1YLMA

Structure of cytosolic protein of unknown function yute from bacillus subtilis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
MYFVDRSKIEKTLGFFEHQLALFDSQTDWQSEIGELALQRIGHLLIECILDTGNDMIDGFIMRDPGSYDDIMDILVDEKVVTEKEGDELKKLIAYRKTLVQQYLLADSGELYRLIKAHQTALQDFPKRIRSYLETELGPVSAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hypothetical cytosolic protein YutE from Bacillus subtilis
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein BSU32300
total genus 50
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01934 DUF86 Protein of unknown function DUF86
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.580 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) bsu32300-like 1ylmA00
1YLMA
chains in the Genus database with same CATH superfamily
1LE4A 5GPGB 5AC4A 4OIPF 2VB6A 1DOWA 3EHNA 1Z6AA 1M2VB 3QW0A 4ER9A 1WTYA 1JPJA 4EKWA 2GA0A 2KSFA 4E0HA 3HNIA 2KNHA 2DGJA 3WODF 3K33A 4DRJB 4IAOA 5HSWA 2L7AA 3ZQVA 3G50A 1YA7O 3AGUA 3C7JA 3LJBA 4U9EA 5A6BA 1TQGA 2IXPA 2EIJC 1J8YF 1VB5A 2XM0A 3A11A 3G4ZA 3TJ6A 4K1OA 4DVYP 5L0CA 4G78A 5KYWA 3R7CA 5KYYB 4E7SA 1MMAA 1QPUA 3VYWA 3ZC4A 5A6AA 4P6IC 3EQLF 5A6BD 2HJ3A 4BG0A 3EZIA 4G0HA 4NTFA 4DBQA 3M79A 4E18A 2I8BA 4EBJA 2P6VA 3PMRA 4JCZA 4G7ZF 3JSEO 3UMKA 4BJTA 1T01A 2H7BA 4PJNA 3IQ5A 4JKVA 2GDCA 4N06A 2X51A 4XLNF 4QI0A 3SXMA 2AVKA 3IEEA 4MVQA 4NTBA 4BJ6C 2ETSA 3ATPA 1BZ4A 4RBNA 3VF0A 4K7BA 1NFNA 1SR2A 2J0XA 2XLDA 1A7EA 3M4BA 4RD9A 4CDYA 4CSAA 2VC9A 4U5FE 1Q0DA 1VYKA 1LE2A 1HMDA 4OINF 3SNHA 1B68A 4AL1A 2D5RB 2KC3A 3AJMA 3L8IA 4JTDB 3RKOF 5AC5A 3UGOA 5JSLA 3AQCA 2NUPB 1IZMA 2Y3DA 2Q3TA 2HFIA 4RDAA 2VCBA 1SYQA 4AE4A 3JYYA 4C7OA 4U5EE 3T6JA 1C02A 1K04A 1TWGA 4CDVA 4LLEA 3LLIA 3QVZA 4MQ9F 3GEIA 4E17A 1O5HA 2XLEA 3AOUA 5AGFA 2IBFA 3GWNA 3PCVA 2R9RB 3KYIA 1N1CA 4N6CA 1T5OA 3EHMA 3RQGA 2VH3A 1M6TA 4LLCA 5E3AA 3TQOA 2CW0F 3NMKA 4BJ1A 1LPEA 4WGZA 2R05A 3MFNA 5DQZA 2YRFA 4I3MA 1FTSA 2OOCA 4MW3A 4OD4A 3ZSUA 2XL8A 3E9VA 1H9GA 2A6HF 1KU2A 2CCYA 2WVQA 4JCHA 2PFDA 2W4MA 5DVWA 4OIQF 1OCZC 3G4XA 4A2NB 1CPQA 5JRAA 1VLTA 3FAJA 4H4KC 2NUTA 3EFOA 4Z9HA 4Z9IA 4EWCA 1D1CA 4J7TA 1BR4A 2AWYA 3H65A 2XXAB 1V74B 3ZIBA 3C8GD 3V5YA 5JLIA 4E7ZA 1T6UA 3SYNA 2DB4A 4CSAC 2FFHA 2YL3A 3OEOA 4JEAA 3ZWIA 2HV6A 5JP7A 5B3SC 4OD5A 1JMWA 3C8GA 1CGME 3UMHA 1EI7A 1AVOB 2EILC 4KC9A 2XM4A 4JW1A 2HMZA 3DAFA 4U9DA 5CIVA 3RW0A 5D92A 1LI7A 1ZU5A 4NY3A 4YL1A 1MNDA 1TKNA 2B0HA 2Z15A 5KYUA 4ZLCA 2IXMA 2XLHA 1BR2A 2DI3A 2Q9AA 5A6KA 5FCLA 4P9TA 4AL0A 1A41A 3K1HA 5L0DA 1OKKD 1W2WA 1Z23A 2WVNA 2JD3A 2XLVA 4DVZA 2Y39A 1Z63A 4PR9A 4LDRA 5IY5C 3LESA 3FDQA 2XLMA 2J9VA 1TFOB 5F5FA 2XLOA 4YL3A 4LDKA 1YJGA 3W8HA 3L0IA 4MS2A 2C04A 2PX0A 4MNDA 3W2VA 3FOOA 3ZTZA 4DJ9A 1SF8A 1LKXA 2G3KA 3DD7A 4BJ5C 2EINC 3Q6NA 2A69F 2KYHA 3C8ZA 2A68F 1WN0A 2LSEA 2BE5F 2WVOA 5D91A 2A1DD 1R5ID 1SMYF 2R7XA 2C03A 1LI5A 1A0BA 1TWCA 1FMWA 5DQTA 2EIMC 2Y3GA 4JTAB 2KW3C 1FNTc 1U89A 3GEHA 4PJLA 4ZLDA 4EHPA 4O6NA 3CAXA 3U5SA 1S05A 3SZRA 1PD1A 4JTCB 3V5XA 2OKUA 2YWAA 3JSZA 5JVEA 1RXQA 2PP4A 2R7TA 1M2OA 2J7PA 4YK5A 1YYXA 3IQCA 2YZSA 1WOLA 3DAGA 1C03A 1H9TA 3L34A 3R2PA 4I1OB 2OJQA 1NZEA 5COGA 1E83A 3FXHA 1NFOA 1NU9C 1RKEB 2FAPB 3GM3A 3RYLA 3UR3C 5KYXB 3CSKA 3POVA 4J32B 3UMIA 3K1IC 4C7OB 2HS5A 1RCPA 1LS4A 3KPHA 3NKDA 4Q5SF 1OKKA 4JJGA 3IQ6A 1TFKB 1VOMA 2HUJA 4Q7CA 3KKBA 3EPVA 1LS1A 4L6RA 1E85A 1OR3A 2LP4A 1E84A 2I15A 4UDVA 3M15A 2HV7A 2ZD9A 2EPOA 4ULWA 3GM1A 3NDBB 2LQGA 3EG9A 3WAQA 1OW7A 3S29A 1HW2A 2ICWG 2F22A 1ZVZA 3RQEA 4CDAA 4GEHA 4C3EA 5E2QA 3CQZA 2LCHA 3W2WA 1QQ3A 3DE9A 4JZAA 2M4EA 3JCUQ 4XEFA 3ZTMA 1ZHTA 2GFHA 4BJ6A 1YYJA 3EH2A 2YEVA 1Q0KA 1H6GA 3LS1A 4O7GA 3MYFA 3AG2C 4JE9A 5A69A 1NBBA 2PF4E 1OXBA 2Q00A 2Q9CA 1ZYRF 1G5ZA 2X0CA 4NC3A 3K66A 4EIYA 3T6BA 5KYYA 1HW1A 2Y69C 1UG7A 3FAPB 3NYMA 3LEOA 2CDQA 1Z5ZA 5FZTA 4A4AA 4M63A 3LS0A 1EQ1A 2Q4FA 2QE9A 3DZAA 1CGNA 5E33A 5T3TA 2XXAA 1RJ9A 3K1IA 4WJ0A 2V3CC 2R03A 2TMVP 2QUPA 2BL2A 4MVSA 3BEHA 3ZVRA 3J06A 4DRIB 3O6XA 1PD0A 4FWVA 2J9UA 2B0JA 1U6HA 3VRCA 4IGGA 4P9FA 2EPMX 3QTHA 5F28E 1CGOA 4KNVA 3NYJA 2IYLD 5EK0A 2HSQA 2OG2A 3MX3A 4I44A 4PJJA 4CS9C 4BPMA 3C8GB 2EPKX 3AG4C 3UGPA 1HMOA 4IARA 4ULVA 1CPRA 4PK4A 3IQTA 4DXWA 2P7VA 2PX3A 1FFTC 1JOGA 1V54C 2EPLX 4AE4B 4YT8A 3UNGC 5L3VA 3EGXB 4DRHB 4GYTA 5EGYA 3DXJF 1YA9A 4JRZA 2G3VA 5E3CA 1EA8A 3PDMP 3FOPA 1FMVA 2AWCA 2OEVA 1O87A 4KI2A 4LACB 3U8VA 3RF3A 3HTKC 3T6GB 4CJOA 1DOVA 1G4US 1Q0GA 3EGXA 3KH2A 1HE1A 1TWHA 3QZCA 3HNJA 4PJMA 3QW1A 4FX5A 1Z3IX 3L1MA 2P1AA 4GQHA 2XL4A 1JRAA 4IB4A 4O79A 3W4YA 5BUOA 4PFPA 1U0BB 1OCRC 4MVMA 2E87A 3TOLA 5T1DB 1O3UA 4MW8A 5K0IA 2MHRA 3TK0A 3U2LA 4WABA 3S90A 3U0CA 1GS9A 3X2QC 1MMNA 4YT5A 1YAUO 4CS8A 1J8MF 4U5CE 1FR0A 4W8KA 3U9MA 2R7UA 3T4RA 2A0UA 1QZXA 2R7SA 3QMKA 4B6IA 2L6GA 2QLAA 4CIPA 3N0TA 1E86A 3LNRA 1V55C 3JTLO 4MVUA 2L81A 2CYDA 1FAPB 1OXKA 4JC7A 1ORSC 3RVYA 3ITFA 4Z9JA 4XPWA 5COFA 3NG1A 3RH3A 3RVZA 1I5NA 3E70C 4BJ5A 1M2VA 3ECSA 1WATA 3DI5A 2NUPA 2J7PD 3I4UA 2RD9A 3NRHA 5CI9A 2XL6A 1APCA 2YL7A 4EBBA 4FESA 3JYHA 4O6YA 4LERA 2NG1A 4NCQA 1Q0MA 3LEVA 1RMVA 1XWJA 2UUHA 1YZAA 3HNLA 4FAPB 4OIRF 1WASA 2QTVA 3JRTA 1NU7D 4D4XA 2A6EF 1KTMA 1I4YA 1BDJB 3S84A 2IXNA 3FVYA 3DJUB 1WGWA 5HV9A 3Q7LA 5KYUB 2D4UA 1QSPA 1ZHYA 3EG9B 1D0ZA 3C62A 3LLKA 4U5GA 2W9YA 4MTFA 5L0GA 5KYWB 1QVXA 1VLSA 1NLXA 4HFKB 1FFHA 2HSBA 1SZIA 3WHNA 3S9OA 3GORA 3VAYA 2CGEA 4U5DE 2IM8A 2VASA 3U2MA 4JEBA 4YT4A 2R7WA 5L0HA 1TR2A 1WWPA 3U8PA 3B0VC 2LK4A 1MNEA 1EKYA 3Q6MA 2J45A 2AU5A 3JRMO 3DWWA 3EH1A 5BQIA 4HE8D 5A6JA 5JT4A 1TWAA 3M1CB 4XTKA 4XWJA 4MVOA 4IAQA 1JPNA 2JX0A 4YT2A 2HMQA 3B71A 4MVRA 1G8XA 1YZCA 3ASNC 3C63A 4W8PA 4D4NA 4JVSA 3EFOB 1M56C 1ZHWA 5B1AC 2J46A 2EIKC 4CS7A 3ZG1A 3N24A 2CNWA 2H8AA 2YL1A 1OR2A 2IOQA 1QKRA 2NPUA 3AG1C 2J9WA 3OA1A 4U5HA 2KQ9A 1OCCC 3DM5A 2MYSA 3F47A 2EPNA 4KNWA 3LAYA 1I4ZA 1S7ZA 3SP1A 3FHDA 2LD6A 2YLDA 4C3BA 1MMGA 3H2VA 3S28A 1E2XA 1YLMA 3DJNB 4XPYA 3BRJA 2ZPAA 2BC5A 3KMIA 5KYXA 1GQAA 4YWQA 3ZQYA 3ABKC 1NSGB 4N6HA 2YLIA 3W8IA 1V4AA 3QVYA 2XLWA 4G7HF 1UFBA 2OQMA 4NQFA 3VM6A 2LFFA 5JUAA 1OCOC 5L0JA 4Q4ZF 3HKKA 2LIGA 1Y6DA 2R7VA 4E0IA 1BBHA 4MTGA 1ZU4A 3RFYA 4CJGA 1Z7Qc 3B9QA 2P61A 4MTOA 4MVZA 3S27A 1ZZPA 3SXYA 1RKCA 1QLEC 4XLPF 1VTMP 3MYIA 3B0PA 3U3FA 3CZ6A 2XRHA 2YQYA 5TJ5E 5L0IA 3PHF2 1KNYA 1D1BA 3LNMB 1L3PA 2WB7A 2KJGA 2QY9A 4EBKA 3O55A 2HZ8A 5JS5A 2R7RA 3K7DA 2HKVA 3I5QA 4BEMJ 1GGQA 3A9CA 5DS4A 1ORJA 3EJNA 3HJCA 4H54A 4O6MA 5COMA 3OWTA 3ABMC 3RIPA 1T6QA 1ZW3A 4NTAA 2H7VC 3SXKA 4K0DA 1K40A 3GEEA 1T6IA 1D0XA 1AEPA 2CNWD 3U3BA 1Q0FA 2OJED 1ORYA 3N2ZB 4DBRA 4OIOF 2GWWA 3ASOC 3KL4A 4JURI 3NMIA 1G4WR 1ZW2A 2OCCC 2Y3HA 4XQ1A 2ZXPA 1RKEA 3GM2A 2OEXA 2KGOA 3NKEA 2XS1A 4AK9A 1PCXA 1NG1A 2WZFA 1T9KA 3IPMO 3O39A 4F4BA 2R02A 3X1OA 1LIHA 2WZGA 4DOZA 4KBLA 3V5ZA 2J8WA 3H2UA 4XEVA 2VCAA 2WL8A 3MLGA 2UUIA 3CEXA 1YARO 3DMDA 4IRUA 1L7CA 4ONSA 3HLZA 2WZLA 1OW8A 4IJJA 5L0FA 3I5PA 3TD7A 1HY5A 2R25A 1MQVA 256BA 3AQBA 3L8JA 4YN0B 4N4WA 2ZXRA 2IXOA 3GANA 3TJ5A 4R32A 5DLJA 2O9XA 5F5HA 2NSFA 3SXZA 4CIHA 5CI8A 2PNOA 2AP3A 3O10A 1VK5A 1Y4CA 3SEOA 3NMJA 4J30B 3US6A 2VCCA 2ZXOA 1K05A 3Q7GA 3JZ0A 3M4CA 2W45A 3JT1A 2J0WA 5L3QA 2L6FA 1XZQA 4CS9A 5DS5A 2A0BA 2QNLA 1BR1A 2XSEA 2MWQA 3AG3C 2RSEB 3C18A 3FMSA 3HNKA 3EZHA 1F1MA 4CX9A 1LM3B 2ASRA 2G62A 3RQFA 2W4BA 4YL0A 4BEJA 2LFDA 4CBEA 2KK1A 1AUEA 4WGYA 3S0XA 2P0NA 4ANJA 5KYNA 3WG7C 3IHUA 4YJWA 3DKAA 3TULA 1ST6A 2PBEA 3B29A 3V7OA 1D0YA 2NSGA 1XZPA 1VYIA 4QDLA 4JJFA 1ZHZA 1OW6A 2YHSA 2Q9BA 4J7YA 1HE9A 2OU6A 3GWLA 2YLGA 1RJ9B 5BQGA 2JPUA 2M64A 3F46A 1D1AA 2XS8A 4PFOA 3NYLA 4C3DA 3DE8A 1MMDA 2DYRC 3LUTB 1A7DA 1LVKA 3KYJA 5DS6A 1IW7F 4IWBA 5B1BC 2L9JA 3GODA 1OQCA 2J9BA 4EUKB 1PV3A 1GM5A 3MBGA 2R7OA 2Q7RA 2V26A 1R4TA 3DM9B 4QI2A 2GAQA 4HFFB 4U5BE 3AGTA 1M57C 4CS8C 4G7OF 3ABLC 2YL0A 1YVIA 5BQHA 1JAFA 1C17M 3K6BA 3B0UX 2ZXWC 1A7VA 3TOMA 1H7IA 4X0RA 4XPXA 3ZDLA 4JIOA 1JR8A 3U9JA 4PACA 1YDIA 1ZHXA 2NUTB 4LDQA 2HJMA 4XEKA 4AX2A 5EHHA 3T9OA 4HEAJ 2H7OA 1VMAA 2R7QA 2Y3BA 5B3IA 2L6HA 4I1MA 3EGDA 5T3WA 2DYSC 2YKZA 3EGDB 2YVKA 2FGYA
chains in the Genus database with same CATH topology
1YLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YLM A; 
#chains in the Genus database with same CATH topology
 1LE4 A;  5GPG B;  5AC4 A;  4OIP F;  2VB6 A;  1DOW A;  3EHN A;  1Z6A A;  1M2V B;  3QW0 A;  4ER9 A;  1WTY A;  1JPJ A;  4EKW A;  2GA0 A;  2KSF A;  4E0H A;  3HNI A;  2KNH A;  2DGJ A;  3WOD F;  3K33 A;  4DRJ B;  4IAO A;  5HSW A;  2L7A A;  3ZQV A;  3G50 A;  1YA7 O;  3AGU A;  3C7J A;  3LJB A;  4U9E A;  5A6B A;  1TQG A;  2IXP A;  2EIJ C;  1J8Y F;  1VB5 A;  2XM0 A;  3A11 A;  3G4Z A;  3TJ6 A;  4K1O A;  4DVY P;  5L0C A;  4G78 A;  5KYW A;  3R7C A;  5KYY B;  4E7S A;  1MMA A;  1QPU A;  3VYW A;  3ZC4 A;  5A6A A;  4P6I C;  3EQL F;  5A6B D;  2HJ3 A;  4BG0 A;  3EZI A;  4G0H A;  4NTF A;  4DBQ A;  3M79 A;  4E18 A;  2I8B A;  4EBJ A;  2P6V A;  3PMR A;  4JCZ A;  4G7Z F;  3JSE O;  3UMK A;  4BJT A;  1T01 A;  2H7B A;  4PJN A;  3IQ5 A;  4JKV A;  2GDC A;  4N06 A;  2X51 A;  4XLN F;  4QI0 A;  3SXM A;  2AVK A;  3IEE A;  4MVQ A;  4NTB A;  4BJ6 C;  2ETS A;  3ATP A;  1BZ4 A;  4RBN A;  3VF0 A;  4K7B A;  1NFN A;  1SR2 A;  2J0X A;  2XLD A;  1A7E A;  3M4B A;  4RD9 A;  4CDY A;  4CSA A;  2VC9 A;  4U5F E;  1Q0D A;  1VYK A;  1LE2 A;  1HMD A;  4OIN F;  3SNH A;  1B68 A;  4AL1 A;  2D5R B;  2KC3 A;  3AJM A;  3L8I A;  4JTD B;  3RKO F;  5AC5 A;  3UGO A;  5JSL A;  3AQC A;  2NUP B;  1IZM A;  2Y3D A;  2Q3T A;  2HFI A;  4RDA A;  2VCB A;  1SYQ A;  4AE4 A;  3JYY A;  4C7O A;  4U5E E;  3T6J A;  1C02 A;  1K04 A;  1TWG A;  4CDV A;  4LLE A;  3LLI A;  3QVZ A;  4MQ9 F;  3GEI A;  4E17 A;  1O5H A;  2XLE A;  3AOU A;  5AGF A;  2IBF A;  3GWN A;  3PCV A;  2R9R B;  3KYI A;  1N1C A;  4N6C A;  1T5O A;  3EHM A;  3RQG A;  2VH3 A;  1M6T A;  4LLC A;  5E3A A;  3TQO A;  2CW0 F;  3NMK A;  4BJ1 A;  1LPE A;  4WGZ A;  2R05 A;  3MFN A;  5DQZ A;  2YRF A;  4I3M A;  1FTS A;  2OOC A;  4MW3 A;  4OD4 A;  3ZSU A;  2XL8 A;  3E9V A;  1H9G A;  2A6H F;  1KU2 A;  2CCY A;  2WVQ A;  4JCH A;  2PFD A;  2W4M A;  5DVW A;  4OIQ F;  1OCZ C;  3G4X A;  4A2N B;  1CPQ A;  5JRA A;  1VLT A;  3FAJ A;  4H4K C;  2NUT A;  3EFO A;  4Z9H A;  4Z9I A;  4EWC A;  1D1C A;  4J7T A;  1BR4 A;  2AWY A;  3H65 A;  2XXA B;  1V74 B;  3ZIB A;  3C8G D;  3V5Y A;  5JLI A;  4E7Z A;  1T6U A;  3SYN A;  2DB4 A;  4CSA C;  2FFH A;  2YL3 A;  3OEO A;  4JEA A;  3ZWI A;  2HV6 A;  5JP7 A;  5B3S C;  4OD5 A;  1JMW A;  3C8G A;  1CGM E;  3UMH A;  1EI7 A;  1AVO B;  2EIL C;  4KC9 A;  2XM4 A;  4JW1 A;  2HMZ A;  3DAF A;  4U9D A;  5CIV A;  3RW0 A;  5D92 A;  1LI7 A;  1ZU5 A;  4NY3 A;  4YL1 A;  1MND A;  1TKN A;  2B0H A;  2Z15 A;  5KYU A;  4ZLC A;  2IXM A;  2XLH A;  1BR2 A;  2DI3 A;  2Q9A A;  5A6K A;  5FCL A;  4P9T A;  4AL0 A;  1A41 A;  3K1H A;  5L0D A;  1OKK D;  1W2W A;  1Z23 A;  2WVN A;  2JD3 A;  2XLV A;  4DVZ A;  2Y39 A;  1Z63 A;  4PR9 A;  4LDR A;  5IY5 C;  3LES A;  3FDQ A;  2XLM A;  2J9V A;  1TFO B;  5F5F A;  2XLO A;  4YL3 A;  4LDK A;  1YJG A;  3W8H A;  3L0I A;  4MS2 A;  2C04 A;  2PX0 A;  4MND A;  3W2V A;  3FOO A;  3ZTZ A;  4DJ9 A;  1SF8 A;  1LKX A;  2G3K A;  3DD7 A;  4BJ5 C;  2EIN C;  3Q6N A;  2A69 F;  2KYH A;  3C8Z A;  2A68 F;  1WN0 A;  2LSE A;  2BE5 F;  2WVO A;  5D91 A;  2A1D D;  1R5I D;  1SMY F;  2R7X A;  2C03 A;  1LI5 A;  1A0B A;  1TWC A;  1FMW A;  5DQT A;  2EIM C;  2Y3G A;  4JTA B;  2KW3 C;  1FNT c;  1U89 A;  3GEH A;  4PJL A;  4ZLD A;  4EHP A;  4O6N A;  3CAX A;  3U5S A;  1S05 A;  3SZR A;  1PD1 A;  4JTC B;  3V5X A;  2OKU A;  2YWA A;  3JSZ A;  5JVE A;  1RXQ A;  2PP4 A;  2R7T A;  1M2O A;  2J7P A;  4YK5 A;  1YYX A;  3IQC A;  2YZS A;  1WOL A;  3DAG A;  1C03 A;  1H9T A;  3L34 A;  3R2P A;  4I1O B;  2OJQ A;  1NZE A;  5COG A;  1E83 A;  3FXH A;  1NFO A;  1NU9 C;  1RKE B;  2FAP B;  3GM3 A;  3RYL A;  3UR3 C;  5KYX B;  3CSK A;  3POV A;  4J32 B;  3UMI A;  3K1I C;  4C7O B;  2HS5 A;  1RCP A;  1LS4 A;  3KPH A;  3NKD A;  4Q5S F;  1OKK A;  4JJG A;  3IQ6 A;  1TFK B;  1VOM A;  2HUJ A;  4Q7C A;  3KKB A;  3EPV A;  1LS1 A;  4L6R A;  1E85 A;  1OR3 A;  2LP4 A;  1E84 A;  2I15 A;  4UDV A;  3M15 A;  2HV7 A;  2ZD9 A;  2EPO A;  4ULW A;  3GM1 A;  3NDB B;  2LQG A;  3EG9 A;  3WAQ A;  1OW7 A;  3S29 A;  1HW2 A;  2ICW G;  2F22 A;  1ZVZ A;  3RQE A;  4CDA A;  4GEH A;  4C3E A;  5E2Q A;  3CQZ A;  2LCH A;  3W2W A;  1QQ3 A;  3DE9 A;  4JZA A;  2M4E A;  3JCU Q;  4XEF A;  3ZTM A;  1ZHT A;  2GFH A;  4BJ6 A;  1YYJ A;  3EH2 A;  2YEV A;  1Q0K A;  1H6G A;  3LS1 A;  4O7G A;  3MYF A;  3AG2 C;  4JE9 A;  5A69 A;  1NBB A;  2PF4 E;  1OXB A;  2Q00 A;  2Q9C A;  1ZYR F;  1G5Z A;  2X0C A;  4NC3 A;  3K66 A;  4EIY A;  3T6B A;  5KYY A;  1HW1 A;  2Y69 C;  1UG7 A;  3FAP B;  3NYM A;  3LEO A;  2CDQ A;  1Z5Z A;  5FZT A;  4A4A A;  4M63 A;  3LS0 A;  1EQ1 A;  2Q4F A;  2QE9 A;  3DZA A;  1CGN A;  5E33 A;  5T3T A;  2XXA A;  1RJ9 A;  3K1I A;  4WJ0 A;  2V3C C;  2R03 A;  2TMV P;  2QUP A;  2BL2 A;  4MVS A;  3BEH A;  3ZVR A;  3J06 A;  4DRI B;  3O6X A;  1PD0 A;  4FWV A;  2J9U A;  2B0J A;  1U6H A;  3VRC A;  4IGG A;  4P9F A;  2EPM X;  3QTH A;  5F28 E;  1CGO A;  4KNV A;  3NYJ A;  2IYL D;  5EK0 A;  2HSQ A;  2OG2 A;  3MX3 A;  4I44 A;  4PJJ A;  4CS9 C;  4BPM A;  3C8G B;  2EPK X;  3AG4 C;  3UGP A;  1HMO A;  4IAR A;  4ULV A;  1CPR A;  4PK4 A;  3IQT A;  4DXW A;  2P7V A;  2PX3 A;  1FFT C;  1JOG A;  1V54 C;  2EPL X;  4AE4 B;  4YT8 A;  3UNG C;  5L3V A;  3EGX B;  4DRH B;  4GYT A;  5EGY A;  3DXJ F;  1YA9 A;  4JRZ A;  2G3V A;  5E3C A;  1EA8 A;  3PDM P;  3FOP A;  1FMV A;  2AWC A;  2OEV A;  1O87 A;  4KI2 A;  4LAC B;  3U8V A;  3RF3 A;  3HTK C;  3T6G B;  4CJO A;  1DOV A;  1G4U S;  1Q0G A;  3EGX A;  3KH2 A;  1HE1 A;  1TWH A;  3QZC A;  3HNJ A;  4PJM A;  3QW1 A;  4FX5 A;  1Z3I X;  3L1M A;  2P1A A;  4GQH A;  2XL4 A;  1JRA A;  4IB4 A;  4O79 A;  3W4Y A;  5BUO A;  4PFP A;  1U0B B;  1OCR C;  4MVM A;  2E87 A;  3TOL A;  5T1D B;  1O3U A;  4MW8 A;  5K0I A;  2MHR A;  3TK0 A;  3U2L A;  4WAB A;  3S90 A;  3U0C A;  1GS9 A;  3X2Q C;  1MMN A;  4YT5 A;  1YAU O;  4CS8 A;  1J8M F;  4U5C E;  1FR0 A;  4W8K A;  3U9M A;  2R7U A;  3T4R A;  2A0U A;  1QZX A;  2R7S A;  3QMK A;  4B6I A;  2L6G A;  2QLA A;  4CIP A;  3N0T A;  1E86 A;  3LNR A;  1V55 C;  3JTL O;  4MVU A;  2L81 A;  2CYD A;  1FAP B;  1OXK A;  4JC7 A;  1ORS C;  3RVY A;  3ITF A;  4Z9J A;  4XPW A;  5COF A;  3NG1 A;  3RH3 A;  3RVZ A;  1I5N A;  3E70 C;  4BJ5 A;  1M2V A;  3ECS A;  1WAT A;  3DI5 A;  2NUP A;  2J7P D;  3I4U A;  2RD9 A;  3NRH A;  5CI9 A;  2XL6 A;  1APC A;  2YL7 A;  4EBB A;  4FES A;  3JYH A;  4O6Y A;  4LER A;  2NG1 A;  4NCQ A;  1Q0M A;  3LEV A;  1RMV A;  1XWJ A;  2UUH A;  1YZA A;  3HNL A;  4FAP B;  4OIR F;  1WAS A;  2QTV A;  3JRT A;  1NU7 D;  4D4X A;  2A6E F;  1KTM A;  1I4Y A;  1BDJ B;  3S84 A;  2IXN A;  3FVY A;  3DJU B;  1WGW A;  5HV9 A;  3Q7L A;  5KYU B;  2D4U A;  1QSP A;  1ZHY A;  3EG9 B;  1D0Z A;  3C62 A;  3LLK A;  4U5G A;  2W9Y A;  4MTF A;  5L0G A;  5KYW B;  1QVX A;  1VLS A;  1NLX A;  4HFK B;  1FFH A;  2HSB A;  1SZI A;  3WHN A;  3S9O A;  3GOR A;  3VAY A;  2CGE A;  4U5D E;  2IM8 A;  2VAS A;  3U2M A;  4JEB A;  4YT4 A;  2R7W A;  5L0H A;  1TR2 A;  1WWP A;  3U8P A;  3B0V C;  2LK4 A;  1MNE A;  1EKY A;  3Q6M A;  2J45 A;  2AU5 A;  3JRM O;  3DWW A;  3EH1 A;  5BQI A;  4HE8 D;  5A6J A;  5JT4 A;  1TWA A;  3M1C B;  4XTK A;  4XWJ A;  4MVO A;  4IAQ A;  1JPN A;  2JX0 A;  4YT2 A;  2HMQ A;  3B71 A;  4MVR A;  1G8X A;  1YZC A;  3ASN C;  3C63 A;  4W8P A;  4D4N A;  4JVS A;  3EFO B;  1M56 C;  1ZHW A;  5B1A C;  2J46 A;  2EIK C;  4CS7 A;  3ZG1 A;  3N24 A;  2CNW A;  2H8A A;  2YL1 A;  1OR2 A;  2IOQ A;  1QKR A;  2NPU A;  3AG1 C;  2J9W A;  3OA1 A;  4U5H A;  2KQ9 A;  1OCC C;  3DM5 A;  2MYS A;  3F47 A;  2EPN A;  4KNW A;  3LAY A;  1I4Z A;  1S7Z A;  3SP1 A;  3FHD A;  2LD6 A;  2YLD A;  4C3B A;  1MMG A;  3H2V A;  3S28 A;  1E2X A;  1YLM A;  3DJN B;  4XPY A;  3BRJ A;  2ZPA A;  2BC5 A;  3KMI A;  5KYX A;  1GQA A;  4YWQ A;  3ZQY A;  3ABK C;  1NSG B;  4N6H A;  2YLI A;  3W8I A;  1V4A A;  3QVY A;  2XLW A;  4G7H F;  1UFB A;  2OQM A;  4NQF A;  3VM6 A;  2LFF A;  5JUA A;  1OCO C;  5L0J A;  4Q4Z F;  3HKK A;  2LIG A;  1Y6D A;  2R7V A;  4E0I A;  1BBH A;  4MTG A;  1ZU4 A;  3RFY A;  4CJG A;  1Z7Q c;  3B9Q A;  2P61 A;  4MTO A;  4MVZ A;  3S27 A;  1ZZP A;  3SXY A;  1RKC A;  1QLE C;  4XLP F;  1VTM P;  3MYI A;  3B0P A;  3U3F A;  3CZ6 A;  2XRH A;  2YQY A;  5TJ5 E;  5L0I A;  3PHF 2;  1KNY A;  1D1B A;  3LNM B;  1L3P A;  2WB7 A;  2KJG A;  2QY9 A;  4EBK A;  3O55 A;  2HZ8 A;  5JS5 A;  2R7R A;  3K7D A;  2HKV A;  3I5Q A;  4BEM J;  1GGQ A;  3A9C A;  5DS4 A;  1ORJ A;  3EJN A;  3HJC A;  4H54 A;  4O6M A;  5COM A;  3OWT A;  3ABM C;  3RIP A;  1T6Q A;  1ZW3 A;  4NTA A;  2H7V C;  3SXK A;  4K0D A;  1K40 A;  3GEE A;  1T6I A;  1D0X A;  1AEP A;  2CNW D;  3U3B A;  1Q0F A;  2OJE D;  1ORY A;  3N2Z B;  4DBR A;  4OIO F;  2GWW A;  3ASO C;  3KL4 A;  4JUR I;  3NMI A;  1G4W R;  1ZW2 A;  2OCC C;  2Y3H A;  4XQ1 A;  2ZXP A;  1RKE A;  3GM2 A;  2OEX A;  2KGO A;  3NKE A;  2XS1 A;  4AK9 A;  1PCX A;  1NG1 A;  2WZF A;  1T9K A;  3IPM O;  3O39 A;  4F4B A;  2R02 A;  3X1O A;  1LIH A;  2WZG A;  4DOZ A;  4KBL A;  3V5Z A;  2J8W A;  3H2U A;  4XEV A;  2VCA A;  2WL8 A;  3MLG A;  2UUI A;  3CEX A;  1YAR O;  3DMD A;  4IRU A;  1L7C A;  4ONS A;  3HLZ A;  2WZL A;  1OW8 A;  4IJJ A;  5L0F A;  3I5P A;  3TD7 A;  1HY5 A;  2R25 A;  1MQV A;  256B A;  3AQB A;  3L8J A;  4YN0 B;  4N4W A;  2ZXR A;  2IXO A;  3GAN A;  3TJ5 A;  4R32 A;  5DLJ A;  2O9X A;  5F5H A;  2NSF A;  3SXZ A;  4CIH A;  5CI8 A;  2PNO A;  2AP3 A;  3O10 A;  1VK5 A;  1Y4C A;  3SEO A;  3NMJ A;  4J30 B;  3US6 A;  2VCC A;  2ZXO A;  1K05 A;  3Q7G A;  3JZ0 A;  3M4C A;  2W45 A;  3JT1 A;  2J0W A;  5L3Q A;  2L6F A;  1XZQ A;  4CS9 A;  5DS5 A;  2A0B A;  2QNL A;  1BR1 A;  2XSE A;  2MWQ A;  3AG3 C;  2RSE B;  3C18 A;  3FMS A;  3HNK A;  3EZH A;  1F1M A;  4CX9 A;  1LM3 B;  2ASR A;  2G62 A;  3RQF A;  2W4B A;  4YL0 A;  4BEJ A;  2LFD A;  4CBE A;  2KK1 A;  1AUE A;  4WGY A;  3S0X A;  2P0N A;  4ANJ A;  5KYN A;  3WG7 C;  3IHU A;  4YJW A;  3DKA A;  3TUL A;  1ST6 A;  2PBE A;  3B29 A;  3V7O A;  1D0Y A;  2NSG A;  1XZP A;  1VYI A;  4QDL A;  4JJF A;  1ZHZ A;  1OW6 A;  2YHS A;  2Q9B A;  4J7Y A;  1HE9 A;  2OU6 A;  3GWL A;  2YLG A;  1RJ9 B;  5BQG A;  2JPU A;  2M64 A;  3F46 A;  1D1A A;  2XS8 A;  4PFO A;  3NYL A;  4C3D A;  3DE8 A;  1MMD A;  2DYR C;  3LUT B;  1A7D A;  1LVK A;  3KYJ A;  5DS6 A;  1IW7 F;  4IWB A;  5B1B C;  2L9J A;  3GOD A;  1OQC A;  2J9B A;  4EUK B;  1PV3 A;  1GM5 A;  3MBG A;  2R7O A;  2Q7R A;  2V26 A;  1R4T A;  3DM9 B;  4QI2 A;  2GAQ A;  4HFF B;  4U5B E;  3AGT A;  1M57 C;  4CS8 C;  4G7O F;  3ABL C;  2YL0 A;  1YVI A;  5BQH A;  1JAF A;  1C17 M;  3K6B A;  3B0U X;  2ZXW C;  1A7V A;  3TOM A;  1H7I A;  4X0R A;  4XPX A;  3ZDL A;  4JIO A;  1JR8 A;  3U9J A;  4PAC A;  1YDI A;  1ZHX A;  2NUT B;  4LDQ A;  2HJM A;  4XEK A;  4AX2 A;  5EHH A;  3T9O A;  4HEA J;  2H7O A;  1VMA A;  2R7Q A;  2Y3B A;  5B3I A;  2L6H A;  4I1M A;  3EGD A;  5T3W A;  2DYS C;  2YKZ A;  3EGD B;  2YVK A;  2FGY A; 
#chains in the Genus database with same CATH homology
 1YLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...