1YLMA

Structure of cytosolic protein of unknown function yute from bacillus subtilis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
MYFVDRSKIEKTLGFFEHQLALFDSQTDWQSEIGELALQRIGHLLIECILDTGNDMIDGFIMRDPGSYDDIMDILVDEKVVTEKEGDELKKLIAYRKTLVQQYLLADSGELYRLIKAHQTALQDFPKRIRSYLETELGPVSAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein BSU32300
publication title Hypothetical cytosolic protein YutE from Bacillus subtilis
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Structural genomics, unknown function
total genus 50
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01934 DUF86 Protein of unknown function DUF86
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.580 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) bsu32300-like 1ylmA00
1YLMA
chains in the Genus database with same CATH superfamily
2H8AA 4CIPA 1RJ9A 2P7VA 1WASA 2QUPA 4A2NB 1UFBA 4BG0A 1T5OA 3WODF 3N2ZB 3AG1C 2J7PD 3GWLA 4F4BA 4O6YA 1A7EA 4G0HA 3ASNC 3NKEA 4C3EA 5BQIA 3T4RA 1OCCC 3C8ZA 2CNWA 4MVMA 5E33A 3ZC4A 3FDQA 1Z3IX 4BJ1A 3L34A 3GODA 2M64A 3PMRA 4DRJB 3FXHA 4PJJA 5E2QA 3S28A 4JCHA 1E83A 1K40A 2H7BA 2I15A 3EH1A 3W2WA 5F5FA 2DI3A 3EGDB 1JMWA 2V26A 5IY5C 1WOLA 3HNIA 4Q7CA 3F46A 4AK9A 3JCUQ 4CS8A 5A6KA 3EGDA 2R7OA 3DMDA 4U5HA 2XS1A 1A7DA 2EINC 1MMNA 1VYIA 2HKVA 1FTSA 1OR2A 3M79A 3PCVA 1J8MF 4PJLA 3SXZA 1AVOB 4Q4ZF 4XEVA 2IXMA 5L0FA 1T6UA 5HSWA 2ZPAA 2XL8A 1ORJA 3N0TA 3HNKA 3TOLA 4B6IA 2G62A 5A69A 2TMVP 1VB5A 1OCRC 2EIKC 4CDAA 5AC5A 3KYJA 3DXJF 4XPXA 4YT2A 1OKKA 1G5ZA 1RXQA 5L3QA 1Q0FA 1JR8A 3C8GD 5L0JA 3B71A 3KH2A 2Y69C 4J30B 4NTAA 1JPJA 1OQCA 1M56C 5COGA 2L6HA 2R7UA 1PD0A 5JT4A 3UMIA 1BDJB 2CGEA 1O87A 1OW7A 1OR3A 4U5FE 4Q5SF 3DE9A 4CBEA 2O9XA 3ZQVA 2GDCA 4LACB 3O6XA 2OG2A 1EI7A 3PHF2 3QTHA 4EUKB 2LIGA 1S05A 4U5BE 2J7PA 3DI5A 1Q0KA 1CGOA 2LCHA 2QNLA 3U8PA 4JURI 1ZVZA 2IXNA 2P6VA 1LIHA 2CDQA 3POVA 1Q0DA 2L7AA 4CDYA 2ICWG 2IXOA 5EGYA 1YZCA 4X0RA 2X0CA 1YYXA 3EZIA 2X51A 3G50A 2NUTB 1H7IA 4KBLA 2P61A 3VF0A 1CGNA 1HMDA 1YDIA 2A1DD 3EPVA 1EKYA 2L9JA 4O6MA 3M4CA 3T6GB 4U5DE 3GORA 3C63A 2NUTA 5DS6A 5B1BC 2A0BA 3M15A 1I4YA 3SXKA 4EBJA 3ZVRA 2ZXPA 3GANA 4LLEA 4FESA 5JS5A 4IRUA 1LM3B 2KJGA 4NY3A 2EPOA 4RDAA 3CEXA 3AJMA 1T6QA 3JSEO 4XLPF 5EK0A 3NYJA 2PFDA 2WVQA 2J0XA 4LDRA 3R7CA 3C8GB 1I5NA 1K05A 1OCOC 1Z23A 4CDVA 4CS7A 2ZXRA 1H6GA 3S29A 1MMAA 4JEAA 1LI7A 5E3CA 4PACA 3C8GA 4BEJA 4W8KA 4O7GA 2BC5A 3FAJA 4ER9A 2R02A 2WZFA 4IARA 2H7OA 5B3IA 3RVZA 4XQ1A 3LAYA 3Q7GA 4DVYP 4G7HF 3TK0A 2M4EA 1M2OA 4PK4A 1NFOA 2L81A 3U3BA 1G8XA 1ZU4A 3WAQA 2EPKX 2FFHA 3VYWA 3E9VA 3DJNB 1HY5A 1RCPA 1LS4A 1YZAA 3CAXA 4R32A 4P9FA 3IQ6A 3KKBA 3LS1A 1KU2A 1YA7O 2CYDA 2EIJC 2DYRC 2XLVA 3DAGA 3KYIA 3MFNA 3QMKA 2DB4A 1D1BA 3HKKA 5F5HA 4AL0A 3MYIA 3LNMB 2XLOA 3RFYA 4OIOF 2ZXWC 3NDBB 3DM5A 3HNLA 1TWHA 2J45A 2OEXA 1K04A 1A41A 2PP4A 4JCZA 4JRZA 2D4UA 1U89A 4DBQA 2LP4A 3X2QC 1Z63A 1QQ3A 3U9JA 4P9TA 5A6BA 2C03A 4JC7A 3SXMA 4HFFB 2B0HA 2UUHA 2XL4A 4G78A 4EWCA 5L0CA 4MS2A 3EHMA 3FHDA 4JTDB 2RD9A 2C04A 5DLJA 1NFNA 5T3WA 3AOUA 2NSGA 5L0HA 4CS8C 2EPNA 2GWWA 3S84A 3GEEA 3O10A 1V74B 2OEVA 4GYTA 3H65A 4XEFA 3TD7A 4I1MA 1AUEA 3MLGA 5COMA 3N24A 1U0BB 4QI2A 2J9UA 2VCBA 1OXBA 1Y6DA 2YKZA 2NSFA 3EGXB 4NC3A 1OW6A 3DWWA 5CI9A 3RQGA 2R7VA 4JW1A 3NRHA 5AGFA 3UNGC 2LK4A 5K0IA 5CI8A 4C7OB 3EGXA 2XM4A 1BZ4A 3V5YA 1T01A 2YHSA 2Q7RA 4ZLCA 3UMKA 1V55C 3NG1A 3NMJA 3GWNA 1VK5A 4JTCB 4C7OA 1ZHXA 256BA 2LFDA 3ABKC 3DM9B 2JX0A 1NU9C 1MQVA 2R7WA 5JP7A 2R7TA 1ZU5A 4Z9HA 1CPRA 1KNYA 3ITFA 4YN0B 3S90A 4UDVA 5EHHA 3M1CB 3GEHA 3OA1A 4CJGA 5HV9A 2L6FA 4D4NA 3NMKA 2QLAA 4XWJA 1MNDA 1YVIA 2H7VC 2Q00A 4GQHA 1VYKA 1M2VB 4C3DA 3B0VC 2HJ3A 2HFIA 2PBEA 1FNTc 4QI0A 5COFA 3K33A 1JRAA 3L0IA 3UR3C 1ZW2A 3AGTA 3O55A 4OIQF 4U5CE 1M2VA 3QW1A 3ZIBA 3UGOA 4CSAA 3K6BA 2LSEA 1W2WA 1HW1A 2FAPB 3MYFA 1TWGA 4PJMA 4EIYA 3RQEA 3L8JA 1VMAA 1GS9A 4DRHB 3ZSUA 2KSFA 4E0IA 2VH3A 2P1AA 3EG9B 2WVOA 3JT1A 1QKRA 3FOPA 3WG7C 1T6IA 3U5SA 3K66A 3EG9A 2XM0A 4MQ9F 2R7XA 2KK1A 3JZ0A 3U2LA 3CSKA 4BEMJ 3DE8A 3RKOF 4WGYA 2J9BA 3ZTMA 4OIRF 1GM5A 3G4ZA 1GGQA 3E70C 3SYNA 2Y3HA 1Y4CA 1UG7A 4KNWA 3IQ5A 3ZWIA 3LEOA 4MNDA 1R5ID 4FX5A 1FMWA 1D0YA 2IYLD 1ZHTA 2XS8A 1IZMA 3HJCA 4JJFA 5B1AC 1EA8A 4HEAJ 4J7TA 3Q7LA 4L6RA 1ZW3A 2OJED 3U8VA 1PV3A 2OJQA 5TJ5E 4MVRA 2VCAA 3F47A 4YL1A 3RF3A 5GPGB 4DJ9A 4ULWA 3S0XA 3GM1A 2W9YA 4G7OF 2W4BA 2WZGA 2IBFA 4QDLA 4U5EE 3U0CA 5AC4A 1IW7F 1TFOB 4HFKB 4YL0A 4PFOA 5A6AA 1SYQA 2W4MA 4H4KC 2E87A 2R25A 3G4XA 4NTFA 2AWCA 1APCA 2A68F 2MYSA 4EBBA 4OD5A 2Y3DA 2GA0A 4O79A 2LQGA 3UMHA 2ZXOA 4N4WA 1HE1A 3OWTA 4K1OA 4AE4B 1EQ1A 2Y3GA 2CCYA 1GQAA 1NZEA 2GFHA 4ZLDA 1E85A 5FZTA 4N6HA 2D5RB 1CPQA 2J9VA 4CJOA 4NCQA 2G3VA 4AE4A 4NTBA 3IEEA 4J7YA 1U6HA 2AVKA 1OCZC 1A0BA 4MVQA 3RIPA 1S7ZA 4LDQA 4GEHA 2NPUA 1E84A 2YZSA 4I44A 5FCLA 3BRJA 3HTKC 3SNHA 2HSQA 2J9WA 4HE8D 1NU7D 4MVZA 4Z9JA 5L3VA 3RQFA 2OCCC 2YLGA 3ZTZA 2WL8A 2PNOA 2XXAB 1ZHWA 3ABLC 3MBGA 3OEOA 4PFPA 3JYHA 2EPLX 3AG4C 2YWAA 3W2VA 5JVEA 3C62A 4J32B 1LVKA 1BR2A 2XXAA 1A7VA 3M4BA 4IJJA 2PF4E 4JEBA 4E7SA 4LERA 4YT4A 4JE9A 2R7QA 2YRFA 3L1MA 3VM6A 1QPUA 1TWCA 3EQLF 3B0PA 2CNWD 4IGGA 3A9CA 5DQTA 2DYSC 1J8YF 1YLMA 2Q4FA 4MW3A 4MTGA 2NUPB 3DD7A 4JJGA 3T6BA 4H54A 3V7OA 1L3PA 1VLTA 3K1IA 1M6TA 4RD9A 1H9TA 4MTOA 2NUPA 3U9MA 3RH3A 4EBKA 5KYNA 3IQCA 2KNHA 1QZXA 5D92A 3GM2A 1QLEC 1R4TA 3I5QA 4MW8A 4YT5A 3T9OA 4BJ5A 4MVSA 4CS9C 2KC3A 4Z9IA 4FAPB 2FGYA 3B29A 4FWVA 4BPMA 3ABMC 3EJNA 1TFKB 2XL6A 1NSGB 5JLIA 4E0HA 1RKCA 2J46A 4K0DA 2R05A 1FR0A 3QVZA 1N1CA 1RMVA 5DS5A 3KPHA 3DZAA 4K7BA 3DKAA 3V5XA 3LUTB 5JRAA 5BQHA 2R03A 2XLEA 2G3KA 2ZD9A 2NG1A 3EH2A 4OD4A 2JPUA 1Q0GA 4JVSA 4I3MA 1YARO 4DRIB 3MX3A 2Z15A 2IM8A 2AU5A 1VTMP 3B0UX 3NYLA 1QSPA 2HJMA 4CS9A 3FVYA 1O3UA 1SZIA 1YAUO 2HS5A 5D91A 3AQBA 4KI2A 2Y3BA 2QTVA 4CSAC 4YL3A 1NLXA 3ATPA 5KYXB 2PX0A 3Q6MA 4XPYA 2AP3A 1WTYA 4OIPF 1SR2A 1FFHA 4YJWA 2GAQA 5KYXA 1AEPA 1MMGA 1E2XA 4MTFA 3SXYA 3AQCA 3H2VA 3QW0A 3SZRA 3NKDA 3LESA 1ZYRF 4RBNA 4MVOA 3C7JA 4A4AA 2HUJA 2PX3A 3RVYA 4DXWA 1M57C 1ORSC 3T6JA 2MWQA 4BJ6A 4WJ0A 4EHPA 3L8IA 4JTAB 5KYWB 3V5ZA 3TULA 2DGJA 3JRTA 2YL0A 3A11A 3U2MA 3HLZA 1ZHYA 2YL1A 5KYWA 1HMOA 1TKNA 2XLWA 3U3FA 1JAFA 1LS1A 2ASRA 2HMQA 4IWBA 5DQZA 3BEHA 2P0NA 2Q9AA 4N06A 2QY9A 3C18A 3PDMP 1V54C 3EFOB 1BR4A 1NBBA 2V3CC 1Q0MA 1V4AA 3Q6NA 3ASOC 4N6CA 2Q9CA 1JPNA 4PJNA 3DAFA 2AWYA 2L6GA 3EFOA 3ECSA 1D1CA 3H2UA 4WGZA 4XTKA 2HMZA 2R9RB 2XLHA 5F28E 1MNEA 3VRCA 1XZQA 3CQZA 2OOCA 1WGWA 2F22A 3LLIA 4JIOA 1Z5ZA 4U5GA 2Q9BA 5B3SC 2YVKA 3JTLO 3S27A 3TOMA 1WN0A 2LD6A 3R2PA 3S9OA 2XRHA 2KYHA 1OW8A 1TQGA 4WABA 4PR9A 1F1MA 1JOGA 1O5HA 2EILC 2YL3A 4MVUA 4BJTA 4U9DA 3RW0A 4EKWA 5JUAA 1RKEB 2B0JA 2HV7A 3SEOA 2YEVA 2VC9A 3RYLA 3ZG1A 4IAQA 3I5PA 1LE2A 3ZDLA 4XPWA 1RKEA 3TJ5A 2J8WA 3FMSA 1ZHZA 3NMIA 4JKVA 4P6IC 2R7RA 3WHNA 1CGME 3IHUA 1DOWA 3J06A 2KW3C 3LS0A 2Q3TA 5CIVA 2IXPA 2ETSA 1FAPB 1D1AA 1Z7Qc 2VB6A 5KYYB 4ANJA 4YWQA 2VCCA 2XLDA 3CZ6A 3HNJA 4U9EA 1TR2A 4G7ZF 2MHRA 3AG3C 3LNRA 5BQGA 2BL2A 1BR1A 1YYJA 2XLMA 4C3BA 4E18A 5KYYA 2OKUA 4DOZA 1T9KA 2OQMA 1DOVA 4IAOA 1HE9A 3VAYA 5KYUB 2KQ9A 5BUOA 5A6BD 1C17M 4OINF 2OU6A 4LLCA 1NG1A 3I4UA 4ONSA 5T1DB 3DJUB 1L7CA 2HV6A 3K1IC 2WVNA 2RSEB 4I1OB 2A6HF 2WZLA 3QVYA 1LE4A 5KYUA 4E17A 1C02A 2EPMX 4E7ZA 3LEVA 3GM3A 3K1HA 3ZQYA 5DS4A 1FMVA 2A6EF 3B9QA 1ORYA 3W8IA 1LKXA 4YT8A 4BJ5C 5L0GA 4XEKA 2YLDA 5L0DA 3K7DA 3W8HA 2YL7A 3KMIA 1SMYF 1QVXA 1E86A 2WB7A 3IPMO 1XWJA 2R7SA 5E3AA 2VASA 3US6A 1H9GA 2IOQA 3FOOA 1PD1A 2W45A 2UUIA 1OXKA 1XZPA 5T3TA 2KGOA 2YLIA 2XSEA 1D0ZA 4KC9A 1BBHA 3KL4A 3GEIA 4CIHA 2YQYA 1ST6A 1LPEA 2EIMC 2A69F 3JYYA 5DVWA 1VLSA 2I8BA 1I4ZA 4AX2A 2QE9A 1FFTC 4CX9A 4DBRA 5A6JA 2HSBA 1WATA 1YJGA 1G4US 3LLKA 3NYMA 3AG2C 3JSZA 1KTMA 3O39A 4XLNF 1VOMA 4KNVA 3TQOA 2BE5F 3EHNA 2Y39A 1ZZPA 2CW0F 4YK5A 3LJBA 1C03A 3EZHA 1B68A 3QZCA 1WWPA 4D4XA 3W4YA 1YA9A 2A0UA 2JD3A 5JSLA 3SP1A 3TJ6A 1OKKD 1TWAA 2HZ8A 4LDKA 4AL1A 3UGPA 1D0XA 1HW2A 1PCXA 1MMDA 4NQFA 2LFFA 4IB4A 3AGUA 3JRMO 3X1OA 1LI5A 1RJ9B 1Z6AA 3IQTA 4JZAA 4BJ6C 3FAPB 4ULVA 4M63A 4O6NA 5L0IA 4W8PA 1SF8A 2J0WA 1G4WR 4DVZA
chains in the Genus database with same CATH topology
1YLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YLM A; 
#chains in the Genus database with same CATH topology
 2H8A A;  4CIP A;  1RJ9 A;  2P7V A;  1WAS A;  2QUP A;  4A2N B;  1UFB A;  4BG0 A;  1T5O A;  3WOD F;  3N2Z B;  3AG1 C;  2J7P D;  3GWL A;  4F4B A;  4O6Y A;  1A7E A;  4G0H A;  3ASN C;  3NKE A;  4C3E A;  5BQI A;  3T4R A;  1OCC C;  3C8Z A;  2CNW A;  4MVM A;  5E33 A;  3ZC4 A;  3FDQ A;  1Z3I X;  4BJ1 A;  3L34 A;  3GOD A;  2M64 A;  3PMR A;  4DRJ B;  3FXH A;  4PJJ A;  5E2Q A;  3S28 A;  4JCH A;  1E83 A;  1K40 A;  2H7B A;  2I15 A;  3EH1 A;  3W2W A;  5F5F A;  2DI3 A;  3EGD B;  1JMW A;  2V26 A;  5IY5 C;  1WOL A;  3HNI A;  4Q7C A;  3F46 A;  4AK9 A;  3JCU Q;  4CS8 A;  5A6K A;  3EGD A;  2R7O A;  3DMD A;  4U5H A;  2XS1 A;  1A7D A;  2EIN C;  1MMN A;  1VYI A;  2HKV A;  1FTS A;  1OR2 A;  3M79 A;  3PCV A;  1J8M F;  4PJL A;  3SXZ A;  1AVO B;  4Q4Z F;  4XEV A;  2IXM A;  5L0F A;  1T6U A;  5HSW A;  2ZPA A;  2XL8 A;  1ORJ A;  3N0T A;  3HNK A;  3TOL A;  4B6I A;  2G62 A;  5A69 A;  2TMV P;  1VB5 A;  1OCR C;  2EIK C;  4CDA A;  5AC5 A;  3KYJ A;  3DXJ F;  4XPX A;  4YT2 A;  1OKK A;  1G5Z A;  1RXQ A;  5L3Q A;  1Q0F A;  1JR8 A;  3C8G D;  5L0J A;  3B71 A;  3KH2 A;  2Y69 C;  4J30 B;  4NTA A;  1JPJ A;  1OQC A;  1M56 C;  5COG A;  2L6H A;  2R7U A;  1PD0 A;  5JT4 A;  3UMI A;  1BDJ B;  2CGE A;  1O87 A;  1OW7 A;  1OR3 A;  4U5F E;  4Q5S F;  3DE9 A;  4CBE A;  2O9X A;  3ZQV A;  2GDC A;  4LAC B;  3O6X A;  2OG2 A;  1EI7 A;  3PHF 2;  3QTH A;  4EUK B;  2LIG A;  1S05 A;  4U5B E;  2J7P A;  3DI5 A;  1Q0K A;  1CGO A;  2LCH A;  2QNL A;  3U8P A;  4JUR I;  1ZVZ A;  2IXN A;  2P6V A;  1LIH A;  2CDQ A;  3POV A;  1Q0D A;  2L7A A;  4CDY A;  2ICW G;  2IXO A;  5EGY A;  1YZC A;  4X0R A;  2X0C A;  1YYX A;  3EZI A;  2X51 A;  3G50 A;  2NUT B;  1H7I A;  4KBL A;  2P61 A;  3VF0 A;  1CGN A;  1HMD A;  1YDI A;  2A1D D;  3EPV A;  1EKY A;  2L9J A;  4O6M A;  3M4C A;  3T6G B;  4U5D E;  3GOR A;  3C63 A;  2NUT A;  5DS6 A;  5B1B C;  2A0B A;  3M15 A;  1I4Y A;  3SXK A;  4EBJ A;  3ZVR A;  2ZXP A;  3GAN A;  4LLE A;  4FES A;  5JS5 A;  4IRU A;  1LM3 B;  2KJG A;  4NY3 A;  2EPO A;  4RDA A;  3CEX A;  3AJM A;  1T6Q A;  3JSE O;  4XLP F;  5EK0 A;  3NYJ A;  2PFD A;  2WVQ A;  2J0X A;  4LDR A;  3R7C A;  3C8G B;  1I5N A;  1K05 A;  1OCO C;  1Z23 A;  4CDV A;  4CS7 A;  2ZXR A;  1H6G A;  3S29 A;  1MMA A;  4JEA A;  1LI7 A;  5E3C A;  4PAC A;  3C8G A;  4BEJ A;  4W8K A;  4O7G A;  2BC5 A;  3FAJ A;  4ER9 A;  2R02 A;  2WZF A;  4IAR A;  2H7O A;  5B3I A;  3RVZ A;  4XQ1 A;  3LAY A;  3Q7G A;  4DVY P;  4G7H F;  3TK0 A;  2M4E A;  1M2O A;  4PK4 A;  1NFO A;  2L81 A;  3U3B A;  1G8X A;  1ZU4 A;  3WAQ A;  2EPK X;  2FFH A;  3VYW A;  3E9V A;  3DJN B;  1HY5 A;  1RCP A;  1LS4 A;  1YZA A;  3CAX A;  4R32 A;  4P9F A;  3IQ6 A;  3KKB A;  3LS1 A;  1KU2 A;  1YA7 O;  2CYD A;  2EIJ C;  2DYR C;  2XLV A;  3DAG A;  3KYI A;  3MFN A;  3QMK A;  2DB4 A;  1D1B A;  3HKK A;  5F5H A;  4AL0 A;  3MYI A;  3LNM B;  2XLO A;  3RFY A;  4OIO F;  2ZXW C;  3NDB B;  3DM5 A;  3HNL A;  1TWH A;  2J45 A;  2OEX A;  1K04 A;  1A41 A;  2PP4 A;  4JCZ A;  4JRZ A;  2D4U A;  1U89 A;  4DBQ A;  2LP4 A;  3X2Q C;  1Z63 A;  1QQ3 A;  3U9J A;  4P9T A;  5A6B A;  2C03 A;  4JC7 A;  3SXM A;  4HFF B;  2B0H A;  2UUH A;  2XL4 A;  4G78 A;  4EWC A;  5L0C A;  4MS2 A;  3EHM A;  3FHD A;  4JTD B;  2RD9 A;  2C04 A;  5DLJ A;  1NFN A;  5T3W A;  3AOU A;  2NSG A;  5L0H A;  4CS8 C;  2EPN A;  2GWW A;  3S84 A;  3GEE A;  3O10 A;  1V74 B;  2OEV A;  4GYT A;  3H65 A;  4XEF A;  3TD7 A;  4I1M A;  1AUE A;  3MLG A;  5COM A;  3N24 A;  1U0B B;  4QI2 A;  2J9U A;  2VCB A;  1OXB A;  1Y6D A;  2YKZ A;  2NSF A;  3EGX B;  4NC3 A;  1OW6 A;  3DWW A;  5CI9 A;  3RQG A;  2R7V A;  4JW1 A;  3NRH A;  5AGF A;  3UNG C;  2LK4 A;  5K0I A;  5CI8 A;  4C7O B;  3EGX A;  2XM4 A;  1BZ4 A;  3V5Y A;  1T01 A;  2YHS A;  2Q7R A;  4ZLC A;  3UMK A;  1V55 C;  3NG1 A;  3NMJ A;  3GWN A;  1VK5 A;  4JTC B;  4C7O A;  1ZHX A;  256B A;  2LFD A;  3ABK C;  3DM9 B;  2JX0 A;  1NU9 C;  1MQV A;  2R7W A;  5JP7 A;  2R7T A;  1ZU5 A;  4Z9H A;  1CPR A;  1KNY A;  3ITF A;  4YN0 B;  3S90 A;  4UDV A;  5EHH A;  3M1C B;  3GEH A;  3OA1 A;  4CJG A;  5HV9 A;  2L6F A;  4D4N A;  3NMK A;  2QLA A;  4XWJ A;  1MND A;  1YVI A;  2H7V C;  2Q00 A;  4GQH A;  1VYK A;  1M2V B;  4C3D A;  3B0V C;  2HJ3 A;  2HFI A;  2PBE A;  1FNT c;  4QI0 A;  5COF A;  3K33 A;  1JRA A;  3L0I A;  3UR3 C;  1ZW2 A;  3AGT A;  3O55 A;  4OIQ F;  4U5C E;  1M2V A;  3QW1 A;  3ZIB A;  3UGO A;  4CSA A;  3K6B A;  2LSE A;  1W2W A;  1HW1 A;  2FAP B;  3MYF A;  1TWG A;  4PJM A;  4EIY A;  3RQE A;  3L8J A;  1VMA A;  1GS9 A;  4DRH B;  3ZSU A;  2KSF A;  4E0I A;  2VH3 A;  2P1A A;  3EG9 B;  2WVO A;  3JT1 A;  1QKR A;  3FOP A;  3WG7 C;  1T6I A;  3U5S A;  3K66 A;  3EG9 A;  2XM0 A;  4MQ9 F;  2R7X A;  2KK1 A;  3JZ0 A;  3U2L A;  3CSK A;  4BEM J;  3DE8 A;  3RKO F;  4WGY A;  2J9B A;  3ZTM A;  4OIR F;  1GM5 A;  3G4Z A;  1GGQ A;  3E70 C;  3SYN A;  2Y3H A;  1Y4C A;  1UG7 A;  4KNW A;  3IQ5 A;  3ZWI A;  3LEO A;  4MND A;  1R5I D;  4FX5 A;  1FMW A;  1D0Y A;  2IYL D;  1ZHT A;  2XS8 A;  1IZM A;  3HJC A;  4JJF A;  5B1A C;  1EA8 A;  4HEA J;  4J7T A;  3Q7L A;  4L6R A;  1ZW3 A;  2OJE D;  3U8V A;  1PV3 A;  2OJQ A;  5TJ5 E;  4MVR A;  2VCA A;  3F47 A;  4YL1 A;  3RF3 A;  5GPG B;  4DJ9 A;  4ULW A;  3S0X A;  3GM1 A;  2W9Y A;  4G7O F;  2W4B A;  2WZG A;  2IBF A;  4QDL A;  4U5E E;  3U0C A;  5AC4 A;  1IW7 F;  1TFO B;  4HFK B;  4YL0 A;  4PFO A;  5A6A A;  1SYQ A;  2W4M A;  4H4K C;  2E87 A;  2R25 A;  3G4X A;  4NTF A;  2AWC A;  1APC A;  2A68 F;  2MYS A;  4EBB A;  4OD5 A;  2Y3D A;  2GA0 A;  4O79 A;  2LQG A;  3UMH A;  2ZXO A;  4N4W A;  1HE1 A;  3OWT A;  4K1O A;  4AE4 B;  1EQ1 A;  2Y3G A;  2CCY A;  1GQA A;  1NZE A;  2GFH A;  4ZLD A;  1E85 A;  5FZT A;  4N6H A;  2D5R B;  1CPQ A;  2J9V A;  4CJO A;  4NCQ A;  2G3V A;  4AE4 A;  4NTB A;  3IEE A;  4J7Y A;  1U6H A;  2AVK A;  1OCZ C;  1A0B A;  4MVQ A;  3RIP A;  1S7Z A;  4LDQ A;  4GEH A;  2NPU A;  1E84 A;  2YZS A;  4I44 A;  5FCL A;  3BRJ A;  3HTK C;  3SNH A;  2HSQ A;  2J9W A;  4HE8 D;  1NU7 D;  4MVZ A;  4Z9J A;  5L3V A;  3RQF A;  2OCC C;  2YLG A;  3ZTZ A;  2WL8 A;  2PNO A;  2XXA B;  1ZHW A;  3ABL C;  3MBG A;  3OEO A;  4PFP A;  3JYH A;  2EPL X;  3AG4 C;  2YWA A;  3W2V A;  5JVE A;  3C62 A;  4J32 B;  1LVK A;  1BR2 A;  2XXA A;  1A7V A;  3M4B A;  4IJJ A;  2PF4 E;  4JEB A;  4E7S A;  4LER A;  4YT4 A;  4JE9 A;  2R7Q A;  2YRF A;  3L1M A;  3VM6 A;  1QPU A;  1TWC A;  3EQL F;  3B0P A;  2CNW D;  4IGG A;  3A9C A;  5DQT A;  2DYS C;  1J8Y F;  1YLM A;  2Q4F A;  4MW3 A;  4MTG A;  2NUP B;  3DD7 A;  4JJG A;  3T6B A;  4H54 A;  3V7O A;  1L3P A;  1VLT A;  3K1I A;  1M6T A;  4RD9 A;  1H9T A;  4MTO A;  2NUP A;  3U9M A;  3RH3 A;  4EBK A;  5KYN A;  3IQC A;  2KNH A;  1QZX A;  5D92 A;  3GM2 A;  1QLE C;  1R4T A;  3I5Q A;  4MW8 A;  4YT5 A;  3T9O A;  4BJ5 A;  4MVS A;  4CS9 C;  2KC3 A;  4Z9I A;  4FAP B;  2FGY A;  3B29 A;  4FWV A;  4BPM A;  3ABM C;  3EJN A;  1TFK B;  2XL6 A;  1NSG B;  5JLI A;  4E0H A;  1RKC A;  2J46 A;  4K0D A;  2R05 A;  1FR0 A;  3QVZ A;  1N1C A;  1RMV A;  5DS5 A;  3KPH A;  3DZA A;  4K7B A;  3DKA A;  3V5X A;  3LUT B;  5JRA A;  5BQH A;  2R03 A;  2XLE A;  2G3K A;  2ZD9 A;  2NG1 A;  3EH2 A;  4OD4 A;  2JPU A;  1Q0G A;  4JVS A;  4I3M A;  1YAR O;  4DRI B;  3MX3 A;  2Z15 A;  2IM8 A;  2AU5 A;  1VTM P;  3B0U X;  3NYL A;  1QSP A;  2HJM A;  4CS9 A;  3FVY A;  1O3U A;  1SZI A;  1YAU O;  2HS5 A;  5D91 A;  3AQB A;  4KI2 A;  2Y3B A;  2QTV A;  4CSA C;  4YL3 A;  1NLX A;  3ATP A;  5KYX B;  2PX0 A;  3Q6M A;  4XPY A;  2AP3 A;  1WTY A;  4OIP F;  1SR2 A;  1FFH A;  4YJW A;  2GAQ A;  5KYX A;  1AEP A;  1MMG A;  1E2X A;  4MTF A;  3SXY A;  3AQC A;  3H2V A;  3QW0 A;  3SZR A;  3NKD A;  3LES A;  1ZYR F;  4RBN A;  4MVO A;  3C7J A;  4A4A A;  2HUJ A;  2PX3 A;  3RVY A;  4DXW A;  1M57 C;  1ORS C;  3T6J A;  2MWQ A;  4BJ6 A;  4WJ0 A;  4EHP A;  3L8I A;  4JTA B;  5KYW B;  3V5Z A;  3TUL A;  2DGJ A;  3JRT A;  2YL0 A;  3A11 A;  3U2M A;  3HLZ A;  1ZHY A;  2YL1 A;  5KYW A;  1HMO A;  1TKN A;  2XLW A;  3U3F A;  1JAF A;  1LS1 A;  2ASR A;  2HMQ A;  4IWB A;  5DQZ A;  3BEH A;  2P0N A;  2Q9A A;  4N06 A;  2QY9 A;  3C18 A;  3PDM P;  1V54 C;  3EFO B;  1BR4 A;  1NBB A;  2V3C C;  1Q0M A;  1V4A A;  3Q6N A;  3ASO C;  4N6C A;  2Q9C A;  1JPN A;  4PJN A;  3DAF A;  2AWY A;  2L6G A;  3EFO A;  3ECS A;  1D1C A;  3H2U A;  4WGZ A;  4XTK A;  2HMZ A;  2R9R B;  2XLH A;  5F28 E;  1MNE A;  3VRC A;  1XZQ A;  3CQZ A;  2OOC A;  1WGW A;  2F22 A;  3LLI A;  4JIO A;  1Z5Z A;  4U5G A;  2Q9B A;  5B3S C;  2YVK A;  3JTL O;  3S27 A;  3TOM A;  1WN0 A;  2LD6 A;  3R2P A;  3S9O A;  2XRH A;  2KYH A;  1OW8 A;  1TQG A;  4WAB A;  4PR9 A;  1F1M A;  1JOG A;  1O5H A;  2EIL C;  2YL3 A;  4MVU A;  4BJT A;  4U9D A;  3RW0 A;  4EKW A;  5JUA A;  1RKE B;  2B0J A;  2HV7 A;  3SEO A;  2YEV A;  2VC9 A;  3RYL A;  3ZG1 A;  4IAQ A;  3I5P A;  1LE2 A;  3ZDL A;  4XPW A;  1RKE A;  3TJ5 A;  2J8W A;  3FMS A;  1ZHZ A;  3NMI A;  4JKV A;  4P6I C;  2R7R A;  3WHN A;  1CGM E;  3IHU A;  1DOW A;  3J06 A;  2KW3 C;  3LS0 A;  2Q3T A;  5CIV A;  2IXP A;  2ETS A;  1FAP B;  1D1A A;  1Z7Q c;  2VB6 A;  5KYY B;  4ANJ A;  4YWQ A;  2VCC A;  2XLD A;  3CZ6 A;  3HNJ A;  4U9E A;  1TR2 A;  4G7Z F;  2MHR A;  3AG3 C;  3LNR A;  5BQG A;  2BL2 A;  1BR1 A;  1YYJ A;  2XLM A;  4C3B A;  4E18 A;  5KYY A;  2OKU A;  4DOZ A;  1T9K A;  2OQM A;  1DOV A;  4IAO A;  1HE9 A;  3VAY A;  5KYU B;  2KQ9 A;  5BUO A;  5A6B D;  1C17 M;  4OIN F;  2OU6 A;  4LLC A;  1NG1 A;  3I4U A;  4ONS A;  5T1D B;  3DJU B;  1L7C A;  2HV6 A;  3K1I C;  2WVN A;  2RSE B;  4I1O B;  2A6H F;  2WZL A;  3QVY A;  1LE4 A;  5KYU A;  4E17 A;  1C02 A;  2EPM X;  4E7Z A;  3LEV A;  3GM3 A;  3K1H A;  3ZQY A;  5DS4 A;  1FMV A;  2A6E F;  3B9Q A;  1ORY A;  3W8I A;  1LKX A;  4YT8 A;  4BJ5 C;  5L0G A;  4XEK A;  2YLD A;  5L0D A;  3K7D A;  3W8H A;  2YL7 A;  3KMI A;  1SMY F;  1QVX A;  1E86 A;  2WB7 A;  3IPM O;  1XWJ A;  2R7S A;  5E3A A;  2VAS A;  3US6 A;  1H9G A;  2IOQ A;  3FOO A;  1PD1 A;  2W45 A;  2UUI A;  1OXK A;  1XZP A;  5T3T A;  2KGO A;  2YLI A;  2XSE A;  1D0Z A;  4KC9 A;  1BBH A;  3KL4 A;  3GEI A;  4CIH A;  2YQY A;  1ST6 A;  1LPE A;  2EIM C;  2A69 F;  3JYY A;  5DVW A;  1VLS A;  2I8B A;  1I4Z A;  4AX2 A;  2QE9 A;  1FFT C;  4CX9 A;  4DBR A;  5A6J A;  2HSB A;  1WAT A;  1YJG A;  1G4U S;  3LLK A;  3NYM A;  3AG2 C;  3JSZ A;  1KTM A;  3O39 A;  4XLN F;  1VOM A;  4KNV A;  3TQO A;  2BE5 F;  3EHN A;  2Y39 A;  1ZZP A;  2CW0 F;  4YK5 A;  3LJB A;  1C03 A;  3EZH A;  1B68 A;  3QZC A;  1WWP A;  4D4X A;  3W4Y A;  1YA9 A;  2A0U A;  2JD3 A;  5JSL A;  3SP1 A;  3TJ6 A;  1OKK D;  1TWA A;  2HZ8 A;  4LDK A;  4AL1 A;  3UGP A;  1D0X A;  1HW2 A;  1PCX A;  1MMD A;  4NQF A;  2LFF A;  4IB4 A;  3AGU A;  3JRM O;  3X1O A;  1LI5 A;  1RJ9 B;  1Z6A A;  3IQT A;  4JZA A;  4BJ6 C;  3FAP B;  4ULV A;  4M63 A;  4O6N A;  5L0I A;  4W8P A;  1SF8 A;  2J0W A;  1G4W R;  4DVZ A; 
#chains in the Genus database with same CATH homology
 1YLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...