1OR2A

Apolipoprotein e3 (apoe3) truncation mutant 165
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
130
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords APOLIPOPROTEIN E
publication title Conformational flexibility in the apolipoprotein E amino-terminal domain structure determined from three new crystal forms: implications for lipid binding.
pubmed rcsb
source organism Homo sapiens
total genus 47
structure length 130
sequence length 141
ec nomenclature
pdb deposition date 1999-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1or2A00
1LE4A 3R2PA 1OR3A 1LE2A 1OR2A 1BZ4A 1LPEA 1GS9A 1EA8A 2KC3A 1LS4A 1H7IA 1EQ1A 1B68A 1AEPA 1NFOA 3S84A 1NFNA 1YA9A
chains in the Genus database with same CATH superfamily
1LE4A 1MNEA 3KYIA 3NRHA 3FHDA 3HTKC 4FWVA 4D4XA 1HMOA 3ZWIA 4IAOA 4MVRA 3CQZA 1LE2A 2KW3C 2VCAA 3TULA 2M4EA 3C7JA 3RQEA 1MNDA 2L81A 4MQ9F 2ETSA 4RDAA 2M64A 4G7OF 3MLGA 2IXMA 2Q9CA 3LJBA 5COMA 1DOWA 4E18A 1Q0MA 4BEJA 2R7OA 2W4MA 2L6HA 3R7CA 2KGOA 4G7HF 2G62A 3B9QA 2NUTA 4HFFB 3AOUA 3U9JA 1OXKA 2E87A 3DJUB 4YJWA 1H7IA 2YKZA 2ZPAA 3DAFA 3TOLA 1N1CA 3LEOA 2FAPB 5AC5A 1H9TA 3LS1A 3Q7LA 1A41A 1AUEA 4JURI 1T5OA 5KYXB 3ITFA 4YWQA 3M15A 2TMVP 4MNDA 3UGPA 3ABKC 2KNHA 3C63A 4N4WA 4ULWA 2R7XA 1MMGA 2NPUA 1VYIA 2A0BA 2MHRA 3RF3A 1CPRA 3NMJA 5A69A 1I4YA 1OCZC 1C02A 1QKRA 3LEVA 3KPHA 4U9DA 1VK5A 2W9YA 2X0CA 3T6BA 2A0UA 3AGTA 4YN0B 2R7QA 1M2OA 3JTLO 3EGDA 3LUTB 2XLEA 4U5CE 4DBQA 2HV6A 2XSEA 2YRFA 2KC3A 2XLOA 2NSFA 2O9XA 2ZXPA 4U5DE 4CS8C 5K0IA 3SXYA 4U9EA 4AL0A 3OA1A 1A7EA 2DI3A 4IGGA 4WJ0A 1H9GA 4I3MA 4JE9A 4C3BA 3G50A 1K40A 2HSBA 5A6AA 2C03A 2Q00A 4K1OA 1R5ID 1TWAA 3WAQA 3CAXA 1J8YF 3ZG1A 2YHSA 1TR2A 4G78A 2L7AA 4NTBA 4AE4B 4JKVA 4MVMA 3EGXA 4EBKA 3K1IA 1M2VB 4NTFA 4FX5A 3L34A 1VLSA 3DE9A 1TFKB 4LLCA 5TJ5E 3U2MA 2KSFA 2QTVA 2YLGA 2XL8A 4RBNA 1V55C 4CBEA 5KYWB 4YK5A 1M57C 2XLHA 2F22A 2Q9AA 4L6RA 1E83A 1XZQA 3B71A 4MVZA 1LM3B 2RSEB 2Y3BA 3HJCA 1ZHYA 4N6CA 2CDQA 1JRAA 1M2VA 1G8XA 1ZU5A 2Q4FA 3G4ZA 2YLDA 1JPJA 4D4NA 5KYWA 1T6QA 1G4WR 4KC9A 5L0FA 3NYJA 1QZXA 2R02A 1HE9A 3KMIA 1YA7O 4XLPF 3CZ6A 1ZHTA 4E0HA 2LFDA 3QZCA 4ER9A 4DXWA 2D5RB 4MS2A 1SZIA 1O3UA 1WATA 1XZPA 5JRAA 3IQTA 3EZHA 3RVYA 3GWNA 3B0UX 4XLNF 3U2LA 3ATPA 4NY3A 3SP1A 2FGYA 3WODF 4DOZA 3KH2A 1ORSC 2HFIA 2OJED 4JEBA 1OCOC 2H8AA 4MTOA 1WGWA 3DM9B 3GEHA 4X0RA 4CJGA 1C03A 4Q5SF 1QPUA 2XL6A 4HFKB 2XLWA 4MVUA 1YAUO 2B0JA 1O87A 4XPWA 4A4AA 1VOMA 3EFOB 2Q9BA 3V5YA 1EKYA 2KK1A 2XLMA 2QLAA 4HE8D 3C8GB 2Y3HA 3F47A 3LLIA 5DQZA 3NKEA 2XS1A 2LD6A 1JOGA 3DI5A 1QQ3A 1VLTA 2EIMC 3DM5A 2OJQA 2XM0A 3LNRA 3TOMA 3X1OA 3EFOA 1GQAA 2JX0A 3RQGA 3IQ5A 4E7ZA 1TKNA 2WVOA 5JSLA 1D0ZA 2ZXWC 1C17M 1ZU4A 3HNJA 5E2QA 2HSQA 5L0JA 2R7VA 2P1AA 5KYYB 1LPEA 1E86A 4UDVA 4ANJA 4FAPB 3EH2A 4XEVA 4XEKA 3QVZA 1L3PA 1TWGA 4AL1A 1BR2A 2IXPA 3U8VA 4DRJB 1DOVA 1QLEC 1A7VA 3NMIA 4MW8A 1O5HA 3S90A 2DB4A 2J9WA 4IRUA 5DS6A 5FZTA 2P6VA 2R05A 5KYYA 4DRHB 4OIQF 1JR8A 5F28E 1RCPA 3U8PA 4C3DA 3M4CA 4H4KC 4JEAA 4XPXA 2XL4A 4CIPA 5L0CA 5B3SC 1TWHA 2VC9A 4CS7A 2Q3TA 2WZLA 2CNWD 3FXHA 3K33A 3QW1A 1JAFA 5EGYA 3FAPB 5JT4A 3FDQA 3UGOA 4LERA 1GGQA 3TK0A 4N06A 3B0PA 2Z15A 5AC4A 4GEHA 3DE8A 2H7BA 3I5PA 1FMVA 2NUTB 3LLKA 1KNYA 5COFA 2AWCA 1F1MA 1YZCA 2J7PD 1NSGB 1A7DA 3B0VC 1ST6A 4QDLA 1KU2A 4W8KA 3TD7A 1FTSA 4MTGA 4DBRA 2EIJC 3MX3A 3SXMA 2A69F 2XS8A 1U0BB 2HMZA 3B29A 2CGEA 3CEXA 1FFTC 3M1CB 3V5ZA 4CS9A 3ASNC 1JPNA 1Z3IX 4M63A 1ORYA 1OW8A 5A6BA 2IBFA 3IQ6A 2I8BA 3EGDB 1RKCA 4BJ6A 3AG1C 3BRJA 1YLMA 3T9OA 4ZLDA 4NTAA 3KL4A 3J06A 1FFHA 3T4RA 4CJOA 4U5EE 1LS1A 1SMYF 1D1BA 3EZIA 4QI0A 3RYLA 4LDKA 4PJNA 1A0BA 1EI7A 2LK4A 3OWTA 4Z9HA 3G4XA 1S7ZA 3EGXB 3X2QC 2PNOA 4CSAA 3DJNB 4XQ1A 3M79A 2J9UA 4NC3A 4F4BA 2KYHA 2MYSA 1FNTc 3EPVA 2H7VC 4PACA 3GEEA 4FESA 1NG1A 1WTYA 4WGZA 4BJ5A 2XLDA 4OIOF 2G3VA 3L8IA 2AWYA 3US6A 1ZW2A 4CIHA 1Q0GA 3LNMB 5F5HA 5BUOA 3K6BA 4E7SA 1HW2A 5AGFA 1T01A 2R7UA 5JS5A 4I1MA 3I4UA 2GDCA 2R7TA 2A6EF 3U0CA 5HSWA 3EH1A 2R03A 2XRHA 4N6HA 5CIVA 2BL2A 3DD7A 2R25A 3F46A 1Z6AA 4IJJA 2YL3A 1BZ4A 1M56C 4IWBA 4DJ9A 5L3VA 1D0YA 2MWQA 3A11A 3JRTA 4J7YA 4CS9C 3RH3A 1RMVA 1OKKD 3C8GD 4JW1A 1JMWA 3SZRA 2AU5A 2YQYA 1D0XA 1M6TA 1TWCA 2OQMA 2EIKC 2YZSA 1WOLA 3U3FA 4O7GA 3W2VA 4PJJA 3BEHA 3DWWA 4JTDB 1ZYRF 2EPMX 3W2WA 2HKVA 1YJGA 1SYQA 4B6IA 1E84A 1VMAA 2DYSC 2YEVA 3S29A 3GM2A 2EPLX 3DXJF 1FMWA 256BA 2HMQA 2LSEA 4G0HA 4RD9A 3QMKA 2Q7RA 5DS5A 1KTMA 1TQGA 4BJ5C 1YYJA 2GFHA 3C62A 3VM6A 2YLIA 2OKUA 3EHNA 3E70C 4OD5A 3RW0A 3NYLA 3PCVA 4KNVA 1HW1A 1EA8A 1FR0A 4K0DA 2OEVA 4YT2A 3HNLA 1LS4A 2CCYA 3ABLC 3K1IC 2R7WA 4C7OB 4EKWA 3GEIA 1J8MF 1SR2A 4JVSA 3VRCA 5L3QA 5CI8A 2QUPA 1LI7A 1V54C 4BJ1A 3HNKA 5GPGB 1CGOA 4MVOA 2XM4A 4G7ZF 1AEPA 3U9MA 1IW7F 1IZMA 2HV7A 3S84A 2RD9A 4I44A 2AVKA 1SF8A 2FFHA 3UNGC 4C7OA 5B3IA 3ZIBA 3EG9A 2IM8A 4GQHA 5D91A 1HY5A 5DLJA 3GANA 5B1BC 3HNIA 2V3CC 3EQLF 2R7RA 4PFOA 2QE9A 3K7DA 4HEAJ 5T3TA 2WVNA 1RKEB 3ZSUA 5L0IA 4JCHA 1W2WA 2VASA 3T6JA 3RVZA 1CGME 3E9VA 1PD1A 1U6HA 5D92A 5KYNA 3VF0A 3PHF2 3DAGA 4BG0A 5A6JA 2DYRC 4R32A 2YL0A 4U5FE 4BJTA 3S0XA 4IAQA 4J7TA 2EILC 3C18A 5B1AC 1Q0DA 1RKEA 2L6GA 3QTHA 4U5HA 4XWJA 2GWWA 4YT5A 3Q7GA 2VCCA 3POVA 2YL7A 1BDJB 4C3EA 2X51A 4CDVA 5A6KA 1YVIA 3LAYA 5L0HA 5JLIA 1NFNA 4WABA 2P7VA 3QVYA 2XXAB 1V74B 1Y6DA 3R2PA 5F5FA 1K05A 1G5ZA 5T3WA 3WHNA 2H7OA 4O6MA 2J45A 1YZAA 2WVQA 4BPMA 2J8WA 3A9CA 4OD4A 1UG7A 1RJ9B 4EUKB 2XXAA 1R4TA 3S28A 2P61A 2YVKA 5DQTA 3ABMC 2HS5A 4PJLA 1GM5A 2EPNA 3H2VA 3LS0A 5BQGA 2PP4A 5EHHA 3TJ5A 2Y69C 1EQ1A 4JJGA 2R7SA 1S05A 1E2XA 1RJ9A 3JRMO 3L0IA 4YL3A 4OINF 3PDMP 1ZHZA 1D1CA 4JJFA 5FCLA 4W8PA 4CS8A 1HMDA 1ZHXA 2YWAA 5HV9A 3KKBA 4Z9JA 3RIPA 3ZTMA 2I15A 2VCBA 1APCA 3NKDA 2NUPA 3H65A 2D4UA 5COGA 1MQVA 2UUIA 1UFBA 3AQBA 5JVEA 1NZEA 2JPUA 1MMNA 2PFDA 2LCHA 4GYTA 5KYUB 3UR3C 4QI2A 2QNLA 2GAQA 1VB5A 1MMDA 3MFNA 3DMDA 3DKAA 2LFFA 3ZVRA 2WZGA 1I4ZA 2WB7A 3W8HA 3AQCA 4P9FA 4U5BE 3N2ZB 3JYYA 1U89A 1VTMP 1OQCA 2P0NA 5KYUA 3ZQVA 3IPMO 2A1DD 1G4US 1OXBA 4LDQA 2V26A 5BQIA 3GM1A 3SXZA 2OG2A 3HLZA 4LDRA 3HKKA 2BC5A 4H54A 2EINC 1OW6A 4P9TA 5L0DA 2W45A 2ASRA 3SNHA 3M4BA 5IY5C 3AG4C 1ZZPA 2B0HA 2A68F 3IEEA 1OR3A 3LESA 2HUJA 1OR2A 1ZW3A 4CDAA 2EPOA 2IYLD 5KYXA 4A2NB 3SYNA 4EIYA 4MTFA 4EWCA 2J46A 4XEFA 2Y3GA 3Q6MA 3WG7C 3Q6NA 3S9OA 2L9JA 1GS9A 1WN0A 2XLVA 4U5GA 1LKXA 1QVXA 1XWJA 5EK0A 4WGYA 2CNWA 1V4AA 2Y39A 1FAPB 5T1DB 1ZVZA 2YL1A 4PR9A 3GWLA 4BJ6C 5E33A 4DRIB 3OEOA 3W4YA 3NYMA 4P6IC 3O55A 3NG1A 2OCCC 4O79A 3FOPA 1T9KA 4O6YA 3ZTZA 4JIOA 2HJMA 2OOCA 2J0WA 5DVWA 3T6GB 1ZHWA 2IXOA 2ZD9A 2J9BA 3JSZA 2NG1A 3AJMA 4ULVA 3C8ZA 3V5XA 3AG3C 2W4BA 3I5QA 4IB4A 4LACB 2J7PA 1I5NA 3TQOA 3UMKA 5BQHA 4YT8A 2NSGA 2Y3DA 4JTCB 4MVSA 4CSAC 4AE4A 1L7CA 3FVYA 3O6XA 1CGNA 1YYXA 3PMRA 4XTKA 1PCXA 3RFYA 3SEOA 5E3AA 3O39A 1WWPA 4JCZA 5L0GA 5DS4A 4KBLA 3RKOF 2J0XA 1BBHA 3NMKA 1MMAA 4YL1A 5E3CA 1PD0A 1VYKA 1OCRC 1Z5ZA 2CW0F 1YARO 2WL8A 4JZAA 4PFPA 3EJNA 3U3BA 1D1AA 3JCUQ 2ICWG 1NBBA 3UMHA 3EG9B 1Y4CA 4Q7CA 3NDBB 1YDIA 2A6HF 2JD3A 3CSKA 3FOOA 4I1OB 2PF4E 1E85A 1NFOA 4YL0A 1BR1A 3TJ6A 2ZXRA 1Q0KA 2LP4A 4NCQA 4EBJA 3QW0A 1HE1A 2ZXOA 1K04A 1Z63A 4E0IA 2HJ3A 4Z9IA 3ECSA 3L1MA 4JTAB 4Q4ZF 1OW7A 4KI2A 4XPYA 3UMIA 2AP3A 4JC7A 2KQ9A 2BE5F 2L6FA 5A6BD 1NLXA 2PBEA 3FAJA 2C04A 3KYJA 3K1HA 4OIPF 3H2UA 1Z23A 4CX9A 2KJGA 1LVKA 3MYFA 1TFOB 1NU7D 3MYIA 4EBBA 2VB6A 1Z7Qc 3AG2C 1RXQA 3DZAA 3IHUA 1ORJA 4MW3A 3GODA 4ZLCA 2PX3A 1Q0FA 4OIRF 1NU9C 2LIGA 2WZFA 4KNWA 2G3KA 2J9VA 3JZ0A 4NQFA 3VAYA 1CPQA 3AGUA 1BR4A 3U5SA 1PV3A 2VH3A 4J30B 2EPKX 4LLEA 3ZC4A 2GA0A 4DVYP 3L8JA 4MVQA 1OKKA 3C8GA 3V7OA 1LIHA 3ASOC 4PK4A 1OCCC 4EHPA 2R9RB 2CYDA 3IQCA 4AX2A 2PX0A 5JP7A 4K7BA 4BEMJ 2IOQA 2QY9A 2OEXA 5JUAA 3N0TA 4O6NA 3ZQYA 2HZ8A 2DGJA 3GORA 1AVOB 4AK9A 3W8IA 3JYHA 1T6UA 3GM3A 1T6IA 3S27A 4J32B 1QSPA 5CI9A 4YT4A 2NUPB 1B68A 1LI5A 1WASA 2IXNA 3FMSA 3JT1A 4IARA 3EHMA 2LQGA 3O10A 3SXKA 4DVZA 1H6GA 3JSEO 4CDYA 3VYWA 3K66A 4ONSA 4E17A 4PJMA 2UUHA 3RQFA 3N24A 1YA9A 3ZDLA 2OU6A 3MBGA 4JRZA
chains in the Genus database with same CATH topology
1LE4A 3R2PA 1OR3A 1LE2A 1OR2A 1BZ4A 1LPEA 1GS9A 1EA8A 2KC3A 1LS4A 1H7IA 1EQ1A 1B68A 1AEPA 1NFOA 3S84A 1NFNA 1YA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LE4 A;  3R2P A;  1OR3 A;  1LE2 A;  1OR2 A;  1BZ4 A;  1LPE A;  1GS9 A;  1EA8 A;  2KC3 A;  1LS4 A;  1H7I A;  1EQ1 A;  1B68 A;  1AEP A;  1NFO A;  3S84 A;  1NFN A;  1YA9 A; 
#chains in the Genus database with same CATH topology
 1LE4 A;  1MNE A;  3KYI A;  3NRH A;  3FHD A;  3HTK C;  4FWV A;  4D4X A;  1HMO A;  3ZWI A;  4IAO A;  4MVR A;  3CQZ A;  1LE2 A;  2KW3 C;  2VCA A;  3TUL A;  2M4E A;  3C7J A;  3RQE A;  1MND A;  2L81 A;  4MQ9 F;  2ETS A;  4RDA A;  2M64 A;  4G7O F;  3MLG A;  2IXM A;  2Q9C A;  3LJB A;  5COM A;  1DOW A;  4E18 A;  1Q0M A;  4BEJ A;  2R7O A;  2W4M A;  2L6H A;  3R7C A;  2KGO A;  4G7H F;  2G62 A;  3B9Q A;  2NUT A;  4HFF B;  3AOU A;  3U9J A;  1OXK A;  2E87 A;  3DJU B;  4YJW A;  1H7I A;  2YKZ A;  2ZPA A;  3DAF A;  3TOL A;  1N1C A;  3LEO A;  2FAP B;  5AC5 A;  1H9T A;  3LS1 A;  3Q7L A;  1A41 A;  1AUE A;  4JUR I;  1T5O A;  5KYX B;  3ITF A;  4YWQ A;  3M15 A;  2TMV P;  4MND A;  3UGP A;  3ABK C;  2KNH A;  3C63 A;  4N4W A;  4ULW A;  2R7X A;  1MMG A;  2NPU A;  1VYI A;  2A0B A;  2MHR A;  3RF3 A;  1CPR A;  3NMJ A;  5A69 A;  1I4Y A;  1OCZ C;  1C02 A;  1QKR A;  3LEV A;  3KPH A;  4U9D A;  1VK5 A;  2W9Y A;  2X0C A;  3T6B A;  2A0U A;  3AGT A;  4YN0 B;  2R7Q A;  1M2O A;  3JTL O;  3EGD A;  3LUT B;  2XLE A;  4U5C E;  4DBQ A;  2HV6 A;  2XSE A;  2YRF A;  2KC3 A;  2XLO A;  2NSF A;  2O9X A;  2ZXP A;  4U5D E;  4CS8 C;  5K0I A;  3SXY A;  4U9E A;  4AL0 A;  3OA1 A;  1A7E A;  2DI3 A;  4IGG A;  4WJ0 A;  1H9G A;  4I3M A;  4JE9 A;  4C3B A;  3G50 A;  1K40 A;  2HSB A;  5A6A A;  2C03 A;  2Q00 A;  4K1O A;  1R5I D;  1TWA A;  3WAQ A;  3CAX A;  1J8Y F;  3ZG1 A;  2YHS A;  1TR2 A;  4G78 A;  2L7A A;  4NTB A;  4AE4 B;  4JKV A;  4MVM A;  3EGX A;  4EBK A;  3K1I A;  1M2V B;  4NTF A;  4FX5 A;  3L34 A;  1VLS A;  3DE9 A;  1TFK B;  4LLC A;  5TJ5 E;  3U2M A;  2KSF A;  2QTV A;  2YLG A;  2XL8 A;  4RBN A;  1V55 C;  4CBE A;  5KYW B;  4YK5 A;  1M57 C;  2XLH A;  2F22 A;  2Q9A A;  4L6R A;  1E83 A;  1XZQ A;  3B71 A;  4MVZ A;  1LM3 B;  2RSE B;  2Y3B A;  3HJC A;  1ZHY A;  4N6C A;  2CDQ A;  1JRA A;  1M2V A;  1G8X A;  1ZU5 A;  2Q4F A;  3G4Z A;  2YLD A;  1JPJ A;  4D4N A;  5KYW A;  1T6Q A;  1G4W R;  4KC9 A;  5L0F A;  3NYJ A;  1QZX A;  2R02 A;  1HE9 A;  3KMI A;  1YA7 O;  4XLP F;  3CZ6 A;  1ZHT A;  4E0H A;  2LFD A;  3QZC A;  4ER9 A;  4DXW A;  2D5R B;  4MS2 A;  1SZI A;  1O3U A;  1WAT A;  1XZP A;  5JRA A;  3IQT A;  3EZH A;  3RVY A;  3GWN A;  3B0U X;  4XLN F;  3U2L A;  3ATP A;  4NY3 A;  3SP1 A;  2FGY A;  3WOD F;  4DOZ A;  3KH2 A;  1ORS C;  2HFI A;  2OJE D;  4JEB A;  1OCO C;  2H8A A;  4MTO A;  1WGW A;  3DM9 B;  3GEH A;  4X0R A;  4CJG A;  1C03 A;  4Q5S F;  1QPU A;  2XL6 A;  4HFK B;  2XLW A;  4MVU A;  1YAU O;  2B0J A;  1O87 A;  4XPW A;  4A4A A;  1VOM A;  3EFO B;  2Q9B A;  3V5Y A;  1EKY A;  2KK1 A;  2XLM A;  2QLA A;  4HE8 D;  3C8G B;  2Y3H A;  3F47 A;  3LLI A;  5DQZ A;  3NKE A;  2XS1 A;  2LD6 A;  1JOG A;  3DI5 A;  1QQ3 A;  1VLT A;  2EIM C;  3DM5 A;  2OJQ A;  2XM0 A;  3LNR A;  3TOM A;  3X1O A;  3EFO A;  1GQA A;  2JX0 A;  3RQG A;  3IQ5 A;  4E7Z A;  1TKN A;  2WVO A;  5JSL A;  1D0Z A;  2ZXW C;  1C17 M;  1ZU4 A;  3HNJ A;  5E2Q A;  2HSQ A;  5L0J A;  2R7V A;  2P1A A;  5KYY B;  1LPE A;  1E86 A;  4UDV A;  4ANJ A;  4FAP B;  3EH2 A;  4XEV A;  4XEK A;  3QVZ A;  1L3P A;  1TWG A;  4AL1 A;  1BR2 A;  2IXP A;  3U8V A;  4DRJ B;  1DOV A;  1QLE C;  1A7V A;  3NMI A;  4MW8 A;  1O5H A;  3S90 A;  2DB4 A;  2J9W A;  4IRU A;  5DS6 A;  5FZT A;  2P6V A;  2R05 A;  5KYY A;  4DRH B;  4OIQ F;  1JR8 A;  5F28 E;  1RCP A;  3U8P A;  4C3D A;  3M4C A;  4H4K C;  4JEA A;  4XPX A;  2XL4 A;  4CIP A;  5L0C A;  5B3S C;  1TWH A;  2VC9 A;  4CS7 A;  2Q3T A;  2WZL A;  2CNW D;  3FXH A;  3K33 A;  3QW1 A;  1JAF A;  5EGY A;  3FAP B;  5JT4 A;  3FDQ A;  3UGO A;  4LER A;  1GGQ A;  3TK0 A;  4N06 A;  3B0P A;  2Z15 A;  5AC4 A;  4GEH A;  3DE8 A;  2H7B A;  3I5P A;  1FMV A;  2NUT B;  3LLK A;  1KNY A;  5COF A;  2AWC A;  1F1M A;  1YZC A;  2J7P D;  1NSG B;  1A7D A;  3B0V C;  1ST6 A;  4QDL A;  1KU2 A;  4W8K A;  3TD7 A;  1FTS A;  4MTG A;  4DBR A;  2EIJ C;  3MX3 A;  3SXM A;  2A69 F;  2XS8 A;  1U0B B;  2HMZ A;  3B29 A;  2CGE A;  3CEX A;  1FFT C;  3M1C B;  3V5Z A;  4CS9 A;  3ASN C;  1JPN A;  1Z3I X;  4M63 A;  1ORY A;  1OW8 A;  5A6B A;  2IBF A;  3IQ6 A;  2I8B A;  3EGD B;  1RKC A;  4BJ6 A;  3AG1 C;  3BRJ A;  1YLM A;  3T9O A;  4ZLD A;  4NTA A;  3KL4 A;  3J06 A;  1FFH A;  3T4R A;  4CJO A;  4U5E E;  1LS1 A;  1SMY F;  1D1B A;  3EZI A;  4QI0 A;  3RYL A;  4LDK A;  4PJN A;  1A0B A;  1EI7 A;  2LK4 A;  3OWT A;  4Z9H A;  3G4X A;  1S7Z A;  3EGX B;  3X2Q C;  2PNO A;  4CSA A;  3DJN B;  4XQ1 A;  3M79 A;  2J9U A;  4NC3 A;  4F4B A;  2KYH A;  2MYS A;  1FNT c;  3EPV A;  2H7V C;  4PAC A;  3GEE A;  4FES A;  1NG1 A;  1WTY A;  4WGZ A;  4BJ5 A;  2XLD A;  4OIO F;  2G3V A;  3L8I A;  2AWY A;  3US6 A;  1ZW2 A;  4CIH A;  1Q0G A;  3LNM B;  5F5H A;  5BUO A;  3K6B A;  4E7S A;  1HW2 A;  5AGF A;  1T01 A;  2R7U A;  5JS5 A;  4I1M A;  3I4U A;  2GDC A;  2R7T A;  2A6E F;  3U0C A;  5HSW A;  3EH1 A;  2R03 A;  2XRH A;  4N6H A;  5CIV A;  2BL2 A;  3DD7 A;  2R25 A;  3F46 A;  1Z6A A;  4IJJ A;  2YL3 A;  1BZ4 A;  1M56 C;  4IWB A;  4DJ9 A;  5L3V A;  1D0Y A;  2MWQ A;  3A11 A;  3JRT A;  4J7Y A;  4CS9 C;  3RH3 A;  1RMV A;  1OKK D;  3C8G D;  4JW1 A;  1JMW A;  3SZR A;  2AU5 A;  2YQY A;  1D0X A;  1M6T A;  1TWC A;  2OQM A;  2EIK C;  2YZS A;  1WOL A;  3U3F A;  4O7G A;  3W2V A;  4PJJ A;  3BEH A;  3DWW A;  4JTD B;  1ZYR F;  2EPM X;  3W2W A;  2HKV A;  1YJG A;  1SYQ A;  4B6I A;  1E84 A;  1VMA A;  2DYS C;  2YEV A;  3S29 A;  3GM2 A;  2EPL X;  3DXJ F;  1FMW A;  256B A;  2HMQ A;  2LSE A;  4G0H A;  4RD9 A;  3QMK A;  2Q7R A;  5DS5 A;  1KTM A;  1TQG A;  4BJ5 C;  1YYJ A;  2GFH A;  3C62 A;  3VM6 A;  2YLI A;  2OKU A;  3EHN A;  3E70 C;  4OD5 A;  3RW0 A;  3NYL A;  3PCV A;  4KNV A;  1HW1 A;  1EA8 A;  1FR0 A;  4K0D A;  2OEV A;  4YT2 A;  3HNL A;  1LS4 A;  2CCY A;  3ABL C;  3K1I C;  2R7W A;  4C7O B;  4EKW A;  3GEI A;  1J8M F;  1SR2 A;  4JVS A;  3VRC A;  5L3Q A;  5CI8 A;  2QUP A;  1LI7 A;  1V54 C;  4BJ1 A;  3HNK A;  5GPG B;  1CGO A;  4MVO A;  2XM4 A;  4G7Z F;  1AEP A;  3U9M A;  1IW7 F;  1IZM A;  2HV7 A;  3S84 A;  2RD9 A;  4I44 A;  2AVK A;  1SF8 A;  2FFH A;  3UNG C;  4C7O A;  5B3I A;  3ZIB A;  3EG9 A;  2IM8 A;  4GQH A;  5D91 A;  1HY5 A;  5DLJ A;  3GAN A;  5B1B C;  3HNI A;  2V3C C;  3EQL F;  2R7R A;  4PFO A;  2QE9 A;  3K7D A;  4HEA J;  5T3T A;  2WVN A;  1RKE B;  3ZSU A;  5L0I A;  4JCH A;  1W2W A;  2VAS A;  3T6J A;  3RVZ A;  1CGM E;  3E9V A;  1PD1 A;  1U6H A;  5D92 A;  5KYN A;  3VF0 A;  3PHF 2;  3DAG A;  4BG0 A;  5A6J A;  2DYR C;  4R32 A;  2YL0 A;  4U5F E;  4BJT A;  3S0X A;  4IAQ A;  4J7T A;  2EIL C;  3C18 A;  5B1A C;  1Q0D A;  1RKE A;  2L6G A;  3QTH A;  4U5H A;  4XWJ A;  2GWW A;  4YT5 A;  3Q7G A;  2VCC A;  3POV A;  2YL7 A;  1BDJ B;  4C3E A;  2X51 A;  4CDV A;  5A6K A;  1YVI A;  3LAY A;  5L0H A;  5JLI A;  1NFN A;  4WAB A;  2P7V A;  3QVY A;  2XXA B;  1V74 B;  1Y6D A;  3R2P A;  5F5F A;  1K05 A;  1G5Z A;  5T3W A;  3WHN A;  2H7O A;  4O6M A;  2J45 A;  1YZA A;  2WVQ A;  4BPM A;  2J8W A;  3A9C A;  4OD4 A;  1UG7 A;  1RJ9 B;  4EUK B;  2XXA A;  1R4T A;  3S28 A;  2P61 A;  2YVK A;  5DQT A;  3ABM C;  2HS5 A;  4PJL A;  1GM5 A;  2EPN A;  3H2V A;  3LS0 A;  5BQG A;  2PP4 A;  5EHH A;  3TJ5 A;  2Y69 C;  1EQ1 A;  4JJG A;  2R7S A;  1S05 A;  1E2X A;  1RJ9 A;  3JRM O;  3L0I A;  4YL3 A;  4OIN F;  3PDM P;  1ZHZ A;  1D1C A;  4JJF A;  5FCL A;  4W8P A;  4CS8 A;  1HMD A;  1ZHX A;  2YWA A;  5HV9 A;  3KKB A;  4Z9J A;  3RIP A;  3ZTM A;  2I15 A;  2VCB A;  1APC A;  3NKD A;  2NUP A;  3H65 A;  2D4U A;  5COG A;  1MQV A;  2UUI A;  1UFB A;  3AQB A;  5JVE A;  1NZE A;  2JPU A;  1MMN A;  2PFD A;  2LCH A;  4GYT A;  5KYU B;  3UR3 C;  4QI2 A;  2QNL A;  2GAQ A;  1VB5 A;  1MMD A;  3MFN A;  3DMD A;  3DKA A;  2LFF A;  3ZVR A;  2WZG A;  1I4Z A;  2WB7 A;  3W8H A;  3AQC A;  4P9F A;  4U5B E;  3N2Z B;  3JYY A;  1U89 A;  1VTM P;  1OQC A;  2P0N A;  5KYU A;  3ZQV A;  3IPM O;  2A1D D;  1G4U S;  1OXB A;  4LDQ A;  2V26 A;  5BQI A;  3GM1 A;  3SXZ A;  2OG2 A;  3HLZ A;  4LDR A;  3HKK A;  2BC5 A;  4H54 A;  2EIN C;  1OW6 A;  4P9T A;  5L0D A;  2W45 A;  2ASR A;  3SNH A;  3M4B A;  5IY5 C;  3AG4 C;  1ZZP A;  2B0H A;  2A68 F;  3IEE A;  1OR3 A;  3LES A;  2HUJ A;  1OR2 A;  1ZW3 A;  4CDA A;  2EPO A;  2IYL D;  5KYX A;  4A2N B;  3SYN A;  4EIY A;  4MTF A;  4EWC A;  2J46 A;  4XEF A;  2Y3G A;  3Q6M A;  3WG7 C;  3Q6N A;  3S9O A;  2L9J A;  1GS9 A;  1WN0 A;  2XLV A;  4U5G A;  1LKX A;  1QVX A;  1XWJ A;  5EK0 A;  4WGY A;  2CNW A;  1V4A A;  2Y39 A;  1FAP B;  5T1D B;  1ZVZ A;  2YL1 A;  4PR9 A;  3GWL A;  4BJ6 C;  5E33 A;  4DRI B;  3OEO A;  3W4Y A;  3NYM A;  4P6I C;  3O55 A;  3NG1 A;  2OCC C;  4O79 A;  3FOP A;  1T9K A;  4O6Y A;  3ZTZ A;  4JIO A;  2HJM A;  2OOC A;  2J0W A;  5DVW A;  3T6G B;  1ZHW A;  2IXO A;  2ZD9 A;  2J9B A;  3JSZ A;  2NG1 A;  3AJM A;  4ULV A;  3C8Z A;  3V5X A;  3AG3 C;  2W4B A;  3I5Q A;  4IB4 A;  4LAC B;  2J7P A;  1I5N A;  3TQO A;  3UMK A;  5BQH A;  4YT8 A;  2NSG A;  2Y3D A;  4JTC B;  4MVS A;  4CSA C;  4AE4 A;  1L7C A;  3FVY A;  3O6X A;  1CGN A;  1YYX A;  3PMR A;  4XTK A;  1PCX A;  3RFY A;  3SEO A;  5E3A A;  3O39 A;  1WWP A;  4JCZ A;  5L0G A;  5DS4 A;  4KBL A;  3RKO F;  2J0X A;  1BBH A;  3NMK A;  1MMA A;  4YL1 A;  5E3C A;  1PD0 A;  1VYK A;  1OCR C;  1Z5Z A;  2CW0 F;  1YAR O;  2WL8 A;  4JZA A;  4PFP A;  3EJN A;  3U3B A;  1D1A A;  3JCU Q;  2ICW G;  1NBB A;  3UMH A;  3EG9 B;  1Y4C A;  4Q7C A;  3NDB B;  1YDI A;  2A6H F;  2JD3 A;  3CSK A;  3FOO A;  4I1O B;  2PF4 E;  1E85 A;  1NFO A;  4YL0 A;  1BR1 A;  3TJ6 A;  2ZXR A;  1Q0K A;  2LP4 A;  4NCQ A;  4EBJ A;  3QW0 A;  1HE1 A;  2ZXO A;  1K04 A;  1Z63 A;  4E0I A;  2HJ3 A;  4Z9I A;  3ECS A;  3L1M A;  4JTA B;  4Q4Z F;  1OW7 A;  4KI2 A;  4XPY A;  3UMI A;  2AP3 A;  4JC7 A;  2KQ9 A;  2BE5 F;  2L6F A;  5A6B D;  1NLX A;  2PBE A;  3FAJ A;  2C04 A;  3KYJ A;  3K1H A;  4OIP F;  3H2U A;  1Z23 A;  4CX9 A;  2KJG A;  1LVK A;  3MYF A;  1TFO B;  1NU7 D;  3MYI A;  4EBB A;  2VB6 A;  1Z7Q c;  3AG2 C;  1RXQ A;  3DZA A;  3IHU A;  1ORJ A;  4MW3 A;  3GOD A;  4ZLC A;  2PX3 A;  1Q0F A;  4OIR F;  1NU9 C;  2LIG A;  2WZF A;  4KNW A;  2G3K A;  2J9V A;  3JZ0 A;  4NQF A;  3VAY A;  1CPQ A;  3AGU A;  1BR4 A;  3U5S A;  1PV3 A;  2VH3 A;  4J30 B;  2EPK X;  4LLE A;  3ZC4 A;  2GA0 A;  4DVY P;  3L8J A;  4MVQ A;  1OKK A;  3C8G A;  3V7O A;  1LIH A;  3ASO C;  4PK4 A;  1OCC C;  4EHP A;  2R9R B;  2CYD A;  3IQC A;  4AX2 A;  2PX0 A;  5JP7 A;  4K7B A;  4BEM J;  2IOQ A;  2QY9 A;  2OEX A;  5JUA A;  3N0T A;  4O6N A;  3ZQY A;  2HZ8 A;  2DGJ A;  3GOR A;  1AVO B;  4AK9 A;  3W8I A;  3JYH A;  1T6U A;  3GM3 A;  1T6I A;  3S27 A;  4J32 B;  1QSP A;  5CI9 A;  4YT4 A;  2NUP B;  1B68 A;  1LI5 A;  1WAS A;  2IXN A;  3FMS A;  3JT1 A;  4IAR A;  3EHM A;  2LQG A;  3O10 A;  3SXK A;  4DVZ A;  1H6G A;  3JSE O;  4CDY A;  3VYW A;  3K66 A;  4ONS A;  4E17 A;  4PJM A;  2UUH A;  3RQF A;  3N24 A;  1YA9 A;  3ZDL A;  2OU6 A;  3MBG A;  4JRZ A; 
#chains in the Genus database with same CATH homology
 1LE4 A;  3R2P A;  1OR3 A;  1LE2 A;  1OR2 A;  1BZ4 A;  1LPE A;  1GS9 A;  1EA8 A;  2KC3 A;  1LS4 A;  1H7I A;  1EQ1 A;  1B68 A;  1AEP A;  1NFO A;  3S84 A;  1NFN A;  1YA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...