EZ2A 4A2NB 1CLXA 1DXIA 2PF0A 2VH3A 2VEIA 2VRQA 3WLHA 2QCCA 1V3LA 2X8RA 4B5WA 3ZLHA 4M3PA 2X09A 4ECLA 3QMSA 1F3WA 2ADAA 3NYLA 4PEEA 4UZSA 2PX3A 2HE5A 1JYWA 4AZ7A 1DOVA 1G0CA 4CS8C 1DBTA 1CENA 3M7SA 1Z7AA 3TSBA 4U2ZA 3W24A 1G5ZA 2QW5A 4ZSTA 4WY0B 5KZ6A 5U4NA 1WBHA 3T6JA 3TV8A 2OVLA 2GVYA 3RRAA 2I9EA 4KIEA 1UWSA 4QE5A 2PP4A 4L9YA 4GVIA 1W3JA 2XH2A 2DSKA 3TK7A 3U8PA 4A29A 3IS4A 4ZOCA 1TQGA 1JCLA 4BJ5C 1S3TC 1XRVA 2RH9A 3PBYA 4NSBA 4GGHA 4M56A 1O5HA 5IFPA 1YVIA 4WJEA 3W7MA 4OTKA 4IMAA 3EB4A 1BYBA 3VDBA 4PSRA 2FMNA 1UZDA 2BVWA 5DMYA 4XPWA 3ISIX 3N15A 3TOPA 3NA8A 4QG6A 1JD9A 1HQTA 4PCTA 2BE5F 4GMEA 3RIKA 4XD5A 5FAGA 1Q5MA 2F8QA 3EA3A 3W0KA 4FNUA 4JEBA 1GVOA 1P0DA 4C60A 4NY2A 2JF7A 1US2A 1PZ2A 3E5BA 1KGWA 5BMWA 4XO6A 5FF7A 4NAEB 2Z15A 1MWOA 8CGTA 1UHVA 1DORA 5HJLA 5D05A 1R5ID 3WLTA 4R32A 2YDAA 3WK0A 2FQIA 4QDLA 3MYOA 1AA1B 4XG1A 5A3HA 1UQZA 8RUCA 4URIA 5F2MA 4IJBA 2PZNA 1IIHA 4A8LA 4ACZB 3NAVA 4Q3MA 4AWUA 3MKKA 2J0WA 2XM4A 1TMHA 2BOFX 4Y9NA 1Q6FA 3FDQA 3DKLA 3LXBA 1ZBWA 3PPCA 1NWTA 5I24A 5DEZA 1CDGA 1M57C 1LWHA 4D1IA 1D3HA 4H8UA 3OGRA 4DNHA 2JIEA 4JL2A 5AYYA 3IQCA 4XIMA 5D03A 3GVRA 4IWBA 1OADA 4MIMA 5A2CA 5B3SC 2ATMA 1JXJA 3SCSA 1CGUA 3QMRA 1ZAIA 3CV2A 4EPDC 4NTFA 3B03A 3K1IA 3QR0A 4KGLA 3UZJA 1O5RA 3V18A 5FA5A 1QRQA 1BTCA 1YBQA 2RUSA 1TUXA 4IJRA 3AMDA 3MHFA 4JYDA 4HSOA 1W9XA 4O1CA 5IHRA 1OIMA 4JFWA 4J2PA 3AWOA 4PL1A 4DBEA 3Q58A 4YWIA 1EPXA 4DO7A 3VKCA 4FLRA 1VJSA 3GNOA 2W67A 3C18A 3CTTA 1RXQA 2WO5A 1VENA 4Q33A 3KVJA 3VRCA 4Y90A 1ITUA 4XB3A 3L7RA 1C90A 4FOUA 2Y4SA 3K1GA 1YJGA 1A5SA 1DWGM 4K7VA 1RMVA 4WLCA 3HURA 1JZ5A 2E1WA 3VKBA 3MZ2A 3ZIBA 4UMBA 1OXKA 1B4KA 3KBMA 4CNOA 3WNPA 3HOJA 1XLAA 2GDCA 2B81A 4ZXLA 3GTNA 2OKOA 3GR4A 2NSXA 3TNBA 4C6QA 4AEFA 1W5NA 1RCOB 1LOLA 1LRTA 2QCGA 1SU5A 5GPRA 1FFQA 3MKVA 5CJMA 1ISZA 1RV8A 3QVZA 1JPDX 2NV1A 2ISVA 2PRLA 2MWQA 4LAMA 3CH0A 3A4WA 4PMQA 4NQFA 1GHRA 1QMLA 3B9AA 2UUHA 3BSMA 1XJBA 4PUEA 1IXPA 4G2DA 3MUIA 1KM6A 2DUXA 3FOOA 8XIMA 4JYFA 3NMIA 3KP0A 3STFA 3LCLA 5FSEC 3NMJA 2HBXA 1KRCC 3T7VA 5H2ZA 1IGWA 2P7VA 4M6VA 3VIPA 2E0PA 5HNNA 1R3QA 5LSMA 2WKLA 5E3AA 2V82A 1X98A 3QF0A 3BICA 3CHCA 1Q6EA 3VGDA 3CASA 3MI2A 5JIPA 2P0NA 1MNEA 2IKGA 1U5HA 4WXZA 3FSUA 3CC1A 2PTXA 2LP4A 5M03A 4NC3A 3BV4A 1Q13A 3W7DA 3BMXA 3ATYA 2CGEA 2VC6A 1WPCA 3PZMA 2JE8A 5BXTA 1D1AA 1XCFA 2XU2A 3KYIA 1ODZA 3LGDA 5M17A 3DU0A 1XLDA 2YFNA 4I8DA 4WXYA