1OR2A

Apolipoprotein e3 (apoe3) truncation mutant 165
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
130
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN E
publication title Conformational flexibility in the apolipoprotein E amino-terminal domain structure determined from three new crystal forms: implications for lipid binding.
pubmed rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 47
structure length 130
sequence length 141
ec nomenclature
pdb deposition date 1999-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1or2A00
1H7IA 1LS4A 1LE2A 1LE4A 1YA9A 1GS9A 3R2PA 1OR3A 1EA8A 1LPEA 1BZ4A 1AEPA 1EQ1A 1NFOA 1OR2A 3S84A 2KC3A 1NFNA 1B68A
chains in the Genus database with same CATH superfamily
5KYUA 2WVOA 3RKOF 3TOMA 4E0IA 3US6A 1RKEB 1QQ3A 2ICWG 4YL1A 4JEBA 1ZHXA 2GDCA 5E3AA 5L0HA 5L0FA 1IW7F 1LE2A 3S29A 3TOLA 3HNJA 3N2ZB 4Q4ZF 1U89A 2ZXPA 2XLWA 2L6HA 4FX5A 3AG4C 1H9TA 4OIPF 2TMVP 1NG1A 3LLKA 5EHHA 3HJCA 2UUHA 4OD5A 3BEHA 1RXQA 4JTCB 3RQEA 4CX9A 3RW0A 4EWCA 4YWQA 1KNYA 3U2LA 4U5FE 5T1DB 2YVKA 1YZAA 1ZHWA 4U9EA 3T6GB 1ZW2A 5JVEA 5L3VA 3GODA 5BQIA 5JRAA 3TK0A 4EUKB 1NSGB 1M2VB 2YL0A 3KYJA 2A1DD 2A6HF 3SP1A 2L81A 3AOUA 4LLCA 4CBEA 2EPKX 2LQGA 4BPMA 2J9UA 2I15A 5JT4A 4E0HA 3KKBA 1JAFA 3W2WA 3X1OA 2W4BA 4FAPB 4JE9A 4XPYA 5HV9A 2PX0A 2YRFA 2YLGA 2D5RB 1Z7Qc 3M1CB 3GEEA 3UGPA 1TFKB 1M6TA 3FMSA 3FDQA 2HZ8A 4MVUA 3X2QC 2WVQA 3NMJA 1K05A 3AGUA 4IARA 4E7ZA 2HMZA 5L0DA 1GM5A 3OWTA 2CNWA 1K04A 2R7OA 3EFOA 2Q00A 1LI7A 3C7JA 2IOQA 3HLZA 1AVOB 2PP4A 3NMKA 3UMHA 3N0TA 4YL0A 1H6GA 3ATPA 3ZG1A 3S84A 1LI5A 4J7YA 1YARO 1RKEA 4JJFA 1FFHA 2YWAA 3KMIA 3JSZA 1VK5A 4J7TA 3TJ6A 4HFFB 2YQYA 1YAUO 2XL8A 3CSKA 3Q6NA 3T4RA 2L6FA 1ZHTA 3L0IA 3U5SA 1T6IA 1LS4A 3KH2A 4O6YA 1A41A 1RKCA 3R7CA 5CI9A 3M4CA 2W45A 3S9OA 3TULA 4J30B 4W8PA 2OEVA 3O39A 3K7DA 2F22A 2MWQA 2R25A 4XEVA 4OD4A 3W4YA 4YT4A 3NDBB 3QMKA 5A6JA 1SF8A 4YT8A 3CEXA 2EIKC 1N1CA 4AL0A 1MMNA 1M2VA 4JVSA 4B6IA 1JR8A 3IEEA 2Y3DA 3ZVRA 2EPNA 4WABA 1EQ1A 1Q0DA 4O7GA 4XLNF 1BR4A 2HV6A 2GFHA 1EI7A 3W8HA 4WJ0A 4QDLA 5TJ5E 3PCVA 4MVRA 3U3BA 4EBKA 3HKKA 5DS4A 3RFYA 1OKKD 1SMYF 2A68F 4C3DA 3C8ZA 3RIPA 2R7TA 3DJUB 4RDAA 2A69F 3MX3A 5K0IA 4G78A 3VYWA 3W2VA 1QKRA 3C18A 3K6BA 3UNGC 3B0PA 1SYQA 3NRHA 4RD9A 2H7OA 1O5HA 4AX2A 5DQTA 3H65A 4JJGA 4YT5A 4KC9A 1UFBA 2NUPB 3N24A 2HFIA 4MTFA 2J0XA 1A7VA 3WHNA 4CJGA 1OXKA 4KNVA 4DXWA 3B9QA 4AE4B 4HFKB 1Q0FA 3NKDA 5CI8A 5FZTA 1E85A 3NYJA 1FTSA 3WAQA 3LEVA 2A0BA 2PFDA 2L7AA 3DAGA 1A7DA 1YLMA 2PBEA 2HUJA 2QE9A 4BJTA 1XZPA 3EGXB 4F4BA 1W2WA 2XL6A 2CW0F 1HMOA 3UMKA 1D0ZA 2ASRA 1PD0A 5T3TA 1ZHZA 4AK9A 2R7QA 1VLTA 3L34A 1H9GA 3S27A 3ZWIA 5A6KA 5D91A 3GORA 1T6UA 4K7BA 5EK0A 5GPGB 4O6MA 1J8MF 4HEAJ 2YEVA 3SXYA 2HS5A 2OJQA 1L7CA 3M4BA 4L6RA 4MVQA 2Q9CA 5KYYB 1NZEA 2LSEA 1ORYA 2EIJC 2BE5F 1APCA 4IWBA 4N06A 4XWJA 3CZ6A 1IZMA 5COMA 4PJJA 5L0CA 2KC3A 3RVYA 4JEAA 2J46A 2H8AA 1MNDA 4NY3A 4RBNA 2GA0A 3GM1A 1H7IA 4QI2A 1FAPB 3M79A 4XQ1A 2XLDA 3LNMB 4MW8A 2Q7RA 3ABLC 2J0WA 2EILC 3POVA 2HV7A 3LNRA 2NUPA 1E84A 3ABMC 2Y3BA 2ETSA 2R7VA 1LE4A 3JYHA 1WOLA 2KSFA 4ANJA 1CGOA 4NCQA 4AE4A 5DQZA 1GS9A 2YHSA 3VRCA 4D4XA 2EPMX 4CIHA 5L0JA 3BRJA 2Q4FA 4JKVA 4LDQA 4PJMA 5B3SC 1MNEA 1TWGA 2JX0A 3GWLA 4K0DA 4BG0A 3RH3A 1A7EA 1BZ4A 4HE8D 4NTAA 2NPUA 4XPXA 3AG1C 3VAYA 5FCLA 3U0CA 1V74B 1GGQA 1NFOA 5F28E 3LLIA 1Q0GA 3GM2A 3EGDB 1YDIA 1VTMP 3LUTB 3GEHA 4NC3A 3C62A 4U5HA 3Q7LA 3U2MA 2IXNA 2R7RA 2NUTB 2ZXOA 4Z9IA 1OKKA 3RF3A 2XM0A 2X51A 4BJ6A 2RSEB 3ZC4A 1DOWA 3IQ5A 3U8VA 1C02A 2IXOA 2XS1A 3B0VC 2EINC 4P9TA 3HNLA 3K33A 4PJLA 1LKXA 1G5ZA 2IYLD 1AUEA 3CQZA 5JP7A 4DVYP 5KYYA 2O9XA 4PFPA 1E83A 2IXMA 3O6XA 4C7OB 3R2PA 3FHDA 1ZHYA 4DRHB 1YA7O 5CIVA 5AC5A 4N4WA 1PV3A 2L6GA 2X0CA 1OW7A 3F46A 1D0XA 3VM6A 3RVZA 1RJ9B 2KYHA 2P1AA 2Q9BA 3Q6MA 5D92A 3SXMA 3V5XA 1U0BB 3EQLF 1WWPA 1WGWA 2XM4A 4NQFA 5E3CA 3NKEA 1ZVZA 3EPVA 4BJ1A 3EHNA 1B68A 1VB5A 4LACB 3K1IA 1D1AA 4MS2A 4YN0B 1I4ZA 4DRJB 1RMVA 2KK1A 2WZLA 4JTDB 3VF0A 2XS8A 1TR2A 2BC5A 3SZRA 3GWNA 1JPNA 4KNWA 2VCAA 5AGFA 5F5HA 1S7ZA 3PMRA 4JC7A 5COFA 1YA9A 4E7SA 4ONSA 1SR2A 3DM5A 4MTGA 3U9JA 2QNLA 2WZGA 3T9OA 2NSFA 3DMDA 4FESA 3NYMA 3EH2A 1QPUA 2NUTA 1A0BA 1OR2A 3MBGA 2OQMA 4EBJA 4BEJA 2WB7A 1NBBA 1SZIA 3IQCA 1NFNA 3AG2C 3MYIA 1M57C 4JCHA 3RYLA 3DWWA 3I5PA 1G8XA 4C3EA 1U6HA 2XLHA 1OW6A 3DXJF 3V5ZA 1TKNA 1HW1A 1M56C 1OCOC 2JD3A 3NMIA 3EG9B 2Y3HA 4OINF 4XEFA 3ZSUA 4MQ9F 4BJ6C 4C3BA 4CDAA 4C7OA 2PF4E 3NYLA 1GQAA 2Q3TA 4PJNA 2G3KA 4KI2A 4ZLDA 2YL1A 2EPOA 3W8IA 2J45A 4MVMA 5F5FA 2C04A 3L8JA 2XSEA 3ASOC 1FR0A 4CS8A 1RJ9A 1LM3B 2VASA 4N6CA 1Z5ZA 4G7ZF 1T9KA 4FWVA 3V7OA 2M4EA 1E86A 5JUAA 3IPMO 1LVKA 4CS9A 5E2QA 5A6BD 3HNIA 3MYFA 2LFDA 3E9VA 1BR2A 1EKYA 2OCCC 5DVWA 3ZTZA 3SEOA 1I4YA 3K1IC 4JCZA 3DM9B 2CYDA 4IAQA 1ZYRF 4G7HF 3I4UA 3EZHA 2J9VA 3G50A 3T6JA 4UDVA 2OJED 2M64A 4H54A 3UMIA 4EHPA 3IQTA 1Q0MA 2PX3A 4O6NA 4PK4A 5HSWA 2KNHA 1YVIA 1UG7A 4NTBA 4U5EE 1VYIA 2HSBA 3ASNC 4BJ5A 5IY5C 4W8KA 4MNDA 1EA8A 4MVSA 3J06A 1QSPA 1VYKA 1MMDA 3T6BA 2A6EF 1DOVA 4X0RA 1OCZC 4XPWA 2Q9AA 2P0NA 1K40A 4XTKA 4I1OB 5B1BC 4DVZA 1BR1A 2E87A 1R5ID 3C8GB 5DS5A 2DYSC 1JPJA 3EG9A 1OCRC 2J7PD 4DOZA 1MQVA 4D4NA 2RD9A 1XZQA 2UUIA 3QVYA 2FFHA 4QI0A 1BBHA 2FAPB 2YZSA 3GM3A 4G7OF 2KQ9A 3G4XA 1VOMA 5T3WA 5JS5A 2VC9A 3V5YA 256BA 2QTVA 4KBLA 4LLEA 1S05A 2KGOA 2NG1A 2W4MA 2ZPAA 4CDVA 2R7UA 2XL4A 4CS8C 4OIRF 2NSGA 2DYRC 3U3FA 4MW3A 2XLEA 3SXZA 2Y69C 2GAQA 4LERA 4NTFA 2YL7A 4GEHA 1G4WR 3KYIA 3EGXA 5E33A 4CS9C 4MTOA 2AWYA 3FOOA 1C03A 1V4AA 3O10A 4CS7A 3WODF 2ZD9A 2G62A 5DS6A 1QLEC 1OXBA 4EIYA 2DI3A 2B0JA 2OOCA 4PFOA 2QLAA 3H2VA 5BQHA 2KJGA 1T6QA 4JTAB 4J32B 2WL8A 4CSAA 3FAJA 1LS1A 5EGYA 4PR9A 3ZIBA 1LIHA 2OU6A 3HNKA 4GYTA 4N6HA 5L0GA 2IXPA 3JTLO 2OG2A 1ZW3A 4EKWA 1WASA 3AJMA 2D4UA 3AQBA 3QZCA 1CGME 3OA1A 5L0IA 3C8GA 3EJNA 3EHMA 1F1MA 1V55C 4U5GA 4BJ5C 3JZ0A 4CDYA 2V26A 4GQHA 2QUPA 3A9CA 4IJJA 5KYWB 3DJNB 2C03A 1WTYA 5KYNA 2R05A 4XEKA 4XLPF 2YLIA 2VH3A 2B0HA 2DB4A 2KW3C 5A6BA 4YK5A 3ZTMA 3TD7A 2R02A 2VCBA 1M2OA 3AG3C 2AU5A 2GWWA 4Z9HA 4LDRA 3LS1A 2IM8A 3E70C 2Z15A 4ZLCA 2P7VA 2XLVA 4DBRA 1HY5A 4Q5SF 4A4AA 3LJBA 1L3PA 2Y39A 4U5DE 5KYXB 3UR3C 3HTKC 3PHF2 1NLXA 2R7WA 2XXAB 5B3IA 4OIOF 1D1CA 3JSEO 3EGDA 4I1MA 1QVXA 1Z63A 1R4TA 3EZIA 2EPLX 3FAPB 3QW1A 2A0UA 3S90A 1YJGA 2JPUA 3GANA 3U8PA 3LS0A 1YZCA 1NU7D 2I8BA 1JRAA 3SYNA 3DD7A 2QY9A 4CIPA 5L3QA 2G3VA 2H7BA 2J9BA 3IQ6A 4ULVA 1ORJA 2J7PA 1TWAA 2HJ3A 2W9YA 3JRTA 3RQFA 4BEMJ 2HSQA 3JCUQ 3M15A 3QTHA 1ZU5A 2LFFA 3L8IA 4H4KC 4JW1A 4P6IC 4ULWA 3QW0A 2AWCA 3TQOA 3TJ5A 4E17A 2YLDA 2CGEA 4CSAC 1XWJA 2HKVA 2J9WA 4WGYA 2LCHA 3DI5A 2PNOA 1I5NA 3DZAA 3H2UA 3JYYA 3LESA 2HMQA 4JZAA 5A69A 1OCCC 4EBBA 4IGGA 4ER9A 5KYWA 1YYXA 3EH1A 4DJ9A 1J8YF 2XLOA 3C8GD 2IBFA 2YKZA 5DLJA 3DKAA 3B0UX 5BUOA 2DGJA 1TQGA 2J8WA 3LAYA 4AL1A 2WZFA 3C63A 1Z6AA 3A11A 5BQGA 2MYSA 3S0XA 4M63A 2R7XA 3I5QA 4I3MA 2VCCA 3ABKC 3DE8A 2CCYA 3FOPA 4K1OA 4LDKA 1D1BA 1Q0KA 1Y4CA 4G0HA 1V54C 4I44A 1JOGA 1QZXA 4O79A 5COGA 4U5BE 4R32A 3L1MA 3SXKA 3ZDLA 3ZQVA 3GEIA 4YL3A 3FVYA 1Y6DA 1TWHA 1PCXA 1HE9A 3NG1A 4JIOA 2LD6A 1VLSA 1T5OA 5JSLA 1BDJB 3U9MA 4A2NB 1O87A 1MMAA 2AVKA 2P61A 4DBQA 3AQCA 5JLIA 5KYXA 3ECSA 1HMDA 5KYUB 2HJMA 1CGNA 2XXAA 4MVZA 3DE9A 2V3CC 1G4US 2ZXRA 3QVZA 1NU9C 5A6AA 5AC4A 1MMGA 2P6VA 2R7SA 1OQCA 2CNWD 1Z3IX 3WG7C 4OIQF 1VMAA 4IB4A 3PDMP 3F47A 1D0YA 3O55A 1FMWA 1ORSC 1TFOB 3AGTA 3RQGA 1O3UA 3JT1A 1ZU4A 1TWCA 3S28A 2AP3A 2YL3A 1ZZPA 1KU2A 1E2XA 4MVOA 4U9DA 4E18A 1HW2A 3K66A 4P9FA 3KPHA 3SNHA 3UGOA 3MFNA 2Y3GA 1C17M 1YYJA 2R03A 2VB6A 2WVNA 2H7VC 2LP4A 2R9RB 1ST6A 1WN0A 1HE1A 4Z9JA 2ZXWC 3K1HA 1WATA 4CJOA 2L9JA 1Z23A 4JURI 1JMWA 1FMVA 2LK4A 2XRHA 3Q7GA 3OEOA 1KTMA 1FFTC 3DAFA 3ITFA 2CDQA 3IHUA 2OEXA 4JRZA 4IRUA 1CPQA 2LIGA 4WGZA 5B1AC 2FGYA 3JRMO 2MHRA 4PACA 1T01A 1OR3A 2EIMC 1OW8A 1LPEA 1PD1A 3KL4A 4U5CE 4YT2A 4Q7CA 3G4ZA 4YJWA 3B71A 3CAXA 1FNTc 1AEPA 4IAOA 4DRIB 2BL2A 3ZQYA 2OKUA 1RCPA 3B29A 3MLGA 3EFOB 3LEOA 1CPRA 2XLMA 3FXHA
chains in the Genus database with same CATH topology
1H7IA 1LS4A 1LE2A 1LE4A 1YA9A 1GS9A 3R2PA 1OR3A 1EA8A 1LPEA 1BZ4A 1AEPA 1EQ1A 1NFOA 1OR2A 3S84A 2KC3A 1NFNA 1B68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7I A;  1LS4 A;  1LE2 A;  1LE4 A;  1YA9 A;  1GS9 A;  3R2P A;  1OR3 A;  1EA8 A;  1LPE A;  1BZ4 A;  1AEP A;  1EQ1 A;  1NFO A;  1OR2 A;  3S84 A;  2KC3 A;  1NFN A;  1B68 A; 
#chains in the Genus database with same CATH topology
 5KYU A;  2WVO A;  3RKO F;  3TOM A;  4E0I A;  3US6 A;  1RKE B;  1QQ3 A;  2ICW G;  4YL1 A;  4JEB A;  1ZHX A;  2GDC A;  5E3A A;  5L0H A;  5L0F A;  1IW7 F;  1LE2 A;  3S29 A;  3TOL A;  3HNJ A;  3N2Z B;  4Q4Z F;  1U89 A;  2ZXP A;  2XLW A;  2L6H A;  4FX5 A;  3AG4 C;  1H9T A;  4OIP F;  2TMV P;  1NG1 A;  3LLK A;  5EHH A;  3HJC A;  2UUH A;  4OD5 A;  3BEH A;  1RXQ A;  4JTC B;  3RQE A;  4CX9 A;  3RW0 A;  4EWC A;  4YWQ A;  1KNY A;  3U2L A;  4U5F E;  5T1D B;  2YVK A;  1YZA A;  1ZHW A;  4U9E A;  3T6G B;  1ZW2 A;  5JVE A;  5L3V A;  3GOD A;  5BQI A;  5JRA A;  3TK0 A;  4EUK B;  1NSG B;  1M2V B;  2YL0 A;  3KYJ A;  2A1D D;  2A6H F;  3SP1 A;  2L81 A;  3AOU A;  4LLC A;  4CBE A;  2EPK X;  2LQG A;  4BPM A;  2J9U A;  2I15 A;  5JT4 A;  4E0H A;  3KKB A;  1JAF A;  3W2W A;  3X1O A;  2W4B A;  4FAP B;  4JE9 A;  4XPY A;  5HV9 A;  2PX0 A;  2YRF A;  2YLG A;  2D5R B;  1Z7Q c;  3M1C B;  3GEE A;  3UGP A;  1TFK B;  1M6T A;  3FMS A;  3FDQ A;  2HZ8 A;  4MVU A;  3X2Q C;  2WVQ A;  3NMJ A;  1K05 A;  3AGU A;  4IAR A;  4E7Z A;  2HMZ A;  5L0D A;  1GM5 A;  3OWT A;  2CNW A;  1K04 A;  2R7O A;  3EFO A;  2Q00 A;  1LI7 A;  3C7J A;  2IOQ A;  3HLZ A;  1AVO B;  2PP4 A;  3NMK A;  3UMH A;  3N0T A;  4YL0 A;  1H6G A;  3ATP A;  3ZG1 A;  3S84 A;  1LI5 A;  4J7Y A;  1YAR O;  1RKE A;  4JJF A;  1FFH A;  2YWA A;  3KMI A;  3JSZ A;  1VK5 A;  4J7T A;  3TJ6 A;  4HFF B;  2YQY A;  1YAU O;  2XL8 A;  3CSK A;  3Q6N A;  3T4R A;  2L6F A;  1ZHT A;  3L0I A;  3U5S A;  1T6I A;  1LS4 A;  3KH2 A;  4O6Y A;  1A41 A;  1RKC A;  3R7C A;  5CI9 A;  3M4C A;  2W45 A;  3S9O A;  3TUL A;  4J30 B;  4W8P A;  2OEV A;  3O39 A;  3K7D A;  2F22 A;  2MWQ A;  2R25 A;  4XEV A;  4OD4 A;  3W4Y A;  4YT4 A;  3NDB B;  3QMK A;  5A6J A;  1SF8 A;  4YT8 A;  3CEX A;  2EIK C;  1N1C A;  4AL0 A;  1MMN A;  1M2V A;  4JVS A;  4B6I A;  1JR8 A;  3IEE A;  2Y3D A;  3ZVR A;  2EPN A;  4WAB A;  1EQ1 A;  1Q0D A;  4O7G A;  4XLN F;  1BR4 A;  2HV6 A;  2GFH A;  1EI7 A;  3W8H A;  4WJ0 A;  4QDL A;  5TJ5 E;  3PCV A;  4MVR A;  3U3B A;  4EBK A;  3HKK A;  5DS4 A;  3RFY A;  1OKK D;  1SMY F;  2A68 F;  4C3D A;  3C8Z A;  3RIP A;  2R7T A;  3DJU B;  4RDA A;  2A69 F;  3MX3 A;  5K0I A;  4G78 A;  3VYW A;  3W2V A;  1QKR A;  3C18 A;  3K6B A;  3UNG C;  3B0P A;  1SYQ A;  3NRH A;  4RD9 A;  2H7O A;  1O5H A;  4AX2 A;  5DQT A;  3H65 A;  4JJG A;  4YT5 A;  4KC9 A;  1UFB A;  2NUP B;  3N24 A;  2HFI A;  4MTF A;  2J0X A;  1A7V A;  3WHN A;  4CJG A;  1OXK A;  4KNV A;  4DXW A;  3B9Q A;  4AE4 B;  4HFK B;  1Q0F A;  3NKD A;  5CI8 A;  5FZT A;  1E85 A;  3NYJ A;  1FTS A;  3WAQ A;  3LEV A;  2A0B A;  2PFD A;  2L7A A;  3DAG A;  1A7D A;  1YLM A;  2PBE A;  2HUJ A;  2QE9 A;  4BJT A;  1XZP A;  3EGX B;  4F4B A;  1W2W A;  2XL6 A;  2CW0 F;  1HMO A;  3UMK A;  1D0Z A;  2ASR A;  1PD0 A;  5T3T A;  1ZHZ A;  4AK9 A;  2R7Q A;  1VLT A;  3L34 A;  1H9G A;  3S27 A;  3ZWI A;  5A6K A;  5D91 A;  3GOR A;  1T6U A;  4K7B A;  5EK0 A;  5GPG B;  4O6M A;  1J8M F;  4HEA J;  2YEV A;  3SXY A;  2HS5 A;  2OJQ A;  1L7C A;  3M4B A;  4L6R A;  4MVQ A;  2Q9C A;  5KYY B;  1NZE A;  2LSE A;  1ORY A;  2EIJ C;  2BE5 F;  1APC A;  4IWB A;  4N06 A;  4XWJ A;  3CZ6 A;  1IZM A;  5COM A;  4PJJ A;  5L0C A;  2KC3 A;  3RVY A;  4JEA A;  2J46 A;  2H8A A;  1MND A;  4NY3 A;  4RBN A;  2GA0 A;  3GM1 A;  1H7I A;  4QI2 A;  1FAP B;  3M79 A;  4XQ1 A;  2XLD A;  3LNM B;  4MW8 A;  2Q7R A;  3ABL C;  2J0W A;  2EIL C;  3POV A;  2HV7 A;  3LNR A;  2NUP A;  1E84 A;  3ABM C;  2Y3B A;  2ETS A;  2R7V A;  1LE4 A;  3JYH A;  1WOL A;  2KSF A;  4ANJ A;  1CGO A;  4NCQ A;  4AE4 A;  5DQZ A;  1GS9 A;  2YHS A;  3VRC A;  4D4X A;  2EPM X;  4CIH A;  5L0J A;  3BRJ A;  2Q4F A;  4JKV A;  4LDQ A;  4PJM A;  5B3S C;  1MNE A;  1TWG A;  2JX0 A;  3GWL A;  4K0D A;  4BG0 A;  3RH3 A;  1A7E A;  1BZ4 A;  4HE8 D;  4NTA A;  2NPU A;  4XPX A;  3AG1 C;  3VAY A;  5FCL A;  3U0C A;  1V74 B;  1GGQ A;  1NFO A;  5F28 E;  3LLI A;  1Q0G A;  3GM2 A;  3EGD B;  1YDI A;  1VTM P;  3LUT B;  3GEH A;  4NC3 A;  3C62 A;  4U5H A;  3Q7L A;  3U2M A;  2IXN A;  2R7R A;  2NUT B;  2ZXO A;  4Z9I A;  1OKK A;  3RF3 A;  2XM0 A;  2X51 A;  4BJ6 A;  2RSE B;  3ZC4 A;  1DOW A;  3IQ5 A;  3U8V A;  1C02 A;  2IXO A;  2XS1 A;  3B0V C;  2EIN C;  4P9T A;  3HNL A;  3K33 A;  4PJL A;  1LKX A;  1G5Z A;  2IYL D;  1AUE A;  3CQZ A;  5JP7 A;  4DVY P;  5KYY A;  2O9X A;  4PFP A;  1E83 A;  2IXM A;  3O6X A;  4C7O B;  3R2P A;  3FHD A;  1ZHY A;  4DRH B;  1YA7 O;  5CIV A;  5AC5 A;  4N4W A;  1PV3 A;  2L6G A;  2X0C A;  1OW7 A;  3F46 A;  1D0X A;  3VM6 A;  3RVZ A;  1RJ9 B;  2KYH A;  2P1A A;  2Q9B A;  3Q6M A;  5D92 A;  3SXM A;  3V5X A;  1U0B B;  3EQL F;  1WWP A;  1WGW A;  2XM4 A;  4NQF A;  5E3C A;  3NKE A;  1ZVZ A;  3EPV A;  4BJ1 A;  3EHN A;  1B68 A;  1VB5 A;  4LAC B;  3K1I A;  1D1A A;  4MS2 A;  4YN0 B;  1I4Z A;  4DRJ B;  1RMV A;  2KK1 A;  2WZL A;  4JTD B;  3VF0 A;  2XS8 A;  1TR2 A;  2BC5 A;  3SZR A;  3GWN A;  1JPN A;  4KNW A;  2VCA A;  5AGF A;  5F5H A;  1S7Z A;  3PMR A;  4JC7 A;  5COF A;  1YA9 A;  4E7S A;  4ONS A;  1SR2 A;  3DM5 A;  4MTG A;  3U9J A;  2QNL A;  2WZG A;  3T9O A;  2NSF A;  3DMD A;  4FES A;  3NYM A;  3EH2 A;  1QPU A;  2NUT A;  1A0B A;  1OR2 A;  3MBG A;  2OQM A;  4EBJ A;  4BEJ A;  2WB7 A;  1NBB A;  1SZI A;  3IQC A;  1NFN A;  3AG2 C;  3MYI A;  1M57 C;  4JCH A;  3RYL A;  3DWW A;  3I5P A;  1G8X A;  4C3E A;  1U6H A;  2XLH A;  1OW6 A;  3DXJ F;  3V5Z A;  1TKN A;  1HW1 A;  1M56 C;  1OCO C;  2JD3 A;  3NMI A;  3EG9 B;  2Y3H A;  4OIN F;  4XEF A;  3ZSU A;  4MQ9 F;  4BJ6 C;  4C3B A;  4CDA A;  4C7O A;  2PF4 E;  3NYL A;  1GQA A;  2Q3T A;  4PJN A;  2G3K A;  4KI2 A;  4ZLD A;  2YL1 A;  2EPO A;  3W8I A;  2J45 A;  4MVM A;  5F5F A;  2C04 A;  3L8J A;  2XSE A;  3ASO C;  1FR0 A;  4CS8 A;  1RJ9 A;  1LM3 B;  2VAS A;  4N6C A;  1Z5Z A;  4G7Z F;  1T9K A;  4FWV A;  3V7O A;  2M4E A;  1E86 A;  5JUA A;  3IPM O;  1LVK A;  4CS9 A;  5E2Q A;  5A6B D;  3HNI A;  3MYF A;  2LFD A;  3E9V A;  1BR2 A;  1EKY A;  2OCC C;  5DVW A;  3ZTZ A;  3SEO A;  1I4Y A;  3K1I C;  4JCZ A;  3DM9 B;  2CYD A;  4IAQ A;  1ZYR F;  4G7H F;  3I4U A;  3EZH A;  2J9V A;  3G50 A;  3T6J A;  4UDV A;  2OJE D;  2M64 A;  4H54 A;  3UMI A;  4EHP A;  3IQT A;  1Q0M A;  2PX3 A;  4O6N A;  4PK4 A;  5HSW A;  2KNH A;  1YVI A;  1UG7 A;  4NTB A;  4U5E E;  1VYI A;  2HSB A;  3ASN C;  4BJ5 A;  5IY5 C;  4W8K A;  4MND A;  1EA8 A;  4MVS A;  3J06 A;  1QSP A;  1VYK A;  1MMD A;  3T6B A;  2A6E F;  1DOV A;  4X0R A;  1OCZ C;  4XPW A;  2Q9A A;  2P0N A;  1K40 A;  4XTK A;  4I1O B;  5B1B C;  4DVZ A;  1BR1 A;  2E87 A;  1R5I D;  3C8G B;  5DS5 A;  2DYS C;  1JPJ A;  3EG9 A;  1OCR C;  2J7P D;  4DOZ A;  1MQV A;  4D4N A;  2RD9 A;  1XZQ A;  2UUI A;  3QVY A;  2FFH A;  4QI0 A;  1BBH A;  2FAP B;  2YZS A;  3GM3 A;  4G7O F;  2KQ9 A;  3G4X A;  1VOM A;  5T3W A;  5JS5 A;  2VC9 A;  3V5Y A;  256B A;  2QTV A;  4KBL A;  4LLE A;  1S05 A;  2KGO A;  2NG1 A;  2W4M A;  2ZPA A;  4CDV A;  2R7U A;  2XL4 A;  4CS8 C;  4OIR F;  2NSG A;  2DYR C;  3U3F A;  4MW3 A;  2XLE A;  3SXZ A;  2Y69 C;  2GAQ A;  4LER A;  4NTF A;  2YL7 A;  4GEH A;  1G4W R;  3KYI A;  3EGX A;  5E33 A;  4CS9 C;  4MTO A;  2AWY A;  3FOO A;  1C03 A;  1V4A A;  3O10 A;  4CS7 A;  3WOD F;  2ZD9 A;  2G62 A;  5DS6 A;  1QLE C;  1OXB A;  4EIY A;  2DI3 A;  2B0J A;  2OOC A;  4PFO A;  2QLA A;  3H2V A;  5BQH A;  2KJG A;  1T6Q A;  4JTA B;  4J32 B;  2WL8 A;  4CSA A;  3FAJ A;  1LS1 A;  5EGY A;  4PR9 A;  3ZIB A;  1LIH A;  2OU6 A;  3HNK A;  4GYT A;  4N6H A;  5L0G A;  2IXP A;  3JTL O;  2OG2 A;  1ZW3 A;  4EKW A;  1WAS A;  3AJM A;  2D4U A;  3AQB A;  3QZC A;  1CGM E;  3OA1 A;  5L0I A;  3C8G A;  3EJN A;  3EHM A;  1F1M A;  1V55 C;  4U5G A;  4BJ5 C;  3JZ0 A;  4CDY A;  2V26 A;  4GQH A;  2QUP A;  3A9C A;  4IJJ A;  5KYW B;  3DJN B;  2C03 A;  1WTY A;  5KYN A;  2R05 A;  4XEK A;  4XLP F;  2YLI A;  2VH3 A;  2B0H A;  2DB4 A;  2KW3 C;  5A6B A;  4YK5 A;  3ZTM A;  3TD7 A;  2R02 A;  2VCB A;  1M2O A;  3AG3 C;  2AU5 A;  2GWW A;  4Z9H A;  4LDR A;  3LS1 A;  2IM8 A;  3E70 C;  2Z15 A;  4ZLC A;  2P7V A;  2XLV A;  4DBR A;  1HY5 A;  4Q5S F;  4A4A A;  3LJB A;  1L3P A;  2Y39 A;  4U5D E;  5KYX B;  3UR3 C;  3HTK C;  3PHF 2;  1NLX A;  2R7W A;  2XXA B;  5B3I A;  4OIO F;  1D1C A;  3JSE O;  3EGD A;  4I1M A;  1QVX A;  1Z63 A;  1R4T A;  3EZI A;  2EPL X;  3FAP B;  3QW1 A;  2A0U A;  3S90 A;  1YJG A;  2JPU A;  3GAN A;  3U8P A;  3LS0 A;  1YZC A;  1NU7 D;  2I8B A;  1JRA A;  3SYN A;  3DD7 A;  2QY9 A;  4CIP A;  5L3Q A;  2G3V A;  2H7B A;  2J9B A;  3IQ6 A;  4ULV A;  1ORJ A;  2J7P A;  1TWA A;  2HJ3 A;  2W9Y A;  3JRT A;  3RQF A;  4BEM J;  2HSQ A;  3JCU Q;  3M15 A;  3QTH A;  1ZU5 A;  2LFF A;  3L8I A;  4H4K C;  4JW1 A;  4P6I C;  4ULW A;  3QW0 A;  2AWC A;  3TQO A;  3TJ5 A;  4E17 A;  2YLD A;  2CGE A;  4CSA C;  1XWJ A;  2HKV A;  2J9W A;  4WGY A;  2LCH A;  3DI5 A;  2PNO A;  1I5N A;  3DZA A;  3H2U A;  3JYY A;  3LES A;  2HMQ A;  4JZA A;  5A69 A;  1OCC C;  4EBB A;  4IGG A;  4ER9 A;  5KYW A;  1YYX A;  3EH1 A;  4DJ9 A;  1J8Y F;  2XLO A;  3C8G D;  2IBF A;  2YKZ A;  5DLJ A;  3DKA A;  3B0U X;  5BUO A;  2DGJ A;  1TQG A;  2J8W A;  3LAY A;  4AL1 A;  2WZF A;  3C63 A;  1Z6A A;  3A11 A;  5BQG A;  2MYS A;  3S0X A;  4M63 A;  2R7X A;  3I5Q A;  4I3M A;  2VCC A;  3ABK C;  3DE8 A;  2CCY A;  3FOP A;  4K1O A;  4LDK A;  1D1B A;  1Q0K A;  1Y4C A;  4G0H A;  1V54 C;  4I44 A;  1JOG A;  1QZX A;  4O79 A;  5COG A;  4U5B E;  4R32 A;  3L1M A;  3SXK A;  3ZDL A;  3ZQV A;  3GEI A;  4YL3 A;  3FVY A;  1Y6D A;  1TWH A;  1PCX A;  1HE9 A;  3NG1 A;  4JIO A;  2LD6 A;  1VLS A;  1T5O A;  5JSL A;  1BDJ B;  3U9M A;  4A2N B;  1O87 A;  1MMA A;  2AVK A;  2P61 A;  4DBQ A;  3AQC A;  5JLI A;  5KYX A;  3ECS A;  1HMD A;  5KYU B;  2HJM A;  1CGN A;  2XXA A;  4MVZ A;  3DE9 A;  2V3C C;  1G4U S;  2ZXR A;  3QVZ A;  1NU9 C;  5A6A A;  5AC4 A;  1MMG A;  2P6V A;  2R7S A;  1OQC A;  2CNW D;  1Z3I X;  3WG7 C;  4OIQ F;  1VMA A;  4IB4 A;  3PDM P;  3F47 A;  1D0Y A;  3O55 A;  1FMW A;  1ORS C;  1TFO B;  3AGT A;  3RQG A;  1O3U A;  3JT1 A;  1ZU4 A;  1TWC A;  3S28 A;  2AP3 A;  2YL3 A;  1ZZP A;  1KU2 A;  1E2X A;  4MVO A;  4U9D A;  4E18 A;  1HW2 A;  3K66 A;  4P9F A;  3KPH A;  3SNH A;  3UGO A;  3MFN A;  2Y3G A;  1C17 M;  1YYJ A;  2R03 A;  2VB6 A;  2WVN A;  2H7V C;  2LP4 A;  2R9R B;  1ST6 A;  1WN0 A;  1HE1 A;  4Z9J A;  2ZXW C;  3K1H A;  1WAT A;  4CJO A;  2L9J A;  1Z23 A;  4JUR I;  1JMW A;  1FMV A;  2LK4 A;  2XRH A;  3Q7G A;  3OEO A;  1KTM A;  1FFT C;  3DAF A;  3ITF A;  2CDQ A;  3IHU A;  2OEX A;  4JRZ A;  4IRU A;  1CPQ A;  2LIG A;  4WGZ A;  5B1A C;  2FGY A;  3JRM O;  2MHR A;  4PAC A;  1T01 A;  1OR3 A;  2EIM C;  1OW8 A;  1LPE A;  1PD1 A;  3KL4 A;  4U5C E;  4YT2 A;  4Q7C A;  3G4Z A;  4YJW A;  3B71 A;  3CAX A;  1FNT c;  1AEP A;  4IAO A;  4DRI B;  2BL2 A;  3ZQY A;  2OKU A;  1RCP A;  3B29 A;  3MLG A;  3EFO B;  3LEO A;  1CPR A;  2XLM A;  3FXH A; 
#chains in the Genus database with same CATH homology
 1H7I A;  1LS4 A;  1LE2 A;  1LE4 A;  1YA9 A;  1GS9 A;  3R2P A;  1OR3 A;  1EA8 A;  1LPE A;  1BZ4 A;  1AEP A;  1EQ1 A;  1NFO A;  1OR2 A;  3S84 A;  2KC3 A;  1NFN A;  1B68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...