1YLMA

Structure of cytosolic protein of unknown function yute from bacillus subtilis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
MYFVDRSKIEKTLGFFEHQLALFDSQTDWQSEIGELALQRIGHLLIECILDTGNDMIDGFIMRDPGSYDDIMDILVDEKVVTEKEGDELKKLIAYRKTLVQQYLLADSGELYRLIKAHQTALQDFPKRIRSYLETELGPVSAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein BSU32300
publication title Hypothetical cytosolic protein YutE from Bacillus subtilis
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
total genus 50
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01934 DUF86 Protein of unknown function DUF86
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.580 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) bsu32300-like 1ylmA00
1YLMA
chains in the Genus database with same CATH superfamily
1LE2A 1E86A 2DYSC 4BJ1A 2W45A 2XSEA 3GORA 5KYWB 2VC9A 1JR8A 2WVOA 2Z15A 4DBQA 4C7OB 1XWJA 3GEEA 4K0DA 4YT8A 1BR1A 4U5HA 3EGXA 3S9OA 4OIOF 1RMVA 2BC5A 5T1DB 1N1CA 4BJ6A 2YRFA 4AK9A 2G62A 4L6RA 4CX9A 2V3CC 4JCHA 2KJGA 4RDAA 2YKZA 3C8GD 3QTHA 1RKCA 3EHNA 3VF0A 3DZAA 2KSFA 2YLGA 1HE1A 3ABMC 4JE9A 5F5HA 2ZXRA 1VLTA 3JZ0A 4Q5SF 2WZFA 3W8HA 1AEPA 4IWBA 4A2NB 3A9CA 3A11A 3DM9B 3IHUA 4J32B 1FMWA 3C8GB 4CJGA 2J8WA 3DJNB 4FWVA 4IJJA 5COGA 1QZXA 1ORSC 4ULWA 1E2XA 4IGGA 2XLDA 3K7DA 2OJED 4G7OF 3IQ6A 3E70C 2NUTB 2H7VC 1YYJA 2PFDA 1LIHA 1Q0FA 4I1OB 2VASA 1FFTC 3EGDB 1UG7A 4HEAJ 1K04A 4MVOA 1U0BB 5F5FA 3JYYA 3HKKA 4AX2A 3JCUQ 3ZTMA 4MQ9F 3AG3C 2IXMA 2HJMA 1Q0GA 2HS5A 1ZVZA 2OJQA 3KH2A 4NCQA 3LS1A 4YT5A 5FZTA 3GWNA 5JSLA 2A6EF 3ZVRA 3EPVA 4CIHA 3GEHA 2XLMA 3CZ6A 4D4XA 2VCAA 2Q9AA 4OINF 5L0FA 1BZ4A 3JRMO 1HMOA 5BQIA 3EGXB 1H6GA 1A7DA 2A0BA 2HKVA 2HV7A 1HY5A 2DI3A 2KNHA 3LNRA 1BR2A 1Y4CA 3NMKA 5JT4A 4CSAC 4R32A 1YDIA 2XS8A 4BPMA 4G7HF 3VRCA 3WHNA 4LACB 5COMA 3KYJA 2Y3HA 1OCOC 3NKDA 2DYRC 3RW0A 3K66A 1HMDA 4CDAA 2HMQA 2EIJC 3DJUB 4JTAB 1NU7D 4OIQF 1NLXA 1WWPA 3ZQVA 4JIOA 1CGNA 3K1IA 2R7OA 1MQVA 4OD4A 4EBJA 4WABA 2VB6A 3E9VA 3SP1A 3RVZA 2G3KA 1VLSA 4YL3A 4BEJA 3B0UX 4B6IA 1DOVA 1ZHTA 4QI0A 4XTKA 1DOWA 1TWAA 3LESA 5F28E 2XLHA 2YHSA 3NG1A 4N6HA 4CS9A 4LLEA 4AL0A 1EA8A 1SMYF 2YL1A 4NTAA 3TOMA 2GDCA 4CS7A 2KW3C 4FAPB 5E3CA 1GM5A 5JUAA 3UMHA 1M57C 4P9FA 4NTFA 1XZQA 5IY5C 1TQGA 3RYLA 5JS5A 1LI7A 1CGOA 1MMAA 3B71A 1IW7F 3FHDA 3FAJA 3MBGA 2UUIA 4X0RA 2LIGA 3J06A 2Q3TA 3LEOA 1AUEA 4PFOA 3ZQYA 4I3MA 1LS1A 2OG2A 4NQFA 4ANJA 1ZHWA 1J8MF 4U5FE 2A68F 4GEHA 5DLJA 4H54A 5DVWA 1U89A 2YVKA 5JVEA 4H4KC 5CI8A 1M6TA 4AE4A 1A7VA 2R7QA 4W8KA 2QY9A 5KYXA 5L0JA 2Y3DA 1KU2A 3HNIA 1GGQA 2P1AA 4U5CE 2P7VA 3S29A 2CNWA 2YEVA 1G4US 2FGYA 1MMNA 2OOCA 4M63A 4MVUA 4MW8A 4XPYA 1FTSA 1SYQA 3SXYA 3SEOA 3IQTA 1PD0A 4I44A 2OEVA 3U3FA 2M4EA 3N0TA 2XRHA 4E18A 3GM2A 4XPXA 3AGTA 2J7PA 1ZYRF 3LLIA 3ZG1A 1TWCA 4IRUA 1YZAA 2L6GA 1T5OA 1YA9A 2R05A 4DRJB 4HFFB 3RF3A 4IB4A 3EQLF 3N24A 1OR3A 3GODA 5D91A 1ST6A 3V5XA 1RCPA 4MVZA 3Q6NA 3AGUA 2D5RB 4KC9A 3NYMA 1T6UA 2XL6A 1PV3A 4JC7A 4Q4ZF 3V7OA 1SF8A 2I8BA 2J9UA 3HNKA 2DB4A 1MNEA 4Q7CA 3NYLA 3WODF 4CS8A 3C7JA 3JTLO 4C3DA 1ZZPA 4E7SA 2OQMA 256BA 2VCBA 2HJ3A 3DE9A 4PK4A 1ORYA 2CNWD 3KMIA 5DQTA 1LM3B 2JD3A 4AE4B 2A1DD 3ZTZA 3U8PA 2HMZA 1L7CA 2PBEA 3QW1A 4NY3A 3U9JA 4LLCA 3UGPA 4GQHA 3FAPB 5AC5A 4JTCB 3ITFA 2J9VA 4K7BA 4KNWA 3LAYA 3DI5A 2KYHA 2LD6A 1O5HA 3FOOA 3FXHA 1R4TA 2A6HF 2A69F 2ETSA 2J7PD 3AJMA 3T4RA 3T9OA 1O87A 2OEXA 3TJ6A 4C3EA 4EWCA 4QI2A 3UGOA 3EJNA 2NUPA 2Q4FA 3HNJA 2MHRA 5L0CA 2CCYA 1G4WR 3G4XA 2RSEB 5EGYA 5L0DA 1D0ZA 1MMGA 3QVZA 5FCLA 3JSZA 1V4AA 2OU6A 3DXJF 4U5EE 2W9YA 1T6IA 1IZMA 5L0IA 4O6NA 5DS4A 3S90A 3EFOA 1Z7Qc 5B3IA 3R2PA 1D1CA 3X1OA 1RKEA 1TFOB 2OCCC 4P6IC 3AG4C 3GM3A 1E85A 2HFIA 3W4YA 3PHF2 4DRIB 2LQGA 2DGJA 3T6BA 1ZHXA 3SNHA 4XLPF 5D92A 3UMIA 3G4ZA 4U9EA 5TJ5E 4YK5A 5EHHA 1BBHA 3NRHA 3OEOA 4Z9JA 4AL1A 2EINC 2PF4E 3H65A 4YL1A 2HSBA 2CW0F 4N6CA 4O7GA 1Z6AA 5AGFA 4N06A 1FFHA 4ER9A 1VYIA 1TWHA 1T9KA 4XQ1A 3V5ZA 2Q7RA 1NFOA 3U2LA 3HJCA 3K6BA 2JPUA 5T3WA 3S84A 2R7SA 1WATA 2HZ8A 2J0XA 4MW3A 1ZU5A 3LJBA 1OCCC 4CBEA 3MFNA 3MX3A 3FDQA 3VAYA 3X2QC 2PX0A 2XLWA 3CQZA 3ASNC 3AOUA 4JURI 2ZPAA 3G50A 3L8IA 3SXKA 5KYNA 1H9TA 3AG2C 3NMIA 5A69A 3NMJA 4HFKB 3TK0A 4DOZA 1NSGB 1S7ZA 2NUPB 1A0BA 3POVA 1K40A 2V26A 2NSFA 4A4AA 1QKRA 3BEHA 3KPHA 1M2OA 1LPEA 5CIVA 2Y3GA 4CS8C 3M79A 1VMAA 3ZIBA 1H9GA 4E0IA 2P0NA 2EPMX 2R03A 3SXMA 1Q0DA 2J45A 4BJ6C 4ZLCA 1T6QA 5CI9A 1RKEB 3HLZA 5KYYA 3K1HA 3OWTA 4MVMA 3IPMO 2GAQA 2XXAA 3SZRA 3O55A 1ZW2A 1I4ZA 4UDVA 5GPGB 1E84A 1VB5A 2IBFA 1VYKA 2QNLA 2VH3A 3SXZA 1CPRA 1JPNA 1QSPA 2EIMC 1JMWA 4JJGA 2X0CA 2LCHA 1NU9C 3DMDA 2J0WA 3EZHA 4MTGA 1EI7A 1MMDA 2AP3A 2E87A 4E17A 5B3SC 2O9XA 3U3BA 5L0GA 2YL3A 3RQGA 2ZD9A 4BEMJ 1NFNA 1FAPB 2IOQA 2XS1A 1OXKA 1TWGA 3K33A 4EBKA 4EKWA 2Q9BA 3GWLA 3PMRA 5COFA 2QUPA 4GYTA 5E2QA 4F4BA 1YARO 2KC3A 2JX0A 3T6GB 1JAFA 4FESA 3M15A 4WGYA 2NG1A 4Z9IA 5EK0A 1ORJA 1Z3IX 5K0IA 2M64A 5L3VA 3B0VC 2R7TA 1Y6DA 2WVNA 3DM5A 1WTYA 1OKKA 1G5ZA 2Q00A 2UUHA 1I5NA 1TKNA 2WZLA 3B9QA 1PD1A 2YL7A 2FAPB 4PFPA 1D0XA 3V5YA 3RFYA 2YLDA 1LS4A 2D4UA 3LS0A 1J8YF 3IEEA 3EZIA 2A0UA 4U5GA 3UMKA 3ZWIA 1D1BA 1FMVA 1OW6A 1D0YA 2YL0A 2AWCA 4DXWA 1OQCA 2ZXWC 4BJTA 1M2VA 4MS2A 4J7TA 3ZSUA 2X51A 1APCA 1PCXA 1W2WA 3LNMB 4RBNA 5KYYB 5L0HA 3W2VA 4KBLA 1V54C 2BL2A 2L7AA 3RQEA 3U9MA 3I5QA 3L34A 3N2ZB 1A41A 1TFKB 2XM0A 3M4BA 3TJ5A 1QLEC 3CSKA 3QMKA 1Z5ZA 4CIPA 3K1IC 4XEFA 2R02A 2EILC 3F46A 4PJLA 1I4YA 3QW0A 4PJNA 1U6HA 1YZCA 3VYWA 4MTFA 1K05A 5DS5A 3ABKC 2NUTA 4I1MA 1JOGA 4U5DE 4CSAA 3IQCA 1ZU4A 4D4NA 1OKKD 1QVXA 1UFBA 2OKUA 4IAQA 3NKEA 3FOPA 4CS9C 5KYXB 2XLOA 5T3TA 3RQFA 4JZAA 3WG7C 3LLKA 4PJMA 4WGZA 3W2WA 4JCZA 3ZDLA 1HW2A 1HE9A 3LEVA 4HE8D 4EHPA 1O3UA 3CAXA 4ONSA 2XM4A 5B1AC 5DS6A 1L3PA 1OCZC 2EPLX 2VCCA 1YJGA 2Y3BA 3TULA 3ATPA 2GA0A 3EHMA 2W4BA 1FNTc 4JVSA 2IM8A 2R7VA 2J9WA 2R25A 5A6AA 1M2VB 2YWAA 4Z9HA 1JPJA 4YL0A 3JRTA 5DQZA 2LSEA 3KL4A 3IQ5A 4PACA 4XPWA 1BDJB 2GWWA 4JKVA 5HSWA 1OXBA 1YVIA 4O6YA 5JLIA 3JYHA 1XZPA 2C04A 1S05A 3AG1C 1C02A 2YZSA 3QVYA 3B29A 1ZHZA 3PCVA 4JEBA 4OD5A 3I4UA 2WZGA 4W8PA 3US6A 4BJ5A 4C3BA 3TOLA 2LFDA 3TQOA 3DKAA 4IARA 4DBRA 4ULVA 1EQ1A 4MTOA 3U0CA 4MVQA 3H2VA 1YA7O 1OW7A 2L6HA 3B0PA 3DWWA 4IAOA 3F47A 3HNLA 4JTDB 3MYFA 1LI5A 4MVRA 2WVQA 3L0IA 4XLNF 4U9DA 4LDKA 5JRAA 5A6BA 2BE5F 1LKXA 2AWYA 2P6VA 4DVYP 4KI2A 3EH2A 5HV9A 2YQYA 3DAGA 1V55C 2IXNA 3UNGC 1OW8A 2EPKX 4OIRF 3RIPA 2I15A 3AQBA 2LP4A 2F22A 4MNDA 3KYIA 4CDYA 1C17M 5BQGA 1KTMA 3C18A 5KYUA 2XLEA 3EG9A 3I5PA 1TR2A 3JT1A 4G0HA 1RXQA 2AVKA 2KQ9A 3GEIA 1D1AA 1KNYA 1YAUO 1V74B 2L9JA 4YT4A 2R7WA 4RD9A 1HW1A 4U5BE 1A7EA 4J7YA 4DJ9A 2WL8A 1JRAA 4CDVA 3TD7A 1B68A 2YLIA 4YJWA 1WOLA 3L1MA 1H7IA 2KGOA 4JEAA 2G3VA 2ICWG 1WGWA 4QDLA 3EH1A 3LUTB 3Q7LA 5AC4A 2H8AA 2Y69C 3RKOF 1ZHYA 3EFOB 1WASA 5BQHA 1CGME 2B0JA 1CPQA 1MNDA 2TMVP 2MYSA 1ZW3A 2GFHA 2KK1A 2W4MA 3CEXA 1T01A 4DRHB 2XLVA 3S0XA 4OIPF 3NYJA 2ZXOA 3UR3C 2R9RB 2L6FA 1OCRC 3ASOC 3MLGA 5B1BC 3SYNA 4PJJA 1SZIA 2FFHA 3Q7GA 5E3AA 5A6BD 4E0HA 2IYLD 3BRJA 4EIYA 2EIKC 3FVYA 3Q6MA 1QPUA 1GQAA 3GM1A 4BG0A 2EPNA 5JP7A 2R7UA 2B0HA 4XWJA 4JW1A 4EBBA 4O79A 1NG1A 1Z23A 2NPUA 2IXPA 2QLAA 1Z63A 1AVOB 1R5ID 4MVSA 3U8VA 4O6MA 3W8IA 4ZLDA 3S27A 4YT2A 3O10A 4LDRA 1EKYA 1Q0KA 2EPOA 4CJOA 1VTMP 4FX5A 1GS9A 3C8ZA 1C03A 1RJ9A 1LVKA 1SR2A 3H2UA 3WAQA 3JSEO 5KYUB 3O6XA 2Y39A 3EG9B 3R7CA 3PDMP 4G78A 1LE4A 4LERA 4BJ5C 4PR9A 4XEKA 4G7ZF 3VM6A 4E7ZA 4K1OA 1F1MA 2L81A 1NBBA 1BR4A 1VOMA 2HSQA 4KNVA 3U5SA 2PP4A 2AU5A 4J30B 5KYWA 4C7OA 2QTVA 2WB7A 3M4CA 3ZC4A 4NC3A 2ZXPA 1QQ3A 4P9TA 2CGEA 4JJFA 5L3QA 3RVYA 2CYDA 3ABLC 1E83A 4EUKB 5A6JA 2H7OA 2LK4A 2J9BA 4WJ0A 5A6KA 3T6JA 2XXAB 2MWQA 3C63A 3KKBA 5BUOA 3U2MA 4YN0B 3O39A 1FR0A 3C8GA 3DAFA 3AQCA 2PNOA 5E33A 2IXOA 2C03A 3GANA 3MYIA 1G8XA 2H7BA 3FMSA 3M1CB 4JRZA 2QE9A 2R7XA 2HUJA 3DE8A 2R7RA 3C62A 3QZCA 4N4WA 2LFFA 3NDBB 3HTKC 2PX3A 1M56C 1YLMA 3EGDA 3S28A 2RD9A 1RJ9B 4XEVA 1VK5A 2Q9CA 3L8JA 4DVZA 3OA1A 1NZEA 1OR2A 2CDQA 2HV6A 2XL4A 1WN0A 2ASRA 3ECSA 4LDQA 2P61A 2NSGA 4NTBA 4YWQA 1Q0MA 1YYXA 3DD7A 2J46A 2XL8A 3RH3A
chains in the Genus database with same CATH topology
1YLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YLM A; 
#chains in the Genus database with same CATH topology
 1LE2 A;  1E86 A;  2DYS C;  4BJ1 A;  2W45 A;  2XSE A;  3GOR A;  5KYW B;  2VC9 A;  1JR8 A;  2WVO A;  2Z15 A;  4DBQ A;  4C7O B;  1XWJ A;  3GEE A;  4K0D A;  4YT8 A;  1BR1 A;  4U5H A;  3EGX A;  3S9O A;  4OIO F;  1RMV A;  2BC5 A;  5T1D B;  1N1C A;  4BJ6 A;  2YRF A;  4AK9 A;  2G62 A;  4L6R A;  4CX9 A;  2V3C C;  4JCH A;  2KJG A;  4RDA A;  2YKZ A;  3C8G D;  3QTH A;  1RKC A;  3EHN A;  3VF0 A;  3DZA A;  2KSF A;  2YLG A;  1HE1 A;  3ABM C;  4JE9 A;  5F5H A;  2ZXR A;  1VLT A;  3JZ0 A;  4Q5S F;  2WZF A;  3W8H A;  1AEP A;  4IWB A;  4A2N B;  3A9C A;  3A11 A;  3DM9 B;  3IHU A;  4J32 B;  1FMW A;  3C8G B;  4CJG A;  2J8W A;  3DJN B;  4FWV A;  4IJJ A;  5COG A;  1QZX A;  1ORS C;  4ULW A;  1E2X A;  4IGG A;  2XLD A;  3K7D A;  2OJE D;  4G7O F;  3IQ6 A;  3E70 C;  2NUT B;  2H7V C;  1YYJ A;  2PFD A;  1LIH A;  1Q0F A;  4I1O B;  2VAS A;  1FFT C;  3EGD B;  1UG7 A;  4HEA J;  1K04 A;  4MVO A;  1U0B B;  5F5F A;  3JYY A;  3HKK A;  4AX2 A;  3JCU Q;  3ZTM A;  4MQ9 F;  3AG3 C;  2IXM A;  2HJM A;  1Q0G A;  2HS5 A;  1ZVZ A;  2OJQ A;  3KH2 A;  4NCQ A;  3LS1 A;  4YT5 A;  5FZT A;  3GWN A;  5JSL A;  2A6E F;  3ZVR A;  3EPV A;  4CIH A;  3GEH A;  2XLM A;  3CZ6 A;  4D4X A;  2VCA A;  2Q9A A;  4OIN F;  5L0F A;  1BZ4 A;  3JRM O;  1HMO A;  5BQI A;  3EGX B;  1H6G A;  1A7D A;  2A0B A;  2HKV A;  2HV7 A;  1HY5 A;  2DI3 A;  2KNH A;  3LNR A;  1BR2 A;  1Y4C A;  3NMK A;  5JT4 A;  4CSA C;  4R32 A;  1YDI A;  2XS8 A;  4BPM A;  4G7H F;  3VRC A;  3WHN A;  4LAC B;  5COM A;  3KYJ A;  2Y3H A;  1OCO C;  3NKD A;  2DYR C;  3RW0 A;  3K66 A;  1HMD A;  4CDA A;  2HMQ A;  2EIJ C;  3DJU B;  4JTA B;  1NU7 D;  4OIQ F;  1NLX A;  1WWP A;  3ZQV A;  4JIO A;  1CGN A;  3K1I A;  2R7O A;  1MQV A;  4OD4 A;  4EBJ A;  4WAB A;  2VB6 A;  3E9V A;  3SP1 A;  3RVZ A;  2G3K A;  1VLS A;  4YL3 A;  4BEJ A;  3B0U X;  4B6I A;  1DOV A;  1ZHT A;  4QI0 A;  4XTK A;  1DOW A;  1TWA A;  3LES A;  5F28 E;  2XLH A;  2YHS A;  3NG1 A;  4N6H A;  4CS9 A;  4LLE A;  4AL0 A;  1EA8 A;  1SMY F;  2YL1 A;  4NTA A;  3TOM A;  2GDC A;  4CS7 A;  2KW3 C;  4FAP B;  5E3C A;  1GM5 A;  5JUA A;  3UMH A;  1M57 C;  4P9F A;  4NTF A;  1XZQ A;  5IY5 C;  1TQG A;  3RYL A;  5JS5 A;  1LI7 A;  1CGO A;  1MMA A;  3B71 A;  1IW7 F;  3FHD A;  3FAJ A;  3MBG A;  2UUI A;  4X0R A;  2LIG A;  3J06 A;  2Q3T A;  3LEO A;  1AUE A;  4PFO A;  3ZQY A;  4I3M A;  1LS1 A;  2OG2 A;  4NQF A;  4ANJ A;  1ZHW A;  1J8M F;  4U5F E;  2A68 F;  4GEH A;  5DLJ A;  4H54 A;  5DVW A;  1U89 A;  2YVK A;  5JVE A;  4H4K C;  5CI8 A;  1M6T A;  4AE4 A;  1A7V A;  2R7Q A;  4W8K A;  2QY9 A;  5KYX A;  5L0J A;  2Y3D A;  1KU2 A;  3HNI A;  1GGQ A;  2P1A A;  4U5C E;  2P7V A;  3S29 A;  2CNW A;  2YEV A;  1G4U S;  2FGY A;  1MMN A;  2OOC A;  4M63 A;  4MVU A;  4MW8 A;  4XPY A;  1FTS A;  1SYQ A;  3SXY A;  3SEO A;  3IQT A;  1PD0 A;  4I44 A;  2OEV A;  3U3F A;  2M4E A;  3N0T A;  2XRH A;  4E18 A;  3GM2 A;  4XPX A;  3AGT A;  2J7P A;  1ZYR F;  3LLI A;  3ZG1 A;  1TWC A;  4IRU A;  1YZA A;  2L6G A;  1T5O A;  1YA9 A;  2R05 A;  4DRJ B;  4HFF B;  3RF3 A;  4IB4 A;  3EQL F;  3N24 A;  1OR3 A;  3GOD A;  5D91 A;  1ST6 A;  3V5X A;  1RCP A;  4MVZ A;  3Q6N A;  3AGU A;  2D5R B;  4KC9 A;  3NYM A;  1T6U A;  2XL6 A;  1PV3 A;  4JC7 A;  4Q4Z F;  3V7O A;  1SF8 A;  2I8B A;  2J9U A;  3HNK A;  2DB4 A;  1MNE A;  4Q7C A;  3NYL A;  3WOD F;  4CS8 A;  3C7J A;  3JTL O;  4C3D A;  1ZZP A;  4E7S A;  2OQM A;  256B A;  2VCB A;  2HJ3 A;  3DE9 A;  4PK4 A;  1ORY A;  2CNW D;  3KMI A;  5DQT A;  1LM3 B;  2JD3 A;  4AE4 B;  2A1D D;  3ZTZ A;  3U8P A;  2HMZ A;  1L7C A;  2PBE A;  3QW1 A;  4NY3 A;  3U9J A;  4LLC A;  3UGP A;  4GQH A;  3FAP B;  5AC5 A;  4JTC B;  3ITF A;  2J9V A;  4K7B A;  4KNW A;  3LAY A;  3DI5 A;  2KYH A;  2LD6 A;  1O5H A;  3FOO A;  3FXH A;  1R4T A;  2A6H F;  2A69 F;  2ETS A;  2J7P D;  3AJM A;  3T4R A;  3T9O A;  1O87 A;  2OEX A;  3TJ6 A;  4C3E A;  4EWC A;  4QI2 A;  3UGO A;  3EJN A;  2NUP A;  2Q4F A;  3HNJ A;  2MHR A;  5L0C A;  2CCY A;  1G4W R;  3G4X A;  2RSE B;  5EGY A;  5L0D A;  1D0Z A;  1MMG A;  3QVZ A;  5FCL A;  3JSZ A;  1V4A A;  2OU6 A;  3DXJ F;  4U5E E;  2W9Y A;  1T6I A;  1IZM A;  5L0I A;  4O6N A;  5DS4 A;  3S90 A;  3EFO A;  1Z7Q c;  5B3I A;  3R2P A;  1D1C A;  3X1O A;  1RKE A;  1TFO B;  2OCC C;  4P6I C;  3AG4 C;  3GM3 A;  1E85 A;  2HFI A;  3W4Y A;  3PHF 2;  4DRI B;  2LQG A;  2DGJ A;  3T6B A;  1ZHX A;  3SNH A;  4XLP F;  5D92 A;  3UMI A;  3G4Z A;  4U9E A;  5TJ5 E;  4YK5 A;  5EHH A;  1BBH A;  3NRH A;  3OEO A;  4Z9J A;  4AL1 A;  2EIN C;  2PF4 E;  3H65 A;  4YL1 A;  2HSB A;  2CW0 F;  4N6C A;  4O7G A;  1Z6A A;  5AGF A;  4N06 A;  1FFH A;  4ER9 A;  1VYI A;  1TWH A;  1T9K A;  4XQ1 A;  3V5Z A;  2Q7R A;  1NFO A;  3U2L A;  3HJC A;  3K6B A;  2JPU A;  5T3W A;  3S84 A;  2R7S A;  1WAT A;  2HZ8 A;  2J0X A;  4MW3 A;  1ZU5 A;  3LJB A;  1OCC C;  4CBE A;  3MFN A;  3MX3 A;  3FDQ A;  3VAY A;  3X2Q C;  2PX0 A;  2XLW A;  3CQZ A;  3ASN C;  3AOU A;  4JUR I;  2ZPA A;  3G50 A;  3L8I A;  3SXK A;  5KYN A;  1H9T A;  3AG2 C;  3NMI A;  5A69 A;  3NMJ A;  4HFK B;  3TK0 A;  4DOZ A;  1NSG B;  1S7Z A;  2NUP B;  1A0B A;  3POV A;  1K40 A;  2V26 A;  2NSF A;  4A4A A;  1QKR A;  3BEH A;  3KPH A;  1M2O A;  1LPE A;  5CIV A;  2Y3G A;  4CS8 C;  3M79 A;  1VMA A;  3ZIB A;  1H9G A;  4E0I A;  2P0N A;  2EPM X;  2R03 A;  3SXM A;  1Q0D A;  2J45 A;  4BJ6 C;  4ZLC A;  1T6Q A;  5CI9 A;  1RKE B;  3HLZ A;  5KYY A;  3K1H A;  3OWT A;  4MVM A;  3IPM O;  2GAQ A;  2XXA A;  3SZR A;  3O55 A;  1ZW2 A;  1I4Z A;  4UDV A;  5GPG B;  1E84 A;  1VB5 A;  2IBF A;  1VYK A;  2QNL A;  2VH3 A;  3SXZ A;  1CPR A;  1JPN A;  1QSP A;  2EIM C;  1JMW A;  4JJG A;  2X0C A;  2LCH A;  1NU9 C;  3DMD A;  2J0W A;  3EZH A;  4MTG A;  1EI7 A;  1MMD A;  2AP3 A;  2E87 A;  4E17 A;  5B3S C;  2O9X A;  3U3B A;  5L0G A;  2YL3 A;  3RQG A;  2ZD9 A;  4BEM J;  1NFN A;  1FAP B;  2IOQ A;  2XS1 A;  1OXK A;  1TWG A;  3K33 A;  4EBK A;  4EKW A;  2Q9B A;  3GWL A;  3PMR A;  5COF A;  2QUP A;  4GYT A;  5E2Q A;  4F4B A;  1YAR O;  2KC3 A;  2JX0 A;  3T6G B;  1JAF A;  4FES A;  3M15 A;  4WGY A;  2NG1 A;  4Z9I A;  5EK0 A;  1ORJ A;  1Z3I X;  5K0I A;  2M64 A;  5L3V A;  3B0V C;  2R7T A;  1Y6D A;  2WVN A;  3DM5 A;  1WTY A;  1OKK A;  1G5Z A;  2Q00 A;  2UUH A;  1I5N A;  1TKN A;  2WZL A;  3B9Q A;  1PD1 A;  2YL7 A;  2FAP B;  4PFP A;  1D0X A;  3V5Y A;  3RFY A;  2YLD A;  1LS4 A;  2D4U A;  3LS0 A;  1J8Y F;  3IEE A;  3EZI A;  2A0U A;  4U5G A;  3UMK A;  3ZWI A;  1D1B A;  1FMV A;  1OW6 A;  1D0Y A;  2YL0 A;  2AWC A;  4DXW A;  1OQC A;  2ZXW C;  4BJT A;  1M2V A;  4MS2 A;  4J7T A;  3ZSU A;  2X51 A;  1APC A;  1PCX A;  1W2W A;  3LNM B;  4RBN A;  5KYY B;  5L0H A;  3W2V A;  4KBL A;  1V54 C;  2BL2 A;  2L7A A;  3RQE A;  3U9M A;  3I5Q A;  3L34 A;  3N2Z B;  1A41 A;  1TFK B;  2XM0 A;  3M4B A;  3TJ5 A;  1QLE C;  3CSK A;  3QMK A;  1Z5Z A;  4CIP A;  3K1I C;  4XEF A;  2R02 A;  2EIL C;  3F46 A;  4PJL A;  1I4Y A;  3QW0 A;  4PJN A;  1U6H A;  1YZC A;  3VYW A;  4MTF A;  1K05 A;  5DS5 A;  3ABK C;  2NUT A;  4I1M A;  1JOG A;  4U5D E;  4CSA A;  3IQC A;  1ZU4 A;  4D4N A;  1OKK D;  1QVX A;  1UFB A;  2OKU A;  4IAQ A;  3NKE A;  3FOP A;  4CS9 C;  5KYX B;  2XLO A;  5T3T A;  3RQF A;  4JZA A;  3WG7 C;  3LLK A;  4PJM A;  4WGZ A;  3W2W A;  4JCZ A;  3ZDL A;  1HW2 A;  1HE9 A;  3LEV A;  4HE8 D;  4EHP A;  1O3U A;  3CAX A;  4ONS A;  2XM4 A;  5B1A C;  5DS6 A;  1L3P A;  1OCZ C;  2EPL X;  2VCC A;  1YJG A;  2Y3B A;  3TUL A;  3ATP A;  2GA0 A;  3EHM A;  2W4B A;  1FNT c;  4JVS A;  2IM8 A;  2R7V A;  2J9W A;  2R25 A;  5A6A A;  1M2V B;  2YWA A;  4Z9H A;  1JPJ A;  4YL0 A;  3JRT A;  5DQZ A;  2LSE A;  3KL4 A;  3IQ5 A;  4PAC A;  4XPW A;  1BDJ B;  2GWW A;  4JKV A;  5HSW A;  1OXB A;  1YVI A;  4O6Y A;  5JLI A;  3JYH A;  1XZP A;  2C04 A;  1S05 A;  3AG1 C;  1C02 A;  2YZS A;  3QVY A;  3B29 A;  1ZHZ A;  3PCV A;  4JEB A;  4OD5 A;  3I4U A;  2WZG A;  4W8P A;  3US6 A;  4BJ5 A;  4C3B A;  3TOL A;  2LFD A;  3TQO A;  3DKA A;  4IAR A;  4DBR A;  4ULV A;  1EQ1 A;  4MTO A;  3U0C A;  4MVQ A;  3H2V A;  1YA7 O;  1OW7 A;  2L6H A;  3B0P A;  3DWW A;  4IAO A;  3F47 A;  3HNL A;  4JTD B;  3MYF A;  1LI5 A;  4MVR A;  2WVQ A;  3L0I A;  4XLN F;  4U9D A;  4LDK A;  5JRA A;  5A6B A;  2BE5 F;  1LKX A;  2AWY A;  2P6V A;  4DVY P;  4KI2 A;  3EH2 A;  5HV9 A;  2YQY A;  3DAG A;  1V55 C;  2IXN A;  3UNG C;  1OW8 A;  2EPK X;  4OIR F;  3RIP A;  2I15 A;  3AQB A;  2LP4 A;  2F22 A;  4MND A;  3KYI A;  4CDY A;  1C17 M;  5BQG A;  1KTM A;  3C18 A;  5KYU A;  2XLE A;  3EG9 A;  3I5P A;  1TR2 A;  3JT1 A;  4G0H A;  1RXQ A;  2AVK A;  2KQ9 A;  3GEI A;  1D1A A;  1KNY A;  1YAU O;  1V74 B;  2L9J A;  4YT4 A;  2R7W A;  4RD9 A;  1HW1 A;  4U5B E;  1A7E A;  4J7Y A;  4DJ9 A;  2WL8 A;  1JRA A;  4CDV A;  3TD7 A;  1B68 A;  2YLI A;  4YJW A;  1WOL A;  3L1M A;  1H7I A;  2KGO A;  4JEA A;  2G3V A;  2ICW G;  1WGW A;  4QDL A;  3EH1 A;  3LUT B;  3Q7L A;  5AC4 A;  2H8A A;  2Y69 C;  3RKO F;  1ZHY A;  3EFO B;  1WAS A;  5BQH A;  1CGM E;  2B0J A;  1CPQ A;  1MND A;  2TMV P;  2MYS A;  1ZW3 A;  2GFH A;  2KK1 A;  2W4M A;  3CEX A;  1T01 A;  4DRH B;  2XLV A;  3S0X A;  4OIP F;  3NYJ A;  2ZXO A;  3UR3 C;  2R9R B;  2L6F A;  1OCR C;  3ASO C;  3MLG A;  5B1B C;  3SYN A;  4PJJ A;  1SZI A;  2FFH A;  3Q7G A;  5E3A A;  5A6B D;  4E0H A;  2IYL D;  3BRJ A;  4EIY A;  2EIK C;  3FVY A;  3Q6M A;  1QPU A;  1GQA A;  3GM1 A;  4BG0 A;  2EPN A;  5JP7 A;  2R7U A;  2B0H A;  4XWJ A;  4JW1 A;  4EBB A;  4O79 A;  1NG1 A;  1Z23 A;  2NPU A;  2IXP A;  2QLA A;  1Z63 A;  1AVO B;  1R5I D;  4MVS A;  3U8V A;  4O6M A;  3W8I A;  4ZLD A;  3S27 A;  4YT2 A;  3O10 A;  4LDR A;  1EKY A;  1Q0K A;  2EPO A;  4CJO A;  1VTM P;  4FX5 A;  1GS9 A;  3C8Z A;  1C03 A;  1RJ9 A;  1LVK A;  1SR2 A;  3H2U A;  3WAQ A;  3JSE O;  5KYU B;  3O6X A;  2Y39 A;  3EG9 B;  3R7C A;  3PDM P;  4G78 A;  1LE4 A;  4LER A;  4BJ5 C;  4PR9 A;  4XEK A;  4G7Z F;  3VM6 A;  4E7Z A;  4K1O A;  1F1M A;  2L81 A;  1NBB A;  1BR4 A;  1VOM A;  2HSQ A;  4KNV A;  3U5S A;  2PP4 A;  2AU5 A;  4J30 B;  5KYW A;  4C7O A;  2QTV A;  2WB7 A;  3M4C A;  3ZC4 A;  4NC3 A;  2ZXP A;  1QQ3 A;  4P9T A;  2CGE A;  4JJF A;  5L3Q A;  3RVY A;  2CYD A;  3ABL C;  1E83 A;  4EUK B;  5A6J A;  2H7O A;  2LK4 A;  2J9B A;  4WJ0 A;  5A6K A;  3T6J A;  2XXA B;  2MWQ A;  3C63 A;  3KKB A;  5BUO A;  3U2M A;  4YN0 B;  3O39 A;  1FR0 A;  3C8G A;  3DAF A;  3AQC A;  2PNO A;  5E33 A;  2IXO A;  2C03 A;  3GAN A;  3MYI A;  1G8X A;  2H7B A;  3FMS A;  3M1C B;  4JRZ A;  2QE9 A;  2R7X A;  2HUJ A;  3DE8 A;  2R7R A;  3C62 A;  3QZC A;  4N4W A;  2LFF A;  3NDB B;  3HTK C;  2PX3 A;  1M56 C;  1YLM A;  3EGD A;  3S28 A;  2RD9 A;  1RJ9 B;  4XEV A;  1VK5 A;  2Q9C A;  3L8J A;  4DVZ A;  3OA1 A;  1NZE A;  1OR2 A;  2CDQ A;  2HV6 A;  2XL4 A;  1WN0 A;  2ASR A;  3ECS A;  4LDQ A;  2P61 A;  2NSG A;  4NTB A;  4YWQ A;  1Q0M A;  1YYX A;  3DD7 A;  2J46 A;  2XL8 A;  3RH3 A; 
#chains in the Genus database with same CATH homology
 1YLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...