1VMAA

Crystal structure of cell division protein ftsy (tm0570) from thermotoga maritima at 1.60 a resolution
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
294
structure length
294
Chain Sequence
MGLFDFLKKGLQKTKETFFGRVVKLLKGKKLDDETREELEELLIQADVGVETTEYILERLEEKDGDALESLKEIILEILNFDTKLNVPPEPPFVIMVVGVNGTGKTTSCGKLAKMFVDEGKSVVLAAADTFRAAAIEQLKIWGERVGATVISHSEGADPAAVAFDAVAHALARNKDVVIIDTAGRLHTKKNLMEELRKVHRVVKKKIPDAPHETLLVIDATTGQNGLVQAKIFKEAVNVTGIILTKLDGTAKGGITLAIARELGIPIKFIGVGEKAEDLRPFDPEAFVEVLLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords cell division protein FtsY
publication title Crystal structure of Cell division protein ftsY (TM0570) from Thermotoga maritima at 1.60 A resolution
rcsb
source organism Thermotoga maritima
total genus 111
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1vmaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vmaA02
4DBLC 4NE2A 4NU0A 2O8BA 2NO1A 1J2JA 5AJYA 1ZM9A 1Z6GA 3QPUA 1BYIA 4RFVA 4A0HA 1E2NA 5TDHA 2AFIE 2JJ1A 2ZVQX 5E7IA 4LJ4A 2ZI4A 2KB0A 3MSXA 3QXCA 2JIZD 2WPDA 2HT1A 2IUSA 3L0SA 1U98A 1X3SA 2BJVA 4B2PA 5JEDA 1KGDA 2FSHA 4IDNA 4PX9A 1XTSA 4PR0A 3TH5A 2BKUA 3CRVA 2FFQA 4LHZA 2FSFA 3OAAD 2GESA 3FHOA 3G5UA 3LXRA 4US1R 4RKEA 4KLNA 4V0KA 4EQ6A 3THXB 4PSKA 4DCTA 2WMNB 2OO7A 3OHMA 4M1YA 5AJWA 1P2UA 2ODEA 1KK3A 1KSJA 1HTWA 2ZYUX 1WRBA 4KYIB 4E22A 5KTYA 2Z4SA 1YZTA 4G1UC 4AC9A 3R8CA 1DE0A 4JIMA 4Q9IA 3A37A 2QAGA 1UAAA 2O8BB 3W8RA 1OHHA 2ZU0C 3U5ZB 1T5IA 1GWNA 2ZRGA 4TMTA 3THOA 4ZDJA 5JSZA 2IYTA 1TEVA 4DB2A 1T3HA 5DE3A 1HQCA 1P7CA 4D0NA 4D82A 1KI4A 1HEIA 2BVNA 4EPXA 4BFXA 2J0QA 3ASZA 1GKIA 3JVVA 1KDRA 5BYKA 4PXAA 2GAOA 2XEXA 1Z3IX 2ZEJA 3R9IA 2D4HA 3SJCA 4EQ6B 3O8CA 1YZNA 2J45A 1CULC 1ESNA 2CCJA 5E7MA 1P2VA 1DOAA 4GRAA 1IXRC 4Q9JA 4OHZA 3PEVA 4LJAA 1FMLA 2B8TA 5FR2A 3LY5A 4N0DA 2PCLA 3ZD7A 4S35A 3ADBA 3GCGA 5K8LA 1DO0A 3QY0A 3W9YA 4QM7A 1MH1A 5IT5A 3SU8A 2QAGB 3IO3A 2VP6A 1FNMA 4QBIA 1X1SA 4W7SA 1TQ2A 4A2QA 2OEPA 3GJ4A 4OJKA 5JSZB 3CF6R 2GEUA 1R8QA 1JJVA 2WSSD 1SHZA 1EFHA 1JI0A 3VTKA 1GRQA 3VR2A 2JDID 4I99A 2JJ8A 2G3YA 3WMEA 2F6RA 2Q3FA 1DS6A 2ATXA 5TARA 3K9NA 3LFUA 2REXB 4HAVA 3ZIAA 4BGDA 3RRMA 2HT6A 4FWIB 1NY5A 1E0JA 4B6FA 4Y0AA 4M21A 1W0KD 4LY6A 1EFTA 3ND8A 4V0MA 1ZBDA 3FKSD 1X8KA 3MRSA 2X8AA 1DAHA 4L8GA 2WOOA 2FEOA 2CNWD 4EPWA 5EP4A 1RVDA 4BLTA 1ODFA 2A5DA 4GFDA 4HAWA 4EJSC 3W6OA 5KDLA 1S2MA 1AJEA 1QZXA 2NGRA 4B74A 4BEJA 4JMPA 3WP0A 2ZVPX 3FFAA 4M4SA 3TVTA 2ZJZA 4KFTA 4TLAA 4FCTA 2HXSA 3BWDD 2QTVB 3CZQA 3I32A 4NCKA 1GNPA 1Q1BA 4MYCA 5KNCA 4Q7MB 4A6PA 2N42A 3K53A 2ZUBA 3DEFA 1IXSB 2W0MA 1R8SA 3LBIA 5DYGA 1MO6A 1ZU4A 2IYUA 1UDWA 4LJ5A 4TL7A 3IKJA 4PHGA 4U7DA 1C4OA 5GJWC 5TY0A 3SQWA 1OYYA 1RYHA 4Z8YA 2GCPA 3A1WA 1VG9B 1KNQA 1K6MA 2ZI5A 3NBYC 3DL0A 4NYIR 3AGQA 4PO8A 4G5QA 3AGPA 3VAAA 4ACAA 2HCJB 3TIFA 2VF7A 3GLGA 3LBNA 1COWD 4QHYA 2MSEB 1VG0B 3EW9A 5DO9A 4MRVA 2O8EA 4DRZA 1S3SA 1XFAA 5FBWB 3QKRA 1JNYA 4WXRA 2BWJA 3CF0A 2O8DB 4MITA 4KBGA 2WKRA 4DLSA 2GJKA 4LRWA 3LXXA 1E69A 3MLEA 2BMEA 1AGPA 3A36A 2J3EA 4RD3A 5KOYA 4B76A 3K09A 2IEZA 2PX0A 2VO1A 4JT4A 2ZJYA 1GM5A 4JJZA 1S8FA 2YINC 1G20E 4PPQA 1KI9A 4D4JA 3GLGB 3LVRE 1Z0KA 3SZRA 4DC9A 4Q9LA 5A0FA 4A9AA 3B1WA 1Q22A 1K8RA 4HAZA 4M1OA 4PC1A 4D2IA 1TU3A 5J4VA 3NEYA 2O8EB 4QRHA 5EXXA 4AIIA 3D3QA 1NVVQ 3DKPA 1OB2A 3QKRB 2C03A 3VR5A 4LPSA 5FI0B 4TMZA 3SBEA 2BMFA 1KAGA 3CW2A 3RRNA 1GKUB 1DAFA 5FTKA 5IF9A 3OAAA 1N5JA 1J8YF 1YVDA 3AF4A 1NN1A 1NBMD 1S9DA 1XD8A 2KI5A 4KXFB 2H18A 1E2KA 3GLIA 5AJVB 3VKWA 2BMDA 2ZREA 4C30A 1HH4A 2DBYA 1XNJA 1JAIA 3SYLA 3EZ2A 1U8YA 2GJ9A 2J1LA 1R0XA 3B78A 3FTQA 3K1JA 3KKOA 3P1JA 3L0IB 2NIPA 4LYFA 4BLQA 3VQTA 4NCJA 4D4LA 1PUIA 2OV2A 2QM7A 2QM8A 1YZLA 2GTPA 3CBQA 1GL7A 1AIPA 1WB9A 1XEWX 2FPKA 2WWIA 3IQXA 4LJYA 1CIPA 2E1RA 4FMDF 4UNQA 2CVFA 2ZRFA 4F91B 1GNQA 4RSGA 2D2FA 3CF2A 4HDQB 3RVBA 4TL6A 3EX7C 1ZNYA 1ZAKA 4B3CA 4A8JC 1Z22A 2KSQA 1G3MA 2NO7A 3QQ5A 4IDQA 1HY3A 2ZR7A 2YHSA 3NTUA 1X1RA 1T91A 1D9ZA 1KSHA 5LD2C 2C9OA 4PPGA 1E9CA 3WY9A 3GLIB 1ONBA 2GBLA 2CCKA 1IHUA 1R5OA 2ZRPA 3DMNA 3O47A 4FW9A 4YMVA 1KO1A 3QKTA 1NY6A 1S9HA 2ZANA 3D31A 3CKLA 1DEKA 1WDTA 4QKQA 2BOVA 1M74A 1XCPA 3QE0A 5F2EA 4C0BA 3PUXA 1II8A 2FZ4A 4Q1BA 4PC3A 3EPKA 3MFYA 2JLXA 1LNZA 1OYWA 2IK8A 2WSSA 3QF7A 4BZPA 3U6KA 5FUWA 2JDIA 4Q4JA 1IY2A 2GK6A 3K0FA 8OHMA 1GILA 3AKEA 4JLOA 3GJ7A 3IPYA 3ZH9B 2UZIR 3TUJC 5H8WA 3OESA 1YR8A 2DWOA 1KI1A 1NRJB 1XPOA 2CJWA 4PC6A 1W0KA 5K8IA 3FKSA 2ZM5A 2OBLA 1CJVC 4C0JA 4FXPA 2RCNA 3BORA 2VYFA 2OCPA 4O2RA 3U61B 5J5CA 1R2QA 4Q18A 1II8B 2DFNA 3T15A 4B43A 2JCSA 3X1YA 4L5BA 1Z63A 1E9AA 1QHXA 2DB3A 2J41A 2IS2A 3NBXX 2PEYA 4Q48A 1MRSA 2VBCA 2YNMA 3DO6A 1PVOA 3PUZA 3WHKA 1A2KC 1F2TA 3K0FB 1E79D 1IN4A 4RCZA 5FL7D 2V55B 1ZNZA 1F2UA 2WIAA 4BUJA 2R6CA 4QHSA 1U9IC 3AF2A 3H2YA 4Q9HA 1Q1QA 2ZJ5A 3LBHA 1Q3TA 2CJWB 3GLFE 3FHTA 5JCZA 1GITA 2CHVA 1RRCA 2FPLA 3OE7A 4RZUA 1R10A 4ON9A 3ECCA 3W5JA 3Q85A 1E0SA 4BFYA 3EPLA 1KSGA 1XJQA 1CRQA 3NH6A 4HI0E 3AVWA 2A9KA 4WZAE 3WBJA 1Z28A 4YLGA 5L8VA 2VHQA 1W47A 2GEDA 2RGBA 5EE5B 1SZPA 1BMFD 2WM9B 4UKDA 3L8ZA 3RDPA 1DAMA 1YZUA 2C96A 1ZD8A 521PA 1F2TB 2VQSA 4KU4A 4Q47A 3K9GA 2GA8A 1SKYB 4TN1A 1EFRA 3I62A 3I61A 1F2UB 4IEIA 1KI8A 1MO3A 2JLZA 4B32A 2J9RA 1XTRA 3K70D 1QBKC 4OQMA 3MGCA 5HPYB 2IX3A 4YXWD 2ZSDA 4IDHA 1IOZA 1P5ZB 1KIMA 2NMVA 3CPJB 1P9NA 5IK2A 4C0KA 1HT2E 3HP1A 2ZRDA 3P32A 1D2MA 4TYQA 2WWFA 1NSFA 3TRFA 3HWSA 3CRMA 2OT3B 3TJZA 1S1MA 3ZS8A 1CXZA 4Z1MD 4JSTA 3SDZA 4IOKA 1NJGA 3BFXA 3WHLA 3GQBA 2AL7A 2ZRIA 4RY2A 1NVXQ 2JLSA 2ZJBA 2W0SA 4JJKA 4C0QC 2OILA 1OIXA 4GL2A 3RS3A 2IXFA 2O0KA 5CK4A 4CEHA 1U0LA 2MSCB 1YZGA 1GZSA 2XNSA 1E6CA 3KX2A 5CLQA 4JL5A 2NZ8A 3ETLA 2J0SA 3HR8A 1RPZA 4TZ0A 1YRBA 2FE4A 2ZAMA 3SYKA 4JVMA 3B1VA 1H8EA 4QHTA 1YHNA 3BK7A 5FUYA 3I8XA 5HCIA 1T9HA 5GJCA 3F8TA 4ZI2A 2XOKD 4TLDA 1LTQA 3A1TA 3AVUA 1IBRA 4JLVA 2G88A 1TU4A 2AKYA 4AKIA 4WVFA 1YKSA 1OXSC 1CP2A 1E2HA 5KHOC 3P4YA 4NDZA 2F1HA 3A58B 3LWNA 3KQNA 4CEJA 2TMKA 4H9GA 1I4LD 4NKRA 5EE9A 1J90A 1HQYE 2VPPA 1G6HA 4LGMA 4DLZA 4CEHB 3IDQA 2OLJA 2IT1A 1FZQA 3TAHA 2OBNA 2QMHA 2BCJQ 3CNOA 2XJ9A 3GEEA 4GZLA 1E2DA 1Z6AA 3SJZA 2GILA 3WXMA 2RHMA 3EC2A 4WAUA 4G5GA 3M6AA 1WP9A 3U6BA 2AN9A 3OFND 2A2ZA 3MG9A 3TQCA 2ZJOA 5TB5A 2VHJA 5JHGB 1W36B 2P5TB 2FMXA 4KFRA 4PAQA 3CPHA 4MRRA 3RYTC 4DIEA 4X8HA 4IDPA 3KTAA 5LDDC 3DOFA 4CEJB 2WWHA 2RGNC 5JWHA 4KI0A 5JRZA 4RZXA 3VNVA 4UNNA 1H65A 4RZ2A 3I73A 1NG9A 5FBVB 4M8NE 3T1VA 2BDTA 3TGPA 1G21E 1OIVA 4EPRA 1N5LA 3QPVA 1TF2A 4K81B 5H1YA 2JASA 3UMSA 1MO5A 3BBPA 1W0JD 1ELOA 4PO9A 3W6NA 4ASUA 4LBVA 1JJ7A 2FU5C 1OXVA 3DVLA 5KDDA 4JBWA 4KCGA 4NYJQ 4W5JA 4YC7A 3LVQE 2F1IA 5DNYB 2BJWA 5DYIA 4PZYA 2DFTA 3PFIA 2BKEA 1WGWA 4Q1FA 4WA7A 4B75A 5JS7A 3ADKA 3ONWA 4AYWA 2Z5FA 4DDUA 1U8AA 4AKHA 4GP7A 1DTSA 4BFZA 3KTAB 4M1MA 1NN5A 4JS0A 2HCBA 5FOVA 5JS8A 4GOXA 3KJGA 4TQAA 3AF3A 1RIFA 1JR3D 1EWQA 4I1UA 5FOSA 1G64A 4JLAA 1F5NA 1G5TA 2ZS8A 1Z2AA 5B2ZA 1PLJA 4NYMQ 3EZ7A 2WKPA 4D26A 2BIFA 1AZTA 4FMBB 5C46F 2QT0A 1OH5A 4CT5A 1G7CA 3VHLB 2WWXA 3EIEA 5GJVC 2IUUA 2QP3A 1E2EA 3UK6A 1SXJE 2PJZA 3FOZA 2Z0MA 2GXSA 3ICQB 4BECA 3Q8XB 1VYTA 4LJ6A 2ZYWX 4PFSA 1XZPA 1TF5A 1MO4A 4TWZA 3SJBA 3KKMA 4G5OA 2H57A 1JAHA 1BMFA 2NO9A 2F9MA 1T3SA 3K0CC 4IOLA 5DHFA 2VHTA 1VCMA 1Q12A 5HE8A 5KDOA 1KK2A 3EPJA 4URZR 3LQRA 5HZKA 2ZI3A 4MGKR 1JR6A 2ASEA 2XNDD 3A1SA 1S96A 4KJZA 4Y0VA 3RWOA 4J0QA 1YR9A 2IL1A 2XITA 2VHUA 4AYTA 3BC1A 2RH5A 1CLUA 1CJMA 3HU3A 4Q02A 1NKSA 1AK2A 4FCVA 4FMCB 1EFCA 4FCWA 3LLUA 3WMGA 4DLUA 5L3QA 1Z29A 4XVRA 5EZ6B 2GJ8A 5J47A 5GVRA 3AUYA 3GMTA 3KXLA 1CRPA 2DCUA 4FIDA 1ZUNB 4DSOA 1MR3F 1PJRA 4QG7A 1XWIA 4KBFA 3ZLJA 4IXNA 1CR2A 3Q7PA 2EFGA 4B3FX 4TSFD 2P0EA 4JLBA 5FTNA 2A5GA 2CLSA 3MWJA 4L9SA 4Q7JB 2A5YB 4IDOA 1WF3A 1QG4A 4XVUA 4NYJR 2D7CA 2HF8A 3R8FA 4DLXA 3WRYC 2VEDA 1BH2A 2FOLA 4M53A 3T1OA 3UWOA 1NN0A 3U44A 3ZZUA 4F4IA 1XMJA 2JLUA 2WIBA 2ODBA 2QRZA 4PANA 4UJ3A 3ZYCA 4UXIA 1G291 2CMKA 2W83A 3AH8A 2ZS9A 3I3SR 4QJ3A 1T8UA 2CVHA 2FDCA 4TYYA 3FFBA 4HUQA 2HYDA 2A3RA 5L3QB 3GJ5A 2BHRA 3H84A 1U90A 2LKDA 3A6PC 5KPDA 5IRCD 5J4YA 5C18A 4C0HA 1HE8B 4HB0A 1AKYA 1UBCA 2CL7X 4NCHA 3SS8A 3RABA 3ASYA 1DG1G 4P4UA 4DEYA 4L9WA 4KSBA 3KB1A 1FTSA 2FSGA 3IILA 2NO0A 1AS2A 1F6BA 1QDEA 1QHGA 4HDCA 4Q9KA 2V7QA 2AWOA 2R8RA 4JLPA 2AD1A 1Z0JA 3RS0A 1ESMA 2YJTD 2JATA 3U44B 3K70C 4M9XA 4HSEA 5EUQB 2OXRA 2J5XA 1E9RA 4R98A 3BB4A 4S2EA 3SNHA 2ANBA 5KPJA 4IFEA 4DCSA 1J70A 5G3ZA 3KJHA 2XTZA 1PZNA 4HUQB 2FGKA 3AUXA 221PA 3OFNA 4B47A 2CLDX 4RJLA 4F92B 2NPIA 1VYUA 3K0SA 3OZXA 2W6ID 4O3MA 4BEBA 4PZLA 2BBOA 4BQSA 1OPXA 3Q7QA 4AK9A 2ERYA 4TYWA 1E1RD 3GD7A 3NC0C 3QENA 2F1JA 4BZXA 4V0LA 1XP8A 4G01B 4ZCMA 5AR1A 4G5SA 3SOPA 4BLOA 1KNXA 4FN5A 4EJSA 3CR8A 4PTLA 2FWRA 5LB4A 4KHZA 1P4SA 2GCOA 4BRWA 1W0JA 5HKKA 5JZVA 1AQUA 4CF7A 3LW7A 3PENA 4R9UC 1ZIPA 3K0EA 5CITA 4B3GA 1G5RA 1TADA 2A78A 2CEAA 3FGNA 1N6IA 4QBGB 1KMHA 1Q21A 2FNAA 2OXCA 5GVSA 1EESA 4K46A 5DIFA 2F9LA 4LYJA 4AURA 4Q1CA 2XXAA 3ZD6A 5CJ2A 4ZDWA 3GPLA 2VP9A 2AKAB 1YJ5A 4TYPA 4QXAA 4KO8A 3PR1A 4Q01A 2XZLA 4TYNA 1O3YA 3U7HB 4WIAA 2ZAOA 1JR3A 3I4LA 4B3BA 4EJSB 1JPJA 1K5GA 2P6NA 1SVWA 4F93B 2VRWA 4L16A 2GCOB 1Z6XA 2CLCX 1AN0A 1OKKA 1GIAA 4W5HA 4TMWA 1JECA 2ZUCA 5DSZA 5EXTA 1XRJA 2N46A 2HV8A 2GVZC 4MRNA 4D4MA 5E4FA 1KMHB 1UBEA 2IC5A 4MRSA 3U4QA 3NC1C 1PLLA 2OSBA 2XXAB 2O8FA 2VP5A 3OF5A 4HZIA 1UKYA 4M1WA 1J7KA 1N0UA 2JAQA 1M1YE 1GTVA 2BBWA 4JLKA 4C2UA 5JRJA 3QI2A 1IXZA 5A4JA 1B0UA 3QKSA 4TT3D 4N0EA 2EQBA 2V1XA 3RSOA 3A4MA 3U7GA 2QE7D 2R9VA 3ZVLA 2JLQA 1G8PA 2RAPA 3B8HA 3AVYA 2XNDA 3OIYA 1QRAA 1DPFA 4ZI3A 2VHCA 2IXEA 3B5JA 1GFIA 3IBGA 3NG1A 2C8VA 3QBTA 2H8KA 3B6EA 2XZOA 2ERXA 1E0KA 2GF9A 3U4QB 3QBVA 1SGWA 4JVSB 2PLFA 2O8FB 1N3BA 2AK2A 5L3RA 2JJ2A 2ZU6A 1SVLA 5CIQA 5LPNA 1DAGA 4OHVA 1CF4A 3VKHA 4UNSA 1G8GA 2V4ZA 3SFVA 5JI3E 3U3OA 2RGEA 2WAYA 2K5UA 3RWMB 4GNKA 1OXTA 4GBMA 4TTRA 2RHDA 3I5YA 3QKSB 4XH9B 2X1VA 1GSIA 5JFGA 5A5GA 4H1UA 2QA5A 1JQJC 3I72A 4P4SA 4EKDA 1VHLA 2ZITA 1SULA 1E9SA 1E4VA 3RLFA 4NCIA 4F38A 1ZRHA 1Q44A 3FWYA 3H86A 3JVUA 2ODWA 4DUGD 1NL3A 4B44A 1LF0A 3B1XA 4QM6A 2R62A 2WTUA 2VP4A 5BN3A 2DWQA 1JQLB 3U3RA 2B6HA 1K5DA 1E94E 1S1CA 3HJNA 4A8JA 3CX6A 4IFBA 1ZM2A 3TUIC 4B3XA 5JWOA 1R7RA 2H7VA 3KQHA 3FE2A 4PSAA 2H1LA 3IGFA 3QXHA 3EA0A 3SI7A 3ZZ0A 4LJ8A 3CH5A 3PEYA 1R0ZA 3NBZC 4Q1AA 2PH1A 5JEEA 621PA 1T5LA 2V6JA 1IJEA 5CB8A 5KSOA 1OFIA 1NJFA 2DY1A 4JLNA 1E98A 2PLRA 3HU2A 4HEJA 2D74A 3O8DA 1XTQA 4P4SB 4QFMA 2CK3D 3CRQA 1G3RA 1TPZA 1CR4A 5EQTA 2YZ2A 3N2EA 4X8MA 3ZQ6A 3IEVA 2NPFA 3RANA 2VP0A 2PL3A 3V4FA 2KWIA 2CE7A 1W49A 2JIZA 3M4YA 1LW7A 4LHYA 1UM8A 1OIWA 1S4QA 3RS2A 4CT4B 1KHTA 1FQJA 3IIKA 1LVGA 5CYOA 3P26A 4A8JB 2PZGA 1W4BA 3IUYA 1Z08A 3CRW1 4PHFA 2H5EA 1NNEA 5LD2B 4ZCLA 2EWVA 3MJHA 1IY1A 4V0ME 1EK0A 3MWKA 1E1RA 1I2DA 4LBZA 3CRRA 3KDSE 3HR7A 4JYBA 3N5CA 1G18A 1T0HB 2FZLA 3BFKA 3E5HA 4TLBA 2XB2A 2RGXA 1IQPA 4LK2A 3GFTA 3VFDA 4QGGA 1EWRA 3QIAA 3CB4A 1RYFA 5CB6A 4TMXA 4DCNA 1FP7A 1CR0A 2HYIC 4A82A 3IQWA 2XSZD 2G0NA 3FYHA 1SXJD 3RRYA 1QHNA 1U9IA 4LBYA 5DLQC 4IRUB 5EE0A 1M7HA 4DLTA 4U02A 3PUYA 1NVWQ 3GP8A 4QC2A 4YMWA 3R7WA 1SVOA 1XEWY 4QJ5A 5G3YA 2QEQA 1G3QA 5KYKA 3ND9A 3ZDQA 1G16A 4XD7D 4XIGS 5FBLB 5J40A 3TW8B 1KKMA 4BFUA 3TKLA 3PEWA 1ZCAA 1W4CA 2EFDB 2MSDB 3REFA 1ZYUA 2QNRA 4UXHA 4OI1A 2NG1A 3GLGE 3QNUA 2QN6A 3B2EA 5EZ5A 4QNMA 5FUVA 1PV4A 1DBSA 5JMTA 3J81k 3LX8A 1KAOA 3AB3A 3Q5EA 4Z54A 1WMSA 4QBFA 4XTCS 1U0HC 2A5FA 2IS4A 4D0GA 1KYIA 2FJUA 3A8TA 3AF0A 1KO5A 1JXOA 1N0VC 3B13B 4OBEA 3KJEA 2PBRA 3DOEA 1E1QD 2VF8A 3HDTA 1GVNB 4KAXA 3EWAA 4HAUA 4DSTA 3R7WB 4Q21A 2AXNA 2VSFA 4PQFA 1N0WA 2ZRMA 3LO5A 4JVLA 3T1TA 2GJSA 3JZMA 2IYSA 2B21A 2D2EA 3CX8A 3KUCA 1OFUX 2O5VA 3ZGXA 3ZVMA 5SZJA 1VHTA 2LKCA 3RC8A 1NVVR 4HB4A 2CNWA 2X2FA 5BWMA 4QOSA 1XJ0A 2ZPTX 5FOWA 3BOSA 2A7QA 4WOPA 2QRNA 2ZRNA 2EFCB 2W2XA 1OSNA 4Q4JB 3OEHD 3KXKA 3WYGA 4LX0A 1IM2A 4P33A 4MUAA 4QNRA 1XXHA 3RHFA 2IYXA 3RS4A 5FH9A 2OFXA 1JB1A 4GDFA 2QZ4A 1MOZA 3FPAA 3PITA 1FMJA 3WP1B 4MGZR 2OM2A 4WZBE 3W5IA 4RFSA 5HZHA 2OAQ1 1KJWA 2BCGY 1E9BA 1P3JA 3KFVA 4C7OA 1NSTA 1I4TD 3KFXA 5AJZA 1KZ7B 2P67A 1RRPA 1FTNA 2X19A 4URXR 3GLIE 1IN7A 2WJGA 5FPHA 3TUZC 2FFBA 5EXSA 1H8HD 3CWQA 1RRGA 4BLPA 4HYYA 5DN6D 3SC3A 4LV8B 1COWA 2DPXA 1OH7A 1SVIA 3X2SA 3MCAA 2DFKB 2ZI6A 3T5DA 4DUGA 4DSNA 1GL6A 1R5NA 4POAA 4WW0A 4XVQA 3U7EB 4MUBA 1ZCBA 4LBWA 4PHTA 1G17A 2QU8A 1XXHB 1XD2A 1CU1A 1CJUC 2DFLA 1YQTA 3CX7A 2ZRBA 3BAFA 3V9PA 3ADCA 4M1TA 1F60A 3VX4A 2R44A 2OCBA 1OFHA 4TMVA 1KKLA 1MT0A 4C7OB 4ILEA 4OL0A 2QQ0A 5JJKA 1UKZA 3EC1A 1NLYA 1DAKA 5K8TA 4NHOA 1N25A 2ZRJA 2IYZA 1F3OA 2GETA 1M8PA 2IW3A 3BERA 3GLHA 4HDOB 4XJXA 721PA 3L43A 2Q9BA 5GADl 1E96A 2UZ3A 4ZKDA 1OB5A 4QGAA 3K0AA 1RC8A 4M22A 1FW6A 1N6PA 1G3IA 1IAQA 1NF3A 1YR6A 2QGNA 2RGNA 4BZQA 2BM1A 1W48A 1D8TA 2C2HA 3QG1A 1Z0AA 2OAP1 2RGAA 1L2TA 4B71A 1XD2B 4GI7A 2IYLD 3W6PA 2OG2A 2VSOA 1ZD1A 3AVTA 2LWIA 3LX5A 3GJXC 5KSZA 1AKEA 1Z6TA 2XAUA 1NN3A 5AUNB 3ZQJA 4ERNA 4YMSA 1XEXA 1ZM7A 1CEEA 1PLKA 3EXAA 1YE8A 3L2OB 4CVNA 1NBMA 1N6HA 2YOHA 5J4KA 3QVUA 1E4YA 4YMUA 4XWAA 4TTQA 1KY3A 3T61A 2IWHA 4MYHA 4JBYA 4OQNA 3GLHB 5IHPA 5EJEA 1HE1C 4GOJA 4IW3B 3X1DA 4YQFA 3K0AB 3WRXC 2FG5A 2FN4A 4O2LA 3CUEF 4JT2A 4D0LB 5FPYA 2ZSFA 5JCPA 4ZKEA 4Q1EA 4A2PA 1SKYE 3RAPR 1ZC4A 5AJXA 4PZZA 4PQYA 5EE3A 5SZKB 3NVAA 4HATA 3M0EA 4MH0R 4EPVA 5FPSA 4P4TA 3AQ4A 3I5XA 1A1VA 1ZUHA 1MKYA 1KTVA 1M7GA 2OZEA 1E2FA 1WXQA 1XMSA 1XPRA 3IPXA 2ZUDA 3BH0A 4LPKA 1IONA 1P62B 3OEED 1V43A 4XD7A 2IYYA 1P9WA 3SE0A 2B7BA 3NXSA 1V5WA 2FEMA 1E0AA 5G41A 3E70C 2J87A 3LRPA 2OFOA 4PQRA 4HB3A 4Q4LA 3U3JA 1TQ6A 3EASA 3T06B 1US8A 4B48A 1E2PA 4NZYA 4WBSA 1P72A 1G4UR 4MA4A 1UKVY 1T6NA 4H1VA 2JJ1D 4IHQA 4JL8A 1MRNA 3GFPA 1IN6A 3UMRA 3C15C 3K0CA 4FMDB 1U81A 3AVQA 1BIFA 1Z83A 2VLIA 4Z8XA 2PZFA 1GNRA 1XDBA 4BRUA 1AGRA 1G8FA 2P6UA 2G83A 5B57C 5SZHB 1E1QA 3MAAC 1KY2A 2OBMA 4TL8A 4BLRA 1BOFA 2CL0X 1JXMA 5CYPA 1XTJA 2ORIA 1I2MA 3LNCA 5AUQA 1I4DD 4BASA 1N6RA 1VG1A 1CJKC 2B8WA 2QAJA 2LCFA 1U94A 1KI3A 1S0UA 3FMOB 2J7KA 4X8LA 1OXXK 2ZI7A 2QPTA 3R9WA 1A2BA 1OHHD 1US8B 1P60A 1E9EA 4PSVA 5JBQA 3LA6A 4ZDIA 2R6AA 2ZYTX 3HYRA 4HLDA 4RZ3A 2P5SA 1LS6A 4OQFA 3C14C 4I1SA 2QSZA 3DDCA 3UPUA 4MKFA 2WJYA 1DADA 1XZQA 5EP1A 3B85A 5CDFA 1E79A 5FL7A 4RKFA 3EARA 4IOJA 1E2MA 1MV5A 1SXJC 2QTHA 2IYRA 1NLFA 2ZE5A 1E2QA 3T5GA 4KFUA 1AZSC 5JJLA 1TL7C 5C2JB 1SHKA 1G7TA 3ZVRA 1CKEA 1OV4A 1G19A 3KZ1E 3GJ3A 3LD9A 5D3QA 4DIDA 1NIPA 1KO7A 1UADA 2G1JA 4C9BA 1H8HA 3RC3A 1XJCA 3CR7A 1OXUA 3EWSA 2C77A 3QEOA 3U3KA 2FPMA 3V4RA 2BC9A 2ORVA 1Q57A 3EAQA 1M2OB 4Q00A 4BLSA 4EDHA 3C4JA 4DDTA 2JLWA 1XCGB 2ORWA 1HT1E 3C5CA 4KVGA 4B3DA 4P0TA 1GOTA 5G40A 2FGJA 4OKSA 3BB1A 5FI1B 2BEKA 2Z83A 1KZGB 2ZE7A 1IN5A 2UKDA 3P27A 4M1KA 2AD5A 2VIIA 3B9PA 4AG5A 4XWKA 4YXWA 1OJLA 4LSGA 1BYUA 1RJ9A 4HUTA 2AHOA 2RGGA 1AS0A 2R6DA 5C4GB 1Z06A 5KU1A 1DO2A 4IKEA 4C0LA 2ZTSA 3THYA 4UNPA 4JLMA 5HE9A 1TTTA 3TBKA 1E2JA 2QMUA 1W44A 3NDPA 5H70A 2PZEA 4Z1MA 4NH0A 1VG8A 4OQLA 4URVR 1KK0A 1XTIA 1KJYA 5LBIA 4G0NA 3ZJYA 2AWNA 4W9MC 3RS5A 2OUKA 1ZNWA 2ZRHA 3B82A 2FV8A 3ZZTA 1EX6A 1WCV1 4HLUC 3IIJA 5ANRB 2ZR9A 1ZU5A 3N2IA 1GP2A 4C4PA 2P3SA 4YDHB 5FTLA 3K70B 1G7RA 1T4GA 4LV5B 3TSZA 1RJ9B 4RCYA 5DH9A 3ZVNA 1UFQA 2EYUA 1Q1ZA 2WBLC 2DYKA 1KMQA 5TV2A 1G5PA 5AUPB 1AM4D 4FINA 4CGZA 4DXAA 3GEIA 1SVMA 2HJGA 2XOKA 2GKSA 4TQ9A 5FFMA 4D81A 2E9SA 3BJIC 1ZM3A 4US2R 2V8OA 2ZRAA 4B34A 1TUEA 1ZNXA 4NPHA 4KLZA 3T34A 2CL6X 4OQXA 5HTKA 5BQ5A 2CHQA 2ZXUA 2ECKA 2QBYA 4DCUA 4JSYA 5P21A 121PA 2I4IA 4GSYA 4NYMR 1RRFA 2BMJA 4US0R 2QROA 2X2EA 2R65A 4A2WA 2IUTA 4HAXA 4UNRA 3W8NA 1L4YA 2C98A 1R6BX 5FUXA 1LV7A 4AY2A 5DGXA 2O0HA 3A4NA 4O25A 4OJQA 4KSCA 3PIRA 3TQFA 3QPWA 3R9XA 4NMMA 1VMAA 1HURA 1M7BA 2YWEA 4HLQB 3THWA 4EIWA 4LJ9A 3QXJA 4V02A 3VMFA 3OEEA 1KDPA 3Q9LA 5FOTA 1Z07A 2GJAA 3MWLA 3VR6A 2F7SA 5FL3A 3DM5A 2ZSBA 2SHKA 2WVJA 2QBYB 4OHXA 3OIWA 2I1VB 2F55A 3E2IA 1D9XA 1Z47A 4A6XA 4A0FA 2QSYA 3SYNA 5H68A 3O8BA 1FQKA 2F1RA 3U2QA 3HPQA 4L15A 1GAJA 4DHEA 4M9SA 2J7PD 4NTZA 2ANCA 1QHIA 1B23P 3CZPA 2OE2A 6Q21A 3C8UA 4OK5A 2CHGA 3UWKA 1JEEA 3DM9B 2GZAA 2YVUA 1VCNA 3THWB 3E1SA 3A1VA 3AVVA 2W2VA 4XWOA 4QJ4A 1XEFA 5JJIA 1NI3A 1Z0DA 2QMEA 3HU1A 5DHAA 4M9QA 4EUNA 5J4LA 4CDGA 1UBFA 3WNCA 4MQBA 1GDDA 1M34E 1G1MA 3DZDA 2DR3A 1L4UA 1OH8A 2O52A 4Z51A 2Q0HA 4IJMA 2WJVA 3HPRA 3L82B 4D80A 5CIWA 3U60B 1TQDA 1SVSA 4NYIQ 1Y63A 3UANA 3WBKA 4BFSA 5E3HA 4OI0A 4OK6A 3BS4A 1CBUA 2V1UA 4V0OA 1W2HA 4JL6A 3BD9A 2V9PA 2YOFA 1WQ1R 2JLYA 2QORA 4RD0A 2GRJA 4P31A 4LUCA 2I3BA 3QUSA 4PHHA 2PX3A 1LB1B 1OFTA 3U3MA 4JLJA 4RD1A 1E9DA 2V54A 2G77B 4M1SA 2VH5R 1DELA 2J0VA 4BFTA 3TR5A 1ETUA 5HR5A 3LDAA 3TSWA 4URWR 5FOUA 3TK1A 4IXMA 2A5JA 2EYQA 1MABA 1LY1A 2Q3MA 1G8YA 1LFDB 1TNDA 4OI2A 2HJVA 2HLDD 3AEZA 2ZE6A 2C95A 2VA8A 3ICEA 1DARA 1A5TA 4NP6A 2BV3A 2XTMA 3AKDA 3A1UA 3KKPA 4P3YA 3X1WA 2WJJA 3W90A 4CRWB 5EXPA 1DG3A 4LCBA 5E7JA 4LC1A 1E99A 5DISB 4B33A 3AP2A 3PJRA 4MKIA 3UMFA 2REOA 1S3GA 4TZ6A 5DI9A 4IOMA 2O0JA 3VR1A 2YC2C 3AKCA 3BRWD 4AG6A 5IDVA 1KSFX 3L0PA 3WNBA 2V3CC 2W6JD 3LLMA 2GXQA 2QAGC 1FUKA 1P6XA 1MABB 2ZETA 3MWYW 5JI2E 1NKTA 2WSMA 3IEUA 2CXXA 4TL9A 2Q6TA 5D3MA 2EWWA 2BEJA 2WJHA 4TSFA 3Q72A 4LHVA 2REBA 4MYTA 3SFZA 1WBBA 4UQOA 3KXIA 2GZHA 2YWFA 3WYFA 1Z0FA 4Q19A 2ZR0A 2O8DA 2KE5A 4DDWA 1KI6A 4YONB 1TX4B 3NIBA 2IF2A 1CR1A 2NOAA 3CIOA 1XX6A 2RMKA 3KUDA 2E87A 1OF1A 3OE7D 1XU4A 1P75A 4Q03A 4AD8A 4KYUA 2B7CA 2MMGA 2RGDA 4XTRA 1PUJA 1IY0A 3I1FA 4MKGA 4IEEA 4MYUA 2IHYA 1T8TA 1UDXA 3TW4A 2NZJA 3EIQA 5AUOB 1GG2A 5JHHB 1WBDA 4F7WA 5D3MB 4KODA 3C5HA 2EFEB 4DLRA 2AK3A 3FVQA 3UG6A 4B73A 1DVRA 4N3NA 4RD4A 1EFRD 1JR3E 1P2SA 3TR0A 1CJTC 3AF1A 4W5WA 4QBHA 3AVOA 1W7AA 2ZRKA 1BS1A 3VNUA 2J59A 1KI6B 3U7FB 1W5TA 4FI3C 5SZIA 4AYXA 3L0OA 4K8OA 4URUR 4GMDA 4ZDKA 5FPKA 3K9HA 3TE6A 1II9A 1U0JA 1WA5A 2HF9A 3VR4A 4XSGA 3WMFA 5IK2D 2QY9A 2C9CA 4ZPXA 1VCIA 1NIJA 4GPTA 4MGIR 3B1YA 4M0LA 4TLCA 3SBDA 3D8BA 2KBFA 2N1BA 4CZ2A 4WZ6A 4ITRC 3QG5A 2IYWA 1JALA 1XMIA 3BB3A 3EG5A 4CW7A 3JZAA 4PAMA 1ZMXA 1A4RA 1FX0A 2W6IA 2YC4C 2W00A 3AKYA 5CM8B 3OIUA 1RZ3A 3CONA 3D7MA 3BH6A 3HYTA 3IBYA 3FKQA 1W2GA 1Q0UA 5E95A 3CNNA 3PQCA 4AWXA 4B2LA 3KB2A 4PC2A 3BH7A 2NTYC 1X8LA 2J7PA 2IF0A 1P2TA 1ZUIA 2ZRLA 3GLFA 1C9KA 3LV8A 2DWPA 4ZCIA 1N5KA 4F4JA 2ZROA 1H8ED 3W3ZB 2GF0A 4GOKA 4OHYA 3MD0A 2XGJA 4E03A 4XSHA 4C2TA 1W36D 2P65A 1W1WA 5LB2A 1UPTA 3QKUA 1FX0B 1L7VC 3SHFA 3NBFA 3DKVA 3M1IA 2WJIA 4CEIA 2Y8EA 3QXSA 4BFVA 1QVAA 1U2RA 4UXJA 2R2AA 4PO1A 4Q7LA 3GJ6A 1SQ5A 3PG5A 3QF4A 2G9NA 2L0XA 1YRAA 4Q66C 1VYVA 3B1ZA 2VTKA 2XZPA 4EPYA 2GXAA 2AXPA 1Q20A 4U5XA 2QUZA 4MRPA 1LF5A 3LH5A 3KQUA 1RFLA 2FA9A 4QGFA 2QG6A 1D5CA 1G6OA 3GLFB 3ADDA 2A30A 1G9XA 3AV0B 4KVAA 4PC7A 3KKQA 3NWJA 1P9RA 4ARZA 3K09C 2AFHE 4GMXA 3UXMA 1KJZA 2QGZA 1Z6YA 3EPHA 1G4AE 5B64A 1AA9A 4LOAA 2GCNA 2OHFA 2HUPA 4O0MA 1NMYA 1OH6A 5TXGA 3P4XA 2ZRCA 2PT7A 3MMPA 2GVDC 4YMTA 2WMOB 1VKJA 3GJ8A 4TMKA 4CEIB 3DHWC 3SEAA 2PT5A 4JVNA 4M9ZA 4TT3A 2GK7A 3CLVA 2BBTA 2Z6VA 2HLDA 2ZYVX 2Z4RA 1TEXA 2Q21A 2QE7A 2ZJ8A 1KK1A 2H92A 3VR3A 4B2IA 3QF4B 1E2IA 4IVRA 3TVDA 2FX3A 1GRRA 5DI3A 4ESHA 4DB4A 4ZV4A 4ASUD 4R2IA 5FOXA 1T3LA 1ZP6A 2EW1A 4KITB 1IN8A 5BYJA 1FP6A 1OW3B 1G41A 1NLZA 2G6BA 4ARZB 4JZKA 2J46A 2QQEA 3X1XA 2YV5A 2YYZA 3Q5DA 4F4CA 4UJ5A 4A92A 3T35A 3V00A 3WNDA 1W4RA 4LJ7A 2JLRA 2C78A 2W6JA 2R6GA 1XTKA 5BXQC 3B9QA 5BW8A 1C1YA 3GJ0A 1Z5ZA 3I92A 3QVVA 1ZD9A 2ZQ5A 2WICA 4LHXA 4A15A 5F3WB 1VPLA 2VP2A 1XF9A 3FMFA 1W46A 4NL4H 3PVSA 5CM9C 2C5LA 5EP3A 4LZZA 2F3RA 4JKIA 4A36A 1G7SA 4LWZA 4E5UA 3B7GA 5KNBA 4LHWA 5DI3B 3C7KA 3MUFA 1II0A 4A1FA 1OLOA 4Q4AA 3VX3A 2QP9X 4IVPA 5JECA 2W58A 3LW8A 1W4AA 5FR1A 2P6RA 5FBQB 2CCGA 4LDJA 3RNLA 2X77A 4FMCF 3DMDA 2ONJA 4BWYA 2OCAA 2PMDA 2GBLC 3EIHA 3UKDA 4IVQA 2IYVA 2FH5B 1GL9B 5KSPA 3C16C 4RFSB 1G8HA 5FBRB 5FPTA 4TLEA 2GAAA 821PA 1FNNA 2CE2X 4NCNA 1E32A 2EVWX 1QHYA 2QPOA 3EZ6A 2EU8A 4D6PA 3PUWA 3IO5A 1NVUQ 4V0NA 2JGNA 5TMPA 4EAQA 5F98A 4A4DA 5ELXA 2WAXA 2QP4A 4HLCA 1Z8FA 3FB4A 4E09A 3T1QA 2CK3A 2XX3A 4DCVA 1WE2A 3OIVA 5CK5A 2WZQA 3BXZA 3TNFA 4Q4AB 1QVRA 1HA3A 1FL9A 1X6VA 2AR7A 2PEZA 1ZVQA 2PCJA 3K8YA 5L3SA 3BFVA 5KUTA 1KDTA 3GEHA 2YKGA 4G3XA 3VHXA 1BO6A 2IS1A 2JEOA 2OCYC 2XTNA 3PUVA 1A82A 2MMCA 2D62A 4LYHA 3AVXA 2J0UA 4DSUA 1N5IA 3CPEA 4I1VA 4LV6A 2JA1A 4QGHA 1BKDR 4DLVA 5K8UA 3QSYA 5GJBA 1EXMA 1EG7A 4TTPA 3FDIA 1N6OA 1ZM4A 2I1QA 5HCNA 1UEIA 2PMKA 3FHCB 2HXYA 4LYAA 2GZDA 4N1AA 5B30A 1E9FA 1R4AA 3AP3A 4D4KA 1RW4A 1YZQA 3REGA 1Z2CA 1X86B 3CM0A 1YU9A 1HUQA 2CBZA 2H17A 4A0RA 1XCMA 3TAUA 3UG7A 3F0TA 1O87A 1Q1EA 2RGCA 4D25A 4ABYA 5L3SB 1OT3A 1X8JA 1RE0A 4DVGA 3F5FA 2NQ2C 1NMZA 1VDZA 1G3UA 1XXHE 1FUUA 1VCOA 3CNLA 5C4MA 2FSIA 2IXGA 1KO8A 2XSZA 1SXJA 1TF7A 4CYMA 1R0YA 2GNOA 2D06A 4AKEA 3QEJA 2BBSA 4WXPA 1XEXB 2FF7A 2J0UB 3G82C 3KKNA 2FFHA 1N6LA 2ZI9A 1P73A 3CO5A 2Q9CA 2BM0A 2JLVA 1E2LA 4Q4HA 4DZZA 1HV8A 3BE4A 4DWJA 1YR7A 3BIFA 1EX7A 1NMXA 4R7ZA 4DEXA 1LS1A 2V7QD 2HDNB 2NO6A 3SR0A 1P61B 2GXUA 1M6NA 1D6JA 3SQXA 1Z0IA 4U00A 1UJ2A 3AM1A 1Q3HA 2ZJAA 4MDFA 3VKGA 4I81A 2W2TA 2WPDD 3W3AA 4BE7B 3L8YA 2HEIA 2IBMA 3EZFA 5L3VA 4OYHA 3PXGA 2D7DA 1QF9A 3A4LA 1J99A 4EFLA 3SJAA 5J4HA 1SXJB 4KV9A 1U99A 4HZUA 4XOIA 4B35A 5M04A 4P32A 1UKEA 4Q1DA 1TAGA 3FMIA 5KNDA 5F9HA 1U8ZA 1QG2A 4X8OA 2WOJA 2VL7A 4GP6A 4OHWA 2PJRA 4Q4HB 4RD6A 1VIYA 2OLKA 4MKHA 3NEJA 5UKDA 4DT1A 4AI6A 4ZIRA 2C99A 1R5BA 2AX4A 3GLHE 3T12A 4DDVA 3IHWA 1L8QA 3DPUA 1KI2A 4NBSA 2GDJA 4BPBA 4R71A 3NDBB 4LC0A 5HKKD 3LQQA 1QHHA 1XMVA 1ZC3A 3NHAA 1FOEB 2ZIAA 1JBKA 3OEHA 1D2EA 1N6NA 4HB2A 1KO4A 1TMKA 2CDNA 4BFWA 3B60A 4HLUA 4HZUB 5BN4A 4RD2A 4AKGA 2IA5A 1VTKA 2GWHA 2ZSAA 4G5RA 1GKYA 1W36C 1JEDA 3K9LA 3S1AA 4M2LA 5EUMA 5AWFC 1DAEA 2IHBA 3C41J 4FWTA 1NBME 2WKQA 1ANKA 1SKQA 1J8MF 2ZS7A 4PAOA 3CWZA 3KQKA 2GEVA 2B92A 4DT1B 2EFHB 1T0JB 5KSYA 1GUAA 1N2CE 2F3TA 3DZ8A 4I1OA 5EE1A 4EFNA 4ZIRB 2ZSEA 4GT1A 3WYAA 2O8CA 3LAWA 2ONKA 1ZW6A 1UF9A 1JPNA 4I4LA 2RB4A 2QT1A 5DN6A 3TMKA 4MDEA 2IS6A 1E3MA 4PPNA 1OKKD 1IJFA 3MJRA 1F48A 4DLWA 1QHHB 4C0AC 2OESA 2KBEA 4OI4A 2QL6A 3IHLA 2FFAA 3F3YA 3PCRB 5JWRA 3UIEA 1AS3A 2IYQA 2YWHA 3H0KA 4JLDA 3AVPA 4V03A 3D6TB 2F43A 3UATA 3RSLA 3ZIAD 5F9FA 2QTFA 1TUIA 2Q9AA 3S1AB 2WV9A 4JBXA 2ATVA 1TQ4A 4C3ZA 4DJTA 4ESVA 3AP1A 1XBTA 2P2LA 2WWGA 3H1TA 1A7JA 2Z43A 1KI7A 3SN6A 4ACBA 1W5SA 2H16A 3VU9A 5FTMA 4YDSA 4E07A 1CS4C 4ZO4A 1RKBA 1EGAA 4PPFA 2RKOA 5CLLA 4CIDA 2KJQA 3PV0A 5C1BA 2ODNA 1KOFA 2O8CB 4HAYA 1YZKA 3W34A 2WWYA 1ZJ6A 3FMPB 4KFSA 1VECA 1UEJA 2C9YA 2IEYA 2Q3HA 2R6FA 2YWGA 3G0HA 3NH9A 5B58C 2DHRA 2ZJ2A 4DLYA 4Q7KA 3ZS9A 1GRNA 4JYCA 3KL4A 1XB2A 1EFUA 2ZE8A 2QI9C 3NHBA 3TLXA 3R20A 5CJPA 5KO2A 3EA5A 1XPUA 2F43B 2D3WA 5BN5A 3I8SA 2JJ2D 3P20A 3RS7A 3IIMA 3KQLA 3BGWA 2UVQA 1KDOA 3Q3JB 4EPTA 3QXXA 3NKVA 1FFHA 4II7A 3VU9B 2YOGA 3RRZA 2WHXA 4DKXA 1E2GA 4GZMA 4A0GA 421PA 3THYB 2V6IA 1VIAA 5AK0A 4QL3A 1Y3AA 2OFWA 3PEUA 1NP6A 3X1ZA 1OE0A 4TQUS 1N6KA 1DAIA 4URYR 3GFOA 4RVCA 1UBGA 5EP2A 4B6EA 4LI0A 2GHIA 1SVKA 1QHSA 1D2NA 1ZINA 3O8RA 5G53C 3N70A 1NG1A 3KJIA 1CTQA 4L4UA 5CDFE 3SHWA 4JKYA 3QOFA 1XD9A 2QMOA 1AQYA 3QJYA 2IWRA 2C04A 1ZIOA 2XB4A 4EFMA 5FTJA 2WWWA 2QENA 5JLJA 1R0WA 3THXA 4R2HA 2G0TA 3EZ9A 4C0SA 4OK3A 4Q5IA 1FPMA 3CH4B 4FD2A 2VSXA 4NONA 3H4MA 2G1KA 2XJ4A 3TSOA 4MGYR 5TVKA 1HYQA 2QPAA
chains in the Genus database with same CATH superfamily
4NU0A 5AJYA 1TFRA 1E89A 1BYIA 4IXDA 5C8YF 2AFIE 2ZVQX 3M8KA 1EQ1A 3JTEA 1CZOA 1HMPA 2PNJA 2FZEA 4IV8A 3TH5A 5CYFA 1NW6A 4WADA 5CJJA 3G5UA 2ZT7A 2PBZA 4WL0A 3WWOA 4S1PA 3MOSA 1T6QA 3RHZA 3A37A 2QAGA 4WK6A 3E9EA 1TEVA 2LIGA 4C4OA 2X5NA 2PH5A 3KL2A 5FO0A 1LCIA 2BGGA 3CLUC 2D0DA 1ZK1A 3K05A 4EARA 4BJ6A 3RTCA 3D8NA 2KGOA 1VKNA 3GCGA 1C4XA 5IH3A 1TO6A 1TQ2A 2NUPA 3R5FA 1JJVA 1L5KA 3QUTA 2JDID 3EUAA 3NAMA 4AY5A 1LTHR 3ILXA 4C7BA 3KAJA 1TLTA 4EUEA 1XTTA 3QX7A 4ARCA 4FC6A 3T3GA 2VUUA 4HQRA 1NXVA 1LDEA 3MRSA 2X8AA 3UB3A 2CDAA 1ZCJA 5KYWA 3DBOB 2ZB3A 2VP3A 4TKVB 3CUKA 4LY0A 5IMBA 5JYCA 2B36A 4U7DA 5TY0A 1OYYA 1Q0KA 5FUMA 1A98A 1VG0B 3EVGA 3L7DA 3PI7A 5FBWB 1PWHA 4FN4A 4WXRA 3CF0A 2QTTA 3L1HA 1QGZA 5MHTA 2J3EA 3AM3A 3H3JA 3R2PA 3K09A 2ONCA 1GM5A 1E8DA 2A9QA 3GLGB 1TU3A 1POWA 5JS1A 2UUOA 1ZIYA 3COSA 4KH1A 1NVVQ 3I1YA 1Z0UA 3TEJA 2BMFA 1NBBA 4LAFA 4X7MA 1RHQA 4GI2A 3VQTA 2C4UA 2HW8A 3TQIA 1PD1A 2FPKA 2Q4RA 2HLHA 2QE6A 2HRDA 2ZR8A 1C8BA 5AK6A 4GAEA 4A8JC 4C6SA 3LZCA 5L0JA 4PLFA 1PJQA 2W2QA 2EV9A 1U7PA 1NX9A 4BO0A 4IIJB 1B68A 1DV2A 2JKZA 3TPFA 2WUFA 3AUFA 1FB5A 4LERA 1FFAA 2PANA 3GUHA 3CE9A 2A5LA 4GUAA 3O83A 2IE0A 4B6PA 3BWXA 1BNCA 3NIWA 4O2RA 1Y1RA 3KWLA 2YBDA 4MPJA 4LLCA 1J9EA 4PBTA 3EDRA 3VXKA 4RDAA 1WSBA 3GCDA 3RK1A 1J7JA 4HDRA 2Z09A 3KQOA 3N07A 1GITA 4J0CA 1R10A 1YS6A 1MA3A 1EVEA 1DFIA 3AVWA 4WZAE 4W5QA 4YNBA 3FSGA 4YCDA 4M88A 5TF4A 2AG5A 4EB0A 3K9GA 2P4SA 5LXTB 3I61A 3K0HA 2C2BA 1JF8A 5JAIA 5DHRA 1O0BA 3MGCA 3EMKA 3VR4H 3BXPA 1KZYC 4BVGA 1T10A 3NT4A 1CQWA 4IILA 1Y1SA 4IXWA 3WHLA 4YRSA 2PA0A 2NUTB 1G8SA 4L3VA 2O2XA 1TWGA 4TZ0A 4MUJA 5ALEA 4JVMA 3MINA 4XCVA 4EF5A 3WDLA 2QD4A 3AR2A 1R74A 3T3NA 2JLAA 4F5DA 4UU8A 4H9GA 1JFFA 3FJOA 4LGCA 1Y9DA 4DA9A 3KT8A 4IZOA 4HMOA 5AXBA 5J1TB 2HN9A 3W2TA 2XJ9A 5K0JA 2HMWA 2F3SA 1YE5A 1W36B 5TX7A 4KFRA 1A7KA 1CY4A 4DIEA 2LSEA 2WWHA 2O2SA 1CVLA 1XZKA 1A8QA 4QRIA 2HV6A 2MR6A 4EPRA 1JQEA 2V7PA 4K81B 2YXBA 1NULA 1ELOA 2CWWA 2OV4A 3I6QA 3B89A 2QLJA 2B8EA 4CM3A 1J2YA 3PFIA 4B6IA 2BKEA 4Q1FA 4QO7A 1VE6A 1X94A 4DRXA 4LN1A 2G06A 3KJGA 2ILVA 2NVOA 1D2RA 1QK4A 4I1UA 2XL8A 1NQAO 1XAHA 2O3TA 3H8SA 1D03A 2XUKA 4J1SA 5GJVC 3NHJA 1N0IA 3BCUA 5CFRA 4ZXFA 3EVEA 1MO4A 4LNUA 1EVZA 1RXQA 3T5PA 2BFBA 2PZAA 3KQQA 1F8GA 2R7WA 4EY8A 3EPJA 4EUFA 2X0FA 1EJ2A 3WLTA 3JQBC 3SCZA 4BX9A 3RD5A 5ES4B 1YDFA 1Z29A 4S0XA 4AMUA 5EZ6B 1EUDA 2IOHA 3OP1A 2BFAA 2OXEA 3FSRA 1MR3F 4U2FA 3ZLJA 2IZ7A 3UXEA 2VDNB 5EEHA 2FOLA 3JQQA 4F4IA 3QMMA 1IJKA 2W70A 3O38A 4XLZA 4QAQA 1YMQA 4I2NA 4I0WB 1N9ZA 3NONA 1MC4A 3NHYA 2QRJA 3FDFA 4RA9A 1PT7A 3HM9A 1HLFA 1VZ2A 4TTIA 2H6EA 1TFOB 3C0KA 5CW2A 3GGOA 2DERA 4Z3OA 3U44B 3A9VA 4HSEA 2W48A 2YMQA 1W25A 1FVFA 1K04A 4RMIA 2XWSA 4KQ1A 3NORA 4O3MA 3ZK7A 1KU0A 4BZXA 1LGYA 3IAFA 3OJCA 4AWBA 2QWXA 3V7FA 1P4SA 3KSAC 4B87A 1WEHA 2C97A 1NQXA 3GPBA 4AZTA 3ATPA 5DKFA 4XGIA 5C34B 4R1OA 4LW8A 1LK5A 2YHIA 3RU7A 3WLEA 2J8ZA 3U7HB 3IAAA 2YH2A 3ZXUB 1V4AA 3EGCA 1IU9A 1PDWA 2IC5A 3HXKA 4CKBB 1YS2X 4C2UA 4JY7A 3RSOA 1R9MA 1X1AA 1QR6A 3WGVA 3VNQA 5EJ2A 5JNWA 2HU2A 2I8LA 1T0IA 1SGWA 3LC0A 3QOYA 5AVOA 1A4UA 4QG3A 3ODGA 4M8IA 2ZD9A 3I5YA 3VTFA 4XH9B 5J43A 1LDYA 4QGSA 3I72A 1TTHA 1EFKA 3PVCA 3UT5B 4MGEA 4P7GA 1ZICA 3ZWKA 3LDHA 3AIMA 3H2KA 2MWMA 4RVHA 1DIHA 4A8JA 5FP0A 1RAIA 3EIXA 2Q7RA 3FTPA 5JEEA 4P08A 2QU7A 1E5DA 4H17A 2CC2A 2CNLA 1SXIA 3IXQA 3KT0A 2YZ2A 1ULUA 1DKRA 3RANA 2YR0A 2PL3A 4FZJA 1FQJA 4FDMA 1U11A 3NHZA 5JDIC 3F7TA 3W79A 5L7YA 4L51A 2QF7A 2FZVA 1ZPDA 4OH7A 2XZDA 2XMDA 3NYQA 3PL5A 1QLHA 3HR7A 2XB2A 4CDMA 2R1TA 1YI0A 4LK2A 4CT0A 5L0CA 2ACEA 1VQ1A 4TMXA 3D8TA 2VDWB 1SXJD 2FWMX 4LBYA 4IRUB 3JQ9C 3ELDA 4U02A 2WB7A 2FFJA 4C6TA 1G3QA 2HHCA 3N8DA 2IELA 2XXJA 5K0GA 1M1NB 2EBFX 3IKMB 2DUWA 5MFPA 1A9PA 2VPZA 1WZUA 1ILWA 1WMSA 3V80A 3V4PB 4LOHA 1EINA 3PKZA 5KTKA 1JXOA 1Z7YA 2PBRA 3DOEA 1IW7F 4DSTA 3R7WB 4IAOA 2R85A 3HSKA 3ITEA 1VJTA 3SC2B 4K9OA 3ISTA 2B21A 2B30A 3KUCA 1MVNA 4JUFA 3ZGXA 1KRHA 4AJNA 2VA9A 1MT3A 4P93A 4HH4A 1LI5A 1CUVA 3KXKA 2XTJA 1UK7A 1LEHA 2QVLA 4GDFA 1E7YA 5A03A 2CXNA 4BQEA 5JD5A 1H6DA 1W8DA 2P7IA 4P4GA 2OPBA 5LYJA 4CMIA 1ORIA 5JMWA 2VUIB 1GPJA 1VPEA 3NDRA 1DIBA 1FRNA 3IT0A 5FD8A 2BFFB 4P22A 1GTZA 1XL1A 4LDZA 3CX7A 5KVCA 3O92A 4EG8A 5JYBA 1U9YA 3GCWA 1PJBA 4DV4B 1F3OA 4BLWA 1T2DA 3ZQUA 2FP4A 5DNDA 3ROMA 1H4VB 1I9GA 2I76A 1WLYA 3OPVA 4YUXA 3WV4A 3VR5H 1Z0AA 1XEAA 5AJHA 1GYRA 4IARA 2ZDHA 1NZJA 3ON5A 3S7ZA 1KE1A 1PNRA 5TF0A 4PG7A 4PYNA 1PLKA 2Q4EA 2J08A 4AMZA 4AQ7A 1X92A 4PG6A 1Z73A 1JDBB 5A4AA 3GLHB 3S68A 3FUWA 3P0FA 3K0AB 3N0WA 5E38A 5JAZA 2Q49A 2BFEB 5LOVB 1ZHOA 2X4IA 4GE0A 4B81A 1DOHA 5U1PA 3PLAE 1A9YA 4HEA6 4YP7A 5E6RA 4KG7A 3UNGC 3RPEA 5JZOA 1H42A 5E1MA 4DMFA 3EASA 3T06B 1US8A 1P72A 1PZHA 1XZCA 3GFPA 3UMRA 3G6KA 1UZUA 2WHEA 2P6UA 1EFLA 5AK3A 5SZHB 3JQBA 1KY2A 3QITA 4QREA 1N6RA 2B8WA 1O9BA 4GIBA 1OXXK 4BJ5C 2QLLA 3NTXA 4C03A 5D8DA 5HF8A 2QSZA 1OVGA 1Z5OA 3DZAA 2ZE5A 4KFUA 5JJLA 1SHKA 4QGBA 4NECA 3WIVA 3A3YA 1RU3A 1YUMA 4R9VA 3H0CA 1NBWB 1GPYA 1M2OB 2ATCA 2JLWA 3W5BA 4IP0A 3KNZA 3OCZA 3NNDA 1IN5A 1UANA 3RG8A 4MRMB 4UCQA 1OC4A 1JHMA 1XMQB 4S1NA 4IKEA 3HKDA 4UHBA 1IHPA 3E1GA 4WK4B 1CDOA 3PHGA 3DSRA 2JBAA 2QJWA 4GRIA 2PLAA 3DBRB 1Y6FA 2C7BA 3L6BA 4Z9XA 5KNCD 1L1FA 3QKIA 1FJXA 3D6HA 4DVZA 4HTAA 4H0FA 2O59A 1UFQA 2FCAA 4GI1A 2FUNB 3UNXA 5DF1A 4TTTS 5CVJA 1D0YA 3LQKA 4I2VA 2Z2YA 1NVEA 1M5TA 1FIUA 2BHNA 4MQFB 5EZQA 2QNIA 4RTQA 4M76B 5BXYA 1JIIA 4PXYA 3ET5A 3ZW8A 2EDAA 4XEUA 3NP7A 5AQEA 2ZLBA 1HURA 4MUFA 4JP5A 1W73A 3QVGB 3PHHA 5CM2Z 2CZCA 2PO7A 3UV6A 4B46A 1ZHWA 3BMCA 3HNOA 4LTDA 4A0FA 4JUBA 1ISRA 3E22B 3K5IA 3C8UA 4OK5A 1QRUA 3DM9B 1JB9A 2GZ3A 2XLDA 4HDNA 1Z0DA 3HU1A 5DHAA 2WPNA 3IIEA 3RC1A 4ALNA 3EUFA 3DZDA 5LL6P 2O52A 2Q0HA 1P2DA 2E4XA 4B3TB 1SVSA 1Y63A 1SOVA 3AT1A 5KQMA 4MVZA 1AUEA 2I3BA 2LDXA 2XVZA 4XUEA 3DZKA 1GN8A 1ETUA 1OX5A 4WLFA 1MB2A 1C02A 5JANA 2HWKA 1YZYA 1OCEA 1DARA 4D8XA 5HJ2A 5E7JA 5CX1B 5DISB 3SDSA 2X1MA 4ZXPA 1EQ2A 4MIKA 1JJIA 5J2UA 4YLYA 1FNBA 1D4FA 2WK1A 3L0PA 5JDIA 1JU3A 5LLTA 1DU4A 1N5OX 4KMOA 3FNHA 3UJHA 2NSFA 2WJHA 3C7AA 4MVWA 2I7DA 3VPXA 2DGJA 3PGXA 1A0OA 1IPEA 3CIOA 4F5YA 4Q03A 3K73O 4XTRA 4ADSG 1P2GA 4BNZA 1X14A 1E8NA 3JQ9A 3LPAA 5JS5A 3EIQA 2O1XA 4U2CA 2AK3A 1JJBA 4FAPB 2EP7A 1OAKA 2IHZA 3KBBA 3PGLA 4RLHA 2ZRKA 4ZWNA 3ECAA 5C8YA 3G7UA 5BQIA 3UKOA 3WMFA 2R7SA 3PGJA 4MVJG 3SBDA 2CMDA 3QG5A 2NZUG 1SCDA 4PCAA 1Z39A 4KUEA 3JARA 4EG5A 4HUJA 5D3ZA 3VHQA 4TWBA 1TKCA 2GF0A 1RKUA 2IE8A 1TQHA 2UXDB 2HWYA 1W34A 5EHHA 2ON6A 3DKVA 1AB5A 4PO1A 1HTTA 3S81A 3QF4A 1RHMA 2Q3TA 1HTBA 1LK0A 3THRA 3P71T 3AOEC 2AFHE 5DXFA 2PS9A 3VKFA 2CVPA 3ANLA 3MS2A 4X6XA 2YV3A 2BBTA 1FSPA 1L3BA 3K3PA 4LRXA 2W43A 4YJGA 2ALJA 3FCAA 3IH5A 5ALTA 1XMXA 1L7DA 1U9CA 2F8TA 1KETA 3BGVA 3WNDA 4LJ7A 5K3BA 4I6GA 4PWZA 1DCMA 5DNVA 4HL6A 1L7AA 1QX3A 2R8PA 2E55A 2I4RA 2IOFA 3KBOA 4L28A 1XF9A 2YL3A 4D4NA 2JK1A 3VX3A 4F5EA 2YWJA 2JD1A 5JPIA 2O14A 3EGOA 3ILHA 2W2MA 4O4LB 1M2WA 3WZMA 3C16C 4LGVA 1E1NA 3GBPA 4MYSA 1KFKB 3PUWA 1NVUQ 2H51A 4JB8A 5ELXA 3QYAA 1CYDA 1BVYF 1TUGA 2HRQA 1BXRA 3N28A 3PKJA 3MQ4A 4G3XA 4NV3A 2GEJA 3JXEA 3EHEA 5GJBA 1EG7A 1UEIA 4KYTA 2HXYA 1SXPA 3REOA 4BJ5A 5DTJA 4A73A 3CM0A 2GO7A 1PR0A 2N1MA 1ENYA 1HI9A 1VCOA 1M76A 1TF7A 3OQMA 4AKEA 1XEXB 1LSSA 1IK4A 2SKDA 1UC5B 4OUDA 2YFKA 4JJFA 2XM0A 3D3KA 3CN7A 1QU3A 2Z57A 1UJ2A 2CZGA 2JCVA 1H3EA 5FX2A 4M8LA 2HEIA 4X1KB 1M6HA 1J99A 4JROA 3E9ZA 1T0BA 2I87A 1U0TA 3ROEA 4RPHA 1Q77A 1QSPA 4UDYX 3NEJA 4AI6A 2O0LA 3QSGA 1YQEA 3ABIA 4IZ6A 3REQA 1C30B 1I7QB 4GE3A 2NYRA 2ZIAA 1U4OA 4DZRA 4E18A 5B3KA 1C7FA 1JEDA 1TM7E 4HDKB 3A28A 5EUMA 2IHBA 4WT7A 4PYRA 2NU7B 3KQKA 2VT6A 5CFNA 5ARDA 2O8CA 2FZKA 1V25A 3LAWA 1OKKD 1Y6RA 2WZCA 2YV2A 1PO7A 3O8QB 2E48A 3HFGA 4W7IA 5BN4B 1PUXA 6GPBA 4RFLA 2XDAA 2KJQA 2QZJA 4HAYA 4TMFA 2WWYA 5YASA 1WMEA 5F3DA 3OZ7A 4Z4CA 2AKEA 3BXGA 4G7ZF 4GGPA 4PLCA 3T0IA 3TF5A 3K7DA 4II7A 4A5OA 2WHXA 3SYTA 1LVKA 4HY3A 5AK0A 5JLAA 5GM1A 4OH1A 3ID6C 4JC4A 3LUJA 3PNBA 5B53A 1VOMA 1XRNA 4P4NA 1RZVA 4B6EA 3UFXA 3X3HA 1Q95A 1YAJA 1D2NA 5DNAA 3O8RA 3WZLA 2MHCA 2VXYA 1NG1A 4L4UA 3NIDB 2IWRA 3ZHQA 4G7HF 1P4HA 3S29A 1UZNA 5B7NA 4EYQA 3PA8A 1PX0A 4H7DA 2XJ4A 5D84A 3OEYA 3KALA 4D82A 4PZPA 3SZUA 4NE2A 1KWKA 4FOPA 4KO3S 4OX9B 4M60A 4S0ZA 4UHEA 2B4RO 2HIHA 1KVRA 1Z23A 4EY4A 1AUOA 2FSHA 4FYKA 3OAAD 4DCTA 4XTKA 1KSJA 1SD1A 3ZE1B 4JB3A 4AC9A 1QAOA 5DHPA 2DH6A 1V71A 4GSKA 5IKPA 3K9WA 4FFVA 2BTEA 3F6SA 1XLUA 4EO4A 4EPXA 2P0NA 3ASZA 2UU9B 2C2ZA 2CB9A 4U9EA 2PR2A 4K7BA 1IXRC 3B6KA 1NYRA 2BONA 4N0DA 1IZ0A 2FPGA 5K6RA 4LXIA 3WAKA 3U49A 5JSZB 3R0VA 1P1CA 2WSSD 1SHZA 3E81A 4FUTA 3KVRA 5IZCC 1KZ4A 1X7YA 3I9NA 3CMCO 1WXEA 2B5OA 2VAWA 1W0KD 2Z8YA 1O0CA 4RTNA 1ENPA 1RLMA 2HFKA 4K6MA 1A5SB 3SFTA 4B82A 3IQTA 1FX1A 1E60A 3PWKA 3TZQA 3B29A 1OT5A 3TG8A 1V8BA 2N42A 2W0MA 3AF5A 4GPBA 3GK3A 1UKBA 4LJ5A 4BKRA 1J1ZA 1BEUB 3SICE 2HCJB 4JA0A 2EP5A 1ULAA 1XFAA 5B3LA 3QKRA 1C80A 1DKNA 3K2QA 1M5RA 5A3JA 2I2DA 1BMDA 3AOEA 2IXMA 2Z1NA 2XRZA 1FXWA 4KIFA 3FDZB 4EG1A 3DTVB 3K6SB 3FNRA 3W5DA 1DC3A 1Y1LA 4PONA 5LC1A 1KAGA 2OTCA 3CW2A 3IP6A 4JC0A 2P7HA 3AR9A 3ZI0A 5K0EA 3OT5A 3MXOA 4ALLA 2XGGA 1UZMA 1X1DA 2WAOA 4ZVQA 4JYAB 3IQXA 2CVFA 2ZRFA 4F91B 2XGSA 3PLNA 5A5DA 3HR4A 1Z22A 2ZBRA 3GC6A 2ZR7A 4WZBB 1Z34A 1ZH6A 1GU7A 1E6WA 5ICGA 4YMVA 4HQ6A 1ZSYA 3AI2A 1KO1A 1T01A 2XGMA 3AWDA 5LNK1 4PXSA 4B6RA 2PUWA 1ZSVA 3U7RA 3IPYA 2TMVP 4NWIA 1YR8A 3G0OA 2X40A 3DEIA 1P7PA 5BMVF 4UPDA 1JSRA 5J5CA 1II8B 2JCSA 3AL2A 1OBCA 4CLOB 4EJMA 1CVIA 3E6AA 5H0IA 3LPDA 3MF4A 3GLFE 4LWQA 3G9XA 4LACB 2XLVA 1NW3A 2FPLA 1U1IA 2Y1GA 2WM2A 2GFHA 1RJDA 2WD7A 1E3TA 4BJHB 2FR1A 4YLGA 3I01A 2AN3A 2EPMX 2BY4A 2VQSA 3MBOA 2AQHA 3DZHA 1E5QA 4OA5A 4BNWA 1FDOA 2B6NA 5CBKA 2WWFA 4R2JA 3OJEA 5IPFA 3D6NB 1ZNQO 1IOLA 3NOOA 4ETWA 3JSEO 2W0SA 4EOGA 4FGZA 1GZSA 3L0CA 3MWDB 2QRLA 4EEZA 2R5FA 3NEPX 4ZVLA 4CV0A 4LXUA 3UJDA 1HSOA 1EM6A 3EN0A 5IU6A 2J4FA 3ABZA 1PT8A 4DLZA 2OBNA 3DLHA 1FNCA 3WXMA 1TB4A 5D91A 4PFQA 1YDGA 2D13A 3HKBA 4L0CA 2JANA 9MHTA 3QLVC 2VBFA 4BCCA 1AUPA 3J7AC 3TCXB 3DOFA 3DBHA 4RZXA 1H65A 3I73A 5DLYA 2XT9A 1M72A 1P5RA 4PO9A 3VSCA 3MBGA 2WUVA 4JBWA 2DFTA 4CTMA 5EHQA 4RM2A 3EUEA 3QNMA 1WGWA 3KM0A 4TGLA 3ITFA 2A14A 5HK9A 3CR3C 3ZEAA 3AF3A 2XLEA 1EB8A 1F5NA 1ZWKA 1PYGA 1KQOA 4PEVA 1EJBA 2VPYA 4R8VA 2GXSA 1VLZA 5AHKA 4J0EA 2CYCA 2ZZKA 5DBFA 2QDXA 3WB0A 2NO9A 4RAQA 1Q19A 4E0IA 4AP6A 2FP3A 1KR2A 3LQRA 2I2AA 1BVRA 2ASEA 4BMPB 2EJWA 2H9YA 2VZ0A 4Z5XA 4UCWA 2HR1A 2A1IA 3BEDA 3AY6A 4ZVRA 3X43A 4K9RA 3FHJA 2IHNA 3VHRA 4KBFA 1KPIA 3BIXA 3LM8A 3LIIA 3B7WA 4WXEA 4GQAA 4UUAA 3PCXA 3CRNA 3TW6A 3VDXA 1SIBE 2IHJA 4W6ZA 4UJ3A 4F9EA 1JRAA 2EHDA 5I6DA 5L3QB 3PGA1 5A9TA 4UEJA 2JGDA 2FUKA 4JQCA 5HKLA 2A9FA 3VAYA 3P4UA 2BYTA 1O58A 3RS0A 5B6PA 3CGWA 3TM5A 1FYEA 1ZK4A 2BGUA 3C63A 3W3AH 4R98A 4EYEA 4YECA 1J70A 2OZVA 221PA 5IZCA 3JRWA 1AC5A 1H5UA 4DBQA 3ABQB 2ERCA 4H35A 2R66A 4QXPA 2PUJA 5KQSA 4O6MA 5KKNB 5LCXA 1FFEA 5PGMA 4BNDB 1XLTC 5HKKA 2P79A 4FR5A 5CITA 5CIYA 3WGYA 1RE1A 2CEAA 3FGNA 1KMHA 1OAAA 4YROA 4YRBA 2AKAB 4ZAVA 3Q7RA 4AO8A 4PZDA 3NT2A 5L9AA 4WIAA 4AZ3B 1H66A 4JDPA 2W2LD 2ESRA 1DHRA 1S5PA 4H6VA 2XMGA 2HV8A 4MRNA 1SUCA 4QPJC 3P2IA 3HZZA 1JR4A 4EKYA 2E4AA 4M1WA 1GTVA 1BE1A 4DY4A 2I3DA 1RQ2A 1ZJJA 1EFAA 1MJFA 3PU6A 5JZBA 1PCXA 1ZJ4A 2Z8YM 2IXEA 4Y2VA 4S3MA 1GFIA 2XZOA 2G9QA 4ARAA 1EP9A 2CHFA 5C8ZA 2AK2A 3IPLA 5G4LA 1SVLA 2DLCX 1BVUA 3I1IA 1WXHA 4OD0A 3VPGA 5LZ9A 4MV6A 1DJLA 4P4SA 1SULA 4NCIA 1ZRHA 4HO1X 5AP9A 4CV2A 1DAOA 1NUHA 4P54A 1P1JA 3U5SA 2H1LA 4E4YA 3SK0A 3BMNA 4QU9A 3C7DB 4CQJA 5H16A 3VVMA 2BT4A 3CRQA 1P1HA 3ZQ6A 4NE7A 2HV9A 1FLVA 4L2IA 3V4FA 3KVVA 5NULA 3WKCA 1XNHA 3P26A 4XARA 1ADFA 2BR5A 3BG5A 1LBIA 2HJ9A 1E2UA 3WQBA 4LJRA 5F3RA 3EZLA 2A0FA 3PJEA 3LC1O 1TLFA 2RGXA 4G1EB 4JCZA 1EWRA 2Y1EA 2LFFA 2G0NA 5AICA 4RKYA 2QEQA 3ND9A 4CM4A 4DJAA 4BFUA 2MSDB 3QWFA 1L4BA 1ZYUA 1E6KA 4F5ZA 3EFOB 3J81k 4L0DA 3WL6A 2UYQA 1BQEA 3LL7A 2VNHA 1SOAA 2YZKA 1M9NA 3HDTA 4KAXA 2G7ZA 2DX7A 1UFRA 4OXIA 2VSFA 1KAQA 3BMQA 4RANA 2FMKA 5SZJA 4W1PA 5B1AC 1C1DB 4E0BA 5FJIA 5FBHA 5THKA 4YDRA 3RS4A 3S55A 4NAHA 4RDXA 3FPAA 2H31A 1TVKB 3WP1B 3KELA 4L95C 4TTSA 3JALA 5JH7B 4RAOA 2IY8A 1KJWA 2WJAA 1P3JA 2NSGA 1Q16A 3KFXA 3RVMA 4ZREA 2NSHA 3CLTC 1WXGA 3LEVA 1COWA 2O7NA 3W7BA 4Q6BA 4O6VA 5LLDA 3RE1A 2R84A 2FW1A 1ZGAA 2DBQA 4LNHA 2YL1A 5HNKA 4YCLA 3DXXA 3I01M 4DCMA 1SB9A 1DAKA 5LMCA 4NHOA 4MUIA 3QLVA 1FDTA 1JZSA 1Q0FA 1RC8A 1IHDA 4E2XA 5CUQA 3TRJA 2JGEA 1F2VA 1ZN2A 1UC4B 1MNQA 1I5EA 2IYEA 2R25B 3JZDA 2XAUA 4XB6B 5CI8A 1KY3A 3AL3A 1I4EB 3R0XA 4WUTA 4NXMB 5I7FA 3X1DA 2P91A 4TVBA 2QHXA 5KOHB 2FQ1A 5FPYA 3I9OA 3AFGA 2V4UA 2VRBA 4O4IA 3TTXA 2XKBA 4XJSA 1P0PA 5TJ5E 1DJOA 2AEFA 2SBTA 1KTVA 1XPRA 3K0BA 3IPXA 1ZMRA 2ZB4A 1BCSA 3SE0A 1N2CB 5SY6A 3GUCA 2ZIGA 4MNTA 1J0AA 3E70C 1U3UA 3PVZA 2CDRA 4B48A 3JATB 2ODPA 3OA1A 4JL8A 1HYBA 3NTVA 4IHJF 1X87A 1GNRA 2JGLA 3FJ1A 3KB6A 1BOFA 1U9ZA 5AUQA 3SXUA 2D7JA 1WSWA 4MR8A 3H2GA 3F1LA 5L4LA 4JJGA 4EZEA 2I4TA 3AB8A 1DKUA 4LWPA 2OGZA 2F8SA 1WOMA 5DZSA 1DOVA 2B1QA 1TMOA 2WFZA 1E3JA 5D3QA 1FY2A 4F2PA 1UADA 3RC3A 2CLLB 1OXUA 1ZHFA 3VH3A 1UMCA 2AFIA 1YB1A 2HHLA 4LZAA 4C7MA 1ACLA 2OQRA 1GGEA 2BEKA 2Z83A 4BBJA 3CNEA 2OQ2A 2R6DA 5LQDA 3DAHA 2J3HA 5HYVA 3K2BA 1T29A 1IJBA 1E2JA 3EOAI 5DLPA 1VG8A 5EEGA 1FJGB 1J09A 1P7ZA 3V3KA 1TQGA 1FW8A 4U63A 1X0XA 1EX6A 1LXCA 3VDQA 1XLTA 4TRJA 4R84A 4G67A 5KZMB 1G5PA 1DWPA 5CVCA 3LCUA 3A6GA 2V8OA 5MFZA 2H3HA 2Y0PA 1U7UA 4UBNA 2D59A 4EO7A 2CV0A 3DCIA 2X2EA 1MIOB 5CCBA 1USUA 2IUTA 1DHTA 1ZX1A 4BU0A 3RSGA 3A4NA 4ZANA 2CUZA 3UUFA 3DF9A 3L8GA 2Q62A 1KDPA 3KYJB 2RC5A 3MWLA 3VR6A 3TSCA 5A7GA 2C9ZA 1YDIA 1UP7A 2N9UA 4F3NA 2J5QA 2PAFA 3D6FA 3IEPA 4NTZA 1PWZA 1IMJA 1B23P 3VDRA 2KQ9A 3FPLA 3SX4A 1AD2A 2F3PA 1JEEA 1UH5A 2IYPA 3ZYZA 4QJ4A 4FDLA 5J4LA 5KQGA 2J0EA 2HNBA 2NVWA 2XNKA 2I34A 2AGVA 3L82B 3CSDA 3T5AA 5E2AA 5E3HA 3OFJA 2XYGA 5IW8A 4H18A 2GN9A 3ANMA 3DKIA 4FONA 2Q1XA 4UD6A 1JJFA 5GMOA 1WATA 2V74B 3WIOA 1JJAA 5LA6F 5E8RA 2J67A 5REQB 3OQNA 3O3OB 4BWFB 3AESA 2ZIXB 2W2KB 2HJVA 1ZH8A 2HLDD 2ZE6A 3OZIA 2AVKA 2PYDA 3PC2A 1XU7A 5EXPA 3EGEA 4UW9A 4LC1A 1E99A 5T8KC 2C5AA 5ALSA 2MHRA 3RVDA 4O1MA 3D6MA 3DCNA 3MFNA 3I2YX 2EWWA 1W5EA 4LHVA 2YDXA 2E5LB 2O8DA 1KI6A 4GXTA 4AD8A 2A58A 1AVOB 3L1IA 1PUJA 3P0JA 5IM5A 2H1OA 1PWYE 2NZJA 1OUMA 3WK6A 1ODJA 4KODA 1URPA 2HFIA 4B0PA 2J59A 4AYXA 1E84A 1UQTA 3WFZA 2X5XA 3QYJA 4M9UA 1P0CA 2AR9A 2H5IA 1XXLA 5COGA 2AUMA 3HB1A 1TZCA 2WSIA 4TZTA 3G1WA 2EBHX 5IJZA 4R3UC 4FHCA 1UM9B 2FJ0A 4I5DA 1NMEA 3KU1A 4ZCQA 5EL0A 2P65A 2AI3A 4WZAA 1LSUA 2RDMA 1QLWA 5AXAA 1HLGA 3TR6A 3F7NA 4R6WA 2INGX 2R2AA 2JFHA 1TU0A 2X9VA 2EPNA 1SQ5A 5A0TA 2ZTHA 4XDZA 4LEIA 3IP8A 3MTJA 1JP7A 1R8JA 4IAQA 3RGWS 3UAVA 4FFRA 4F1KA 1OH6A 4S1VA 2ZRCA 3RS9A 3NKEA 3DHWC 1Q0PA 4YQEA 2GPAA 4JVNA 2Z6VA 5B5SA 1SBTA 5DI3A 5BW6B 2G6BA 1CY7A 1UP4A 2CNBA 4Q9DA 5BOSB 2ZQ5A 4EDFA 5F3WB 1FQWA 4B3MB 1WB6A 3B7GA 4HGZA 1PX2A 4Q4AA 2PKRA 4IVPA 1W4AA 5FR1A 1YU6A 1WO8A 3ZIBA 3A1FA 1ZH2A 4FMCF 2IU0A 4KXWA 5IAAA 3FOWA 4ZZ3A 3CLSC 4HN2A 3C3CA 5AKHA 2ZJ3A 4GL4A 4V0NA 3TDNA 5EIBD 3GVPA 2V65A 5K8JB 1I1OA 1CGOA 4ND2A 5BRNA 1V8FA 4URHA 3J81A 5AHOA 1QQ5A 3RIEA 2DHQA 3LYUA 1FMVA 2XE6A 2OCYC 2XTNA 3NTLA 4GI3A 3RARA 3RT7A 3TDMA 4CKCA 3AR7A 3CU5A 4IQFA 3HNJA 2W6QA 5K8UA 1EXMA 1S8NA 3TSYA 2IV7A 2Q07A 1A9RA 1MJGM 5D1NA 4PIVA 4KIWA 1U7WA 3F5FA 1NMZA 2ZSIA 3STHA 4EHKA 2GNOA 1NXXA 4WXPA 7REQA 2FF7A 2FFHA 3WHPA 4DWJA 1YR7A 1AEPA 1NMXA 2IHVA 4EG3A 2IIQA 4HMPA 3GMDA 4Q3DA 4L7QA 4OYHA 1ORWA 2EIKC 4JGBA 1T9CA 3ESXA 3KSRA 2VL7A 2XQVA 1VIYA 3FSJX 1QNFA 5LIPA 4EKNB 1NXTA 2GDJA 3AERB 4JLWA 3OEHA 5DM2A 2FWIA 4MVCA 1QB7A 3MJ4A 3KEGA 2CYDA 4D45A 4HNVA 2WKQA 1SKQA 1WZEA 3GZJA 3QVOA 3T0FA 2F3TA 3DZ8A 1A88A 3IEIA 3ZV7A 2QT1A 3UHOA 2HJMA 5C5CA 1V5GA 1DJMA 1E6EA 2QL6A 1K7SN 4MIOA 3HP4A 2Q3CA 4MIYA 3CF4A 3WIEA 3X44A 4XZ3A 3IURA 1PEAA 4JSRA 3UMCA 3UOWA 2Y1CA 1YZKA 4ZQEA 1I5OA 2EQAA 3M6WA 4GGOA 3K5HA 2XT0A 1RZUA 1NXQA 3ZS9A 2XF2A 2QI9C 1T8YA 4C0WA 3CJRA 3BGWA 4HVTA 1ETHA 1ADCA 1Y4SA 3VU9B 1FFHA 2E5FA 421PA 4QL3A 2OFWA 4TQUS 3VV3A 2VXBA 1HE9A 3ZCSA 3JD1A 3GFOA 1MX9A 1QHSA 2FQYA 2Q7OE 3IQZA 4ZLCA 4P3NA 3PUHA 4FGJA 1R6DA 2XUGA 3QUBA 1M34B 1IFXA 1TWCA 2BEVA 1CZRA 1KVUA 2CW5A 2GEKA 5TDHA 4INOA 4ZYTA 5E7IA 4LJ4A 2F9FA 3OPYI 2FHSA 1RI2A 4V0KA 4EQ6A 4KYIB 5T8KA 5AJTA 2G5PA 3QVLA 4QARA 4NFLA 4UEQA 3SP1A 2JKYA 1GTG1 3N59A 5IYZB 4F1JA 3THOA 2ZRGA 4BV8A 3CTPA 1H0KA 1RC0A 2J0QA 2PX6A 1Z3IX 3TYXA 3SJCA 3KPUA 2QRVA 5JV5A 1Y42X 4HFFB 3NVDA 1UKCA 3SOZA 1SBCA 2X0DA 5JO0A 3QY0A 2VHYA 3SU8A 5CTJA 3SF8B 3BF7A 1I4OA 2X58A 2R00C 4EK9A 3H6HA 1WKVA 3FOFC 4CTKA 5HKOA 4DADA 2VC9A 1T9AA 3K2IA 2KMLA 1S2MA 1U2EA 3PPIA 2QTVB 4A6PA 2NQ8A 3ZCQA 3IKJA 1AKNA 2EZTA 3A1WA 2EGGA 5DWQA 3AGPA 1NXPA 3VAAA 3VJKA 1AKQA 4L7VA 2VDUE 4FDAA 5IFKA 4DCCA 1XPJA 4JU8A 1NBAA 1QYVA 5ILQA 1ORHA 5DM60 1LS4A 3SPXA 3OU7A 3AILA 4ULWA 3MLEA 1HNXB 3FCUB 3Q0IA 4IQ0A 4OIQF 1WPXA 2LVBA 5IEBA 2P4UA 2O6LA 2JCYA 3OBBA 1K8RA 4DYVA 2P30A 1EGMB 4FSXA 1Z2NX 4QRHA 4YUWA 1K98A 2FPSA 1VP9A 3H6GA 4JXXA 4TMZA 3GT3A 4XGQA 3D2AA 5ILOA 1SBHA 4PK4A 1JG2A 3PXDA 2W4IA 2GRAA 1ZJZA 1PHRA 1XNJA 3WLRA 2X6RA 5FI5A 1XEWX 4IWXA 1ISPA 4LDPA 3RVBA 2NO7A 4Y2TA 2H7VC 4Y6QA 2YDYA 5AKIA 3CUUA 1NR7A 1J22A 4XWJA 1PWXA 3EFHA 4MV4A 4PC3A 3LL4A 1CQZA 5A9SA 3TLAA 1QRTA 3PRJA 3WLIA 2YJNA 1NW5A 4Z7QB 2B4KA 4O2AA 2VBIA 1C41A 3E3NA 3B6JA 4R0VA 2H2DA 2VJBA 5IMSA 3IOCA 1Z63A 2FTKE 3PXUA 3ZJVA 5A6KA 4KBLA 2V7EA 2OA0A 4A26A 1CEXA 3PHBE 4BS9A 3NYWA 2O5RA 3KAQA 3EPLA 2Q4TA 5L8VA 1EXDA 2A1TR 3L8ZA 4Y3UA 1O77A 1J00A 3BXOA 4DDMA 4P36A 4RE5A 1MUUA 5ALIA 3L7OA 3CPJB 3VSBA 4MZXA 4X20A 5J2TB 2ZRDA 4RWZA 4ZEVA 4J0DA 3U26A 2OYCA 4MAFA 3KZVA 1NJGA 3A6HA 3TIVA 3GA7A 3SXKA 4AW9A 1GQFA 4RMHA 3WLMA 3JQ8A 4B0OA 4DNXA 4GWGA 1RKQA 2A4KA 4G4SP 1T8RA 1E6C