1OR2A

Apolipoprotein e3 (apoe3) truncation mutant 165
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
130
Chain Sequence
b'GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN E
publication title Conformational flexibility in the apolipoprotein E amino-terminal domain structure determined from three new crystal forms: implications for lipid binding.
pubmed rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 47
structure length 130
sequence length 141
ec nomenclature
pdb deposition date 1999-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1or2A00
1B68A 1EA8A 1NFNA 1H7IA 1LS4A 2KC3A 1OR2A 1AEPA 1LE2A 1OR3A 1BZ4A 3R2PA 1YA9A 1EQ1A 3S84A 1GS9A 1LPEA 1LE4A 1NFOA
chains in the Genus database with same CATH superfamily
2J9UA 3ASOC 1K05A 4XEFA 1OW8A 4Z9JA 1ZHWA 3G4ZA 1EKYA 4IB4A 1CPQA 1E2XA 4N4WA 5AC4A 3S29A 2OEXA 2LFDA 1JOGA 4N6CA 3RQFA 5EHHA 3OA1A 2WZFA 3U0CA 1FMWA 3HJCA 4BG0A 1M57C 2W4MA 4RBNA 4YL3A 4BJ5A 4NTAA 4MVRA 4U9EA 3R2PA 2J9WA 3Q7GA 3EG9B 4BPMA 1FMVA 2Q3TA 3ZQYA 3U3FA 4YT4A 2L6GA 1H9GA 5KYYA 3EZHA 3DE9A 1OCCC 3DWWA 3NKDA 3T6GB 1JAFA 4JKVA 3B9QA 3DKAA 3DXJF 4NQFA 3RQEA 3EGDA 4E7ZA 2HZ8A 4JCZA 1M56C 3I4UA 3N24A 1WTYA 3DJUB 4C3DA 2HV6A 2IXMA 2L9JA 2A6HF 2PNOA 3NG1A 4NC3A 2KC3A 3UR3C 1FTSA 1HW2A 1L3PA 5HSWA 3M1CB 3C63A 2DGJA 4HFKB 2R7QA 3M79A 5D92A 2CGEA 2YL1A 3LS0A 5GPGB 2R7RA 1ZU4A 1JR8A 5B1BC 4E0IA 3R7CA 4FX5A 2H7BA 4Z9HA 4FWVA 3NYJA 4BEMJ 3GANA 1HY5A 1RKEB 1YDIA 5T3TA 2PP4A 1BR1A 1YYJA 2WZLA 4U9DA 4LERA 4BJ6A 2NUPA 3S90A 2A68F 4LDKA 2YKZA 2HSBA 2FFHA 3MYFA 3H2UA 2L6HA 5KYUA 1VYKA 2HUJA 3F46A 4CS9A 3WAQA 4HE8D 1H7IA 2VB6A 2ZD9A 2FAPB 1DOWA 3BRJA 4JW1A 3RIPA 5COMA 2R02A 4G78A 1CPRA 3K1HA 2LQGA 1KTMA 4N06A 3B0VC 5A6JA 4NTBA 3OEOA 1T01A 4XQ1A 3M15A 2BE5F 2PBEA 1Y4CA 5K0IA 1TQGA 2EPNA 4MVUA 2UUHA 3VM6A 4D4NA 5DLJA 3I5PA 1SF8A 3A9CA 4DRJB 2PFDA 2AP3A 2XM0A 3S84A 2DB4A 3AG1C 1T5OA 1EQ1A 4AL0A 3B0PA 3GODA 4O7GA 4MVMA 3K66A 4E17A 3QZCA 3RW0A 5JS5A 1B68A 3M4BA 1AUEA 3QTHA 4YJWA 5B3IA 3EH2A 4DXWA 2R25A 4HEAJ 4PR9A 1LS4A 1NZEA 4DRHB 3AGTA 4DOZA 1V55C 1LM3B 1TFOB 5CI8A 2HMZA 1S05A 4B6IA 3S0XA 3CEXA 1S7ZA 3RKOF 4MS2A 1CGNA 1L7CA 1ZHXA 3C8ZA 4CDAA 1Q0KA 2PF4E 1MMGA 1OKKD 3U8PA 3ZSUA 2XXAA 1WN0A 2EIMC 1GQAA 3K1IC 3ZIBA 3GEHA 1XZPA 3K7DA 2J0XA 3I5QA 4YT5A 2Y3HA 3U2LA 4I1MA 2OJQA 4O6YA 2GWWA 3L8IA 3ECSA 3C7JA 5E3CA 4AE4A 1G5ZA 3QW1A 2Y3BA 1FR0A 2X51A 1WWPA 5T1DB 4JZAA 1YLMA 1WATA 4JTAB 1V4AA 4FAPB 4U5FE 3FOPA 4MVSA 3DZAA 3EFOB 1IZMA 3T6BA 1A7DA 2GAQA 1FAPB 3ZWIA 2VCBA 2GDCA 2WVNA 3L8JA 4H4KC 2HS5A 1NLXA 4JE9A 4WGYA 5BQHA 1BDJB 2HSQA 4EBKA 1YZCA 1RKCA 3S28A 3TQOA 2A1DD 1NU7D 3QMKA 4IJJA 4PJLA 2HJ3A 5KYWB 1RJ9A 3HKKA 3GM3A 2P61A 2EIJC 3F47A 1TR2A 1VB5A 2QNLA 3ITFA 1ZW3A 4G7ZF 1RMVA 2KGOA 4EHPA 2XLMA 1Z3IX 1SMYF 1NSGB 2OU6A 4OINF 3H65A 3JRMO 4NCQA 1CGOA 4DRIB 1O3UA 2LK4A 4P9TA 1NBBA 2AVKA 3EGXB 2X0CA 4EIYA 3UMIA 1ZU5A 4MTFA 2RD9A 3Q6MA 4YT2A 1ORSC 5DS6A 4DBQA 1LI7A 3LESA 4KNVA 3RH3A 4ULWA 2Y3GA 2J7PA 4IWBA 2Q7RA 4PACA 3IEEA 3ZG1A 1JPJA 4K7BA 4L6RA 4XEKA 3E70C 3SXKA 1VMAA 5JUAA 3NYMA 1VK5A 1YA7O 4QDLA 4K1OA 3QW0A 2RSEB 3V5ZA 2Y3DA 2EPLX 2O9XA 2QLAA 5A6KA 1ORYA 1QPUA 2CDQA 2YRFA 4YL1A 2HKVA 2YL3A 3M4CA 2HV7A 3JRTA 5E33A 4OIQF 1MNEA 1Y6DA 2XLOA 3ZQVA 3POVA 1WASA 4C3BA 3KPHA 1M2VA 2OEVA 1Z7Qc 3RVYA 1C17M 3JYYA 4CJOA 2VH3A 4JEBA 4U5CE 1ZHTA 4E0HA 2OCCC 2R03A 3GM1A 1OW7A 4CS8C 1NU9C 2F22A 5JP7A 4XPYA 3V7OA 2W4BA 3W2VA 5BUOA 1K40A 4U5EE 3UMHA 2WVQA 1VOMA 1BBHA 2EPMX 4I1OB 1YVIA 4IARA 1XZQA 1PCXA 3V5YA 3ABMC 3QVZA 3WHNA 3SXZA 4AL1A 4ANJA 2WZGA 256BA 4FESA 4CDVA 2IYLD 1WOLA 3TJ6A 1D0YA 3PCVA 3EJNA 4ZLCA 3HNKA 3K33A 1F1MA 5AC5A 5L0HA 2FGYA 2AU5A 2NUTB 2EIKC 5JT4A 1OR3A 4UDVA 2JPUA 3NKEA 5A69A 2XL4A 2NG1A 3N2ZB 2TMVP 3IHUA 2KK1A 1A0BA 2Q9BA 3U3BA 3X1OA 4YT8A 1J8YF 4J30B 3TOMA 4XLNF 5FZTA 2YWAA 4JTCB 3ZDLA 1YZAA 3K6BA 1UFBA 4G0HA 1JPNA 3AQBA 1RCPA 1LIHA 4NY3A 3VYWA 3NMKA 3AG3C 5COGA 1VTMP 3SZRA 1Q0MA 1VYIA 2B0HA 3LEVA 2R7XA 1QZXA 3J06A 2D5RB 4C7OA 4XLPF 1OCZC 2V3CC 1OCRC 3NMIA 4EUKB 1APCA 4PFPA 5F5FA 3C18A 4M63A 5L3QA 4CJGA 3JSEO 3H2VA 2VASA 2B0JA 4JTDB 1LI5A 3TD7A 3X2QC 3LUTB 3HLZA 2CW0F 4WGZA 5B3SC 1ZVZA 2YL7A 2G3KA 4OD5A 1A7VA 2XLEA 4KC9A 3IPMO 1ST6A 1H6GA 4LDQA 5A6BD 1W2WA 1J8MF 1PV3A 3TULA 2H7VC 3QVYA 4CIPA 2Q00A 4OD4A 2CNWD 1RJ9B 2XLWA 1TWHA 4JVSA 2J8WA 1C03A 2IXPA 4O6MA 5L0JA 1EA8A 2XLDA 3SP1A 5A6BA 3EG9A 4DJ9A 1M6TA 2A0BA 3SXYA 1QKRA 4LDRA 3U2MA 2G62A 3FAPB 2CNWA 4LACB 2XS1A 2HJMA 1LE2A 1KU2A 2CYDA 1A41A 5T3WA 1E86A 4EBBA 1DOVA 4CSAC 3U9MA 1ZYRF 3K1IA 4G7OF 1GM5A 3CZ6A 2JD3A 4OIRF 2AWYA 3RYLA 1TKNA 1D0XA 2W45A 1N1CA 3KKBA 3LLIA 3W2WA 3RF3A 2P7VA 4O6NA 2PX3A 3KYJA 5L0FA 2R7OA 3U9JA 2AWCA 2V26A 1HE9A 4YN0B 4EWCA 3RVZA 4JEAA 3C8GA 1T6QA 2JX0A 4MNDA 2R7SA 3RQGA 3BEHA 1BR2A 1G8XA 2GA0A 1QSPA 5FCLA 4A4AA 2ZXPA 2QTVA 2ZXWC 4JJFA 1RKEA 4KBLA 1LKXA 4LLCA 4XEVA 3L1MA 3S9OA 3LS1A 1WGWA 4K0DA 5KYYB 1IW7F 4NTFA 3EPVA 2DYSC 1RXQA 3Q6NA 4MVOA 2KYHA 2OOCA 3EGDB 5COFA 3Q7LA 1ZHYA 2P6VA 4XTKA 5JSLA 4H54A 3VAYA 2YQYA 2D4UA 2R7VA 2XL8A 3T6JA 2J7PD 1UG7A 4W8PA 4JRZA 4MVQA 1FFHA 4U5BE 2A6EF 2NPUA 4PK4A 3L0IA 1E85A 1QQ3A 3DAGA 2R7WA 2UUIA 2LSEA 3NYLA 1PD1A 2MYSA 4EBJA 1JMWA 3ASNC 3DD7A 5DS4A 1G4WR 3WG7C 2YLIA 2Q9AA 2EPOA 4BEJA 4DBRA 1LS1A 4G7HF 1NFNA 4P6IC 3UGOA 1Z6AA 2VCAA 3MBGA 4PJJA 3NMJA 4AX2A 4LLEA 4JC7A 4EKWA 2ZPAA 2XL6A 4RD9A 3DAFA 3LJBA 2HFIA 2KQ9A 3GEEA 5CI9A 2R7UA 1VLTA 2LIGA 2NUPB 5DVWA 3V5XA 3MYIA 2VCCA 3EHNA 3FMSA 2ASRA 4RDAA 4CBEA 2R9RB 3SEOA 3U8VA 5JRAA 1BZ4A 5KYUB 2M4EA 2ZXOA 1NG1A 2XSEA 1OQCA 2YEVA 3LAYA 4Z9IA 3TOLA 3SXMA 3CQZA 3IQ5A 4MVZA 1D1BA 1LPEA 2BL2A 1V54C 4CS8A 3LNMB 2P1AA 1C02A 1I5NA 2M64A 3RFYA 2YHSA 1ZZPA 2Q4FA 3O55A 4KNWA 4XPWA 1Q0FA 1CGME 4ONSA 3DM5A 2XM4A 5KYNA 2J0WA 2KW3C 3DM9B 1YJGA 3GM2A 3W4YA 2R7TA 4J32B 2WL8A 4E18A 4IRUA 1AEPA 5L0GA 4Q7CA 3VRCA 3DE8A 1U89A 5EK0A 2J9VA 2CCYA 2J46A 1Q0DA 2L7AA 2YLGA 4JURI 3HNJA 2PX0A 3KYIA 2LFFA 1D1CA 1ORJA 1OW6A 2Q9CA 3AQCA 1KNYA 2P0NA 2NSFA 3KH2A 3EFOA 3L34A 1OXKA 3TK0A 4BJ5C 3MFNA 1I4YA 4PJNA 5B1AC 1QLEC 2YL0A 1PD0A 1O5HA 2OG2A 3E9VA 2KNHA 5AGFA 1K04A 1YARO 1MMDA 4MW8A 3B71A 1XWJA 1Z23A 5L3VA 5KYWA 5JVEA 4YWQA 1TWGA 4J7TA 4XPXA 3PDMP 1T9KA 1T6IA 3FVYA 3ZTZA 5L0CA 2IBFA 1I4ZA 3WODF 2LP4A 3FDQA 2XXAB 4GYTA 2YZSA 3SYNA 1SR2A 1AVOB 5KYXA 4QI2A 1OR2A 3GWNA 3EGXA 4OIOF 4WJ0A 4MW3A 4DVYP 3W8IA 2BC5A 3UMKA 4AE4B 3KL4A 3AJMA 4ER9A 3G50A 5HV9A 3DMDA 2EINC 1FNTc 2WB7A 3N0TA 4KI2A 2WVOA 3C8GB 3AG2C 4A2NB 1R5ID 3NRHA 3IQTA 4D4XA 1QVXA 2XRHA 3FXHA 3CSKA 2QUPA 1YA9A 2ICWG 4N6HA 3VF0A 3GEIA 2OKUA 4PJMA 4WABA 1SYQA 2J45A 3B29A 4I3MA 4X0RA 4IAQA 4BJ6C 4E7SA 3B0UX 2HMQA 3S27A 2EPKX 2DI3A 2EILC 2E87A 2IM8A 4C3EA 4CX9A 2Y69C 4Q5SF 1JRAA 4CS9C 3KMIA 3NDBB 3JTLO 4GQHA 5E3AA 3UGPA 4YK5A 4CS7A 5L0IA 1MMAA 1OXBA 3JSZA 2QE9A 3ABLC 4MQ9F 3LNRA 4F4BA 5BQIA 5DS5A 1D0ZA 1D1AA 1GGQA 1LVKA 2R05A 3PMRA 1BR4A 2VC9A 3O10A 4U5HA 1R4TA 3W8HA 4CSAA 4BJTA 5TJ5E 3CAXA 4U5GA 5L0DA 3C8GD 2I8BA 4OIPF 1VLSA 1YAUO 1TWCA 3EZIA 4W8KA 1MMNA 1V74B 3SNHA 3JT1A 4ULVA 3IQ6A 2NUTA 5JLIA 1OCOC 1MQVA 3IQCA 4O79A 2H7OA 2MHRA 3GWLA 2YLDA 2YVKA 2IXOA 1T6UA 2W9YA 1M2VB 2NSGA 2OJED 3EQLF 4BJ1A 1U0BB 4YL0A 4ZLDA 1TWAA 4MTOA 4QI0A 1EI7A 2LD6A 3MLGA 3EH1A 2G3VA 3O6XA 3UNGC 1ZHZA 2A0UA 2XS8A 3T4RA 3ABKC 3TJ5A 3ZC4A 5EGYA 5D91A 1H9TA 1U6HA 1HW1A 1HE1A 2GFHA 2H8AA 2I15A 3DJNB 5CIVA 5A6AA 1E84A 3HNIA 1SZIA 5DQZA 1GS9A 2IXNA 1LE4A 2C04A 1NFOA 2XLHA 3HTKC 3ZVRA 4I44A 2IOQA 5F28E 4Q4ZF 1OKKA 2Y39A 2OQMA 3O39A 3U5SA 3JCUQ 4HFFB 1HMDA 3OWTA 4JIOA 4XWJA 3US6A 4GEHA 1Z63A 3DI5A 2J9BA 3JZ0A 3MX3A 2A69F 3EHMA 3AG4C 3PHF2 1TFKB 4U5DE 2C03A 5F5HA 3FHDA 5BQGA 1Z5ZA 2KJGA 2Z15A 2ZXRA 1G4US 4R32A 1YYXA 4IGGA 2ETSA 3C62A 4JCHA 4PFOA 3AGUA 1O87A 3HNLA 3ATPA 3A11A 3FAJA 3FOOA 3GORA 1Q0GA 3LLKA 4IAOA 1E83A 2L6FA 2KSFA 2L81A 2QY9A 4P9FA 5DQTA 4DVZA 1M2OA 2XLVA 5E2QA 2MWQA 3JYHA 4CIHA 4JJGA 3AOUA 1MNDA 1FFTC 1HMOA 4J7YA 3ZTMA 4MTGA 4C7OB 4CDYA 5KYXB 3LEOA 3G4XA 3T9OA 4AK9A 1A7EA 1ZW2A 2DYRC 2LCHA 5IY5C
chains in the Genus database with same CATH topology
1B68A 1EA8A 1NFNA 1H7IA 1LS4A 2KC3A 1OR2A 1AEPA 1LE2A 1OR3A 1BZ4A 3R2PA 1YA9A 1EQ1A 3S84A 1GS9A 1LPEA 1LE4A 1NFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B68 A;  1EA8 A;  1NFN A;  1H7I A;  1LS4 A;  2KC3 A;  1OR2 A;  1AEP A;  1LE2 A;  1OR3 A;  1BZ4 A;  3R2P A;  1YA9 A;  1EQ1 A;  3S84 A;  1GS9 A;  1LPE A;  1LE4 A;  1NFO A; 
#chains in the Genus database with same CATH topology
 2J9U A;  3ASO C;  1K05 A;  4XEF A;  1OW8 A;  4Z9J A;  1ZHW A;  3G4Z A;  1EKY A;  4IB4 A;  1CPQ A;  1E2X A;  4N4W A;  5AC4 A;  3S29 A;  2OEX A;  2LFD A;  1JOG A;  4N6C A;  3RQF A;  5EHH A;  3OA1 A;  2WZF A;  3U0C A;  1FMW A;  3HJC A;  4BG0 A;  1M57 C;  2W4M A;  4RBN A;  4YL3 A;  4BJ5 A;  4NTA A;  4MVR A;  4U9E A;  3R2P A;  2J9W A;  3Q7G A;  3EG9 B;  4BPM A;  1FMV A;  2Q3T A;  3ZQY A;  3U3F A;  4YT4 A;  2L6G A;  1H9G A;  5KYY A;  3EZH A;  3DE9 A;  1OCC C;  3DWW A;  3NKD A;  3T6G B;  1JAF A;  4JKV A;  3B9Q A;  3DKA A;  3DXJ F;  4NQF A;  3RQE A;  3EGD A;  4E7Z A;  2HZ8 A;  4JCZ A;  1M56 C;  3I4U A;  3N24 A;  1WTY A;  3DJU B;  4C3D A;  2HV6 A;  2IXM A;  2L9J A;  2A6H F;  2PNO A;  3NG1 A;  4NC3 A;  2KC3 A;  3UR3 C;  1FTS A;  1HW2 A;  1L3P A;  5HSW A;  3M1C B;  3C63 A;  2DGJ A;  4HFK B;  2R7Q A;  3M79 A;  5D92 A;  2CGE A;  2YL1 A;  3LS0 A;  5GPG B;  2R7R A;  1ZU4 A;  1JR8 A;  5B1B C;  4E0I A;  3R7C A;  4FX5 A;  2H7B A;  4Z9H A;  4FWV A;  3NYJ A;  4BEM J;  3GAN A;  1HY5 A;  1RKE B;  1YDI A;  5T3T A;  2PP4 A;  1BR1 A;  1YYJ A;  2WZL A;  4U9D A;  4LER A;  4BJ6 A;  2NUP A;  3S90 A;  2A68 F;  4LDK A;  2YKZ A;  2HSB A;  2FFH A;  3MYF A;  3H2U A;  2L6H A;  5KYU A;  1VYK A;  2HUJ A;  3F46 A;  4CS9 A;  3WAQ A;  4HE8 D;  1H7I A;  2VB6 A;  2ZD9 A;  2FAP B;  1DOW A;  3BRJ A;  4JW1 A;  3RIP A;  5COM A;  2R02 A;  4G78 A;  1CPR A;  3K1H A;  2LQG A;  1KTM A;  4N06 A;  3B0V C;  5A6J A;  4NTB A;  3OEO A;  1T01 A;  4XQ1 A;  3M15 A;  2BE5 F;  2PBE A;  1Y4C A;  5K0I A;  1TQG A;  2EPN A;  4MVU A;  2UUH A;  3VM6 A;  4D4N A;  5DLJ A;  3I5P A;  1SF8 A;  3A9C A;  4DRJ B;  2PFD A;  2AP3 A;  2XM0 A;  3S84 A;  2DB4 A;  3AG1 C;  1T5O A;  1EQ1 A;  4AL0 A;  3B0P A;  3GOD A;  4O7G A;  4MVM A;  3K66 A;  4E17 A;  3QZC A;  3RW0 A;  5JS5 A;  1B68 A;  3M4B A;  1AUE A;  3QTH A;  4YJW A;  5B3I A;  3EH2 A;  4DXW A;  2R25 A;  4HEA J;  4PR9 A;  1LS4 A;  1NZE A;  4DRH B;  3AGT A;  4DOZ A;  1V55 C;  1LM3 B;  1TFO B;  5CI8 A;  2HMZ A;  1S05 A;  4B6I A;  3S0X A;  3CEX A;  1S7Z A;  3RKO F;  4MS2 A;  1CGN A;  1L7C A;  1ZHX A;  3C8Z A;  4CDA A;  1Q0K A;  2PF4 E;  1MMG A;  1OKK D;  3U8P A;  3ZSU A;  2XXA A;  1WN0 A;  2EIM C;  1GQA A;  3K1I C;  3ZIB A;  3GEH A;  1XZP A;  3K7D A;  2J0X A;  3I5Q A;  4YT5 A;  2Y3H A;  3U2L A;  4I1M A;  2OJQ A;  4O6Y A;  2GWW A;  3L8I A;  3ECS A;  3C7J A;  5E3C A;  4AE4 A;  1G5Z A;  3QW1 A;  2Y3B A;  1FR0 A;  2X51 A;  1WWP A;  5T1D B;  4JZA A;  1YLM A;  1WAT A;  4JTA B;  1V4A A;  4FAP B;  4U5F E;  3FOP A;  4MVS A;  3DZA A;  3EFO B;  1IZM A;  3T6B A;  1A7D A;  2GAQ A;  1FAP B;  3ZWI A;  2VCB A;  2GDC A;  2WVN A;  3L8J A;  4H4K C;  2HS5 A;  1NLX A;  4JE9 A;  4WGY A;  5BQH A;  1BDJ B;  2HSQ A;  4EBK A;  1YZC A;  1RKC A;  3S28 A;  3TQO A;  2A1D D;  1NU7 D;  3QMK A;  4IJJ A;  4PJL A;  2HJ3 A;  5KYW B;  1RJ9 A;  3HKK A;  3GM3 A;  2P61 A;  2EIJ C;  3F47 A;  1TR2 A;  1VB5 A;  2QNL A;  3ITF A;  1ZW3 A;  4G7Z F;  1RMV A;  2KGO A;  4EHP A;  2XLM A;  1Z3I X;  1SMY F;  1NSG B;  2OU6 A;  4OIN F;  3H65 A;  3JRM O;  4NCQ A;  1CGO A;  4DRI B;  1O3U A;  2LK4 A;  4P9T A;  1NBB A;  2AVK A;  3EGX B;  2X0C A;  4EIY A;  3UMI A;  1ZU5 A;  4MTF A;  2RD9 A;  3Q6M A;  4YT2 A;  1ORS C;  5DS6 A;  4DBQ A;  1LI7 A;  3LES A;  4KNV A;  3RH3 A;  4ULW A;  2Y3G A;  2J7P A;  4IWB A;  2Q7R A;  4PAC A;  3IEE A;  3ZG1 A;  1JPJ A;  4K7B A;  4L6R A;  4XEK A;  3E70 C;  3SXK A;  1VMA A;  5JUA A;  3NYM A;  1VK5 A;  1YA7 O;  4QDL A;  4K1O A;  3QW0 A;  2RSE B;  3V5Z A;  2Y3D A;  2EPL X;  2O9X A;  2QLA A;  5A6K A;  1ORY A;  1QPU A;  2CDQ A;  2YRF A;  4YL1 A;  2HKV A;  2YL3 A;  3M4C A;  2HV7 A;  3JRT A;  5E33 A;  4OIQ F;  1MNE A;  1Y6D A;  2XLO A;  3ZQV A;  3POV A;  1WAS A;  4C3B A;  3KPH A;  1M2V A;  2OEV A;  1Z7Q c;  3RVY A;  1C17 M;  3JYY A;  4CJO A;  2VH3 A;  4JEB A;  4U5C E;  1ZHT A;  4E0H A;  2OCC C;  2R03 A;  3GM1 A;  1OW7 A;  4CS8 C;  1NU9 C;  2F22 A;  5JP7 A;  4XPY A;  3V7O A;  2W4B A;  3W2V A;  5BUO A;  1K40 A;  4U5E E;  3UMH A;  2WVQ A;  1VOM A;  1BBH A;  2EPM X;  4I1O B;  1YVI A;  4IAR A;  1XZQ A;  1PCX A;  3V5Y A;  3ABM C;  3QVZ A;  3WHN A;  3SXZ A;  4AL1 A;  4ANJ A;  2WZG A;  256B A;  4FES A;  4CDV A;  2IYL D;  1WOL A;  3TJ6 A;  1D0Y A;  3PCV A;  3EJN A;  4ZLC A;  3HNK A;  3K33 A;  1F1M A;  5AC5 A;  5L0H A;  2FGY A;  2AU5 A;  2NUT B;  2EIK C;  5JT4 A;  1OR3 A;  4UDV A;  2JPU A;  3NKE A;  5A69 A;  2XL4 A;  2NG1 A;  3N2Z B;  2TMV P;  3IHU A;  2KK1 A;  1A0B A;  2Q9B A;  3U3B A;  3X1O A;  4YT8 A;  1J8Y F;  4J30 B;  3TOM A;  4XLN F;  5FZT A;  2YWA A;  4JTC B;  3ZDL A;  1YZA A;  3K6B A;  1UFB A;  4G0H A;  1JPN A;  3AQB A;  1RCP A;  1LIH A;  4NY3 A;  3VYW A;  3NMK A;  3AG3 C;  5COG A;  1VTM P;  3SZR A;  1Q0M A;  1VYI A;  2B0H A;  3LEV A;  2R7X A;  1QZX A;  3J06 A;  2D5R B;  4C7O A;  4XLP F;  1OCZ C;  2V3C C;  1OCR C;  3NMI A;  4EUK B;  1APC A;  4PFP A;  5F5F A;  3C18 A;  4M63 A;  5L3Q A;  4CJG A;  3JSE O;  3H2V A;  2VAS A;  2B0J A;  4JTD B;  1LI5 A;  3TD7 A;  3X2Q C;  3LUT B;  3HLZ A;  2CW0 F;  4WGZ A;  5B3S C;  1ZVZ A;  2YL7 A;  2G3K A;  4OD5 A;  1A7V A;  2XLE A;  4KC9 A;  3IPM O;  1ST6 A;  1H6G A;  4LDQ A;  5A6B D;  1W2W A;  1J8M F;  1PV3 A;  3TUL A;  2H7V C;  3QVY A;  4CIP A;  2Q00 A;  4OD4 A;  2CNW D;  1RJ9 B;  2XLW A;  1TWH A;  4JVS A;  2J8W A;  1C03 A;  2IXP A;  4O6M A;  5L0J A;  1EA8 A;  2XLD A;  3SP1 A;  5A6B A;  3EG9 A;  4DJ9 A;  1M6T A;  2A0B A;  3SXY A;  1QKR A;  4LDR A;  3U2M A;  2G62 A;  3FAP B;  2CNW A;  4LAC B;  2XS1 A;  2HJM A;  1LE2 A;  1KU2 A;  2CYD A;  1A41 A;  5T3W A;  1E86 A;  4EBB A;  1DOV A;  4CSA C;  3U9M A;  1ZYR F;  3K1I A;  4G7O F;  1GM5 A;  3CZ6 A;  2JD3 A;  4OIR F;  2AWY A;  3RYL A;  1TKN A;  1D0X A;  2W45 A;  1N1C A;  3KKB A;  3LLI A;  3W2W A;  3RF3 A;  2P7V A;  4O6N A;  2PX3 A;  3KYJ A;  5L0F A;  2R7O A;  3U9J A;  2AWC A;  2V26 A;  1HE9 A;  4YN0 B;  4EWC A;  3RVZ A;  4JEA A;  3C8G A;  1T6Q A;  2JX0 A;  4MND A;  2R7S A;  3RQG A;  3BEH A;  1BR2 A;  1G8X A;  2GA0 A;  1QSP A;  5FCL A;  4A4A A;  2ZXP A;  2QTV A;  2ZXW C;  4JJF A;  1RKE A;  4KBL A;  1LKX A;  4LLC A;  4XEV A;  3L1M A;  3S9O A;  3LS1 A;  1WGW A;  4K0D A;  5KYY B;  1IW7 F;  4NTF A;  3EPV A;  2DYS C;  1RXQ A;  3Q6N A;  4MVO A;  2KYH A;  2OOC A;  3EGD B;  5COF A;  3Q7L A;  1ZHY A;  2P6V A;  4XTK A;  5JSL A;  4H54 A;  3VAY A;  2YQY A;  2D4U A;  2R7V A;  2XL8 A;  3T6J A;  2J7P D;  1UG7 A;  4W8P A;  4JRZ A;  4MVQ A;  1FFH A;  4U5B E;  2A6E F;  2NPU A;  4PK4 A;  3L0I A;  1E85 A;  1QQ3 A;  3DAG A;  2R7W A;  2UUI A;  2LSE A;  3NYL A;  1PD1 A;  2MYS A;  4EBJ A;  1JMW A;  3ASN C;  3DD7 A;  5DS4 A;  1G4W R;  3WG7 C;  2YLI A;  2Q9A A;  2EPO A;  4BEJ A;  4DBR A;  1LS1 A;  4G7H F;  1NFN A;  4P6I C;  3UGO A;  1Z6A A;  2VCA A;  3MBG A;  4PJJ A;  3NMJ A;  4AX2 A;  4LLE A;  4JC7 A;  4EKW A;  2ZPA A;  2XL6 A;  4RD9 A;  3DAF A;  3LJB A;  2HFI A;  2KQ9 A;  3GEE A;  5CI9 A;  2R7U A;  1VLT A;  2LIG A;  2NUP B;  5DVW A;  3V5X A;  3MYI A;  2VCC A;  3EHN A;  3FMS A;  2ASR A;  4RDA A;  4CBE A;  2R9R B;  3SEO A;  3U8V A;  5JRA A;  1BZ4 A;  5KYU B;  2M4E A;  2ZXO A;  1NG1 A;  2XSE A;  1OQC A;  2YEV A;  3LAY A;  4Z9I A;  3TOL A;  3SXM A;  3CQZ A;  3IQ5 A;  4MVZ A;  1D1B A;  1LPE A;  2BL2 A;  1V54 C;  4CS8 A;  3LNM B;  2P1A A;  1C02 A;  1I5N A;  2M64 A;  3RFY A;  2YHS A;  1ZZP A;  2Q4F A;  3O55 A;  4KNW A;  4XPW A;  1Q0F A;  1CGM E;  4ONS A;  3DM5 A;  2XM4 A;  5KYN A;  2J0W A;  2KW3 C;  3DM9 B;  1YJG A;  3GM2 A;  3W4Y A;  2R7T A;  4J32 B;  2WL8 A;  4E18 A;  4IRU A;  1AEP A;  5L0G A;  4Q7C A;  3VRC A;  3DE8 A;  1U89 A;  5EK0 A;  2J9V A;  2CCY A;  2J46 A;  1Q0D A;  2L7A A;  2YLG A;  4JUR I;  3HNJ A;  2PX0 A;  3KYI A;  2LFF A;  1D1C A;  1ORJ A;  1OW6 A;  2Q9C A;  3AQC A;  1KNY A;  2P0N A;  2NSF A;  3KH2 A;  3EFO A;  3L34 A;  1OXK A;  3TK0 A;  4BJ5 C;  3MFN A;  1I4Y A;  4PJN A;  5B1A C;  1QLE C;  2YL0 A;  1PD0 A;  1O5H A;  2OG2 A;  3E9V A;  2KNH A;  5AGF A;  1K04 A;  1YAR O;  1MMD A;  4MW8 A;  3B71 A;  1XWJ A;  1Z23 A;  5L3V A;  5KYW A;  5JVE A;  4YWQ A;  1TWG A;  4J7T A;  4XPX A;  3PDM P;  1T9K A;  1T6I A;  3FVY A;  3ZTZ A;  5L0C A;  2IBF A;  1I4Z A;  3WOD F;  2LP4 A;  3FDQ A;  2XXA B;  4GYT A;  2YZS A;  3SYN A;  1SR2 A;  1AVO B;  5KYX A;  4QI2 A;  1OR2 A;  3GWN A;  3EGX A;  4OIO F;  4WJ0 A;  4MW3 A;  4DVY P;  3W8I A;  2BC5 A;  3UMK A;  4AE4 B;  3KL4 A;  3AJM A;  4ER9 A;  3G50 A;  5HV9 A;  3DMD A;  2EIN C;  1FNT c;  2WB7 A;  3N0T A;  4KI2 A;  2WVO A;  3C8G B;  3AG2 C;  4A2N B;  1R5I D;  3NRH A;  3IQT A;  4D4X A;  1QVX A;  2XRH A;  3FXH A;  3CSK A;  2QUP A;  1YA9 A;  2ICW G;  4N6H A;  3VF0 A;  3GEI A;  2OKU A;  4PJM A;  4WAB A;  1SYQ A;  2J45 A;  3B29 A;  4I3M A;  4X0R A;  4IAQ A;  4BJ6 C;  4E7S A;  3B0U X;  2HMQ A;  3S27 A;  2EPK X;  2DI3 A;  2EIL C;  2E87 A;  2IM8 A;  4C3E A;  4CX9 A;  2Y69 C;  4Q5S F;  1JRA A;  4CS9 C;  3KMI A;  3NDB B;  3JTL O;  4GQH A;  5E3A A;  3UGP A;  4YK5 A;  4CS7 A;  5L0I A;  1MMA A;  1OXB A;  3JSZ A;  2QE9 A;  3ABL C;  4MQ9 F;  3LNR A;  4F4B A;  5BQI A;  5DS5 A;  1D0Z A;  1D1A A;  1GGQ A;  1LVK A;  2R05 A;  3PMR A;  1BR4 A;  2VC9 A;  3O10 A;  4U5H A;  1R4T A;  3W8H A;  4CSA A;  4BJT A;  5TJ5 E;  3CAX A;  4U5G A;  5L0D A;  3C8G D;  2I8B A;  4OIP F;  1VLS A;  1YAU O;  1TWC A;  3EZI A;  4W8K A;  1MMN A;  1V74 B;  3SNH A;  3JT1 A;  4ULV A;  3IQ6 A;  2NUT A;  5JLI A;  1OCO C;  1MQV A;  3IQC A;  4O79 A;  2H7O A;  2MHR A;  3GWL A;  2YLD A;  2YVK A;  2IXO A;  1T6U A;  2W9Y A;  1M2V B;  2NSG A;  2OJE D;  3EQL F;  4BJ1 A;  1U0B B;  4YL0 A;  4ZLD A;  1TWA A;  4MTO A;  4QI0 A;  1EI7 A;  2LD6 A;  3MLG A;  3EH1 A;  2G3V A;  3O6X A;  3UNG C;  1ZHZ A;  2A0U A;  2XS8 A;  3T4R A;  3ABK C;  3TJ5 A;  3ZC4 A;  5EGY A;  5D91 A;  1H9T A;  1U6H A;  1HW1 A;  1HE1 A;  2GFH A;  2H8A A;  2I15 A;  3DJN B;  5CIV A;  5A6A A;  1E84 A;  3HNI A;  1SZI A;  5DQZ A;  1GS9 A;  2IXN A;  1LE4 A;  2C04 A;  1NFO A;  2XLH A;  3HTK C;  3ZVR A;  4I44 A;  2IOQ A;  5F28 E;  4Q4Z F;  1OKK A;  2Y39 A;  2OQM A;  3O39 A;  3U5S A;  3JCU Q;  4HFF B;  1HMD A;  3OWT A;  4JIO A;  4XWJ A;  3US6 A;  4GEH A;  1Z63 A;  3DI5 A;  2J9B A;  3JZ0 A;  3MX3 A;  2A69 F;  3EHM A;  3AG4 C;  3PHF 2;  1TFK B;  4U5D E;  2C03 A;  5F5H A;  3FHD A;  5BQG A;  1Z5Z A;  2KJG A;  2Z15 A;  2ZXR A;  1G4U S;  4R32 A;  1YYX A;  4IGG A;  2ETS A;  3C62 A;  4JCH A;  4PFO A;  3AGU A;  1O87 A;  3HNL A;  3ATP A;  3A11 A;  3FAJ A;  3FOO A;  3GOR A;  1Q0G A;  3LLK A;  4IAO A;  1E83 A;  2L6F A;  2KSF A;  2L81 A;  2QY9 A;  4P9F A;  5DQT A;  4DVZ A;  1M2O A;  2XLV A;  5E2Q A;  2MWQ A;  3JYH A;  4CIH A;  4JJG A;  3AOU A;  1MND A;  1FFT C;  1HMO A;  4J7Y A;  3ZTM A;  4MTG A;  4C7O B;  4CDY A;  5KYX B;  3LEO A;  3G4X A;  3T9O A;  4AK9 A;  1A7E A;  1ZW2 A;  2DYR C;  2LCH A;  5IY5 C; 
#chains in the Genus database with same CATH homology
 1B68 A;  1EA8 A;  1NFN A;  1H7I A;  1LS4 A;  2KC3 A;  1OR2 A;  1AEP A;  1LE2 A;  1OR3 A;  1BZ4 A;  3R2P A;  1YA9 A;  1EQ1 A;  3S84 A;  1GS9 A;  1LPE A;  1LE4 A;  1NFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...