1YLMA

Structure of cytosolic protein of unknown function yute from bacillus subtilis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
b'MYFVDRSKIEKTLGFFEHQLALFDSQTDWQSEIGELALQRIGHLLIECILDTGNDMIDGFIMRDPGSYDDIMDILVDEKVVTEKEGDELKKLIAYRKTLVQQYLLADSGELYRLIKAHQTALQDFPKRIRSYLETELGPVSAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein BSU32300
publication title Hypothetical cytosolic protein YutE from Bacillus subtilis
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Structural genomics, unknown function
total genus 50
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01934 DUF86 Protein of unknown function DUF86
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.580 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) bsu32300-like 1ylmA00
1YLMA
chains in the Genus database with same CATH superfamily
3M79A 1MQVA 1R4TA 4JTAB 3LESA 5E2QA 4BJ5C 1V55C 4DBQA 4E0HA 2M4EA 2HMQA 4E18A 4ULVA 1XZQA 4MW8A 4YJWA 3NDBB 3H2VA 2HZ8A 4IAQA 1C03A 4MVSA 3HNLA 1RKEA 3ZDLA 3LLKA 2R7XA 2WZGA 1L7CA 4Q5SF 1VK5A 2WZLA 1WASA 2DI3A 1VYKA 2J8WA 2R7OA 3SXZA 4MW3A 5COMA 4XPYA 5A6BD 1I5NA 1TWCA 3NG1A 3HNJA 3SP1A 3LJBA 5DS6A 4K0DA 3PHF2 3V5XA 5JVEA 3U9MA 5CI8A 4CIPA 1HMDA 4YN0B 1FMVA 4JE9A 4B6IA 1OW8A 4O79A 4MS2A 2HUJA 2XS8A 2H7OA 3M4CA 1HW2A 5B3SC 4PJLA 1OW6A 3IQCA 3W2VA 2IXPA 1GQAA 1NZEA 3K1IA 4FAPB 2YEVA 3NYMA 1H7IA 3X2QC 5KYXA 2YLIA 3C63A 3EHNA 2XL4A 2XLVA 2Q3TA 1YDIA 1LM3B 4NTFA 3JZ0A 1VLTA 3IHUA 3SXYA 4ZLCA 4BJTA 3U2LA 1OCRC 3SZRA 3M4BA 2KC3A 4KC9A 4G7HF 1HY5A 1YJGA 3VRCA 1T01A 1PCXA 3A9CA 3MFNA 1NU9C 2I15A 2XM4A 3GORA 2NUTB 2XLOA 1SYQA 4ONSA 1BR1A 4PR9A 4OIRF 1VLSA 2J0WA 3G4ZA 3CAXA 3BRJA 1LVKA 1U6HA 4CJGA 5L0DA 2DYRC 1A7DA 2HS5A 4BJ5A 4P9FA 2YLDA 4QI2A 3JSZA 5JS5A 1OKKA 2EIKC 1O3UA 1CGNA 1WTYA 2E87A 3KMIA 3LS0A 4G78A 4LDKA 4DRIB 3DZAA 3JRTA 4NY3A 1WATA 4XPXA 2AWCA 4PK4A 5KYYA 3U9JA 2EPKX 4C3BA 1LE4A 3VF0A 2ZXWC 3FDQA 1OXKA 4BEJA 3DAFA 1A7EA 1RJ9B 1ZVZA 5DLJA 4EWCA 5A69A 1U89A 3EFOB 1XWJA 3FAJA 3HNIA 4IAOA 1HE1A 3FMSA 4OD5A 2WVNA 2I8BA 3AOUA 2CDQA 2RD9A 3UR3C 1Z3IX 1A0BA 1G4US 2LFDA 4O6MA 4XEFA 3UMHA 4LERA 5DQZA 2HKVA 4W8KA 2HV6A 3EGDA 2BE5F 4CDYA 3J06A 5DS5A 2LFFA 1LE2A 2XL8A 3Q7GA 4O7GA 1LI5A 4U5FE 3ZWIA 2PF4E 3S84A 3ABLC 1K40A 1VTMP 2Q9AA 2R25A 3FAPB 3NMIA 5L0IA 3W8IA 3F46A 5L0HA 3HJCA 5B1AC 3RW0A 2WB7A 4J30B 1KNYA 1MMGA 2L6FA 3BEHA 1T6IA 4IRUA 3TQOA 4WABA 3FHDA 3LNMB 3GWNA 4U9EA 3NKDA 5D92A 2RSEB 2R7SA 4C3DA 1FNTc 2YLGA 3U0CA 2QLAA 1CGOA 1TWAA 3DMDA 2AWYA 1EA8A 4HFKB 5CIVA 4C7OA 2WVQA 3LEOA 3CZ6A 4XLPF 1T9KA 4MVOA 1YAUO 2AU5A 1GS9A 4JURI 2V26A 3LNRA 1PD1A 3T4RA 3S90A 1FFTC 2FGYA 3U8VA 3L8JA 5BUOA 1G5ZA 4YT2A 4LACB 2ZD9A 2ZXRA 1Z5ZA 4XQ1A 4J7YA 2IM8A 3FOOA 2C03A 3S0XA 4KBLA 2R7TA 5JSLA 1APCA 3K33A 3PCVA 3ZSUA 2R7VA 1ZW3A 3AJMA 2YZSA 1BBHA 3M1CB 3QTHA 1OR2A 3I5PA 1WGWA 3EHMA 2R02A 4LDRA 1T5OA 4AE4A 3NRHA 2PNOA 3B0PA 4XEKA 4O6NA 4HE8D 2PP4A 2IXOA 3QW1A 4YWQA 1Z63A 2LSEA 2XL6A 256BA 1VMAA 5A6BA 1ZU5A 3QZCA 2PFDA 1Y6DA 4MNDA 1QLEC 3RKOF 5KYXB 5BQGA 2YVKA 1ZHTA 2IBFA 3M15A 3ZQYA 2A6EF 2HMZA 3X1OA 1EQ1A 3POVA 2EPOA 2R05A 2XLEA 2XRHA 1R5ID 1MMDA 3IQ6A 4RDAA 4XPWA 4FX5A 2KSFA 1K05A 4AL1A 1T6UA 4AK9A 4UDVA 1OR3A 3IPMO 3T9OA 1V4AA 2P6VA 3EJNA 2H7BA 3ZC4A 1AEPA 2QY9A 2VASA 5COGA 3OWTA 4PFPA 1LS1A 1TR2A 3O39A 2OJQA 1ORJA 2LP4A 2WL8A 2J0XA 3C8GD 1J8YF 3HTKC 5JLIA 4U9DA 1TFOB 1NU7D 3DAGA 4G7OF 1OCCC 3AG3C 2R7QA 3LLIA 1A41A 2P61A 3C18A 3B29A 2P7VA 2Q00A 3Q7LA 1V74B 1BR2A 2Z15A 4C3EA 2ZXPA 1YA9A 3L8IA 4EKWA 2YKZA 2PBEA 4I3MA 4KI2A 4OIPF 1T6QA 3DI5A 4IWBA 4JJGA 4FWVA 2HJMA 3DKAA 1NFNA 1Q0KA 2P1AA 4JC7A 4MTGA 4PFOA 3TJ6A 2Q9CA 3C62A 3ITFA 1G8XA 1NFOA 2KNHA 4H4KC 4JCHA 2FAPB 1HMOA 2GAQA 5DS4A 4KNWA 4MTFA 3RVZA 2YRFA 1OQCA 5L0GA 1RCPA 1EI7A 2L6GA 3GWLA 4WGYA 3US6A 5BQHA 5L0CA 2WZFA 3ASNC 3KPHA 1KTMA 1M2VA 1YYJA 1IZMA 2GFHA 2HJ3A 4DVZA 2OG2A 2YL7A 2KW3C 2IOQA 2R03A 2NSFA 4JEBA 1WWPA 2Y3GA 1QPUA 4K7BA 2ICWG 2EINC 1TFKB 4XWJA 3WG7C 4DRJB 1BZ4A 1LI7A 5A6KA 4BJ1A 2CW0F 4YL0A 2P0NA 4JZAA 1ZYRF 3TD7A 2EPMX 5FCLA 4D4XA 4C7OB 4U5GA 3QVZA 2R9RB 1I4YA 4EBKA 4I1OB 5JRAA 2G3KA 2J7PD 2NSGA 2PX3A 2DB4A 1VB5A 1JOGA 1W2WA 2OOCA 2YL1A 4P6IC 4JJFA 4OIOF 1D1CA 2MYSA 3VYWA 3W2WA 3VAYA 5A6AA 4R32A 1FTSA 1JRAA 1FMWA 2EPLX 2Q9BA 3E70C 2AVKA 3MLGA 3T6GB 2OKUA 3KYJA 1E85A 3RIPA 1JMWA 1WOLA 4JTCB 5F28E 2OJED 3ZTMA 1NG1A 1EKYA 3S29A 4BPMA 1E84A 5L0FA 3ABMC 3JCUQ 1J8MF 1UFBA 2B0JA 2J9WA 2A1DD 3DM9B 3HNKA 3RYLA 1YA7O 1YZAA 2MHRA 1E86A 1YARO 5COFA 2G3VA 1KU2A 3EGXA 2J9UA 4H54A 4JW1A 4RD9A 4CJOA 2CNWD 3SXMA 1OCOC 5BQIA 2CGEA 1VYIA 1ZZPA 2W4MA 2OEXA 2L6HA 3AGUA 3MYFA 3NYJA 3R2PA 4J32B 3I5QA 1PD0A 4N06A 2X0CA 1OCZC 4XLNF 4IGGA 2AP3A 3JT1A 4G0HA 4U5BE 4JRZA 3RF3A 3S28A 1DOVA 3RFYA 3QVYA 4QDLA 4LLCA 1QSPA 4WJ0A 3B0UX 2JPUA 3JTLO 4X0RA 1JPJA 1H9GA 3S9OA 4E7ZA 3PMRA 3EPVA 2IXNA 3GM1A 2EPNA 1OW7A 3TOLA 1D1BA 2Y39A 2A68F 2ZXOA 3HLZA 3LAYA 4F4BA 1AUEA 2TMVP 1RKEB 5DQTA 4EUKB 4RBNA 3RQFA 2R7WA 5E3CA 3AG2C 2EIJC 3GEIA 2NG1A 3U5SA 1SZIA 5L0JA 4CBEA 1M6TA 5JUAA 4CDAA 4DBRA 3WHNA 4G7ZF 3ASOC 5E33A 3FOPA 3E9VA 1YVIA 1QKRA 2C04A 2YL3A 2UUIA 3EZHA 3GM2A 3Q6NA 4U5EE 1WN0A 4YK5A 1L3PA 3NMKA 3PDMP 2QNLA 5T3WA 3VM6A 3L1MA 3ZTZA 1MNEA 4ULWA 3C8GA 4CS7A 2LIGA 2FFHA 3DM5A 3EG9A 4HEAJ 3TOMA 1FR0A 3CQZA 1ZHZA 2HFIA 2KQ9A 3RQEA 1TKNA 4QI0A 2XXAA 2IXMA 2IYLD 3UMIA 3C8ZA 4N6HA 2XLHA 3ECSA 3GEHA 4GYTA 1Z23A 4NTAA 4YL1A 4MVZA 2L81A 5DVWA 1M2VB 2CYDA 2OQMA 2Y3HA 1IW7F 3UMKA 4BG0A 1OXBA 5T3TA 4JVSA 2ETSA 1V54C 1ST6A 3UGPA 1RJ9A 3KL4A 1F1MA 1JPNA 3EFOA 3HKKA 1CPRA 4N6CA 3SXKA 3T6JA 4OINF 3O10A 3T6BA 4JTDB 3A11A 3DJUB 2YWAA 4JEAA 4JKVA 4PACA 1E2XA 1FAPB 3FXHA 3H2UA 3OA1A 1ORYA 1MMAA 2M64A 3MYIA 4J7TA 4CIHA 2Y3DA 3FVYA 4PJMA 1HE9A 1QQ3A 3JYYA 4Q7CA 1S7ZA 2LK4A 4OD4A 2R7UA 4YT5A 5A6JA 2QE9A 1O87A 5KYYB 3WAQA 3H65A 1Z6AA 3IQ5A 4P9TA 2QUPA 3CEXA 3R7CA 5IY5C 2H8AA 2ZPAA 2R7RA 5AGFA 2YL0A 4NC3A 3DD7A 4M63A 3V7OA 5KYWA 2BC5A 5EK0A 3U3BA 3JRMO 2O9XA 1PV3A 1NBBA 2J7PA 1U0BB 4MTOA 2EILC 4NTBA 4DRHB 2A6HF 3O6XA 1H6GA 3KKBA 3LEVA 2VCCA 3I4UA 5CI9A 4YL3A 2XS1A 3DE8A 3EGXB 3GM3A 2KK1A 1ZU4A 3EGDB 5AC4A 2MWQA 3DWWA 1D0XA 2HSBA 4IB4A 5F5FA 3N0TA 4CS9C 2VCAA 2W45A 5F5HA 4Q4ZF 3EH2A 3TJ5A 3GANA 3B71A 5EGYA 3DJNB 4OIQF 3K6BA 1M57C 4N4WA 3UNGC 3EH1A 5B1BC 3SYNA 1D0ZA 2YHSA 4MVQA 2GA0A 2VB6A 1D1AA 3JSEO 3MX3A 1M56C 4FESA 4JIOA 3U3FA 2GDCA 1LPEA 4I44A 1A7VA 1ZW2A 2B0HA 1QZXA 3DXJF 4ER9A 1LS4A 4U5CE 2OU6A 2NUPA 2CNWA 2Q4FA 3AG1C 4XTKA 4CDVA 4DVYP 5T1DB 5KYUA 4CSAC 3ZQVA 4U5DE 3N2ZB 4MVMA 4Z9IA 5B3IA 4HFFB 1GM5A 3O55A 3G4XA 2OEVA 1CGME 3V5ZA 4NCQA 3NMJA 3G50A 4BJ6C 2GWWA 3IEEA 4DJ9A 3WODF 4A4AA 2ASRA 1RMVA 1DOWA 3W8HA 4PJJA 4A2NB 1E83A 2H7VC 4BEMJ 5KYNA 3S27A 5E3AA 1Q0GA 1RKCA 3SEOA 2JD3A 1AVOB 2XLWA 4E7SA 4O6YA 3MBGA 4YT8A 1SMYF 2A0UA 2LD6A 2W4BA 5AC5A 5JT4A 2JX0A 4LDQA 2X51A 2L9JA 2NPUA 4AE4B 4ANJA 2KYHA 3KYIA 4CS8C 4D4NA 2XSEA 2WVOA 3C8GB 1C02A 2DYSC 1BR4A 3NKEA 4LLEA 3ZIBA 2HSQA 1G4WR 2Y69C 3EG9B 1GGQA 3LUTB 4K1OA 4CX9A 2VCBA 4GEHA 1MNDA 3TK0A 1ZHWA 4EBBA 4JCZA 4MVUA 3K7DA 1ZHXA 3Q6MA 4WGZA 2XXAB 2PX0A 3RH3A 3C7JA 1K04A 3ZVRA 1TQGA 3L34A 4IARA 3ATPA 3UGOA 2J45A 2A0BA 5L3VA 4L6RA 3JYHA 4CS9A 4KNVA 1YZCA 2HV7A 1HW1A 1Q0DA 2L7AA 3AQBA 1SR2A 2QTVA 2XLDA 3V5YA 2F22A 2DGJA 1M2OA 1Y4CA 2VC9A 3OEOA 4YT4A 4W8PA 1MMNA 4EIYA 1FFHA 3QMKA 2G62A 2BL2A 3IQTA 4GQHA 3F47A 1LIHA 1BDJB 1LKXA 1OKKD 4ZLDA 2XLMA 4DXWA 3U2MA 2J46A 3LS1A 4CSAA 4U5HA 2D5RB 2D4UA 2LQGA 1UG7A 4IJJA 4XEVA 1YYXA 3SNHA 3K1HA 2NUTA 4Z9JA 3W4YA 2XM0A 3EQLF 5KYWB 1QVXA 5EHHA 1C17M 4BJ6A 2LCHA 1S05A 1JR8A 5TJ5E 2A69F 2YQYA 2V3CC 1XZPA 5FZTA 1NLXA 1Z7Qc 1RXQA 4NQFA 4AL0A 4E17A 3AG4C 3GEEA 3L0IA 3N24A 2J9VA 3QW0A 3TULA 3EZIA 5JP7A 5K0IA 4I1MA 3DE9A 2Q7RA 1TWGA 4CS8A 3U8PA 1I4ZA 1SF8A 2CCYA 1VOMA 1O5HA 4MVRA 3K1IC 3KH2A 3B9QA 3NYLA 4MQ9F 4E0IA 3ZG1A 2W9YA 1YLMA 2KGOA 2KJGA 3K66A 5HSWA 1NSGB 3RVYA 2NUPB 3B0VC 4Z9HA 1ORSC 1Q0MA 2Y3BA 2J9BA 1TWHA 3AGTA 5GPGB 1H9TA 4EBJA 4PJNA 5KYUB 1Q0FA 5D91A 2EIMC 4AX2A 2OCCC 3AQCA 3GODA 3RQGA 1N1CA 3ABKC 1JAFA 5HV9A 4EHPA 2UUHA 1CPQA 1ZHYA 1D0YA 2VH3A 3CSKA 1B68A 4DOZA 5L3QA
chains in the Genus database with same CATH topology
1YLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YLM A; 
#chains in the Genus database with same CATH topology
 3M79 A;  1MQV A;  1R4T A;  4JTA B;  3LES A;  5E2Q A;  4BJ5 C;  1V55 C;  4DBQ A;  4E0H A;  2M4E A;  2HMQ A;  4E18 A;  4ULV A;  1XZQ A;  4MW8 A;  4YJW A;  3NDB B;  3H2V A;  2HZ8 A;  4IAQ A;  1C03 A;  4MVS A;  3HNL A;  1RKE A;  3ZDL A;  3LLK A;  2R7X A;  2WZG A;  1L7C A;  4Q5S F;  1VK5 A;  2WZL A;  1WAS A;  2DI3 A;  1VYK A;  2J8W A;  2R7O A;  3SXZ A;  4MW3 A;  5COM A;  4XPY A;  5A6B D;  1I5N A;  1TWC A;  3NG1 A;  3HNJ A;  3SP1 A;  3LJB A;  5DS6 A;  4K0D A;  3PHF 2;  3V5X A;  5JVE A;  3U9M A;  5CI8 A;  4CIP A;  1HMD A;  4YN0 B;  1FMV A;  4JE9 A;  4B6I A;  1OW8 A;  4O79 A;  4MS2 A;  2HUJ A;  2XS8 A;  2H7O A;  3M4C A;  1HW2 A;  5B3S C;  4PJL A;  1OW6 A;  3IQC A;  3W2V A;  2IXP A;  1GQA A;  1NZE A;  3K1I A;  4FAP B;  2YEV A;  3NYM A;  1H7I A;  3X2Q C;  5KYX A;  2YLI A;  3C63 A;  3EHN A;  2XL4 A;  2XLV A;  2Q3T A;  1YDI A;  1LM3 B;  4NTF A;  3JZ0 A;  1VLT A;  3IHU A;  3SXY A;  4ZLC A;  4BJT A;  3U2L A;  1OCR C;  3SZR A;  3M4B A;  2KC3 A;  4KC9 A;  4G7H F;  1HY5 A;  1YJG A;  3VRC A;  1T01 A;  1PCX A;  3A9C A;  3MFN A;  1NU9 C;  2I15 A;  2XM4 A;  3GOR A;  2NUT B;  2XLO A;  1SYQ A;  4ONS A;  1BR1 A;  4PR9 A;  4OIR F;  1VLS A;  2J0W A;  3G4Z A;  3CAX A;  3BRJ A;  1LVK A;  1U6H A;  4CJG A;  5L0D A;  2DYR C;  1A7D A;  2HS5 A;  4BJ5 A;  4P9F A;  2YLD A;  4QI2 A;  3JSZ A;  5JS5 A;  1OKK A;  2EIK C;  1O3U A;  1CGN A;  1WTY A;  2E87 A;  3KMI A;  3LS0 A;  4G78 A;  4LDK A;  4DRI B;  3DZA A;  3JRT A;  4NY3 A;  1WAT A;  4XPX A;  2AWC A;  4PK4 A;  5KYY A;  3U9J A;  2EPK X;  4C3B A;  1LE4 A;  3VF0 A;  2ZXW C;  3FDQ A;  1OXK A;  4BEJ A;  3DAF A;  1A7E A;  1RJ9 B;  1ZVZ A;  5DLJ A;  4EWC A;  5A69 A;  1U89 A;  3EFO B;  1XWJ A;  3FAJ A;  3HNI A;  4IAO A;  1HE1 A;  3FMS A;  4OD5 A;  2WVN A;  2I8B A;  3AOU A;  2CDQ A;  2RD9 A;  3UR3 C;  1Z3I X;  1A0B A;  1G4U S;  2LFD A;  4O6M A;  4XEF A;  3UMH A;  4LER A;  5DQZ A;  2HKV A;  4W8K A;  2HV6 A;  3EGD A;  2BE5 F;  4CDY A;  3J06 A;  5DS5 A;  2LFF A;  1LE2 A;  2XL8 A;  3Q7G A;  4O7G A;  1LI5 A;  4U5F E;  3ZWI A;  2PF4 E;  3S84 A;  3ABL C;  1K40 A;  1VTM P;  2Q9A A;  2R25 A;  3FAP B;  3NMI A;  5L0I A;  3W8I A;  3F46 A;  5L0H A;  3HJC A;  5B1A C;  3RW0 A;  2WB7 A;  4J30 B;  1KNY A;  1MMG A;  2L6F A;  3BEH A;  1T6I A;  4IRU A;  3TQO A;  4WAB A;  3FHD A;  3LNM B;  3GWN A;  4U9E A;  3NKD A;  5D92 A;  2RSE B;  2R7S A;  4C3D A;  1FNT c;  2YLG A;  3U0C A;  2QLA A;  1CGO A;  1TWA A;  3DMD A;  2AWY A;  1EA8 A;  4HFK B;  5CIV A;  4C7O A;  2WVQ A;  3LEO A;  3CZ6 A;  4XLP F;  1T9K A;  4MVO A;  1YAU O;  2AU5 A;  1GS9 A;  4JUR I;  2V26 A;  3LNR A;  1PD1 A;  3T4R A;  3S90 A;  1FFT C;  2FGY A;  3U8V A;  3L8J A;  5BUO A;  1G5Z A;  4YT2 A;  4LAC B;  2ZD9 A;  2ZXR A;  1Z5Z A;  4XQ1 A;  4J7Y A;  2IM8 A;  3FOO A;  2C03 A;  3S0X A;  4KBL A;  2R7T A;  5JSL A;  1APC A;  3K33 A;  3PCV A;  3ZSU A;  2R7V A;  1ZW3 A;  3AJM A;  2YZS A;  1BBH A;  3M1C B;  3QTH A;  1OR2 A;  3I5P A;  1WGW A;  3EHM A;  2R02 A;  4LDR A;  1T5O A;  4AE4 A;  3NRH A;  2PNO A;  3B0P A;  4XEK A;  4O6N A;  4HE8 D;  2PP4 A;  2IXO A;  3QW1 A;  4YWQ A;  1Z63 A;  2LSE A;  2XL6 A;  256B A;  1VMA A;  5A6B A;  1ZU5 A;  3QZC A;  2PFD A;  1Y6D A;  4MND A;  1QLE C;  3RKO F;  5KYX B;  5BQG A;  2YVK A;  1ZHT A;  2IBF A;  3M15 A;  3ZQY A;  2A6E F;  2HMZ A;  3X1O A;  1EQ1 A;  3POV A;  2EPO A;  2R05 A;  2XLE A;  2XRH A;  1R5I D;  1MMD A;  3IQ6 A;  4RDA A;  4XPW A;  4FX5 A;  2KSF A;  1K05 A;  4AL1 A;  1T6U A;  4AK9 A;  4UDV A;  1OR3 A;  3IPM O;  3T9O A;  1V4A A;  2P6V A;  3EJN A;  2H7B A;  3ZC4 A;  1AEP A;  2QY9 A;  2VAS A;  5COG A;  3OWT A;  4PFP A;  1LS1 A;  1TR2 A;  3O39 A;  2OJQ A;  1ORJ A;  2LP4 A;  2WL8 A;  2J0X A;  3C8G D;  1J8Y F;  3HTK C;  5JLI A;  4U9D A;  1TFO B;  1NU7 D;  3DAG A;  4G7O F;  1OCC C;  3AG3 C;  2R7Q A;  3LLI A;  1A41 A;  2P61 A;  3C18 A;  3B29 A;  2P7V A;  2Q00 A;  3Q7L A;  1V74 B;  1BR2 A;  2Z15 A;  4C3E A;  2ZXP A;  1YA9 A;  3L8I A;  4EKW A;  2YKZ A;  2PBE A;  4I3M A;  4KI2 A;  4OIP F;  1T6Q A;  3DI5 A;  4IWB A;  4JJG A;  4FWV A;  2HJM A;  3DKA A;  1NFN A;  1Q0K A;  2P1A A;  4JC7 A;  4MTG A;  4PFO A;  3TJ6 A;  2Q9C A;  3C62 A;  3ITF A;  1G8X A;  1NFO A;  2KNH A;  4H4K C;  4JCH A;  2FAP B;  1HMO A;  2GAQ A;  5DS4 A;  4KNW A;  4MTF A;  3RVZ A;  2YRF A;  1OQC A;  5L0G A;  1RCP A;  1EI7 A;  2L6G A;  3GWL A;  4WGY A;  3US6 A;  5BQH A;  5L0C A;  2WZF A;  3ASN C;  3KPH A;  1KTM A;  1M2V A;  1YYJ A;  1IZM A;  2GFH A;  2HJ3 A;  4DVZ A;  2OG2 A;  2YL7 A;  2KW3 C;  2IOQ A;  2R03 A;  2NSF A;  4JEB A;  1WWP A;  2Y3G A;  1QPU A;  4K7B A;  2ICW G;  2EIN C;  1TFK B;  4XWJ A;  3WG7 C;  4DRJ B;  1BZ4 A;  1LI7 A;  5A6K A;  4BJ1 A;  2CW0 F;  4YL0 A;  2P0N A;  4JZA A;  1ZYR F;  3TD7 A;  2EPM X;  5FCL A;  4D4X A;  4C7O B;  4U5G A;  3QVZ A;  2R9R B;  1I4Y A;  4EBK A;  4I1O B;  5JRA A;  2G3K A;  2J7P D;  2NSG A;  2PX3 A;  2DB4 A;  1VB5 A;  1JOG A;  1W2W A;  2OOC A;  2YL1 A;  4P6I C;  4JJF A;  4OIO F;  1D1C A;  2MYS A;  3VYW A;  3W2W A;  3VAY A;  5A6A A;  4R32 A;  1FTS A;  1JRA A;  1FMW A;  2EPL X;  2Q9B A;  3E70 C;  2AVK A;  3MLG A;  3T6G B;  2OKU A;  3KYJ A;  1E85 A;  3RIP A;  1JMW A;  1WOL A;  4JTC B;  5F28 E;  2OJE D;  3ZTM A;  1NG1 A;  1EKY A;  3S29 A;  4BPM A;  1E84 A;  5L0F A;  3ABM C;  3JCU Q;  1J8M F;  1UFB A;  2B0J A;  2J9W A;  2A1D D;  3DM9 B;  3HNK A;  3RYL A;  1YA7 O;  1YZA A;  2MHR A;  1E86 A;  1YAR O;  5COF A;  2G3V A;  1KU2 A;  3EGX A;  2J9U A;  4H54 A;  4JW1 A;  4RD9 A;  4CJO A;  2CNW D;  3SXM A;  1OCO C;  5BQI A;  2CGE A;  1VYI A;  1ZZP A;  2W4M A;  2OEX A;  2L6H A;  3AGU A;  3MYF A;  3NYJ A;  3R2P A;  4J32 B;  3I5Q A;  1PD0 A;  4N06 A;  2X0C A;  1OCZ C;  4XLN F;  4IGG A;  2AP3 A;  3JT1 A;  4G0H A;  4U5B E;  4JRZ A;  3RF3 A;  3S28 A;  1DOV A;  3RFY A;  3QVY A;  4QDL A;  4LLC A;  1QSP A;  4WJ0 A;  3B0U X;  2JPU A;  3JTL O;  4X0R A;  1JPJ A;  1H9G A;  3S9O A;  4E7Z A;  3PMR A;  3EPV A;  2IXN A;  3GM1 A;  2EPN A;  1OW7 A;  3TOL A;  1D1B A;  2Y39 A;  2A68 F;  2ZXO A;  3HLZ A;  3LAY A;  4F4B A;  1AUE A;  2TMV P;  1RKE B;  5DQT A;  4EUK B;  4RBN A;  3RQF A;  2R7W A;  5E3C A;  3AG2 C;  2EIJ C;  3GEI A;  2NG1 A;  3U5S A;  1SZI A;  5L0J A;  4CBE A;  1M6T A;  5JUA A;  4CDA A;  4DBR A;  3WHN A;  4G7Z F;  3ASO C;  5E33 A;  3FOP A;  3E9V A;  1YVI A;  1QKR A;  2C04 A;  2YL3 A;  2UUI A;  3EZH A;  3GM2 A;  3Q6N A;  4U5E E;  1WN0 A;  4YK5 A;  1L3P A;  3NMK A;  3PDM P;  2QNL A;  5T3W A;  3VM6 A;  3L1M A;  3ZTZ A;  1MNE A;  4ULW A;  3C8G A;  4CS7 A;  2LIG A;  2FFH A;  3DM5 A;  3EG9 A;  4HEA J;  3TOM A;  1FR0 A;  3CQZ A;  1ZHZ A;  2HFI A;  2KQ9 A;  3RQE A;  1TKN A;  4QI0 A;  2XXA A;  2IXM A;  2IYL D;  3UMI A;  3C8Z A;  4N6H A;  2XLH A;  3ECS A;  3GEH A;  4GYT A;  1Z23 A;  4NTA A;  4YL1 A;  4MVZ A;  2L81 A;  5DVW A;  1M2V B;  2CYD A;  2OQM A;  2Y3H A;  1IW7 F;  3UMK A;  4BG0 A;  1OXB A;  5T3T A;  4JVS A;  2ETS A;  1V54 C;  1ST6 A;  3UGP A;  1RJ9 A;  3KL4 A;  1F1M A;  1JPN A;  3EFO A;  3HKK A;  1CPR A;  4N6C A;  3SXK A;  3T6J A;  4OIN F;  3O10 A;  3T6B A;  4JTD B;  3A11 A;  3DJU B;  2YWA A;  4JEA A;  4JKV A;  4PAC A;  1E2X A;  1FAP B;  3FXH A;  3H2U A;  3OA1 A;  1ORY A;  1MMA A;  2M64 A;  3MYI A;  4J7T A;  4CIH A;  2Y3D A;  3FVY A;  4PJM A;  1HE9 A;  1QQ3 A;  3JYY A;  4Q7C A;  1S7Z A;  2LK4 A;  4OD4 A;  2R7U A;  4YT5 A;  5A6J A;  2QE9 A;  1O87 A;  5KYY B;  3WAQ A;  3H65 A;  1Z6A A;  3IQ5 A;  4P9T A;  2QUP A;  3CEX A;  3R7C A;  5IY5 C;  2H8A A;  2ZPA A;  2R7R A;  5AGF A;  2YL0 A;  4NC3 A;  3DD7 A;  4M63 A;  3V7O A;  5KYW A;  2BC5 A;  5EK0 A;  3U3B A;  3JRM O;  2O9X A;  1PV3 A;  1NBB A;  2J7P A;  1U0B B;  4MTO A;  2EIL C;  4NTB A;  4DRH B;  2A6H F;  3O6X A;  1H6G A;  3KKB A;  3LEV A;  2VCC A;  3I4U A;  5CI9 A;  4YL3 A;  2XS1 A;  3DE8 A;  3EGX B;  3GM3 A;  2KK1 A;  1ZU4 A;  3EGD B;  5AC4 A;  2MWQ A;  3DWW A;  1D0X A;  2HSB A;  4IB4 A;  5F5F A;  3N0T A;  4CS9 C;  2VCA A;  2W45 A;  5F5H A;  4Q4Z F;  3EH2 A;  3TJ5 A;  3GAN A;  3B71 A;  5EGY A;  3DJN B;  4OIQ F;  3K6B A;  1M57 C;  4N4W A;  3UNG C;  3EH1 A;  5B1B C;  3SYN A;  1D0Z A;  2YHS A;  4MVQ A;  2GA0 A;  2VB6 A;  1D1A A;  3JSE O;  3MX3 A;  1M56 C;  4FES A;  4JIO A;  3U3F A;  2GDC A;  1LPE A;  4I44 A;  1A7V A;  1ZW2 A;  2B0H A;  1QZX A;  3DXJ F;  4ER9 A;  1LS4 A;  4U5C E;  2OU6 A;  2NUP A;  2CNW A;  2Q4F A;  3AG1 C;  4XTK A;  4CDV A;  4DVY P;  5T1D B;  5KYU A;  4CSA C;  3ZQV A;  4U5D E;  3N2Z B;  4MVM A;  4Z9I A;  5B3I A;  4HFF B;  1GM5 A;  3O55 A;  3G4X A;  2OEV A;  1CGM E;  3V5Z A;  4NCQ A;  3NMJ A;  3G50 A;  4BJ6 C;  2GWW A;  3IEE A;  4DJ9 A;  3WOD F;  4A4A A;  2ASR A;  1RMV A;  1DOW A;  3W8H A;  4PJJ A;  4A2N B;  1E83 A;  2H7V C;  4BEM J;  5KYN A;  3S27 A;  5E3A A;  1Q0G A;  1RKC A;  3SEO A;  2JD3 A;  1AVO B;  2XLW A;  4E7S A;  4O6Y A;  3MBG A;  4YT8 A;  1SMY F;  2A0U A;  2LD6 A;  2W4B A;  5AC5 A;  5JT4 A;  2JX0 A;  4LDQ A;  2X51 A;  2L9J A;  2NPU A;  4AE4 B;  4ANJ A;  2KYH A;  3KYI A;  4CS8 C;  4D4N A;  2XSE A;  2WVO A;  3C8G B;  1C02 A;  2DYS C;  1BR4 A;  3NKE A;  4LLE A;  3ZIB A;  2HSQ A;  1G4W R;  2Y69 C;  3EG9 B;  1GGQ A;  3LUT B;  4K1O A;  4CX9 A;  2VCB A;  4GEH A;  1MND A;  3TK0 A;  1ZHW A;  4EBB A;  4JCZ A;  4MVU A;  3K7D A;  1ZHX A;  3Q6M A;  4WGZ A;  2XXA B;  2PX0 A;  3RH3 A;  3C7J A;  1K04 A;  3ZVR A;  1TQG A;  3L34 A;  4IAR A;  3ATP A;  3UGO A;  2J45 A;  2A0B A;  5L3V A;  4L6R A;  3JYH A;  4CS9 A;  4KNV A;  1YZC A;  2HV7 A;  1HW1 A;  1Q0D A;  2L7A A;  3AQB A;  1SR2 A;  2QTV A;  2XLD A;  3V5Y A;  2F22 A;  2DGJ A;  1M2O A;  1Y4C A;  2VC9 A;  3OEO A;  4YT4 A;  4W8P A;  1MMN A;  4EIY A;  1FFH A;  3QMK A;  2G62 A;  2BL2 A;  3IQT A;  4GQH A;  3F47 A;  1LIH A;  1BDJ B;  1LKX A;  1OKK D;  4ZLD A;  2XLM A;  4DXW A;  3U2M A;  2J46 A;  3LS1 A;  4CSA A;  4U5H A;  2D5R B;  2D4U A;  2LQG A;  1UG7 A;  4IJJ A;  4XEV A;  1YYX A;  3SNH A;  3K1H A;  2NUT A;  4Z9J A;  3W4Y A;  2XM0 A;  3EQL F;  5KYW B;  1QVX A;  5EHH A;  1C17 M;  4BJ6 A;  2LCH A;  1S05 A;  1JR8 A;  5TJ5 E;  2A69 F;  2YQY A;  2V3C C;  1XZP A;  5FZT A;  1NLX A;  1Z7Q c;  1RXQ A;  4NQF A;  4AL0 A;  4E17 A;  3AG4 C;  3GEE A;  3L0I A;  3N24 A;  2J9V A;  3QW0 A;  3TUL A;  3EZI A;  5JP7 A;  5K0I A;  4I1M A;  3DE9 A;  2Q7R A;  1TWG A;  4CS8 A;  3U8P A;  1I4Z A;  1SF8 A;  2CCY A;  1VOM A;  1O5H A;  4MVR A;  3K1I C;  3KH2 A;  3B9Q A;  3NYL A;  4MQ9 F;  4E0I A;  3ZG1 A;  2W9Y A;  1YLM A;  2KGO A;  2KJG A;  3K66 A;  5HSW A;  1NSG B;  3RVY A;  2NUP B;  3B0V C;  4Z9H A;  1ORS C;  1Q0M A;  2Y3B A;  2J9B A;  1TWH A;  3AGT A;  5GPG B;  1H9T A;  4EBJ A;  4PJN A;  5KYU B;  1Q0F A;  5D91 A;  2EIM C;  4AX2 A;  2OCC C;  3AQC A;  3GOD A;  3RQG A;  1N1C A;  3ABK C;  1JAF A;  5HV9 A;  4EHP A;  2UUH A;  1CPQ A;  1ZHY A;  1D0Y A;  2VH3 A;  3CSK A;  1B68 A;  4DOZ A;  5L3Q A; 
#chains in the Genus database with same CATH homology
 1YLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...