1VMAA

Crystal structure of cell division protein ftsy (tm0570) from thermotoga maritima at 1.60 a resolution
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
294
structure length
294
Chain Sequence
MGLFDFLKKGLQKTKETFFGRVVKLLKGKKLDDETREELEELLIQADVGVETTEYILERLEEKDGDALESLKEIILEILNFDTKLNVPPEPPFVIMVVGVNGTGKTTSCGKLAKMFVDEGKSVVLAAADTFRAAAIEQLKIWGERVGATVISHSEGADPAAVAFDAVAHALARNKDVVIIDTAGRLHTKKNLMEELRKVHRVVKKKIPDAPHETLLVIDATTGQNGLVQAKIFKEAVNVTGIILTKLDGTAKGGITLAIARELGIPIKFIGVGEKAEDLRPFDPEAFVEVLLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cell division protein FtsY
publication title Crystal structure of Cell division protein ftsY (TM0570) from Thermotoga maritima at 1.60 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Protein transport
total genus 111
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1vmaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vmaA02
4KHZA 2A9KA 2AWNA 1GFIA 2PCJA 5FBWB 3THYA 5CDFA 3D31A 4NZYA 1N6KA 4HUQB 4EQ6B 1F3OA 5L3QA 2G77B 1E69A 2ZI9A 4UXIA 4JJZA 1F2UA 3TQFA 5TVKA 3FYHA 1J99A 3ND9A 2CE7A 4OKSA 3RLFA 2GVDC 1NG9A 1TMKA 1XBTA 2VO1A 1E1QA 2HUPA 4ZCLA 1DELA 1CP2A 3EARA 3GEHA 4BFVA 3CBQA 2EYUA 3GJ7A 5FOXA 3GFOA 1MO4A 4OK5A 4R71A 4N3NA 5B30A 2XSZD 3ZGXA 3G82C 2ZRCA 4AKHA 2OBMA 4ZDWA 4QJ5A 1NBMD 4F4IA 1DAFA 1ZUIA 3QKUA 5H8WA 2IK8A 2HF9A 5FOWA 1WB9A 2AFHE 5JBQA 2C98A 4LHVA 4PX9A 2WJYA 1BOFA 3L8ZA 4QJ3A 3VNVA 1P60A 5CJPA 3MWKA 5EQTA 3QSYA 1EG7A 4XD7A 4LHZA 1BO6A 4BFUA 4EFLA 4M9XA 2OCBA 4URYR 5EZ5A 2QAGC 2BM0A 2R2AA 3WP0A 3WRXC 2PBRA 2EYQA 2ZSAA 3KXLA 2XEXA 5JCZA 2EFEB 1Q1QA 3I8XA 1AGPA 2O5VA 2QP4A 4KSBA 1TX4B 1VG8A 3OE7A 2IYQA 4RD0A 3KUCA 1IY2A 1DBSA 3B1XA 3PVSA 5AJYA 621PA 5JEEA 1W0JD 4D4MA 3PEVA 2DY1A 1YZLA 4JLVA 2QE7A 4Y0AA 2D06A 2N42A 2W00A 3AVQA 4EQ6A 1G3RA 2L0XA 2ZRGA 4HUQA 4BECA 4D26A 1RRFA 1YZGA 2RGCA 1G1MA 1YR9A 2HJGA 1AS2A 4AURA 3L8YA 2IF0A 5IK2D 1CXZA 1WF3A 4QKQA 2GZAA 4JLDA 4GT1A 4YC7A 1E32A 5B2ZA 4IHQA 1IHUA 2ZSBA 4ON9A 3R7WA 4E03A 3VR5A 1OIWA 3NH6A 1OHHA 4TT3D 4C0AC 1F5NA 2YKGA 1G7RA 4C0LA 1Z6AA 3EW9A 3T35A 3O47A 4C0SA 4C7OB 1SVSA 4MGYR 4GMDA 5FPTA 3CPJB 4JYBA 1OXUA 1I2MA 4M1KA 1ZM3A 5G41A 1E1RD 1K5GA 4EUNA 2XNSA 1KSGA 3T1OA 1L4YA 4BUJA 3A36A 4TLBA 2Z6VA 4LV8B 1KAOA 4NDZA 5FL7D 3ASZA 1L7VC 2W6ID 1ZU4A 3N2EA 4AYXA 3A4MA 3ZDQA 3KUDA 5FUXA 1DS6A 3N2IA 2IXEA 4C2UA 1OH6A 3SDZA 4GOKA 3BH7A 4B76A 2ZUCA 4B2PA 4DDWA 1AS0A 5KNBA 4JLOA 3PJRA 3HDTA 2IXGA 2JAQA 4M1TA 3OIYA 3HP1A 3GLGE 1YZNA 1QHIA 821PA 3GLGB 3TW8B 2C77A 4NH0A 4UKDA 2ZJ5A 3AGPA 4IVPA 3QKSA 3GEEA 3OEEA 4TMXA 3CRQA 1XEWY 4ZV4A 4ABYA 1K6MA 1D2MA 1LNZA 2C9OA 4JSTA 4BASA 1RYFA 4NYMQ 3LBHA 4WAUA 4B2LA 2PT5A 3TH5A 3C7KA 1ELOA 2IWHA 1G5PA 4G5GA 2Z4RA 3CPEA 4RD1A 3TK1A 2FA9A 4OHXA 4RZXA 4TL8A 4TYYA 1KSFX 2YC4C 3IO3A 3NBFA 2G83A 2ZS9A 3WYAA 3ND8A 2G0TA 2NO6A 2QNRA 3ZZ0A 3O8RA 2XX3A 4Z1MD 4KSCA 2CLDX 1LS6A 2DWOA 1DAEA 1OE0A 5CK4A 1ODFA 1LVGA 1FTSA 3VKWA 2G3YA 3C41J 3MWYW 2QMOA 2A5JA 1ZNYA 3EA0A 1OLOA 1X1RA 4M4SA 4Q47A 4BFSA 1M34E 2CMKA 3CRVA 4HI0E 3K53A 4IDQA 2KI5A 1IAQA 2CCKA 3DZ8A 5AUQA 2JLZA 1IXSB 2QBYB 2ZYUX 4IVQA 4D80A 5A5GA 3GLFA 4JSYA 5L3SB 1UKVY 4L5BA 4NKRA 2LKDA 1KO5A 4DB4A 4EDHA 4F7WA 2WJIA 3K0FB 4A0HA 4HAYA 4CEJA 4DLWA 4M1MA 2EFGA 5BQ5A 3VKHA 3KKPA 1E2KA 3ZQ6A 4Q7JB 1SQ5A 4P4UA 3CW2A 1VECA 2D62A 4A0GA 4L9WA 3B85A 4D25A 1EX6A 1E96A 1GL6A 2WV9A 1G3MA 4R7ZA 1DEKA 4DLTA 4Q4JA 4XTRA 5TMPA 2D4HA 1OH7A 2HLDA 1RPZA 2O8DB 5FL3A 2GK6A 4LJYA 2WVJA 1NLFA 1FX0B 4LY6A 2OUKA 3ZJYA 4MYCA 2QU8A 2CL0X 3WYFA 2H57A 4JKYA 2W0SA 1Z8FA 4NL4H 1VYUA 5P21A 5EE0A 3U7GA 2ORIA 3PV0A 2ZRDA 4LJ7A 4G1UC 4B3FX 2GAAA 1T8TA 3FFBA 1XD2B 1F2TB 4LUCA 4RFSB 4JL6A 1NP6A 1ZMXA 3PEWA 3Q85A 1G8GA 3I5YA 1X8JA 2CVHA 2HV8A 4KFSA 1NMXA 2BMJA 2W2TA 1Z22A 3JZMA 1SVWA 3L82B 4RD2A 4OBEA 3IQWA 1GNPA 3JZAA 4BLTA 5JWRA 4UNNA 1V43A 1SXJE 1W0KD 5KO2A 4KVGA 4WXPA 4OK6A 3ZZTA 1YU9A 4GSYA 4KLZA 3UK6A 3VNUA 3VU9A 1F48A 2IBMA 2ZE5A 2ZPTX 2F7SA 3FMFA 1S1MA 2QQEA 3MCAA 4PAQA 4UQOA 3ZQJA 2A5GA 3SN6A 1HY3A 1Z0IA 2C96A 4V02A 2F9MA 3FPAA 4WOPA 4ZDIA 5BW8A 1G6OA 1AM4D 3K0FA 3AF4A 4R98A 1NY6A 5KU1A 1ZINA 3EG5A 1WDTA 1G5TA 4Q7KA 5G3YA 4A8JB 2OLJA 5B57C 5IRCD 1R10A 3THXA 1WQ1R 4AD8A 2ODEA 1P5ZB 4TYNA 2VP0A 1AKEA 2RGBA 5DYGA 4O0MA 1FW6A 4TMWA 2CCGA 5J4YA 3WNDA 1KKMA 2FPLA 3WMGA 3KB1A 4ZI2A 5FUVA 5B64A 4IOMA 2O8DA 2Q9BA 3GLHB 4QBFA 1R0YA 3TNFA 4QHSA 3Q5EA 4PHTA 3WYGA 3UMFA 2Q6TA 4D81A 1COWA 5KDLA 1QG2A 1ZC4A 3K0AA 2VSXA 3NG1A 3V00A 3LDAA 3PUVA 1RIFA 5AJVB 4QM7A 2IYXA 2XJ9A 1W4AA 1F2TA 2W0MA 4OHZA 5FUWA 5J4KA 2UVQA 1E0SA 5SZIA 1OXVA 5JMTA 1DE0A 2IXFA 3WRYC 4DCSA 3DDCA 1OT3A 4TLEA 4TQUS 3MD0A 3H0KA 1XJ0A 4P4TA 1EWRA 5KDDA 1MRNA 1KJZA 5CB6A 3TGPA 3CONA 3C16C 1RZ3A 2E87A 1SXJA 3GFTA 4Q1DA 2OO7A 3CWQA 1E2LA 2GZHA 2ODWA 2OBNA 1J90A 1XTSA 4KBGA 3BB1A 3B7GA 4N0DA 4WIAA 1Z08A 1XCMA 5FPSA 1GUAA 3U3KA 2WSMA 3VQTA 2X19A 2EWVA 3RRZA 1OW3B 4Q21A 1GSIA 2FV8A 4H1VA 1SVMA 2VL7A 3NC0C 1G3UA 1Z47A 4A8JA 2XAUA 2O8BB 6Q21A 4QNRA 5EP4A 2AHOA 2ZRJA 4F93B 4EAQA 4AG5A 3IEUA 4XWKA 4S2EA 2GESA 4ZDKA 2O0HA 5HKKA 1FOEB 4C0JA 3B1ZA 421PA 1XTRA 2BBTA 4XH9B 4DXAA 3BH0A 4OL0A 3ONWA 2WJJA 4N0EA 5JLJA 2JCSA 2XZPA 3B9PA 4IFEA 4NU0A 4C4PA 1UBCA 5D3MA 2J0SA 1UM8A 2P5TB 4P32A 4FXPA 4XVQA 2X77A 3OIWA 1Z6YA 1XJQA 2QSZA 4II7A 2NPIA 1QBKC 4KYIB 1VTKA 2D7CA 4LHXA 1SVKA 2ZJAA 1AA9A 4CDGA 1OXSC 2ZJYA 5KPDA 5AK0A 1Q21A 4MKIA 3VKGA 3J81k 3QF4B 2ZR0A 3TE6A 2WIBA 2CLCX 3HPRA 2E9SA 5JEDA 4HB0A 1N6RA 4DSOA 2Q21A 5HE9A 2BEKA 2R6FA 4M9SA 4YLGA 3LV8A 3RHFA 3TW4A 2F1IA 4M8NE 2ZRHA 2IX3A 3CX6A 4PHFA 4OHYA 3ZIAA 3GLIE 3VR4A 1B23P 2LCFA 3K70D 2QP3A 3PXGA 3VMFA 3UKDA 1ZU5A 1XEWX 2ZU6A 1XX6A 1QZXA 5H68A 221PA 5SZKB 2DFNA 4Q01A 4EJSC 1T0HB 2NO0A 4W5WA 3WBJA 5EP3A 4U02A 2O8CA 4MKHA 1OFHA 3BERA 1RRCA 3QY0A 1US8B 1AIPA 4K8OA 1KOFA 2QY9A 4HLQB 3VHXA 2KWIA 4Y0VA 2TMKA 4F4CA 4Q9HA 3LVRE 1VCNA 1E9DA 1GILA 2GK7A 1P6XA 2HF8A 2FFQA 4Q4AA 3TSOA 4YMVA 4QG7A 1WMSA 3SJZA 4NCNA 2VQSA 2OM2A 2ZE8A 4W5JA 5LB2A 3VTKA 3ETLA 4ASUA 3AM1A 5H70A 4B32A 4MGIR 1AK2A 4B48A 1IOZA 2VP4A 4FIDA 3HWSA 2VP9A 3N5CA 3CX7A 3W5IA 3C14C 3T15A 3CNOA 1OHHD 2O52A 3QF4A 4TZ0A 3L0OA 4NE2A 4A1FA 5HZHA 4JBXA 2NO1A 1ZD9A 4QXAA 1M7HA 1JQLB 4TTPA 1EXMA 1J7KA 2V7QD 5CYOA 2OCAA 2R6AA 2J59A 2H92A 2WKRA 2WWIA 3WP1B 3QKTA 4Q5IA 1UEJA 2V3CC 4Q1BA 2ZJZA 2V9PA 3EC1A 1N6OA 1S1CA 4AIIA 1N0UA 1R5BA 4ARZB 3FB4A 1VPLA 2WPDA 3P27A 3GLIA 1RVDA 1NG1A 4X8LA 4DWJA 2FGJA 4LJ8A 3NVAA 4DUGA 1NL3A 1FQKA 5DN6A 2ZI6A 4DLVA 4DT1B 4I1VA 4YMSA 3W34A 1MRSA 4E22A 2VSOA 2IYYA 1US8A 3QPWA 1KNQA 2H7VA 2WWWA 1H8ED 1HA3A 3SEAA 3AVUA 2FG5A 3BH6A 1S3GA 1O87A 1B0UA 4DLRA 3SC3A 4A2PA 3Q72A 5KTYA 2R6DA 3PG5A 1E99A 4GDFA 2HT1A 3OEED 4ZPXA 3PFIA 5G53C 2FF7A 1ESMA 2RHDA 2ZJ8A 2ZM5A 5F9FA 3DOFA 4M53A 4LI0A 5K8IA 2ZS8A 1VHTA 1FTNA 1SVOA 3IHLA 2BVNA 3B5JA 1CIPA 3SZRA 1PUJA 3V4FA 1YZKA 2IYTA 2CHVA 1NSTA 1KY2A 1W44A 4D4LA 2ZITA 1XXHB 2V6IA 4PPNA 4TLAA 4U7DA 5F3WB 1E4YA 3CNNA 3SBEA 2Q3FA 1ZM2A 4GI7A 4WXRA 1HUQA 1KO8A 4EJSB 1KJYA 2ZROA 3GJXC 4EFMA 2YOGA 3PEYA 1J2JA 4BLPA 3I8SA 2PLRA 2OG2A 5UKDA 1GITA 4KLNA 4JLKA 5DISB 5FBQB 4PHGA 5AWFC 4NYMR 1IONA 1VIYA 4GBMA 1KK0A 1AZSC 3X1DA 2CJWA 3AEZA 4W7SA 2ZI7A 5DGXA 2BV3A 4K81B 4QBGB 2QZ4A 2WHXA 2ZYWX 1JJVA 3E2IA 4LDJA 1N6LA 3AUXA 3E1SA 3U4QB 4KODA 2VP2A 4PANA 2Q9AA 2QN6A 4UNPA 5FPKA 2ZS7A 3OF5A 1M8PA 4BLOA 4Q02A 1PUIA 1G7TA 1U9IA 2GKSA 2PH1A 1PLLA 3T61A 2I4IA 3QKRB 1N6HA 2ZUBA 1XTIA 4GP7A 1XZPA 1CJMA 1R0XA 2A78A 2GCOA 4XVUA 3CNLA 4BLRA 2ZU0C 3R9IA 4LK2A 3HPQA 4H9GA 2BWJA 2P0EA 1ZCBA 2IUTA 2J0UB 2G1JA 2AK3A 1XPRA 1NN1A 1FP6A 1AN0A 1E9EA 1I4DD 2VYFA 4XSGA 4GMXA 1CKEA 3C5HA 3C8UA 3ASYA 3NHAA 4TN1A 3CF2A 5J40A 1A4RA 1YQTA 5HCNA 3KQUA 1J70A 3W3AA 4E07A 5KSOA 3CB4A 1JI0A 2XB4A 1OH8A 1R4AA 2P3SA 4B3GA 4Q7MB 5KSPA 1Z0KA 2ECKA 1ZAKA 4DHEA 3HU1A 5LBIA 1SULA 4KCGA 3THYB 3AVYA 1OSNA 2F9LA 4G3XA 5C4GB 3CKLA 4A9AA 5BXQC 5JFGA 5SZHB 1P75A 5L3QB 4Q4LA 1C4OA 5JI2E 3MGCA 2CHQA 2IHYA 3CX8A 3GCGA 2YNMA 3PITA 4AYTA 3EPLA 2O8FA 4M1WA 1Q12A 3TQCA 5AUPB 5CB8A 1YJ5A 4URZR 3KFXA 3ZZUA 1MO3A 5G40A 4MYTA 4X8HA 3KX2A 4IDHA 3EAQA 4US2R 4Q66C 2NO9A 1UEIA 2Q3HA 2PCLA 3KXIA 4LYHA 1N25A 1T3SA 5DO9A 2VH5R 2XTNA 1IM2A 2BBOA 1DAKA 3DM9B 1ETUA 3IILA 3RS0A 3PIRA 2N46A 2REBA 3A37A 3LVQE 2V8OA 1U94A 1E98A 2P6UA 5CM8B 2OAP1 2HCJB 3EIHA 2W6JD 2JJ2D 1IN5A 3D8BA 3UG6A 2H8KA 4GZLA 3SJBA 2H5EA 4QGHA 3OFNA 2IS4A 1COWD 1GKUB 1IY1A 3ECCA 2J0UA 5HCIA 1DAMA 2AXNA 5CITA 1KSJA 2VLIA 1JEDA 2ZETA 1J8MF 2KJQA 3IO5A 1FP7A 1TEXA 4PZYA 4X8MA 3O8DA 2GEUA 1X8KA 3LY5A 1IN6A 1DADA 1GOTA 5J47A 3TR5A 4LBZA 1Z83A 1JJ7A 2YINC 4GPTA 1G4AE 4TMTA 2A2ZA 3TMKA 5JZVA 1P9RA 1RJ9A 4LPSA 1FPMA 3FHTA 2QP9X 3CM0A 4XWAA 5TY0A 4EFNA 3AF3A 5AUNB 4KV9A 1U8ZA 2JLXA 4TLDA 2NG1A 1T5IA 2OZEA 2I3BA 4FCTA 1UBFA 3R7WB 3EZ2A 3T06B 4DDVA 5A0FA 1M74A 4Q00A 4BGDA 5F9HA 2QTHA 1GKIA 3QG1A 4GRAA 4ESVA 4QGFA 1KYIA 4MYHA 3PCRB 1Z28A 3NHBA 3QE0A 4PSVA 3EASA 2BEJA 3F0TA 4IDNA 2PMKA 4HZUA 1Q22A 2DFTA 3FKSD 4MITA 3HU2A 5CLLA 1HURA 4FW9A 4BFZA 3AF0A 1P9NA 2LWIA 2V6JA 4LPKA 1XPOA 5FOUA 5JI3E 2PJRA 2VHQA 1R2QA 4B43A 4KFRA 1EFRA 4QBIA 5EUQB 1SGWA 1XZQA 1G8PA 1XEFA 3DPUA 1UAAA 1II9A 2AKAB 1CR0A 1PLKA 4D0LB 4RZ3A 3AV0B 1DAGA 3SYLA 2EQBA 1TQ6A 1TEVA 3EZ9A 1XPUA 3TSZA 1NVUQ 3VFDA 3LLMA 1Z0AA 1MV5A 1AGRA 3OEHA 4MRRA 1Z07A 1ZC3A 5KPJA 4PC3A 4BPBA 3SR0A 1M7GA 4NYIQ 2WZQA 3KDSE 2DHRA 2CK3A 4PZLA 4TYQA 1KK2A 3U6KA 3QKSB 3PEUA 4YMUA 3RDPA 3I61A 2CL6X 4XTCS 4XOIA 2PT7A 3IHWA 2IYUA 3AP3A 3NBYC 4G5QA 1E4VA 2ZJOA 4IDPA 5FOTA 2CE2X 3TKLA 3X1WA 1OH5A 2C8VA 2CDNA 4LCBA 5AJZA 2GJSA 4QM6A 2Q3MA 3RVBA 2VP6A 2ZRPA 3NC1C 4M9ZA 4LYJA 4B2IA 3A1WA 3QI2A 5A4JA 1Z6TA 1Q3TA 2ATXA 2PL3A 1ZP6A 3NDPA 1G9XA 3D7MA 1CRQA 2QTFA 3GEIA 5DLQC 3WHLA 1AQUA 4BFWA 1G4UR 4ZIRA 4KI0A 4QHYA 3LBIA 2ATVA 1IQPA 4IOKA 4MYUA 4A4DA 2R6CA 1Z2AA 3BE4A 4PHHA 3IIMA 2ORVA 2QUZA 3Q7QA 1UKZA 3EWSA 4V0ME 2AWOA 2YWGA 3GLFE 4AI6A 1NVWQ 3DHWC 3RAPR 2XZLA 4HAUA 3GLFB 2E1RA 2QROA 1PZNA 1T6NA 3FMIA 2JATA 2Z83A 5TB5A 4AKGA 2X8AA 4Q18A 2DB3A 1ZJ6A 1T91A 3P1JA 1WE2A 3Q8XB 4CEJB 2X1VA 4DCVA 4ASUD 1SXJC 4JLNA 5CIWA 4NCHA 2UKDA 4RZUA 2BJWA 2PZGA 2HXSA 1XMSA 1WRBA 4MQBA 1H65A 4L4UA 3DEFA 2HEIA 3I1FA 1N5JA 4B3BA 4Q4JB 1H8HA 2JJ8A 2VIIA 1SVLA 1YKSA 1LFDB 3MLEA 3Q7PA 1XEXB 4UNSA 2J0VA 1LF5A 4URUR 3TUJC 3ICQB 2R44A 2IC5A 2FDCA 3UIEA 4EPWA 2QL6A 4A8JC 2XNDA 3KXKA 1CS4C 3UWKA 4C30A 1HTWA 3T5DA 3KJEA 4GL2A 2BBSA 3RSLA 3U3OA 3RYTC 4C0HA 1NNEA 5KUTA 1IJFA 1NRJB 4F4JA 1D2EA 4Q48A 3WBKA 3U60B 4LV5B 2IT1A 2WPDD 4FMCF 4EPRA 1W36C 2VPPA 1G20E 1KDOA 3P4XA 3RRYA 2FEMA 5EZ6B 4DUGD 1YZTA 3IUYA 3SHFA 1G6HA 1KI4A 1E79A 1AS3A 3A8TA 2AK2A 2OEPA 1HT1E 1G8YA 2ZJ2A 1R0WA 3MRSA 2C03A 4TLCA 3RS3A 2NO7A 2GJ8A 1E6CA 2GHIA 2WMNB 3RS4A 5CJ2A 3UWOA 4ACAA 3QEJA 2GTPA 5JWHA 1E2PA 1W2HA 2D2FA 4Q03A 2XGJA 3VU9B 1ZM7A 4V0MA 1BIFA 3HJNA 4U5XA 2QG6A 1W47A 3IQXA 4KU4A 1N5LA 4RKFA 4CGZA 3K1JA 5EXXA 4YONB 4W5HA 1GAJA 1OF1A 3LAWA 4M0LA 2J3EA 4PC7A 3L0PA 4JKIA 4OI1A 1XJCA 3QXCA 4CZ2A 4XWOA 2WOJA 2XB2A 4A0FA 3BAFA 3THXB 1YZUA 3CH5A 1P3JA 3FHOA 4OK3A 1Q1ZA 1X1SA 3GQBA 2IHBA 1OKKA 4MUBA 2J7PD 4QRHA 3I4LA 1XEXA 4R2IA 3KB2A 1E2QA 2CEAA 1RFLA 4IEIA 1MH1A 4DLSA 2ZI3A 1RW4A 3SHWA 4LGMA 3K0AB 2B7BA 1TF7A 3BK7A 3BOSA 1G64A 2MMCA 3GPLA 1VHLA 2OSBA 1ZD8A 2F55A 4P0TA 3PUZA 3WMEA 2XITA 1ZNWA 5JS7A 1IXRC 2RB4A 3ZVNA 2AX4A 5HZKA 3W8NA 2J46A 4DSNA 1DO0A 5FUYA 3IIKA 3TIFA 3IKJA 5JHGB 2G88A 4HLUA 3BB4A 3QVVA 4FINA 2P2LA 4YXWA 3UANA 3FKQA 4CVNA 4G5RA 5FBVB 4Z54A 1RRGA 2C78A 1SXJB 4TYWA 4MKGA 1FUUA 5TXGA 4HB3A 2WKQA 3BFKA 2HDNB 1NKTA 3NDBB 1TU4A 1CR1A 1RKBA 4G5SA 3G0HA 3GJ8A 3W5JA 1Y63A 3IIJA 3MJRA 1G3IA 3QEOA 5FTNA 4KFTA 1I2DA 1V5WA 2JLYA 2G1KA 1P7CA 3LFUA 5DHFA 4IFBA 1RYHA 4WBSA 2KB0A 2AN9A 4PC6A 1W49A 3G5UA 2AR7A 1E2HA 2MSCB 1G7CA 4A6XA 3ICEA 3MSXA 4I4LA 4X8OA 2OBLA 1S0UA 2GXSA 1JNYA 4B73A 2ZAOA 1W36B 1NBME 5FPYA 4RVCA 2MSDB 2QEQA 4TQAA 521PA 3LA6A 4I81A 5D3MB 4TZ6A 4YDHB 4PXAA 3P20A 1E0AA 5TDHA 2IW3A 1GL9B 1ZM9A 1OJLA 1G8HA 1UADA 3W6OA 4PC2A 3A4LA 4V03A 4M1OA 4JLJA 4WA7A 3U44B 2B8WA 4A2QA 1T4GA 5KSYA 3KQKA 3W6NA 3EX7C 3BIFA 1LS1A 2R65A 3U7FB 1NMYA 5G3ZA 4R2HA 1K5DA 5KDOA 2IYLD 1MO6A 1E2EA 2JJ1A 3GJ3A 3LO5A 4S35A 4EPXA 3C15C 3ZS9A 2GILA 5JHHB 3AVPA 4P4SB 3RSOA 4AKEA 4D4KA 3I62A 4L15A 1YRAA 4Z8YA 2VHTA 3WNBA 4UNRA 3I72A 2CNWA 2F43A 3DO6A 3U3MA 1A2BA 1QRAA 2FPKA 1E9BA 3AKEA 4EPTA 4OQMA 4MKFA 1KI8A 5BN5A 5FTLA 1UJ2A 3AKCA 5K8LA 5DI3B 2OFWA 4TTRA 5EE5B 1NIJA 3M4YA 3OZXA 2O8CB 5L3VA 4AC9A 2QPOA 2VRWA 5KOYA 4LOAA 4KJZA 3L2OB 4DEYA 4JMPA 1FMLA 2ODBA 2HT6A 2RGXA 3BS4A 5F2EA 1E9AA 3EZ6A 1R5NA 3KFVA 3MUFA 1TTTA 2XSZA 2AD5A 4I1OA 1NBMA 2ZSDA 4FCVA 4Q4AB 4HSEA 2HYDA 3ZVRA 1MABA 2R6GA 3A4NA 3AF1A 4QC2A 1QF9A 3BD9A 3K0CA 2C95A 2WMOB 3ADBA 3OAAA 1U9IC 1VCIA 3SYKA 1E1QD 1GRRA 4JLMA 1T9HA 4DDTA 3U44A 5E4FA 3B82A 3ZH9B 1NN3A 1XDBA 2A7QA 3OIVA 4NP6A 1G16A 3RC3A 1RC8A 2FN4A 5JCPA 2ZI5A 2WKPA 3C5CA 4QGGA 1QHYA 3SFVA 1EWQA 1ZIOA 4Q4HA 3K8YA 4BFXA 4LSGA 3PUYA 1R8SA 4A2WA 5CYPA 2H17A 5IF9A 4P4SA 2IS2A 3BXZA 1S3SA 3SE0A 5KNDA 1KMHB 1M1YE 4QBHA 4B35A 2FZLA 4XD7D 2PEZA 3VHLB 1ZVQA 3GLIB 4CF7A 2D7DA 2YVUA 5TV2A 1EFHA 3QXJA 5DI3A 4NBSA 1E94E 1EESA 4PTLA 3DVLA 1XTJA 1WXQA 3P26A 1E0JA 3R9XA 5K8TA 2VHCA 1SHKA 5GJCA 3OE7D 3U3JA 3OEHD 2FWRA 3IEVA 3LQRA 3F3YA 4NCKA 2ZTSA 1XWIA 2KE5A 5BN4A 4WZBE 2DR3A 2QE7D 1P2UA 3HR8A 4LZZA 3FOZA 4TT3A 5DHAA 1AQYA 2WSSA 1II0A 1P4SA 4JL8A 2DFKB 4TL9A 3LW8A 1DPFA 1NN0A 2C9YA 1E1RA 4GP6A 1E9RA 3UG7A 1R8QA 3CIOA 2YJTD 3FHCB 3S1AA 1U0LA 2O0KA 5FR1A 5FL7A 1Z63A 2YYZA 3RRMA 3K9NA 1TUEA 2W6IA 4LJ6A 2QM8A 2D3WA 3TJZA 1DOAA 2P5SA 4HAZA 4NYIR 2FFAA 4L8GA 3MAAC 4DLZA 3EC2A 3THWA 1KO1A 1XB2A 4ZCIA 1A82A 1ZCAA 2WJVA 1GVNB 2H1LA 3AVOA 4B3CA 4DCUA 3QG5A 1KMHA 3X1ZA 3TUZC 2KSQA 3B60A 2CXXA 3LX8A 4B44A 4LJAA 1R0ZA 3EZFA 3CF0A 2CJWB 2VF8A 3TBKA 4JVMA 4QOSA 4RD6A 2IWRA 2P6RA 1KZ7B 4PAMA 2YWHA 3AQ4A 4JT2A 2RAPA 2WICA 5K8UA 2ZJBA 3I32A 4US1R 3N70A 2QQ0A 1NN5A 1UDWA 3AH8A 3KJGA 2PLFA 1CF4A 1P2SA 2WWGA 1UKEA 2V1XA 5EJEA 4JT4A 2ZE6A 2NZJA 1H8HD 3A1VA 1M7BA 2VP5A 5FBRB 2DWPA 1CJKC 4G5OA 4XSHA 2GCOB 4PQFA 3SQXA 2GJ9A 4Z1MA 1S9HA 2HJVA 1TAGA 1Z6XA 3K09A 5LD2C 1KNXA 3U6BA 2QMUA 1ZRHA 4I99A 2XNDD 2GRJA 2HXYA 1FFHA 4ESHA 1E9FA 2RGDA 4JLPA 2FSHA 4YDSA 1GG2A 2GEVA 1G8FA 1MO5A 1N6NA 4DBLC 4E09A 2FH5B 5KYKA 5LPNA 4PSAA 3B8HA 5IHPA 4M1YA 2ZRMA 4LYAA 1YE8A 4IW3B 1LTQA 1GIAA 2RGNA 3T1QA 4DLYA 3PR1A 3VX4A 1E79D 2Z5FA 2BDTA 1P61B 4DIEA 3AGQA 2GCPA 1X6VA 4FMCB 4R9UC 1S9DA 1HE8B 1Z3IX 4BQSA 3FMPB 4IKEA 4J0QA 2O8FB 4QGAA 4BRWA 2FGKA 3QJYA 4A0RA 3LQQA 3TVTA 4FWIB 2FMXA 2EFCB 3ZD7A 2FPMA 2WWFA 3AP2A 2HYIC 4JVLA 4JZKA 4JLAA 1FUKA 2ZANA 3FWYA 1CU1A 3K9GA 3SYNA 5FOSA 1QHHA 2BBWA 1BH2A 3W9YA 1SKYE 3RWMB 1A5TA 2ZREA 3Q9LA 3V4RA 1W7AA 4AK9A 1VG0B 1NVVQ 2HLDD 5H1YA 1N2CE 1UDXA 4F91B 3I92A 2B8TA 4M2LA 5IDVA 3NEJA 1G291 4QL3A 2G9NA 5DNYB 1JPJA 1X8LA 2QMEA 4DJTA 5JJLA 2EVWX 1IXZA 3BB3A 4D4JA 1LW7A 3DL0A 1Z2CA 4MGZR 1E2FA 3LNCA 4Q7LA 4Z51A 2JGNA 1W0KA 3BRWD 3F5FA 2O8EA 1XMJA 3SJAA 4AY2A 2FEOA 1R7RA 1I4TD 4CEIB 1OFTA 1XMVA 2DBYA 1XFAA 1KMQA 1D8TA 1XD8A 2A30A 2W83A 4D82A 4P31A 1QHNA 4TYPA 1BKDR 3KKQA 3CLVA 3WNCA 1RJ9B 1DARA 4DC9A 3W8RA 2BMFA 4YXWD 5FBLB 4IXNA 1QVAA 3LBNA 4XVRA 5L8VA 1HT2E 3K9LA 4UXJA 5D3QA 3DKPA 1IY0A 4A92A 2WWYA 4LC1A 3CPHA 3FTQA 3AUYA 2FSFA 4TSFA 5JRZA 1A7JA 2GCNA 2ZYTX 5GJBA 5KSZA 2PJZA 1VG9B 5CM9C 3DMDA 1DAHA 2VHJA 4A82A 1NLZA 3H84A 1TPZA 2DWQA 1GRNA 3ZLJA 1EFUA 4PQYA 1S96A 4Q9KA 4LBVA 1DTSA 1K8RA 5AUOB 3VAAA 2KBEA 2IEYA 5LD2B 1ONBA 1A1VA 1JALA 1FMJA 4HZUB 4RSGA 1GWNA 4ILEA 3FVQA 4E5UA 3QXHA 1NJGA 4V0OA 1PV4A 3BJIC 4OJQA 2AD1A 2V4ZA 3QPUA 4M22A 4F92B 2HCBA 3E70C 2BCJQ 2GJAA 1YR8A 5GVSA 1KDPA 5AR1A 4FMDF 2O0JA 2ZRLA 1SVIA 1W4CA 2XTMA 2FZ4A 5FPHA 2CL7X 2GBLA 2FU5C 4RCYA 4L9SA 3UPUA 1AZTA 2PX0A 3KQHA 2YZ2A 1IN7A 4CEIA 1TF2A 2P67A 1XNJA 5BYKA 1TU3A 3QENA 2NZ8A 4B71A 5E7IA 2BKEA 4HZIA 2IYSA 4U00A 4B33A 1W4RA 2JLRA 1BYIA 1X86B 3X2SA 4D6PA 4K46A 1PJRA 3R20A 1KI2A 2JJ1D 3CZPA 5EXSA 1IN8A 3RWOA 2LKCA 2ERXA 4YMTA 1SXJD 2BKUA 4ZKEA 1KY3A 2GF9A 2H16A 2OT3B 1ZW6A 3CUEF 4DKXA 3M1IA 2PMDA 4GNKA 4MRSA 5EE1A 3DM5A 1GRQA 4XJXA 4WW0A 1XTQA 4TMKA 2PZFA 1MR3F 5FTJA 5CLQA 5DIFA 4RD3A 5J4VA 2C2HA 4ZIRB 3MG9A 1CRPA 1LY1A 3FMOB 5EP1A 3NBXX 2XJ4A 1F6BA 4URXR 3UATA 3FE2A 3AB3A 5HKKD 4PC1A 2W2XA 1XF9A 2PX3A 2OCYC 2RGEA 3TAUA 4CEHB 4O3MA 1PVOA 1DAIA 2QRNA 2QGZA 2X2EA 1W36D 3T34A 3P32A 1ZD1A 3FDIA 2X2FA 5JRJA 4DVGA 2W2VA 2F6RA 4HLUC 1NJFA 1QHGA 2F1JA 5EXPA 1E2DA 1XMIA 5C4MA 4A6PA 4LX0A 1TNDA 2FX3A 1UKYA 3OAAD 3QQ5A 4HAVA 2SHKA 2OAQ1 1KI1A 4CYMA 5EUMA 2G0NA 1E2GA 2J41A 4KO8A 1P2TA 2YWEA 4HYYA 4IRUB 1ZUNB 2ZRIA 1EGAA 2DCUA 5CIQA 1JR3E 3H4MA 3ADDA 2KBFA 1WGWA 2EFHB 1M2OB 4OI0A 1LF0A 5HE8A 1ZUHA 3SFZA 2ZEJA 1BMFA 1U98A 4FD2A 3T1VA 4AWXA 4BFTA 4PO1A 1Z0FA 1U8AA 1LV7A 5FFMA 1VIAA 2BM1A 2GEDA 1VG1A 3A58B 3KJIA 5E7JA 2ZE7A 4I1SA 1EFCA 3ZIAD 1KO7A 4MDEA 2QORA 2VSFA 1Q20A 1XTKA 3D6TB 3WMFA 4BZQA 2WWHA 3AVTA 2FSGA 4O2RA 2ZI4A 4HAXA 4FI3C 2EWWA 2F1RA 1P72A 2EU8A 3R9WA 1JPNA 1XU4A 4LV6A 1FL9A 3NH9A 4ZCMA 2ZQ5A 2I1QA 1WP9A 1W5TA 4B75A 2AKYA 4CEHA 2RKOA 2WM9B 3SOPA 1PLJA 2ZRAA 1QDEA 1G5RA 1KDTA 2OXRA 3I73A 4HDOB 5JWOA 2WSSD 2F3RA 2OXCA 1JR6A 3LWNA 1DG1G 3U2QA 3SQWA 2YWFA 4PO8A 3KQNA 5HTKA 3KKOA 2OILA 2EW1A 1ESNA 2V7QA 4PR0A 4N1AA 4KFUA 121PA 3I5XA 3H2YA 2ASEA 4DIDA 2WIAA 1XCPA 1N5IA 3AVVA 4B47A 2Z0MA 3GJ0A 5DYIA 1W4BA 2A5FA 2F3TA 2JIZA 3U61B 4HB2A 4Q9LA 4TL7A 2QRZA 2QM7A 5BN3A 3EPKA 1JR3A 4MA4A 1Z0JA 4US0R 1HV8A 4LJ5A 3L0SA 1ANKA 1KGDA 1WCV1 4MRNA 3B1WA 4LBWA 3TLXA 1N6IA 4NYJQ 4OQXA 4JJKA 5BYJA 4JBYA 1H8EA 2XOKA 1KK1A 4RCZA 4W9MC 4GZMA 1OPXA 5JSZB 3AKYA 4C2TA 3SNHA 5L3RA 1DVRA 3VR1A 1L2TA 1U99A 2Q0HA 1RRPA 5DN6D 4IOLA 4V0KA 2C04A 1EK0A 4AYWA 3K0CC 3VR6A 1UBEA 4AG6A 1D9XA 1JAIA 2GZDA 4RKEA 4B3DA 3IBYA 1GL7A 4GOXA 3M6AA 4JVSB 4V0LA 2CBZA 5C2JB 3A6PC 2XXAB 1NLYA 1ZNXA 3C4JA 3IPYA 1YZQA 2QI9C 3X1YA 4C7OA 2OV2A 5J4HA 5KNCA 5JJIA 1Q1EA 3SS8A 3B9QA 4RZ2A 2OFXA 1DG3A 2BCGY 1OB5A 2QAGB 2ODNA 1MKYA 3GD7A 1CJUC 2J5XA 1E2MA 1E2IA 1SKQA 1EFTA 1F60A 1Z6GA 2GWHA 3EA5A 3HR7A 3ZVMA 4PAOA 3NBZC 4NMMA 2GVZC 3R8FA 3L0IB 4NPHA 1T5LA 2Y8EA 1JXOA 3THOA 5C18A 3QXSA 1CBUA 2DFLA 4Z8XA 4C0QC 1W46A 4JBWA 3EXAA 3KTAB 3MWLA 3FGNA 5EXTA 2WTUA 2AL7A 4CT4B 4FWTA 3U5ZB 4IOJA 2W58A 5SZJA 5DSZA 1N3BA 3A1UA 4KBFA 1JXMA 4FMBB 4CIDA 2IS1A 1CR4A 3QBTA 4G01B 4TMVA 5FI1B 3TVDA 1FNMA 3GLGA 3OESA 5JSZA 1W48A 1OFUX 3TR0A 5C1BA 4TTQA 3K0SA 2BHRA 3CR7A 2JLQA 2QSYA 1FNNA 2QGNA 3CRRA 1JB1A 4DSTA 1N6PA 5IT5A 3EIQA 2PEYA 3M0EA 2JDIA 2CHGA 4PZZA 4DZZA 1SHZA 5F98A 2QMHA 3PENA 1U90A 3CZQA 4ZKDA 1UFQA 3AVWA 4JL5A 2ZRBA 1E3MA 3ADCA 3OHMA 5EE9A 4OQFA 2B92A 5FTKA 3H86A 5E95A 1M6NA 2XXAA 3GP8A 3ZYCA 1R5OA 1A2KC 3PUWA 2F43B 1AJEA 1W1WA 5FR2A 2UZ3A 2Z43A 2AFIE 1XD9A 5B58C 2QAGA 3CR8A 4ITRC 4PQRA 1NKSA 1G18A 1Q0UA 1R6BX 2GXAA 3QIAA 1JECA 1KIMA 1NMZA 4F38A 4C0KA 1E9SA 1U81A 2ONKA 3O8CA 3GMTA 3I3SR 4HDQB 3LW7A 2QA5A 2QBYA 1KI7A 3NXSA 1ZBDA 3UMSA 2NOAA 1GNQA 2WBLC 5AJXA 5L3SA 3T1TA 1VDZA 2NTYC 3BBPA 3KTAA 1CULC 1E2JA 3HYRA 4L16A 3W6PA 1NVVR 3OIUA 4TQ9A 3LXRA 1D9ZA 1P62B 1CLUA 1MABB 3KJHA 3Q5DA 4BRUA 4UNQA 4DEXA 4ZI3A 3VR3A 1BS1A 1OIVA 2NGRA 4NTZA 4LWZA 2IUUA 4OYHA 4TSFD 3TRFA 5E3HA 5EP2A 3WY9A 3CO5A 3GLHE 1N0WA 2IYRA 4B74A 4MGKR 4BLSA 1QHXA 2W6JA 2JJ2A 2ZSEA 1TQ4A 5FI0B 1G19A 2C99A 4M1SA 1FX0A 4TL6A 3K09C 4ACBA 4LJ9A 3MFYA 4I1UA 2DPXA 4HEJA 4Q4HB 2RGAA 3IGFA 3NWJA 1XD2A 3NIBA 1KI9A 1G17A 3KKNA 3SJCA 2GXQA 3LD9A 4DCNA 5JS8A 1HH4A 4RFSA 4DSUA 4B34A 2YOHA 4FN5A 4WZ6A 5GJVC 2JLVA 1U0HC 4DCTA 2V1UA 1G21E 3QOFA 2RGNC 4JLBA 4URWR 1YVDA 3OFND 1HQCA 5JECA 3AP1A 4NCJA 4B6EA 1W2GA 1HYQA 4EIWA 1JAHA 2J87A 3CH4B 4LJ4A 1U2RA 2JASA 3LH5A 1U8YA 2IEZA 4FMDB 4PO9A 2VEDA 5GADl 2V55B 3NKVA 3WHKA 1N0VC 4EKDA 3P4YA 1N5KA 2NPFA 2IYVA 1QHSA 3UXMA 4JIMA 1HEIA 5TARA 3GJ6A 4C9BA 4A15A 3RC8A 2FJUA 2IA5A 2OFOA 1WBBA 3AF2A 4BLQA 3CF6R 1KKLA 3BC1A 3FKSA 2NMVA 2V54A 3U7HB 2Z4SA 3T5GA 2IF2A 3GLHA 1IJEA 4HLDA 2YHSA 3S1AB 2R9VA 3BFXA 4RJLA 5JJKA 2BMDA 4CRWB 1MT0A 2WOOA 2QAJA 2ZVQX 3EZ7A 1D6JA 2GA8A 1XRJA 2EFDB 4OI2A 3LLUA 4YQFA 3RNLA 4Q1FA 3THWB 1UF9A 3GFPA 2Q9CA 3TAHA 4MRPA 5LDDC 1ZM4A 1GKYA 2FOLA 3B1VA 4QNMA 8OHMA 1W0JA 2VA8A 1GM5A 1L4UA 4GFDA 2JLWA 1OXXK 1VKJA 1ZIPA 2BJVA 2CLSA 1EFRD 2N1BA 2VF7A 3F8TA 1UPTA 4C0BA 4BEJA 3B13B 1KZGB 4IVRA 5J5CA 5IK2A 4XIGS 4MUAA 3T12A 1MOZA 1EX7A 1E2NA 1Q3HA 4CW7A 3AVXA 4HATA 5DH9A 4PSKA 1TQ2A 4UJ3A 3QPVA 3QBVA 4NONA 4QJ4A 3QUSA 2CK3D 4H1UA 1CEEA 5AJWA 3MMPA 1FQJA 2ANCA 4HAWA 2O8BA 3PUXA 1DO2A 1BMFD 1NSFA 5KHOC 4BWYA 1KI6B 3EPJA 2ZUDA 1Z29A 1KDRA 5HPYB 1OFIA 3TUIC 2J0QA 3HYTA 1AKYA 2C5LA 4JS0A 4JYCA 4GOJA 2OLKA 4Q1EA 4LHYA 1HE1C 4IDOA 5FOVA 2FFBA 3V9PA 1TQDA 2FE4A 3RABA 4BFYA 3BWDD 1T8UA 4Q1CA 3B2EA 1NIPA 1JBKA 5DI9A 2GBLC 1YR7A 4G0NA 4EPVA 2JEOA 2ORWA 4Q9JA 3GJ4A 1XP8A 2G6BA 1Q57A 1VMAA 4DB2A 4LC0A 2K5UA 4EPYA 3EWAA 3KZ1E 4OHWA 1TF5A 2ONJA 4UXHA 3IBGA 1GNRA 3CRW1 3H1TA 4BEBA 3MJHA 4URVR 1KK3A 3KL4A 1GDDA 1E0KA 4P33A 1QVRA 3KQLA 2RH5A 1KI3A 1KJWA 2IYZA 3A1TA 4P3YA 4LYFA 4MRVA 3Q3JB 4V0NA 2XTZA 1QHHB 2ZVPX 4HB4A 3TSWA 4BE7B 2XZOA 2ZXUA 2B6HA 5LB4A 721PA 2IL1A 3UMRA 2JIZD 4KYUA 2F1HA 4KAXA 2IYWA 2ZIAA 1TL7C 4OI4A 2WAXA 2FFHA 1JR3D 1L8QA 2BC9A 4QHTA 1OIXA 1JQJC 4UJ5A 1GP2A 4NHOA 1Z06A 3LXXA 4FCWA 4Q19A 1KI6A 2CVFA 2OESA 4DLUA 3QXXA 4DDUA 3REFA 1QG4A 3JVVA 1Q44A 2ZAMA 4MDFA 3X1XA 3BFVA 2JLSA 2ZRKA 2XOKD 2O8EB 1U0JA 3JVUA 1KSHA 3RS7A 1GTVA 4RY2A 3W90A 1Z5ZA 2ZYVX 2GETA 2I1VB 2YOFA 2QTVB 3L43A 5FTMA 3ZD6A 3K0EA 3O8BA 3A1SA 3IPXA 4B3XA 3REGA 3NEYA 3QF7A 3EPHA 2GF0A 1KAGA 2A5DA 2VTKA 4O2LA 1KHTA 3AKDA 1T3LA 1O3YA 4NYJR 4PFSA 3SBDA 3B1YA 2RGGA 1FZQA 1IBRA 1Y3AA 1YR6A 1J8YF 2BIFA 2J7PA 1HQYE 1KTVA 4OQNA 5GVRA 1XXHE 4BZPA 3K70C 4IEEA 4AKIA 1UBGA 3ZVLA 2WAYA 1VYTA 3VR2A 1ZYUA 1D2NA 4Q9IA 3FFAA 2FNAA 4C3ZA 1XCGB 2P6NA 5E7MA 3VX3A 3BORA 3HU3A 3LRPA 3LX5A 2P65A 4D0NA 3GJ5A 1YRBA 1NI3A 1Q1BA 3QVUA 1SKYB 1E9CA 4HUTA 1NF3A 4Q1AA 1P9WA 4ARZA 4OHVA 2RCNA 2WWXA 1OKKD 2A5YB 4QFMA 3RS5A 1NVXQ 2QT0A 1BYUA 4DT1A 1CJTC 1JEEA 4D2IA 3RANA 2IUSA 4KITB 1S4QA 1VYVA 2RMKA 2RHMA 4LRWA 2H18A 3E5HA 4OQLA 4TWZA 2FSIA 4ZDJA 1G3QA 3U7EB 4WVFA 1OB2A 1G41A 5DE3A 2OCPA 3RS2A 2JLUA 4M9QA 4DRZA 5BWMA 4LBYA 4M21A 1II8B 2PZEA 3SI7A 4D0GA 5CK5A 2D2EA 4B6FA 2JDID 1TUIA 1KO4A 1D5CA 4O25A 4A36A 4PPFA 2YC2C 2UZIR 4KXFB 4YMWA 3MWJA 2C9CA 3B6EA 3KKMA 1C9KA 2ANBA 3B78A 4DLXA 2AXPA 1YHNA 1OYYA 2R62A 3ZS8A 2D74A 2DYKA 1P73A 1Z0DA 2QPAA 3QNUA 4TMZA 2REXB 1ZNZA 3U3RA 4IJMA 1CJVC 4ERNA 2A3RA 1XXHA 2J9RA 1SZPA 1T0JB 3IDQA 3WXMA 5CDFE 2ZRNA 2BOVA 4OJKA 4BZXA 4EJSA 1C1YA 5ELXA 3CWZA 2OE2A 1P2VA 2YV5A 4CT5A 5GJWC 1T3HA 1TADA 2GNOA 1OXTA 1G7SA 2QT1A 4POAA 4RFVA 1S8FA 1F2UB 3DOEA 4JVNA 1GZSA 3ADKA 2GDJA 2J1LA 3W3ZB 1WA5A 2VBCA 1X3SA 4WZAE 3DKVA 2BMEA 1OYWA 3DZDA 2WJHA 1NY5A 4HDCA 3EIEA 2QPTA 3BGWA 4NCIA 5ANRB 3RRNA 5FH9A 2NIPA 3U4QA 2NQ2C 5M04A 4IXMA 3SU8A 1W5SA 1IN4A 2ZRFA 2ZSFA 2ZR7A 3CRMA 1I4LD 3QKRA 2QENA 4ZO4A 5EE3A 1VCOA 1II8A 4KVAA 1WBDA 2J7KA 2R8RA 2VHUA 1CTQA 4LHWA 2WJGA 3PQCA 1VCMA 1S2MA 4RD4A 5HR5A 3K70B 2GJKA 4MH0R 4PPGA 3DMNA 1LB1B 2CCJA 2MSEB 4PPQA 2GXUA 1OV4A 2B7CA 2REOA 2ZR9A 5J4LA 2IS6A 4HLCA 3NTUA 2ERYA 3D3QA 3R8CA 1RE0A 2J45A 5C46F 3K9HA 2CNWD 1CR2A 2B21A 2OHFA 2JA1A 2MMGA 2GAOA
chains in the Genus database with same CATH superfamily
4RH0A 2PXAA 5EESA 2EPKX 5CDFA 4YV1A 4UXIA 3GLRA 3RLFA 1H22A 2B69A 3GJ7A 1Z0SA 3GFOA 2XSZD 5E1OA 3WLPA 1GADO 4U2DA 4O8ZA 2B98A 3ILXA 1Z23A 3I39X 1ZUIA 3QKUA 5TX7A 5JTUA 1BOFA 2DCMA 5EMKA 4OIRF 3K1AB 4BFUA 2KM1A 4DBZA 2AI3A 4EVSA 2I54A 1K05A 4I5EA 3KQSA 2K7ZA 3PQ3A 1GCUA 5IBRA 5JH7A 1ODLA 2DY1A 1QFSA 4UQLA 4NOLA 4L1KA 3K9FC 3KKEA 3FPJA 1WCXA 4IHQA 3USCS 2Z1DA 1WXHA 3SMQA 4AULA 5FQNA 1R4NB 3OQOA 1ZM3A 5G41A 2QW1A 4W8OA 3Q0EA 4W5NA 2DFPA 3R3JA 3E05A 2AE2A 2ZSJA 2DH5A 4MS4A 1OH6A 2JI6A 2HX1A 4FKZA 1YBAA 5KNBA 3GLTA 5CX1A 3W5DA 4UKDA 4MV9A 4MVZA 1WUJS 4XYBA 1QKIA 2LV8A 5JSFA 4CTKA 5DWQA 1PG2A 5AI9A 5TR9A 5TPWB 1M8JA 2CDBA 2GEJA 1J0XO 4B2LA 3JPWA 1ELOA 3TEFA 4G5GA 4OHXA 4RZXA 4TYYA 3O0TA 2OGUA 3Q12A 2DFVA 2QNRA 4ZOBA 1KJQA 5LR6A 3KVVA 4GXTA 3E58A 1YUNA 2YQZA 4J4BA 2KS6A 4I8IA 2J9VA 2HWKA 1LLFA 4MI1A 3V8VA 1CUXA 1RTTA 2BI7A 3RBVA 1IWPB 1BTOA 4GWGA 1VECA 4XB6B 5JYBA 1HZJA 3B6ZA 3C6MA 3ONVA 3X2FA 3PFNA 2BHSA 1ZESA 5BSTA 5DBIA 2H1IA 1Z12A 1Z8FA 2WYHA 4LJ7A 4PS0A 1WZ2A 3PGVA 2E6KA 1NP6A 3JYHA 3LF1A 2XBLA 2CVHA 1BWSA 2AFIB 4OBEA 1NAHA 2FSSA 1SXJE 2J8ZA 1Q7TA 3ZZTA 1BQ4A 3KT6A 1ZD2P 3HC7A 3E4DA 4OF4A 2XWJI 1Z0IA 3OCXA 3EIXA 4ZDIA 2P9FA 4ZV9A 1G6OA 4LS3A 2WYUA 3S70A 1L5KA 3EPVA 1R10A 1P5ZB 4XEFA 3KB1A 5GV7A 1M8GA 4QO7A 5DHPA 1A71A 8MHTA 3VV3A 4NENB 3K0AA 3NG1A 2O9XA 1A76A 1W4AA 1DSSG 2IXMA 2R7QA 3ACCA 1EWRA 3KUXA 4BQFA 3WHIA 1MDFA 4MS1B 1NW6A 3FAKA 4OP1A 1Z08A 3TIVA 2ZWVA 2EWVA 4AZ3A 1JQ5A 2B1JA 3SE7A 2VL7A 4MAFA 2XAUA 3MAGA 2AHOA 1JG4A 3KBOA 4KQEA 4IM7A 2BFWA 3LRXA 3EDQA 4P4LA 3IT0A 5MN5A 1J33A 1E5TA 4OL9A 1UBCA 5ESDA 4LE0A 2X77A 3JZFA 4QFDA 3ZTMA 3MWFA 1QBKC 4ZMBA 5HTOA 3F9RA 2VK1A 5A4IS 5HMLA 1P9OA 1WN0A 2NV6A 1U2SA 1W59A 1BMQA 3AR3A 4I2VA 3TW4A 1XMOB 2ZRHA 4PHFA 4OHYA 5B7PA 1OX5A 4G8DA 1ZU5A 4LZOA 1OFHA 4YRCA 4K8OA 5B2FA 4JJGA 2KWIA 4MW1A 2WIDA 2APJA 1C9NA 3TSOA 1U5AA 2CSXA 1EX9A 2XKBA 3FRJA 3IQDB 2ONYA 1L5OA 5KX5F 3LT0A 1S7ZA 4UTPA 5EQJB 2GHRA 4JI6B 2WF9A 1C1HA 4HO1X 3B36A 1HGXA 4H0NA 2JH3A 3TOLA 2ZJZA 4AIIA 5TEVA 3BZWA 3FB4A 5K4HA 5A5EA 2XL8A 3WA6A 1F0KA 1MC4A 4LJ8A 2AC4A 1NL3A 5DN6A 5DWVA 1T01A 2JI9A 4Y2RA 2R03A 2P91A 2EIMC 1WKVA 1Z38A 3QMWA 1KZ1A 5H3HA 3H2SA 4GDFA 3LNMB 3PFIA 3UJNA 1GQFA 2PMCA 3V42A 5K8IA 2FMFA 1Z34A 3FCCA 4HGQA 1CUDA 4QQ8A 3OF2A 2NX2A 5UKDA 1GITA 4KLNA 1PDWA 5J3JA 5DISB 4HKTA 1A96A 1U31A 5CDHA 3E9NA 1TO1E 5IYZA 1JT9A 3C8GA 2AYZA 2PGNA 4PLWA 3RG2A 3GFSA 2ZUBA 2BR5A 2DUMA 3MOGA 1B8VA 2J4DA 2A1DD 4XPYA 2IUTA 1VHJA 2VDUE 2DGJA 1T5BA 2D5CA 2I0FA 4C4TA 4J8PA 5LBUA 5L45A 4U0JA 4ID3A 3KZXA 5DBFA 1SZCA 3CKLA 4HQRA 1P75A 2CHQA 2MHCA 4X8HA 1WMBA 4PYJA 2QX7A 3D4PA 3QOWA 1Y5RA 1T3SA 5AH0A 2B1IA 3PXBA 1RABA 1B0AA 2YZKA 2P6UA 2HO5A 4GZLA 5MGNA 1DAMA 3WL8A 3B6MA 1DFIA 2EIKC 4E51A 2PJUA 4FSXA 1P9RA 2X76A 2VUTA 1P5RA 4LXYA 4XWAA 4D9JA 2JLXA 2FP3A 5CIYA 2OZEA 1QRSA 3T54A 5EY5B 3G59A 4QE3A 2GHQA 1U6HA 3A31A 1HQDA 3WLTA 3HU2A 4MS3B 4FGUA 2V6JA 2Z1MA 1N7IA 4KR6A 4RC9A 1R2QA 2D54A 1EFRA 2A88A 1G8XA 4I1IA 4LMAA 3H2VA 2ATCA 3SYLA 4D5EA 3E5RA 4LZJA 3LLMA 1G63A 3JRXA 2X0RA 4GHWA 2ZIWB 4NYIQ 2WZQA 3W5BA 4O79A 1KK2A 4DMHA 2VKQA 1UBUS 2XLWA 2NPUA 1OW6A 3LPDA 4PBRA 4NMWA 2GJSA 1VPTA 3S2ZA 3A3KA 3A1WA 1Z6TA 3NDPA 3AJRA 3OCJA 1C9YA 1MMFB 5E1BA 1PI3A 2HWYA 3LBIA 4MYUA 3K0HA 2H51A 1FR0A 2YWGA 3RAPR 3FBTA 1VL1A 1JE0A 4ASUD 4R5MA 3BFPA 2O2GA 4HP8A 3JQBA 4AN0A 3IP1A 4PYQA 4TM7A 1LF5A 5HYVA 3OTIA 4R31A 3JT1A 2AMYA 3C4VA 3O90A 5A5VA 1XO1A 4EDFA 3DDSA 1NRJB 4OQ4A 2Q3DA 1TMYA 3SHFA 5KQLA 2X0DA 1L8OA 1KYWA 2V4MA 3LHDA 1KEVA 4Q34A 1BFDA 5A7FA 3KEFA 2G07A 4KU4A 1BZYA 1Z8NA 4YONB 4YCDA 3LL7A 1J00A 1JKJB 4OQEA 3HCEA 1BSVA 3ZZMA 3BOSA 2MMCA 4WOBA 2JIPA 3V33A 3X2EA 4E3ZA 1LSUA 5I7VA 3VA7A 3I5QA 3IELA 5B4UA 5H3CA 1TKBA 3R6LA 2FZ5A 2QX4A 2R4TA 3KPVA 3NDBB 4R9SA 1CR1A 1RKBA 4O4JF 3G0HA 2I03A 4D44A 1V5WA 3SHTA 3WWYA 1L8AA 1C3OB 3I9LA 4EW3A 3OCVA 1JA0A 1OJLA 2OKUA 2CLIB 1H1TA 3A4LA 4UHDA 4V0QA 1PR2A 5KSYA 1E4EB 4I6JA 4GPBA 5CVJA 4R8VA 4YJGA 3C15C 3NHSA 5A6SB 1NW4A 3AVPA 1H6CA 2O1XA 3I72A 2CNWA 2UYOA 4MCAA 1LQUA 2ACEA 4MTGA 2HA0A 5K8LA 1D1AA 1OFGA 4R81A 3BS4A 1R5NA 1ZJJA 3WNZA 3G88A 4I1OA 4J90A 1QF9A 1XKXA 4B7CA 3SYKA 5JS6A 5E4FA 1UBSB 5LA6F 3FZQA 2DEUA 2ZI5A 1YRLA 1EWQA 3HLYA 4UATA 1X39A 4B83A 1OQAA 2PEZA 4XD7D 3PL5A 4Q4ZF 4U7TB 2PG3A 4HBGA 2A1IA 2QE7D 4MVCA 3FOZA 1ZZEA 4TT3A 3IP9A 4KMMA 3PEFA 3C1OA 5TVGA 3JYOA 5ULLA 3LW8A 1R3DA 3A7DA 2XCLA 2ECFA 4KQ1A 1E1RA 1E9RA 3UG7A 3WWOA 1PK8A 2CB0A 1WP4A 4D5GA 5DYNA 2FFAA 3QVLA 1GARA 4G1CA 4H1TA 3X1ZA 3TUZC 4YQEA 2GGSA 2XA9A 3UMBA 1D0ZA 2VRBA 4RD6A 4K9KA 1SUSA 4HFKB 2ZJBA 4MI9A 2QQ0A 4X1KB 4C0WA 1F2VA 4GEGA 1V8BA 1D03A 2P62A 3MFNA 2V7EA 5K0NA 1YQUA 4XD2A 3QVTA 3FMVA 3T9EA 5DTQA 5DBHX 1KNXA 2PNOA 2D1FA 4FKBA 1ZRHA 4RJKA 4E7ZA 2YV4A 2CHUA 4QUHA 2CGEA 1YBFA 4UTNA 1YE8A 5KTRA 5AHOA 1YKFA 1E79D 1P7WA 2UYYA 3TD7A 3BTSA 2EFCB 3IAS1 1JG3A 4JZKA 3CLHA 5AESA 1EA5A 1Z45A 2X14A 4YFYA 3Q9LA 3V1LA 5BT9A 4BVFA 2NXJA 2Y1OA 2ZUFA 2FW7A 1BEEA 1IHDA 1G291 1LW7A 1MD9A 2WF6A 2M32A 3ZK8A 2ZULA 3QWAA 4MW4A 4CEIB 2YDXA 4NECA 1DQPA 1P33A 3IOYA 3ZHBA 4TYPA 4H60A 3KKQA 2QLFA 5BR7A 4ZA2A 3PYMA 5FBLB 4XVRA 1IDOA 4JW1A 5CVVA 3RVPA 1XZEA 3DH0A 3KLOA 2BL4A 3PI6A 4PIMA 3ABSB 3NYRA 3KSUA 3JQ8B 3DXXA 2JLBA 5GVSA 4FMDF 3ZKWB 2OK8A 3HABA 4HRYA 3IESA 3QBDA 3B20A 5FA6A 2XKAA 1M8FA 1Q7BA 4NBVA 3LZDA 3WK5A 1L5HB 1UFOA 4B33A 4BNDB 2H8GA 1MBZA 1LS4A 4BO3A 3PHF2 2GF9A 3GDGA 2Z15A 3GPCA 3HKEB 4ZLDA 3MQ2A 4MP8A 4OREX 3DFKA 3UZUA 3WOHA 2NO4A 1I4EB 3EZNA 4KVZA 1XSEA 3VU8A 3RD5A 1XHLA 4CM5A 3A9WA 3LG2A 4R84A 4YTEA 2X2FA 1QHGA 3DXJF 2BGJA 4GC5A 2CD9A 3HJRA 4PGHA 1TNDA 1UL1X 1N36B 5EUMA 1E2GA 5L0GA 3NAZA 5EZYA 2EFHB 3GFFA 3V5NA 1ZMBA 1AKRA 2OV1A 2O23A 4L4ZA 1UZMA 2EIHA 3PFKA 2ZE7A 3SC2A 3MINA 4C5AA 2KLHA 2HSEA 2I1QA 4LZAA 1RE1A 2W71A 4E14A 4OLFA 1YA4A 1YDEA 3HBJA 3WB0A 2OXCA 4NJOA 2EW1A 2GZ1A 121PA 2WIAA 3NONA 2P5UA 1N5IA 3R74A 3AVVA 5DYIA 1W4BA 4Q9LA 4MP6A 2I67A 2QM7A 1CGME 1AV7A 4FYYA 2H48A 4JJKA 4ROSA 5K2OA 2J5KA 3TB4A 3W8DA 1AC5A 1JJBA 2XMGA 2NZYA 1F38A 4Y1FA 4D8TA 3TNJA 4NC3A 3B3JA 4EGJA 1N3YA 4AG6A 1V3QE 5SICE 2QW8A 3VNBA 4N5NA 3A3OA 3ZH2A 2R4UA 2EP5A 1Z7EA 3QM1A 1Z37A 4BNVA 2VNAA 5AVUA 1U2ZA 3HJGA 4UHKA 4TKVA 3NLLA 5CM2Z 3THOA 1JLKA 5AVRA 4BJHB 3M6FA 2GD2A 5SZJA 3E84A 1N3BA 3GLGA 4HCJA 4TTQA 2JLQA 2QSYA 3G0DA 4DZZA 4Z49A 5K5EA 3HCWA 1WS6A 3ME5A 4OQFA 2D00A 1UBKS 1X7XA 3ELWA 1A2KC 2C9DA 2F43B 2AFIE 3QEMA 1OWPA 2R25B 4PFQA 1LLDA 4P5DA 2KSFA 2OENG 2QA5A 1KHHA 2ILVA 1E5DA 4CLDA 1B0PA 3DJNB 2G6TA 2WUGA 3OIUA 1CWUA 3LXRA 3T3DA 2X5OA 4GYTA 2R11A 2IUUA 4JURI 3ZDLA 2LBPA 3IAS6 1LIHA 1TVKB 2PLNA 5BSHA 1RCFA 4BNGA 1XD2A 3LD9A 4M7PA 3QOFA 1WD5A 1YVDA 4B6EA 4DCJA 4QNNA 2C20A 1KMCA 1GPDG 1T6QA 4XX1A 3DYBA 3H2ZA 5F64A 3M1CB 1RI4A 1F06A 3BWMA 4AE4B 2WZBA 4JIMA 4CM6A 2FLVA 4BLQA 2H29A 1WUHS 3BXOA 3S1AB 3RU2A 4D7AA 3R2PA 2IV2X 3TAHA 1JIKA 4N65A 1RACA 1W0JA 3ZGZA 1ADYA 4BVEA 2Y69C 5E3AA 2DBQA 5DNVA 3FPBA 1Z15A 3TLJA 4Y0NA 3ZHSA 4JC4A 4E33A 1BMFD 5KHOC 1DWPA 4E0IA 3TL6A 2OBXA 1SQSA 1HE1C 3T9AA 2CSUA 1QGUA 3PNBA 2KQ9A 5ALYA 3I8OA 4NJMB 2PM8A 1E3QA 2OP0A 3RVRA 4UCWA 3A1TA 4RVFA 1VJRA 1W96A 2CZGA 2PGXA 1A72A 3ESXA 3FPEA 5IABA 2F2TA 5C1PA 1PAUA 3ZDZB 3OX2A 4BATA 4R1MA 2WFAA 5TLSA 2AEEA 4C14A 1YOBA 3PC4A 3RS7A 3LUJA 1Z5ZA 5EKSA 1YDGA 1B6RA 1HTTA 2OVFA 2OGZA 3B1YA 4JU8A 1Y3AA 3V5XA 1CIVA 4AKIA 1NPYA 4XPIA 5K99A 2JANA 2WRZA 4K9MA 3FNFA 1VZ2A 2CDRA 1K6JA 1HYGA 4QFMA 1QNFA 1X9GA 4M8SA 5D3ZA 2XMPA 2GO7A 5DE3A 1VE6A 1IMOA 3AI3A 3SS9X 3LVBA 5CGZA 1LA2A 5DGCA 3F98A 2DYKA 2G40A 5I5GA 2FOXA 4FEAA 4ALNA 5IU6A 3KUUA 4KXNA 4M83A 3ETNA 1QJ4A 4NJEA 1GZSA 5J2TF 1B68A 3DKVA 3T9BA 5GV8A 3JVEA 5T1DB 5M04A 2IZOA 3SU8A 2IHNA 1EE9A 1A5BB 3CB2A 1CZHA 1UWCA 4NDNE 4BAZA 1YJCA 4JB2A 2QENA 3DTVB 4ML3A 4Q9AA 1SBTA 2VHUA 1MMGA 2ZG6A 1S2MA 2PKRA 1H4VB 2A0BA 4W9NA 3IDOA 2A8YA 3N2GB 2PPLA 4C6TB 4HLCA 3HUUA 2VHVA 3RCBA 4J07A 2V7XA 5L3QA 3GFQA 3PHHA 3HNKA 2J4FA 4KOEC 4Q4CA 4KAAA 2ISQA 2ZYRA 3PU6A 4OK5A 3EMBA 4I6EA 4JTCB 3A1FA 5H8WA 4UULA 4H4DA 1NXWA 3GD5A 5CJPA 1WPGA 5H9VA 3H9QA 5EQTA 2QZSA 3QSYA 4EFLA 4BB6A 1PJLA 5LDGA 4I4NA 2H1WA 1SN7A 4P9TA 4K88A 2HKVA 3KUCA 2Y68A 3R0IA 4FB4A 2UUBB 2HZBA 1NNSA 1ORWA 2N42A 10MHA 3S8MA 2RGCA 1N34B 2GZAA 1IEXA 3RJ9A 3TLGB 5E7QA 1PWEA 3DONA 3NH6A 2YKGA 3T35A 4HEHA 4C7OB 4DRXA 4HMQA 3REOA 3H1BA 4F8JA 5GONF 4TLBA 2OFFA 4N54A 2X9NA 3HEAA 2VC9A 2JH8A 4IIBA 4WT7A 3A4MA 5COFA 4C2UA 4YN0B 1V8PA 4QUGA 3GUZA 4JLOA 3HDTA 4B4VA 3TW8B 2HMQA 5EKDA 4RTMA 2BFNA 2O8NA 3GEEA 1X13A 5CA1F 2E37A 4AS3A 4R54A 2YY5A 4LQCA 3VRHA 1LBSA 1TJ4A 1BHSA 3U9LA 3O8RA 1PS0A 2R1VB 3E3NA 4I3FA 2QUJA 5HWSA 4N18A 1ODFA 3EIUA 2CXOA 1VXOA 2AIRA 1AKTA 2C4HA 5BUQA 2KI5A 4UOQA 5BOVA 9LDBA 2NSJA 5CPFA 2EEPA 4U7FA 4DM3A 4FBMA 4F7WA 4JI2B 5AOBA 1RKEA 4JQYA 1RMYA 4HQNA 4Q7JB 4P6VF 4D25A 2PWZA 3PQ2A 1OC2A 1PTKA 1SOMA 1GDHA 3IQHX 4YLEA 5C5DA 3R77A 1FX0B 2W0SA 3PV0A 5D1HA 3BRWA 4IQGA 3EZGA 3NWEA 3AF6A 4EUSA 4YRPA 3KTFA 1EGVB 4KVGA 1TEHA 1T2AA 4KQKA 3V5YA 4FKMA 1ULTA 4V02A 1T0IA 3EG5A 1ULZA 1DKQA 5G3YA 3OETA 1CGNA 4AD8A 4X7PA 2RGBA 3H13A 1IUNA 3GLHB 3UMFA 4EG0A 1QGYA 4YVFA 1ABEA 2DAPA 3F6RA 1P0CA 4AS2A 5HKLA 5BRAA 4KXXA 4MQ6A 3QZUA 3STXA 1E6UA 4CV3A 1JDSA 5F5FA 1VJ0A 4LEIA 1NFNA 1XLUA 3B70A 1RZ3A 2K7FA 4DBQA 2OO7A 3COYA 4J0FA 4KI2A 3L6UA 4G4JA 4NIMA 3ET4A 3D6FA 2GCEA 2J3JA 4WLOA 3QVXA 1RM5A 1X7WB 4P98A 4UW9A 3R9KA 2O0HA 3B1JA 4X7RA 1FEZA 2C1XA 1V74B 1XZFA 2B7LA 2HNAA 4K28A 4K2HA 3PPWA 2YS6A 3NTQA 4RO0A 3ROTA 5E2QA 2NW6A 2PS3A 3DF7A 1E59A 2IY8A 1SRQA 2ZR0A 1OXMA 4RM3A 3HPRA 4P81A 4ZJYA 1KS9A 1OBFO 2FWIA 1NC1A 4YLGA 1Q0DA 1SUDA 2ZAIA 3CX6A 3WL7A 2ZU6A 1S7CA 1QFJA 5JCJD 1AH2A 1IG3A 4E0HA 2MIIA 2VHXA 2HF8A 3HCNA 2FJPA 1UOPA 2VP4A 4PM4A 4QOJA 3I34X 1OHHD 2OR3A 5DGDA 2NO1A 3E9MA 2ZRQA 4LRSB 2PFKA 2QV0A 4D45A 1FFXA 4XLZA 3B29A 2AYXA 2WKRA 2H92A 9ABPA 3WP1B 1ZMRA 5JANA 2V9PA 1S1CA 3I53A 3O2SB 3FWPA 1G1AA 3UOAB 3HSYA 2G8NA 4DWJA 2J5QA 5C80A 2ZI6A 4ZAXA 2R6ZA 3ZWKA 2VSOA 2BGKA 2NPOA 4R8MA 4ANJA 3DT6A 2B35A 3G0BA 5CT9A 4LI0A 4ZYWA 2BVNA 2DQYA 2M6KA 1JIUA 4LC9A 3EEYA 3F46A 5F3WB 4O59O 2Q3BA 4U2FA 1G8MA 1K75A 5BR4A 4EFMA 1MJHA 2P9EA 1IJKA 4MR8B 5CURA 2JFZA 4KR2A 4OYYA 5FJJA 2CJWA 3RC1A 3AEZA 2ZI7A 3AHEA 4BJ5A 4N5LA 2QZ4A 2ZYWX 1N6LA 4PNEA 1GGQA 1CUHA 3A14A 3IALA 3CEAA 1M8PA 4BLOA 1U9IA 3OE4A 2JFXA 2PH1A 2DSNA 5JJBA 1ZITA 1XTIA 3KOZA 3GRFA 4N49A 3PHLA 3CNLA 2ZU0C 3GCWA 1ZCBA 3L1IA 2AK3A 2I4LA 2ZT5A 2PIDA 4WY2A 2XF8A 3C8UA 4V0RA 4O02B 3GBSA 2BFDB 4NVRA 3DC2A 2EPLX 3VBCA 4R7TA 4EZBA 2VJOA 4JCCA 3L7OA 1FLVA 1MO3A 2E3JA 2VPYA 3IT1A 2PRJA 2PCLA 4LYHA 3HWX1 3TTXA 4RDCA 5EKTA 2UUPA 1P3Y1 2J6IA 4A5SA 4J75A 3U0BA 1SUEA 3JD0A 2EJBA 3BULA 2HSBA 3OMXA 3UG6A 1YA8A 5EGSA 2VPQA 2GEKA 2BY4A 4FR5A 1N8TA 2VCYA 5D51S 3NJRA 1ZY2A 1NV9A 1GOTA 1LJ8A 4F4BA 1ZJZA 5JXWA 2V5VA 1UBFA 1PV1A 3QG1A 4ESVA 2HREA 4N03A 3WE7A 4CBEA 2H5IA 5ESWA 2F17A 2A94A 1ZK2A 4J0IA 4MQFB 2IE8A 3NIFB 3E3OA 3BEDA 5HVNA 1FRQA 4G81A 1Q84A 1RYMA 3I61A 5COGA 4J0GA 3GRKA 4Q6WA 3OQVA 4AXBA 4P3XA 4IJ6A 4ZARA 2XVXA 2P6PA 3NX4A 1JIVA 2NTEA 2F64A 1KVRA 1VPVA 2OYSA 3JWIA 3PQFA 1MNQA 1ZO8A 4EY4A 1EGMB 1R6XA 4C05A 4CMEA 3OEWA 4V0ME 1MGOA 3DBVO 3S81A 3DHWC 3HZHA 1JOGA 1MH9A 1QGOA 4OMUA 1T91A 3J81A 1WE2A 4MEAA 2YZ7A 2QVZX 4RGYA 3A2LA 1H65A 1N5JA 4B3BA 1YKSA 3CX4A 5JFOA 5AM5A 2R44A 3OQHA 2BFCB 3WXBA 4RGQA 3HRHA 4F4JA 4LV5B 4AWBA 4NAUA 3AHJA 5C8YA 4WLEA 3VZCA 2OEPA 4KGXA 1C50A 1HDRA 1M34B 4NH4A 3VU9B 2D4UA 4R1QA 4WPGA 2BC5A 3V1TC 1M72A 5DLJA 1A8QA 4QTTB 2WWTA 4M0LA 2XB2A 1YZUA 5EJGA 1RWOA 5IBQA 3V8MA 2YFHA 3TWOA 2IIQA 4IEIA 4LGMA 4P9NA 1K7SN 2E4UA 3W2VA 1Z5OA 1ZD8A 3OOYA 2X7JA 2D13A 4K6KA 2J46A 4E4TA 2PV0A 4R2KA 4XR9A 3FRIA 4QD3A 4JHLA 4Z0NA 3HB9A 3F9IA 3IE1A 2BEWB 1TU4A 3RGGA 3RYIA 3EZHA 1PKEA 4FZ5A 3KSZO 2W2QA 4TVOA 2XNKA 4OJYA 1QV7A 1E2HA 3ICEA 2M6SA 4EK9A 4B73A 1I2ZA 3SC4A 3KSRA 1ID1A 2OQVA 4RUKA 1UK6A 1A9OA 3U44B 1HORA 4EB6B 3KV1A 2Z95A 3ZS9A 3MX3A 4AO8A 1IK6A 3I62A 4B8ZA 2VHTA 5EJIA 4O5AA 1N5OX 1Y34E 1AG9A 1ZCZA 2JFVA 4AJHA 1KE1A 1OAKA 4CCYA 2VDWB 1A9ZA 2JZCA 1K3UB 2OFWA 4ZOCA 5PNTA 1X1AA 3NHPA 4NE9A 1X7GA 3H1FA 2FQ1A 1U8CB 4TVSA 4RAQA 1K92A 1AXEA 1ZCJA 1T9CA 1T9HA 1IZYA 4YAFA 2IZ7A 3DV9A 1FPQA 1U8XX 4MK4A 3HKKA 3QNWA 3C5CA 4TTVA 4BE9A 3DBRB 3ZHTA 4P4SA 3WGQA 2FN8A 3ZWVA 4PSCA 5TV2A 4L8LA 3HCAA 2ZUWA 3FGOA 4JAVC 5C32A 4X71A 4CU2A 4KRYA 2QE6A 2R7MA 3EUAA 4FWBA 3L1JA 4FYXA 2C4MA 2RD2A 4J1TC 4QDJA 2CV1A 1NN0A 3PX7A 1AHHA 4GICA 4TV8A 3N05A 3OMLA 4GAEA 3U4DA 3WYDA 4HAZA 3A28A 2ISCA 4B9AA 4UHBA 4QDLA 3DLBA 1Z7Qc 2JZNA 2IWRA 3G50A 4Z53A 1KZ7B 4PAMA 3T94A 2HUJA 2JAWA 4US1R 2NU8B 4R69A 5T67A 1M8KA 5EJEA 2H2IA 2JKZA 1P1FA 4AJNA 3U6BA 2J32A 4KSYA 5HUQA 4I99A 3RW0A 4DBLC 5IHPA 4GYWA 4JXZA 3F6SA 2EIJC 2XRMA 5EWMB 3SS7X 4DV7B 2YL3A 5JU6A 3DKIA 4X3OA 3ELUA 3D4NA 4L7QA 4L5AA 3KKLA 2DUUA 4QU5A 4OBBA 1NASA 4X20A 2ZREA 4ZT7A 5EIAA 2EF0A 3I92A 1ZH6A 2Y3IA 4QL3A 4EIYA 3V2IA 4XUGB 2JGNA 3RUFA 1UDCA 1Z2PX 1I4TD 2WVQA 2XI4A 1VGRA 3JZ0A 1W73A 3NYQA 3OT1A 4L2IA 4YXWD 1BDJA 1U0OC 1QVAA 1AMUA 1V47A 4BP1A 5DEIA 2FSFA 5GJBA 2OQ2A 4BX3A 4YCAA 3O6VA 3H7AA 2NXWA 2QDXA 4NBWA 3JQQA 4RSGA 4E5UA 4IICA 3BJIC 1XAGA 1Y6JA 4F92B 4ARCA 2GJAA 3G8DA 5A03A 1KAEA 4ZVVA 1I7QB 1UR5A 5AI6A 2X13A 2I7CA 3WZ2A 4I50F 1TU3A 2VYVD 4B71A 4N4AA 5E7IA 4EP1A 1X86B 1C5KA 4PRKA 1IN8A 4ZKEA 1KY3A 3QQPA 1Y5NA 4CLHA 3BSSA 4MV8A 1ZMTA 4WBNA 4H16A 1B16A 1K7XB 1XRRA 3KJXA 4ZQFA 4GF5A 5E6RA 5IAAA 2AG5A 4URXR 3TECE 1Y9DA 2DKNA 4MR9A 3HS3A 4O3MA 3SXYA 5C31A 3P32A 2WU1A 2Q50A 2ZTVA 1GKLA 3SNKA 4D6YA 1T0BA 1WDKA 1MFZA 4S0XA 1EGHA 5JPCA 4R16A 3BDIA 3LWZA 1K6EA 4ARAA 3BMQA 1LF0A 1LI7A 4CM8A 4FFLA 4NX2A 2EDAA 5JIBA 1GZ7A 3DYVA 4CKYA 3P19A 3D6TB 5IHXA 4HDMB 3BVPA 2PQ2A 4PK4A 3M5DA 4LV6A 3UJAA 2ZRAA 4HDOB 1RPAA 3C2QA 5CG1A 3JU3A 3IOEA 5HTKA 1L7AA 4N1AA 2L6HA 3RSZA 4B47A 3WAKA 3GQBB 1MAUA 4OGWA 1H1LA 3T7TA 1UAYA 2FG6C 2MYNA 4RJ2A 1UPAA 3EULA 5KB3A 1MX1A 3KXDA 3TIIA 3R5FA 1V39A 1LJUA 1YD7A 3S8YA 4R01A 2QYTA 1NJ6A 3TTUA 1U99A 1QG0A 3UKJA 5E38A 5BWNA 1L5QA 4RELA 2CF5A 2PU5A 3EVZA 3UAOA 5K8JB 4N8DA 4Z7NB 2XXAB 1F8UA 2QI9C 1YONA 5KNCA 2CVPA 3JASB 3C74A 3SS8A 1DG3A 1Z2OX 2QK4A 3TRKA 1ST2A 1MTZA 4I5IA 1SKQA 3K4HA 4BZWA 3ZVMA 3S2UA 4P7FA 1LUAA 4MMXB 2AL7A 1X7DA 3C3MA 4A0SA 3DBOB 3C63A 3A1UA 1JXMA 2AWCA 2RHRA 3KHUA 3CR7A 4WE3A 1EKXA 2UYCA 4H7PA 2PEYA 3TR6A 1SHZA 1GUDA 1NLMA 3ESBA 3GHYA 2O59A 2J67A 3MMXA 4UBMA 3DV0A 1HYBA 3JAMA 1PT9A 5I6DA 3PC8A 1UWKA 1XD9A 5ALQA 1AX9A 2ZJ3A 3SQNA 1PQWA 2I2BA 3QVKA 2Q3JA 1WHSA 5E6SA 4Q3LA 1VDZA 1NW3A 5K6AC 1KFBB 1VQ1A 2RONA 3Q9SA 1GZUA 2DETA 3K8ZA 4YUVA 3NP7A 4BIIA 3GLHE 4MGKR 4U2CA 5TQ0A 1QPGA 3EN0A 4ZO8A 3D6HA 1L7EA 1T9GS 2BEVA 2I3ZA 4BMZA 1SG9A 3M1YA 4OGKA 3IGFA 1O4VA 5D2CA 2JD3A 3EE6A 4EO9A 4RFSA 5EG5A 3P9YA 4JLBA 4KIFA 1KAQA 2O2IA 3HB5X 3C3CA 2PUJA 2IEZA 1ZYRF 5HV9A 3VXKA 4QRIA 1M1NB 1YBVA 3PSHA 1WVGA 4M0MA 1L8LA 2FY8A 4QT0A 5FOQA 2O20A 4JROA 1ODJA 3E9ZA 4L22A 3BFXA 4AF8A 3ROEA 3QFHA 2EFDB 1MF7A 3VSCA 1CFZA 1F51E 3ITKA 3N58A 1GM5A 1GYRA 1D7OA 1VMEA 3EXFB 3EUFA 4KMRA 1EUDB 2NYUA 3AOEC 4AJEA 4C4AA 1QOPB 1T3GA 5E8RA 5LXTB 1ZK4A 2B25A 2NUTA 3IDAA 2IH5A 5AJWA 4C4YA 1OCZC 4E5NA 3LUKA 2H31A 5D7BA 3OICA 4JYCA 4UCXA 3V9PA 4PCLA 4BX0A 4N76A 1MMNA 3HO1A 1E3DA 2GBLC 3EDCA 1YR7A 4G0NA 3OPNA 1ZGHA 2EV9A 2CFOA 1L5SA 3DHYA 3MLGA 3KQLA 1P8JA 1VJ1A 2VQ3A 3B6KA 1FQOA 1L6IA 3HY4A 2L6GA 4YAOA 3DKAA 2JGLA 1UBJS 5BSUA 2IYWA 4OI4A 3E7XA 5CVUA 1WU7A 4QOHA 2YJ3A 1YJBA 3TZEA 3N2YA 1NDHA 5C1DA 5MFPA 3VVMA 4UM8B 3WRYA 3G9UA 4J0JA 1KDVA 2A5DA 1KNYA 4ND2A 1YR6A 1KTVA 1QOZA 1UBGA 3T99A 2H65A 4HGYA 1QS0B 1YRBA 1NI3A 1ZGAA 4IO1A 1DC6A 2HEGA 1QG6A 2OZLA 1OLXA 1VYVA 2PSSA 4QPDA 5FI5A 3LJBA 4M89A 5A6JA 2ZB4A 3LOQA 3KOOA 1AU9A 3SI7A 2GN9A 3NM4A 2D2EA 2XD4A 4KDFA 2ANBA 1QC5B 5ICMA 1K0FA 1P73A 4RVDA 4TMZA 1BR4A 1O08A 3EG9B 2O7QA 3PQDA 2B2XA 1C1YA 5JD5A 2OE2A 4NS1A 5GJWC 4CV0A 1OXTA 2CXTA 1PV3A 5AVZA 4YJKA 2J1LA 1GZ5A 2VBCA 3EOZA 2BYTA 4CKCB 4KUHA 5ED4A 3EIEA 1L3CA 2J08A 1ZICA 4BV9A 2ZR7A 1ENPA 3TIXB 1GPJA 3EXG1 2NXCA 3PQCA 2H4HA 4XYEA 3WLNA 4J29A 5AFSA 5C46F 1JSZA 4O6VA 4EW2A 3WKDA 4NZYA 3ZWQA 4C29A 4GI2A 4HPWA 5ALXA 3LZ6A 1M10A 4CM7A 3RRFA 4O4HF 4ZDWA 1D4AA 2PY6A 3W06A 4HJXA 1Q92A 1OJ7A 3AY7A 4LXUA 2AFHE 2H4WA 5ALSA 4JIOA 1H2ZA 3U3DA 2EC5A 3C8ZA 5A4FS 4KHPB 1QWOA 1JIXA 2EYQA 2YXBA 5ITSA 3I8XA 3UXYA 1ZSNA 1HXHA 4L95C 3AIIA 4O5OA 2BUAA 3VDXA 2VH1A 5D5QA 1DT3A 4ZRMA 1GXSA 2QUIA 1QGED 3VR5A 4EJMA 3OC0A 2W8BB 4GMDA 4JXXA 2CZCA 1CQIA 4MYDA 2XOEA 3H5VA 5KTKA 5CTAA 4B82A 3ZCPA 4F2HA 5FL7D 4YXFA 4BJ6C 3ILSA 2W6ID 1W29A 4EHLA 1NI5A 3T3IA 3UAZA 2OK7A 1BOOA 4B76A 4G1MB 1WULS 4PLPA 1GTRA 4F9GA 4JJIA 3RO7A 3N9IA 4ZVOA 4HHEA 5SY9A 2NVWA 4BASA 1C9EA 2MSLA 1EFVB 2J9FA 3PZRA 3TK0A 5K1ZA 1ISJA 1B1CA 1CQZA 3UN1A 1QTRA 3ZDXB 3MWYW 4JXKA 3C3AA 4JD5A 4BFSA 5M29A 1M34E 3K53A 1LSSA 5AUQA 4EEXA 1UOQA 2IBSA 2OXFA 4DB4A 3K0FB 1L7OA 5L7TA 4IIYA 3CW2A 4XZ3A 3HY6A 4JENA 4O7GA 2XGGA 5TMPA 1TEZA 4FFBB 5LZ2A 5EHHA 1AGYA 4MVMA 2A1TS 3ZJYA 4IIHA 4MYCA 3NTOA 2HD4A 3L0DA 3A06A 4LFCB 3OU6A 1NOJA 1ZMXA 2PAAA 4A91A 4HTFA 4LDPA 2RHBA 2HV8A 1Y5IA 3CLTD 5KO2A 1QB7A 2R60A 2IBMA 2ZE5A 3TVYA 3SF8B 4ILKA 2C96A 5DM70 3G7NA 3BZBA 3BXFA 1G0OA 2HA2A 3EVNA 4KUEA 1FW6A 3EQ6A 1PSZA 3L7BA 4DM7A 1GRVA 1OLSB 2XADA 2XBUA 4F3NA 1ULAA 4BJ1A 2PGJA 1RIFA 3QBEA 1EQUA 2GPSA 5BVHA 4U5FE 3BQNB 1E0SA 1YRYE 1S05A 1ST6A 2IZ1A 2W9YA 1KP3A 1V55C 1J90A 1GUAA 5AKJA 4KE6A 1I4YA 2WSMA 4H1VA 4Y6SA 5D6NA 2ZRJA 3KDPA 4F93B 1ZHTA 2HF2A 2JAUA 3V7WA 2JIBA 1FOEB 1XTRA 1OR2A 4OL0A 4I5GA 4KH1A 1SHLA 2Z8YA 3GELA 3SQMA 2P5TB 4XVQA 4EATA 3QLUC 2P75A 2D7CA 4AB1A 2BW0A 3GW8A 3FCOA 4FGSA 4LF4B 3VKGA 5DHUA 1GTJ1 1ZUD1 4ZGGA 4B7UA 2I8BA 5DXAA 4JBLA 3KOUA 3HVJA 4AFNA 1G6KA 4EJSC 4YUZA 5I01A 2B8NA 1RWBA 3ZDYB 1V4BA 4MKHA 4MLZA 1ZJWA 5T8KA 4WGZA 3UAYA 4YAKA 4CXMA