1VMAA

Crystal structure of cell division protein ftsy (tm0570) from thermotoga maritima at 1.60 a resolution
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
294
structure length
294
Chain Sequence
MGLFDFLKKGLQKTKETFFGRVVKLLKGKKLDDETREELEELLIQADVGVETTEYILERLEEKDGDALESLKEIILEILNFDTKLNVPPEPPFVIMVVGVNGTGKTTSCGKLAKMFVDEGKSVVLAAADTFRAAAIEQLKIWGERVGATVISHSEGADPAAVAFDAVAHALARNKDVVIIDTAGRLHTKKNLMEELRKVHRVVKKKIPDAPHETLLVIDATTGQNGLVQAKIFKEAVNVTGIILTKLDGTAKGGITLAIARELGIPIKFIGVGEKAEDLRPFDPEAFVEVLLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cell division protein FtsY
publication title Crystal structure of Cell division protein ftsY (TM0570) from Thermotoga maritima at 1.60 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Protein transport
total genus 111
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1vmaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vmaA02
2V9PA 1UEJA 2WHXA 2CCGA 2EYQA 5CLLA 3REGA 2XEXA 5J4LA 2QAGC 4FMDF 3P20A 1BS1A 3FKSA 2C2HA 1Z08A 4CT5A 1E69A 2OXCA 2QL6A 5FUWA 1XD9A 1CIPA 3TK1A 1D9ZA 1OHHD 4BFVA 1YR9A 1JAIA 3B1ZA 4CEJA 1JEEA 5CDFE 4QXAA 1LS6A 2H7VA 4NHOA 1KZ7B 2VO1A 3FDIA 2NGRA 3CRRA 4DRZA 3VU9A 4XWKA 4A2WA 2ANCA 4I1VA 4ZCIA 5FTLA 4OHXA 1KIMA 4JT2A 1G8HA 1OXUA 3R9WA 2J1LA 1E94E 5DSZA 4Z54A 3ADKA 1QHXA 4LJ6A 3KTAA 3WMFA 1RW4A 2IYVA 3JVUA 2ASEA 4JKIA 4HB0A 5TARA 1R8QA 2O5VA 1UM8A 721PA 2GEUA 4QOSA 1I4DD 4N1AA 2VSFA 2WJVA 1EFRD 1Q20A 3U7EB 1EFCA 3M1IA 5BW8A 2FSHA 4OHVA 5CITA 1TADA 3AUXA 1X1SA 2OCPA 3A4LA 2FZLA 4MYHA 5DYGA 2OV2A 3SI7A 2FSFA 3B85A 3TVTA 5G3ZA 4KYUA 5LPNA 4PHGA 1M1YE 5CK5A 2AK3A 3ZYCA 2A30A 2R8RA 1LF0A 1W48A 4G01B 3WRYC 1XEXB 2HXSA 4IKEA 3BORA 621PA 1T5LA 3R7WA 3KFVA 3QY0A 4DXAA 1S8FA 2ZE5A 4FMCB 4HB2A 5JSZB 5EJEA 4HLQB 4TMZA 1G6OA 2NQ2C 2JIZA 4RD0A 3T35A 1GKYA 3ZD7A 4GOKA 4JJZA 3VX3A 2WOJA 4ESHA 1G8PA 1H8HA 4B44A 5FOTA 2HXYA 4B32A 5TMPA 1OSNA 2OCYC 2WWXA 2R65A 1S4QA 4PSVA 4IW3B 1J90A 2O0JA 2BOVA 4P32A 5HZHA 1IY0A 1E98A 4OI2A 3W9YA 1KK2A 2ZVQX 4QKQA 1OXXK 2I1VB 1Q57A 1GWNA 5H1YA 2OUKA 3U61B 3P1JA 5FPSA 3E5HA 4HUTA 2GJ8A 2OE2A 5FL7A 1N6LA 3LD9A 3TQCA 1J8YF 4TMXA 4TTPA 4B33A 2JLXA 1WF3A 4GRAA 1KNQA 3W5JA 4HZIA 2HCBA 1OIVA 4CEHB 2HDNB 1IN8A 4DIDA 2PLRA 3ADBA 3GLGA 1E1RD 3EZ6A 4LYHA 4GP7A 2V6IA 2A9KA 4A2PA 1W47A 3IO3A 1WCV1 2G83A 2ZR9A 3B60A 1ZINA 1NMXA 2C77A 2BMFA 1BMFD 3U3MA 2PT5A 3SBEA 1CJTC 1KI7A 1W0KA 4URXR 5SZJA 1N6IA 3SJCA 1K5DA 1YR8A 3KZ1E 2PMKA 1W2HA 1XCMA 2BCJQ 4JSTA 4NCHA 3SFZA 5F98A 4TYWA 1I2DA 1YKSA 1P9NA 3MWYW 5KNBA 3CH5A 4ZDJA 2ECKA 1QHGA 4Q9IA 3Q85A 2XXAA 3BOSA 2RHMA 5H68A 1JR3A 3TMKA 1V43A 2CVHA 3IBGA 1P73A 5TDHA 4A0HA 2IT1A 2GZDA 5EE5B 4Y0AA 2RGEA 3DOFA 3DM9B 4JLKA 1DEKA 2N1BA 4A1FA 2CHQA 3PEWA 3CWQA 4R2HA 4IOLA 1NG9A 1KZGB 1NN1A 2P0EA 4N3NA 4KITB 1WGWA 3P32A 1YZLA 2QRNA 1VYVA 1ZU4A 3LX8A 3WNDA 4P4UA 5DLQC 3VKGA 4AYXA 1G5TA 3BERA 5L3QB 4N0DA 4LOAA 3WP0A 4M1MA 4DUGD 2BDTA 1KDOA 2GEVA 2CVFA 2YV5A 2CNWA 2G9NA 3S1AA 2W6ID 4HYYA 2BBWA 1ODFA 1F2UB 1HE1C 4C7OB 1JQLB 2CHGA 3SC3A 4RD6A 1KOFA 2JATA 3CF0A 2Z4SA 1UADA 5GJVC 1ZM7A 2FA9A 4NPHA 5F9HA 1U98A 1Q21A 1W4RA 5IF9A 5K8IA 4JLNA 1NVUQ 2EW1A 1RC8A 2O8BB 2QENA 4LV8B 4ERNA 3CRQA 4A4DA 1NVVR 4JJKA 3UIEA 2G1KA 4E03A 1N6PA 2HF8A 2VHTA 4MKIA 4C0SA 5B64A 4Q4JB 3WNBA 1KMQA 2GJ9A 4BFUA 1FP7A 3BBPA 3FMFA 1E9BA 1D2EA 1LVGA 1ZYUA 5FPKA 2OAQ1 1ZC4A 2ZI4A 3ZDQA 2FSGA 3UANA 4ZKDA 2ZANA 2V3CC 4LJ5A 4US1R 2QQEA 3GLHB 2PBRA 2XTZA 2N42A 3MJHA 4JS0A 4C3ZA 3H2YA 2EFGA 2X2FA 3HYRA 4A9AA 4PZYA 1XEWX 1TX4B 1Z6XA 4LJ8A 4NYIR 4AC9A 1KI2A 3VR4A 3PV0A 3EG5A 4L8GA 4BZXA 2IS6A 1FNNA 4RZ3A 1FNMA 3SJBA 4Q7MB 1QHHB 4IDNA 4JVSB 3UKDA 2VPPA 1XPUA 4LJYA 3TGPA 1ZU5A 4CGZA 4WOPA 3WHLA 2BKUA 2QU8A 3AGQA 1W4CA 1NN0A 3BS4A 3L2OB 4O3MA 2IYZA 4NMMA 1GM5A 5E3HA 2GA8A 4Q4AA 5M04A 1ZCBA 3QJYA 5E7MA 3A1VA 4IFBA 4F92B 1X6VA 4V0LA 3CKLA 2E1RA 3D7MA 2ZYUX 3KXIA 4M9QA 4V0KA 3HJNA 4H1UA 2BBOA 3BH7A 4CVNA 4O2RA 2WWWA 1Z28A 4D0LB 5DN6A 4ACBA 3KQNA 3LQQA 2AX4A 1FMLA 1M2OB 2AHOA 1ZW6A 4BRWA 4TSFD 1U0JA 1G3MA 2IYYA 4OQFA 1E2FA 1I4LD 2E9SA 1NN5A 1CR4A 1EFTA 1XD2B 2G77B 3Q5DA 4MKGA 4YXWD 3NEYA 4NTZA 3MSXA 4DLSA 4OK3A 3U60B 4JVLA 3WY9A 1U94A 3Q72A 5UKDA 3DO6A 3OEEA 2WKRA 4UKDA 4HZUB 5DISB 1X8LA 1KY3A 3RS4A 5GVSA 5HTKA 5KSYA 1GKIA 1IJEA 5DI3A 5F3WB 1J99A 2BEKA 4K81B 2V4ZA 3W8RA 2N46A 4HI0E 2W2TA 3PUVA 3LW7A 1M74A 3KKMA 5EE0A 3VX4A 2A5DA 3SOPA 4G0NA 2P6RA 1L7VC 3CNLA 3CWZA 2LKCA 3FKSD 1VCMA 4Q1BA 5JWRA 5JMTA 2C03A 1W36D 2WWFA 1J8MF 1ESMA 2ZAOA 4F7WA 2FEMA 4TZ6A 3QXSA 1CR0A 1JALA 2R6FA 4DZZA 3EXAA 2AR7A 3WYAA 2B6HA 2OBLA 2O0HA 4DC9A 1B23P 1TUIA 2ZROA 1CLUA 1DO0A 3PVSA 3WBKA 4HB3A 1FQJA 1N3BA 4KU4A 4PHTA 3EIQA 4EPWA 2Q9AA 4HAZA 1MABA 5FOXA 3UWOA 4P33A 4EJSA 5BXQC 4X8OA 1Q1BA 1E1QA 2QT0A 3U3RA 2QQ0A 4FMCF 3OIWA 4DJTA 1PLLA 4E5UA 1XMSA 4C4PA 3EPKA 2FWRA 1FTSA 3MD0A 5B58C 5JECA 1QVRA 1MO3A 2QE7A 3CZQA 3KKPA 4CDGA 3HU1A 4FIDA 4UNNA 4BUJA 1JEDA 4TLEA 1XMJA 3NDPA 1ZIPA 3AQ4A 4LYAA 5AJZA 5DYIA 4W5WA 2O8DA 2IS2A 3SE0A 3CONA 1A2BA 3I62A 2GNOA 2ATVA 2RGNC 3WMGA 5DO9A 2Z43A 1ETUA 2WWIA 4IDOA 3LW8A 1U90A 4Q18A 2I3BA 4F93B 5EE3A 4LV5B 1MKYA 4G5SA 1ZUHA 2B8WA 2JLYA 2RCNA 3ZVLA 3KL4A 3C4JA 1NIPA 4PPNA 4KLNA 2ZETA 4ZI2A 5JHGB 5AJXA 3RHFA 3KKOA 2JIZD 2G88A 1VIYA 1NSTA 2ZPTX 3U44A 1E4YA 3ZLJA 3B8HA 2B21A 2D2FA 1RVDA 1H8HD 1RYFA 8OHMA 1O3YA 1JBKA 2NO0A 2Z6VA 1SVIA 4FMDB 3ONWA 4TL8A 5C4MA 4D4LA 4P4SB 1KKLA 3KJIA 1EFRA 2GXAA 1JI0A 1YRAA 5EP3A 4GOJA 5HZKA 3THWA 2VP2A 2ZU6A 1P5ZB 2XZOA 1LB1B 1KJWA 4Z8YA 3RRMA 4A2QA 5JI2E 3FGNA 2HYDA 1Q3TA 3P4XA 3IO5A 2QSZA 1WBDA 3LWNA 1G1MA 2ZRMA 5FL7D 2WJHA 3VTKA 1R0YA 1XJ0A 2REBA 4CW7A 4U7DA 1M7HA 3AF1A 2QPOA 4PQRA 1GZSA 3AB3A 4LRWA 4YMWA 1CJKC 5J40A 3I61A 1G19A 4Q4HB 1ESNA 2CL7X 4JL6A 4A0GA 4EFMA 1S3GA 2IEYA 2MSCB 4DB4A 3SZRA 2NO6A 1D8TA 2RAPA 1NIJA 4TYQA 1FFHA 1XD8A 2IWRA 3C16C 4FI3C 1QHYA 2BJVA 2Q3MA 2NPIA 1VTKA 3K0FA 3WYGA 1IJFA 2WSSA 4A36A 4KSBA 3BFKA 1W0KD 4ILEA 4B3FX 5K8UA 3NHBA 4RZ2A 4OYHA 2R6CA 2H8KA 3FMIA 1HQCA 3GJ3A 1OB2A 2C8VA 2YWHA 2X19A 2FU5C 1GAJA 4IOJA 2A5FA 2FN4A 1JQJC 4NONA 4HLUC 1DS6A 4BLOA 1JR3D 1PLJA 4M1KA 2VIIA 4E09A 3CRW1 2CE7A 3BK7A 1BH2A 3B1YA 5JEDA 1R8SA 1VKJA 3CNNA 4AWXA 2C96A 3M4YA 1XMIA 4WBSA 2YYZA 4DLZA 4M53A 4YMUA 3IKJA 3OESA 4TT3A 3WRXC 2DB3A 4BZPA 5J4HA 3LO5A 2IL1A 2JCSA 3BFVA 3CM0A 2QZ4A 2GBLC 821PA 4NP6A 3PCRB 3I4LA 2FZ4A 5BN3A 3AF4A 1U0LA 5EE9A 2CNWD 1SXJA 1W36B 1WB9A 1KI8A 3U5ZB 5SZIA 1U9IA 2QM8A 4KFTA 3UXMA 5LB4A 5ELXA 1C9KA 1G18A 1II8A 3OE7A 4CEJB 2ZSBA 3NIBA 3IIMA 1UKVY 3BAFA 2OM2A 1Z07A 1FX0A 1Z0KA 2ZYTX 3K9LA 4TYPA 4WIAA 4V03A 1ZMXA 1AKEA 1G8FA 1P2UA 3UMSA 5BN4A 2JLUA 3VQTA 2ZRAA 4FN5A 3FVQA 4XOIA 3B82A 5KUTA 4KSCA 2WICA 4TMWA 3ICQB 3VU9B 4NCJA 1T3LA 4LHWA 3B5JA 3EX7C 1CR2A 4LBZA 1NF3A 1US8B 4M1YA 3CBQA 4LBWA 5KNCA 2AN9A 3SYKA 1Q1EA 4NYMQ 2XB4A 5J47A 1ZIOA 1NMYA 1LV7A 4PHHA 4LHZA 1ZBDA 5C4GB 3ETLA 1XWIA 4IVQA 4IFEA 4LC1A 1GKUB 3CLVA 2HYIC 3NDBB 3W90A 3TSZA 4BLTA 1E2NA 4BE7B 3SYLA 2REXB 3LNCA 1KK3A 2BC9A 2J5XA 3U3JA 1E9SA 5J4VA 2J45A 3V00A 1WRBA 1KSFX 1N6OA 2QMEA 2GXQA 3K09C 5CYOA 3TIFA 1YR6A 4AYTA 3FHTA 1FMJA 2KBEA 4F4CA 1CKEA 1BIFA 2A5GA 2IYQA 2JJ2A 2PMDA 2IHBA 1W0JA 2YOFA 5E95A 2YNMA 2QPAA 4NCNA 5FPYA 2WM9B 1UBEA 3DZ8A 1CJUC 3GEIA 3R7WB 4DLYA 1ZM4A 3T1TA 1P9WA 3L43A 4DCNA 3K0CA 5AUQA 2ERXA 4P31A 1A2KC 2AFHE 4WAUA 1VG8A 3TUZC 3RSLA 4R2IA 1KMHB 1MV5A 4A8JC 3QNUA 5G3YA 2OXRA 2LCFA 2P65A 2PH1A 1P62B 1KGDA 1L4YA 2C5LA 2HJVA 1W2GA 4V0OA 3PEYA 2ZUDA 5EZ6B 2AWOA 2NMVA 2ZUBA 3A8TA 1E4VA 1Z29A 2ZRFA 4QJ4A 4RD4A 1P4SA 2B92A 4QHTA 1ZP6A 1NLYA 1QF9A 2JGNA 2XX3A 4I4LA 3ZS9A 1E2PA 1Y63A 4QM7A 1NI3A 3RWMB 3O8DA 4JIMA 2O8EA 1VG1A 4L4UA 5FL3A 2ORIA 3OEED 5FOVA 4LY6A 3CX7A 3B78A 1MOZA 3EWAA 2KJQA 5DGXA 2VTKA 1ZNZA 5EP2A 121PA 1D6JA 2PJZA 1E0SA 3E2IA 5JI3E 1IAQA 1BKDR 3RAPR 1KI9A 2BIFA 1ZNWA 3LVRE 3L0IB 1KNXA 4RVCA 2AXNA 4OJQA 3GLGB 4UXJA 3AVXA 1MO4A 2FGKA 2FG5A 3NHAA 2DYKA 4M9XA 2OHFA 3VHXA 4B3GA 1D2NA 1ELOA 2D3WA 4GOXA 4KAXA 2R44A 3NBZC 4EPRA 2IF0A 5JCPA 1NVWQ 5KO2A 3B1VA 4A82A 1XZPA 1AK2A 2FGJA 3F8TA 2Q21A 3A1UA 3LFUA 4M9SA 1XTKA 2IXFA 3MWLA 2VA8A 1N5LA 3KKQA 4IRUB 4S2EA 4MYCA 1W7AA 1FPMA 1EWQA 2XXAB 3LV8A 2BJWA 4DDWA 2CLDX 3NH6A 3RS2A 1NJFA 4CEIB 1Q0UA 4JVMA 3TJZA 3EPJA 4JBYA 1E1QD 2ZI6A 2R6AA 3AKCA 1XF9A 3GJXC 4YQFA 1P61B 1UF9A 4QG7A 2EFEB 5BN5A 2J59A 3QG1A 4DLVA 3I1FA 3VR6A 4TQAA 2V6JA 4MGZR 2JLZA 1YZUA 3PG5A 1KDPA 2HJGA 1JJVA 1L8QA 1X86B 2QE7D 3RABA 3AGPA 4UNSA 4WXPA 1AS0A 1P72A 3AVTA 4C2UA 4EQ6A 3WXMA 3L0SA 1AM4D 1EFHA 3TUIC 2QRZA 4Q1DA 1KSHA 2F1IA 3K53A 4BQSA 1N25A 1E9EA 1N0WA 4LYFA 1GILA 4BFXA 4DLUA 1RKBA 1JPNA 3QG5A 1TAGA 3VHLB 4AKGA 1OFUX 2PX0A 3A1TA 2ZSEA 3IQXA 5JS7A 1ZAKA 4D4JA 1OXSC 1A4RA 1G7SA 4BECA 2RGGA 2ZJ2A 1DAHA 5FI1B 2GWHA 4DT1A 3KFXA 2IF2A 3QXHA 4NYJQ 4DLXA 2QBYB 2DCUA 5D3MB 3X1ZA 1NLZA 4ABYA 3O8BA 1R10A 4F4JA 2XGJA 1II0A 3AUYA 2EQBA 4G5QA 4NZYA 2JLWA 1DBSA 1GFIA 2GVDC 5G53C 4MRNA 4OJKA 1PVOA 3TW4A 3CPHA 2ZRJA 3ZIAA 4D26A 3Q7PA 3EASA 4GZLA 4HUQA 2GCNA 2GZAA 2ZQ5A 1G7TA 1VHTA 3AF0A 4P0TA 2O8CA 4GT1A 4W7SA 2VP9A 3EZ7A 2ZR0A 3GLGE 5DI9A 1H65A 4GMDA 4Q7JB 4TL6A 3AVUA 1T8TA 2ZE8A 3RWOA 3AVWA 4EPVA 5FBRB 5GVRA 3RC3A 4CT4B 1JXOA 1E0JA 2E87A 2VLIA 4KLZA 5FFMA 1RFLA 2PL3A 3GQBA 5HKKA 4TZ0A 5CJPA 1E99A 4OL0A 2WIBA 1RRGA 1E79A 2ZI3A 2QN6A 3PIRA 3MCAA 4Q4AB 2YC4C 1OXTA 5K8LA 1KO4A 3Q3JB 2IC5A 3TW8B 1Z6YA 1U0HC 5CIWA 3KJGA 4QHYA 1SVWA 2QP4A 2YWFA 1Y3AA 2BHRA 1OH5A 3QPWA 2QT1A 4JT4A 2C9OA 3RRZA 1Q1ZA 1NP6A 5EP1A 2EFDB 3LBNA 4A6XA 3AP3A 2QGZA 2G6BA 2QAGA 1N5IA 2WSSD 1G41A 3U6BA 3TNFA 1M6NA 3ZJYA 3CO5A 3DL0A 4FWIB 1W49A 1Q12A 2GCOA 1W5SA 3X1DA 1G8YA 2CHVA 3W3ZB 3AKDA 4I99A 1P2TA 2HUPA 1H8EA 3B1WA 2VRWA 5FUYA 2XOKA 2ZRPA 4DLTA 1OH6A 3FFAA 5TB5A 4UNRA 1MR3F 4B3XA 4DB2A 4MYTA 1V5WA 2CDNA 4MRSA 4IDQA 4LJAA 2SHKA 5DI3B 2IYSA 1SZPA 1TF7A 3KXKA 4B3CA 2H18A 3HDTA 4TT3D 4ZDIA 1XJQA 1FZQA 1D5CA 1JB1A 2ZI9A 4XTCS 4OI4A 2J7PA 4ACAA 4Q01A 4QL3A 4RFSA 2DFLA 2IK8A 3T61A 1OFTA 4AIIA 3U7GA 1QHSA 1BYUA 4YDHB 2F6RA 1WMSA 4G3XA 1DAGA 3A4MA 4DEXA 4URUR 1SXJD 2VEDA 2TMKA 4M1SA 1CULC 1P60A 2QY9A 4QJ5A 4L9WA 5HPYB 3QPVA 2X8AA 3EWSA 3OE7D 5IHPA 1OFHA 1XTRA 3BB4A 1JNYA 4DLRA 3CNOA 1OE0A 4MQBA 5FTMA 3CW2A 4Q00A 3OIUA 2O52A 5FUXA 2CK3A 3W8NA 2FPMA 2VBCA 1R5OA 3PUXA 2C04A 1Z6AA 2KI5A 1MABB 1Z0JA 5EZ5A 4HAYA 1XEFA 4R7ZA 3DOEA 2WKQA 1TMKA 4EJSB 2GAAA 2XTMA 2QEQA 1DPFA 4LHVA 3SDZA 1QHIA 1RRFA 3A4NA 1GNRA 2GHIA 1G9XA 1Z5ZA 3R20A 4XVQA 2PCLA 5L3RA 4WW0A 2AXPA 2IYUA 4ZIRA 3CUEF 1ONBA 3N2IA 4IVRA 1W5TA 1RRCA 3IEVA 2AK2A 4II7A 4JL8A 4KVAA 4PC7A 1UFQA 2K5UA 3V4RA 1D9XA 3U3OA 2PCJA 3ZQJA 1RJ9A 1VCOA 2H17A 4B73A 4GNKA 3QEJA 2IYRA 2R6DA 3FB4A 1AJEA 4B48A 3VKHA 1WQ1R 1NL3A 3Q7QA 4RJLA 2J0VA 3HR8A 1R6BX 2ATXA 1JJ7A 2XSZA 4UJ3A 2JJ2D 2YC2C 1W0JD 4KODA 5HCNA 2FV8A 1SKYB 3FPAA 3O47A 3QIAA 3UWKA 4UXHA 3M0EA 4RCZA 4IHQA 2MSEB 4L15A 3KJHA 5E7JA 2J0UB 4AK9A 4EAQA 1Z47A 3EZ2A 2C9YA 3D3QA 3W34A 4QRHA 1S2MA 3HP1A 3KUDA 3ZGXA 2VL7A 2QPTA 3BB1A 1ZM3A 1KO7A 4JBWA 4JVNA 5FOSA 4C2TA 1DOAA 1MT0A 3LXXA 4MRPA 3X2SA 3KX2A 4HDOB 1DAIA 3DVLA 1P75A 2W00A 2DFKB 3B13B 4B74A 1IQPA 2J7KA 3GJ0A 3AP2A 4OK6A 4KO8A 2MMGA 3CIOA 5EXPA 3F5FA 4DEYA 1CP2A 1XU4A 1Q44A 4PO9A 3EA5A 2PZEA 5DHAA 1VECA 2ZRNA 2CJWB 1E96A 1GG2A 3AH8A 1LS1A 3MGCA 2CBZA 5CYPA 1YHNA 5FTKA 4M4SA 2ZVPX 1TTTA 1UKEA 2FPKA 3BE4A 3OAAD 2GCPA 1T6NA 4M21A 4CRWB 3KQHA 3LLMA 1NKTA 3L8ZA 1ZD9A 2D7CA 1TQ6A 4TMTA 1Z0AA 1WBBA 5E7IA 3GJ4A 4V0MA 1UDXA 3QVVA 3BD9A 3P26A 2PEZA 3P4YA 4LUCA 4X8LA 3A37A 1YJ5A 3SEAA 3O8RA 1KAGA 1TF2A 3UPUA 3J81k 1XEXA 2J41A 2ZI7A 5KDLA 3C14C 3K9GA 4Q21A 1P3JA 4UJ5A 2ODEA 3GJ6A 4POAA 2XJ4A 3FFBA 3DHWC 2DWOA 2WJJA 5JSZA 4LPSA 1S0UA 4Q19A 1T9HA 2IUTA 3FMPB 3I92A 2NOAA 5GJWC 2XNSA 1MRNA 1SVMA 2PZFA 5CB8A 5AK0A 2FFQA 4J0QA 1GNPA 1C4OA 3MLEA 2BM1A 1G6HA 5IK2A 4A92A 1QG2A 4D0GA 5BYKA 4ZDWA 5JLJA 3NC0C 1R5BA 1NG1A 3RS0A 3EC2A 3GLIB 4XH9B 2YKGA 1SKYE 3ASZA 3DDCA 1E2EA 1J2JA 1HEIA 3ZS8A 4XSGA 4MDEA 1SVSA 3DPUA 3IBYA 2WJGA 1SXJB 4C0AC 3GP8A 2F9LA 2BBSA 2PX3A 3I8XA 3UG7A 2DFNA 2A78A 4G5RA 3T1OA 4MA4A 3I5XA 4YMTA 1II8B 1E2KA 4D81A 4MYUA 1FX0B 3R9IA 4FCWA 1KI4A 4M1OA 2FOLA 5DNYB 4QC2A 3MFYA 3LY5A 3WYFA 4CEHA 1JXMA 3RRYA 3VAAA 1RE0A 3RRNA 3CPJB 1L4UA 1G64A 3AVQA 3BH6A 4PXAA 4JMPA 4Q1AA 3O8CA 1A5TA 2YOGA 3QKSA 1QVAA 2ZE6A 5H8WA 3DEFA 1XTQA 2QTFA 3PQCA 2MMCA 2ZI5A 4KCGA 3QKRA 1E32A 4W9MC 2IYXA 2VH5R 3ZIAD 3QOFA 3SN6A 2ZE7A 4DIEA 4OHWA 1IXRC 2CEAA 1LNZA 4P3YA 5EUQB 3MAAC 4RD2A 5FOWA 4Q7KA 2DR3A 3U2QA 3QF4A 3R8CA 4LHYA 3QF7A 1CU1A 1EWRA 3CX6A 3FWYA 4L16A 3W5IA 5FOUA 2HF9A 3ASYA 5KPDA 1VCNA 1EG7A 2F9MA 3ZVRA 1PZNA 3OIVA 1PJRA 5EP4A 1SGWA 5LB2A 3EZFA 1UDWA 3LAWA 2Q9BA 5HKKD 1SULA 4HAWA 4XIGS 1XJCA 1XFAA 1KI3A 3QUSA 4PQYA 1E79D 3K0EA 2IS4A 1MO6A 3BWDD 1WXQA 2V7QA 1QZXA 1XB2A 3EIHA 2YJTD 3NBFA 4PC2A 2HT6A 4ITRC 5AUPB 4IEEA 4L5BA 4X8MA 5K8TA 1KK1A 1OYWA 3QVUA 4KFSA 1NLFA 3PEUA 3KQKA 1ZC3A 1E0AA 3K8YA 3T5DA 2AFIE 2W2VA 3RS5A 1W1WA 3CH4B 1KI6B 4G5GA 5EXXA 2FEOA 5DH9A 2A3RA 1JPJA 4LYJA 1E2IA 2WMOB 4FXPA 4OQXA 1IXZA 2O8BA 3GLIE 3GLFA 2WOOA 1N6NA 2NO9A 1KO5A 2WV9A 4U00A 1H8ED 1P9RA 4S35A 2IWHA 3ZQ6A 1IN6A 2IYTA 2XOKD 2EU8A 1K6MA 1NVVQ 5B57C 4Q7LA 1R0ZA 3C5CA 3KDSE 4LDJA 1NRJB 2JASA 4DCUA 2J0QA 1SXJE 2VSOA 1KKMA 3T1QA 4NCIA 3LXRA 1AA9A 2P2LA 3KUCA 5J4YA 2GRJA 2A5YB 3WHKA 5H70A 3GLHA 2QNRA 4C0BA 1SXJC 4WXRA 4AG5A 3R8FA 1CBUA 5KDDA 4RCYA 4BASA 1U9IC 5FBWB 4ARZB 2J7PD 4IXNA 1Q22A 2ZITA 1ZUNB 4B35A 1U8YA 4C30A 2B7CA 4GP6A 4LBYA 1NJGA 2F43A 1EGAA 2W2XA 3VFDA 1QG4A 4CIDA 4YMVA 3B1XA 4NKRA 4PPFA 2HCJB 4JLDA 2GETA 3FHOA 2NTYC 1R0XA 4KI0A 1Z6TA 3EARA 4KJZA 3AM1A 1EESA 3MG9A 4WZ6A 5L3SB 1E9FA 1XNJA 5FR2A 1Q1QA 1FTNA 2FF7A 3FHCB 1G7RA 1HT2E 1IN7A 3AVPA 4TLCA 2ZU0C 5A5GA 2ZS7A 2RGNA 2ZXUA 1N6HA 2ZSAA 2CK3D 4NH0A 4A15A 3NC1C 4Q9JA 2P5SA 3REFA 3NH9A 2FSIA 3HU3A 3DKPA 1GOTA 4JLMA 1TF5A 4HB4A 3ZVNA 2DWQA 1RIFA 2G0TA 3Q8XB 5C18A 1KSJA 4TLBA 1U2RA 3B7GA 4JLJA 4R9UC 4EFLA 1XD2A 2NO7A 5EXTA 3QI2A 4HAUA 2CE2X 1E2QA 1MH1A 5FBVB 3U7FB 2FFAA 1VDZA 1COWA 1IXSB 4HZUA 5B2ZA 3CB4A 1BO6A 1G4UR 2ZUCA 4US2R 2NZ8A 1GUAA 1A7JA 1CTQA 5C46F 4FCTA 3VR2A 1N0VC 1J70A 1HTWA 2OZEA 4XJXA 1OT3A 1EX6A 1KDRA 1FW6A 5EE1A 4QFMA 3QXCA 5HE9A 3FMOB 2QORA 4O2LA 4Q66C 4IXMA 4EDHA 2XSZD 5TY0A 3SU8A 4KVGA 4DT1B 1L2TA 521PA 4D4KA 4WA7A 3CRVA 5GADl 2KE5A 3V4FA 1U99A 2IYWA 4JLBA 3UG6A 2OCAA 1QRAA 4BFWA 4C9BA 1CJMA 4FINA 1IY2A 1SKQA 3TLXA 2IXGA 4B76A 3KTAB 3L0PA 3GJ8A 3RNLA 3FOZA 1HV8A 1NVXQ 1O87A 3BB3A 5G41A 1ZD8A 5JZVA 3DZDA 4HUQB 2ERYA 1XBTA 1Z0IA 1DAKA 5KSPA 3AVOA 2FH5B 1OH7A 1D2MA 3A1SA 5TV2A 1KI1A 1E9DA 3AF2A 4XWAA 2ZRHA 2H92A 4PC3A 1XPRA 4A0FA 5KSOA 1AGRA 3C15C 3QQ5A 4C0HA 4PO8A 2WWYA 3LQRA 3OHMA 3PUWA 3MMPA 1MO5A 4QBFA 2NIPA 4HLUA 4PAMA 2QMOA 1AS3A 4AURA 2Q6TA 5KDOA 3IHLA 4QGAA 1E2MA 1KDTA 2JJ1A 3MWJA 1FP6A 3PFIA 1WA5A 1KSGA 3TUJC 2GBLA 2ODNA 3H0KA 3SQXA 1NBMA 1N5JA 3E1SA 4E07A 1JAHA 4BPBA 4TWZA 1OH8A 1BYIA 2GCOB 3RANA 3G5UA 2VHQA 3HPRA 3IDQA 3ZH9B 3WNCA 1ZNXA 4EIWA 1S96A 2BMJA 1GDDA 2QG6A 2VHUA 2ZJOA 4Q1CA 4MGIR 2YZ2A 4GZMA 1OKKA 2WAYA 4FMBB 2O8FA 4AKHA 1HT1E 3X1XA 1T4GA 4KBGA 2QTHA 1DELA 4MRRA 1T8UA 1GVNB 1I2MA 2L0XA 4RZXA 2OFOA 3AF3A 1SHZA 4M8NE 2WMNB 3E70C 1LY1A 4PAQA 4V0NA 1M7GA 4Q9HA 1W36C 5IK2D 4XWOA 3PENA 4HLCA 2QMHA 4P4SA 4Q1EA 3OAAA 4B6FA 1TQ2A 3AVYA 3GJ5A 2JLQA 2FFBA 3PITA 4RFSB 2YWEA 5FTNA 2ZJ8A 2WJYA 2ZRGA 3ND8A 4RZUA 4QJ3A 2PLFA 1LFDB 3U4QA 3W6NA 1UAAA 5GJCA 2GKSA 1Z63A 4KBFA 2XZPA 4ZO4A 3AVVA 1G20E 1DVRA 4KFUA 1IN5A 1TQDA 4OQLA 2WPDA 3EA0A 4H9GA 3T15A 4O25A 1E2GA 2HLDA 1F60A 1A82A 2QSYA 3AEZA 4Q4HA 4JSYA 3OF5A 1DADA 1P6XA 1S3SA 2BVNA 1TQ4A 1AS2A 1OW3B 1YZKA 3BRWD 3K09A 4NBSA 1Z2CA 4TQUS 3MUFA 1YZQA 5HR5A 2NG1A 2RKOA 4I1OA 2RB4A 5CIQA 2KWIA 1HH4A 1C1YA 1GIAA 4PPGA 1SVLA 1F5NA 4WZAE 3GPLA 1Z0DA 1F6BA 4H1VA 4LV6A 4XD7A 1AN0A 1OV4A 1S9DA 1M34E 4D6PA 1XZQA 4YLGA 2H5EA 3QXXA 3TR5A 1XRJA 1XX6A 5P21A 2RH5A 3ZD6A 5AUNB 4GFDA 4I1SA 1DTSA 4A0RA 5FH9A 2EVWX 4A8JA 4JLOA 4MH0R 3M6AA 1YQTA 2A2ZA 2RHDA 3K0AA 4LHXA 3K0SA 2JLRA 4KV9A 4EPTA 4YONB 2ZM5A 3S1AB 4Y0VA 2YVUA 1VMAA 5CM9C 4B2PA 3RSOA 3WBJA 3GEEA 2ZR7A 3LVQE 3VMFA 2YHSA 2X77A 3GFTA 1UBCA 5F2EA 3OEHA 4URWR 5E4FA 4DDVA 2DFTA 4GMXA 5KU1A 1OF1A 2ZIAA 4UNQA 2GXSA 2XB2A 5FPHA 2V7QD 1XXHA 2ZJZA 2HEIA 2AL7A 1Z3IX 2IUUA 2R6GA 2WKPA 4JYCA 3IQWA 1F3OA 2BEJA 4EKDA 5KYKA 3KKNA 5BQ5A 4XVRA 3CRMA 4DVGA 1JECA 3W3AA 2J0SA 3B6EA 4NL4H 2G1JA 3F3YA 1G8GA 2P67A 4HEJA 4FD2A 1UEIA 4US0R 4WZBE 4URZR 4IVPA 2D7DA 1OPXA 2WIAA 4BFTA 1MRSA 1US8A 4DLWA 3A36A 2BBTA 3ND9A 2GJSA 2GJKA 1AIPA 1UKYA 3OZXA 2OLJA 5LD2B 4Q48A 2W58A 4LGMA 1KHTA 2BWJA 2V54A 4JLPA 4YC7A 2YOHA 1XCPA 2IUSA 2RGXA 1Z06A 3QKUA 2OILA 2DY1A 2VYFA 3QBVA 4F38A 4NE2A 2P5TB 3LRPA 2RGCA 1S9HA 2FE4A 3C7KA 3ZVMA 2KBFA 4NCKA 1DAMA 2ONKA 1JR3E 3X1YA 4DHEA 2I4IA 2ZRIA 1KJYA 3T06B 4MUAA 2GESA 2QP9X 5CLQA 1NMZA 3K70D 5AR1A 1KYIA 2NO1A 3QENA 3K9HA 5IDVA 3U7HB 2OSBA 2BV3A 1OB5A 2LWIA 5AJYA 5J5CA 4G1UC 3JZAA 4M9ZA 1FL9A 1UBFA 3L0OA 4JYBA 2F7SA 2EFHB 4Z51A 4PHFA 3LX5A 2PT7A 1KMHA 4LBVA 4NDZA 4QGFA 4RY2A 3TSWA 4AKEA 4B2LA 5FI0B 2FDCA 1ZRHA 3TBKA 5CDFA 1Z0FA 2GZHA 3UMFA 4DCTA 2AKYA 1TUEA 2ZYWX 3AKEA 3IIJA 1CS4C 4TMVA 4M0LA 3BXZA 4GPTA 2J87A 3HWSA 5JCZA 1KTVA 1F2TA 4HSEA 3THXA 4QHSA 4AI6A 4TLDA 2VF7A 3EPHA 1COWD 2D06A 2C78A 3PUYA 2GEDA 2F55A 2OEPA 2G3YA 3H1TA 3NWJA 1DO2A 2F1RA 3VR3A 1E2JA 4D80A 1QHNA 2VP6A 2ONJA 1YVDA 5JHHB 4Q9LA 1R2QA 4B71A 2IX3A 4FCVA 4RSGA 4Z1MA 1XTJA 2UZ3A 4GSYA 4PZZA 1W4AA 2IHYA 4LZZA 4OBEA 1ZCAA 2DBYA 2IA5A 3VR5A 3T34A 4BZQA 1ZJ6A 5JJKA 2O0KA 1UJ2A 3QBTA 3KB2A 2J46A 2KB0A 2Y8EA 3EC1A 4ON9A 4BLQA 4D82A 2GILA 3QKSB 4KFRA 3THYA 1IM2A 1N5KA 3SHFA 3NG1A 3IGFA 3NKVA 2AD1A 1YRBA 2Q3HA 4FWTA 2ZRKA 4RD3A 3OFNA 4GL2A 3QKRB 1GRRA 2Z4RA 3UMRA 2DWPA 2BKEA 4QNRA 2W0SA 4YDSA 4E22A 1XP8A 5LD2C 421PA 3SQWA 2IBMA 5SZHB 1W44A 3QF4B 3V9PA 2O8DB 3TSOA 4DDTA 3QSYA 4CEIA 1CEEA 4DSOA 1AKYA 3GFPA 4R98A 4V0ME 4QGGA 4B2IA 2QTVB 2ZTSA 2ZEJA 1OJLA 1VYTA 1YZGA 3FYHA 2ODBA 4OI1A 3SNHA 4XVUA 5KTYA 4GDFA 3F0TA 3N70A 1SVOA 3T1VA 1VCIA 4OHYA 2H1LA 3KJEA 3RVBA 3NTUA 1UKZA 4TQ9A 2GDJA 1BOFA 3ICEA 4M22A 4Q47A 2H57A 4DBLC 2JJ1D 4MITA 1G7CA 4HATA 3T5GA 1M7BA 2BCGY 1Z22A 2QGNA 3W6PA 3U44B 1Q3HA 4PZLA 3EW9A 1IONA 3SYNA 1HYQA 1NBMD 2XNDA 4ZPXA 2Z5FA 4U5XA 2GK7A 3VR1A 3R9XA 1GITA 4B34A 4BLRA 2QBYA 5D3MA 3GLFB 3THWB 1HURA 2JLSA 1OKKD 3IPXA 4OI0A 2GXUA 1HQYE 1NN3A 2JEOA 4TL7A 2ZAMA 1U8AA 2IW3A 1E9CA 5JJIA 1A1VA 4JZKA 2F3RA 3ADDA 3DMNA 4BFSA 2VHCA 3MJRA 4EFNA 5JRJA 2OLKA 3I5YA 3DMDA 3PR1A 2GF0A 2J9RA 4Q03A 4DKXA 3AV0B 5B30A 3HYTA 5J4KA 4W5JA 2CCJA 3TAUA 1G4AE 1SQ5A 4HAVA 3D31A 2ZJBA 2F43B 4BFYA 3AP1A 1U8ZA 4G5OA 2JDIA 1ZM2A 2OCBA 2VQSA 3K0FB 4D2IA 5CJ2A 3Q5EA 3K70B 3MWKA 3QE0A 4EJSC 3DM5A 4BWYA 2WPDD 4IEIA 4IOKA 5C2JB 4KXFB 2WWGA 4ZV4A 4ASUA 2HLDD 3QKTA 5L3VA 3RS7A 4B47A 1DE0A 1XEWY 3KQLA 2W6JA 3GD7A 4C0LA 2WJIA 3FKQA 4B43A 4C0JA 4NU0A 4LI0A 1XPOA 2QA5A 3KB1A 1W4BA 4B6EA 1TEVA 2H16A 1G3RA 1T3HA 5KOYA 2CL0X 5HCIA 2P3SA 3ZZTA 4XD7D 2C9CA 2WTUA 5JJLA 2YWGA 3EPLA 2NZJA 5CK4A 1IHUA 4ZCLA 4LC0A 2UVQA 4EPXA 4MDFA 3PUZA 2P6NA 3BH0A 2PJRA 3VNVA 4IOMA 4DDUA 2WSMA 4Q02A 4B3DA 5KPJA 2ZYVX 3K9NA 3BGWA 4F4IA 5EUMA 2GVZC 2XITA 4TYNA 3OIYA 1EX7A 2C98A 3GCGA 4TTRA 2V1UA 1R7RA 4DSNA 1E6CA 1CRPA 4CF7A 3NVAA 2RGDA 1GL6A 3QPUA 3K1JA 4LX0A 4RFVA 2WWHA 2W83A 3OEHD 3W6OA 2JA1A 4M1TA 3LBHA 5CM8B 2J3EA 3PXGA 4R71A 2C99A 3SJZA 3GLFE 3CR7A 3SHWA 221PA 3GFOA 4NYMR 2OBMA 2OG2A 2ZS9A 2DHRA 4O0MA 5TVKA 1B0UA 2WVJA 3Q9LA 3SFVA 1YZNA 2OT3B 4K46A 4XTRA 4U02A 3CPEA 1G17A 3D8BA 4OKSA 4D4MA 1VYUA 2JAQA 1ZVQA 2RGBA 3GLHE 4W5HA 2XTNA 4D0NA 5IRCD 4PQFA 5BWMA 1LW7A 5JWOA 4AG6A 3U3KA 3SS8A 2JJ8A 2D74A 4LJ9A 5CB6A 1SHKA 1G3IA 2JLVA 2EYUA 3A1WA 5FBQB 1DAFA 1E9AA 1OXVA 4JKYA 4ZDKA 2ANBA 1VPLA 3L8YA 1E3MA 1UPTA 1QDEA 2ZSDA 2F1JA 1E0KA 1G16A 1XDBA 1DARA 1X8JA 4X8HA 4TYYA 5IT5A 1AGPA 4LK2A 5L3QA 4GBMA 3K70C 1QBKC 2W0MA 3ECCA 1E2LA 2AKAB 2QAJA 3GEHA 4LJ4A 1N0UA 5JS8A 2ZS8A 1J7KA 1LTQA 3BJIC 2OFWA 3I32A 1F2UA 1EFUA 1FUUA 1OHHA 4C7OA 1XTSA 3FTQA 3BIFA 4M2LA 5JEEA 5EXSA 1KAOA 2F1HA 2FNAA 1TL7C 2GTPA 4N0EA 1Z83A 3ZZ0A 2Q9CA 4BGDA 4LCBA 4MKFA 3TR0A 1OIXA 3KXLA 1P2SA 1ZNYA 2B8TA 5DHFA 1T5IA 1XMVA 1NKSA 2Z83A 1IBRA 3EZ9A 4MUBA 1AZSC 5AWFC 1S1MA 2IYLD 1YR7A 2GAOA 4Q4JA 3TKLA 5FR1A 2O8EB 2AD5A 2O8FB 2V8OA 4HLDA 2J0UA 4ESVA 3P27A 2XAUA 5L8VA 2ZRCA 1VIAA 5JFGA 1GNQA 2GK6A 1PUIA 1GRNA 1KO1A 2FFHA 1GSIA 1XTIA 1PUJA 3ADCA 3FE2A 2R2AA 4MKHA 5A0FA 1YE8A 4JLVA 3WMEA 2QI9C 2DPXA 1GL7A 2QM7A 3C5HA 4OK5A 2FMXA 2ODWA 3JZMA 2CXXA 4EUNA 3G82C 3H84A 3N5CA 1T91A 4DSTA 2WZQA 1E2DA 2CLCX 2OBNA 1IY1A 2V55B 4NYIQ 2GF9A 4LWZA 2VSXA 1QHHA 3U4QB 1TU3A 2REOA 2UKDA 2GJAA 2ZREA 3B9QA 1KY2A 2CJWA 2ZSFA 4PO1A 4DCSA 3HR7A 3ZZUA 4JL5A 3LA6A 3BC1A 4M1WA 2CL6X 2I1QA 4DSUA 4Z1MD 4HDQB 5KNDA 4TLAA 3LBIA 1E9RA 4BLSA 1P2VA 4TN1A 3IPYA 3UATA 3NBXX 2HV8A 4CZ2A 4GI7A 2VF8A 3H86A 2FJUA 2OO7A 3TRFA 3THOA 2Z0MA 2OESA 2KSQA 1UBGA 4RKEA 4TMKA 3HPQA 4TTQA 3RC8A 4BFZA 2Q3FA 1T3SA 3TE6A 3OFND 1VHLA 5KHOC 3SJAA 2F3TA 1KO8A 1TPZA 2WBLC 1CF4A 2WAXA 3A58B 1KJZA 1P7CA 4QNMA 1JR6A 1NNEA 4PAOA 1AQYA 3RYTC 1IN4A 4A8JB 2IS1A 3G0HA 4EQ6B 2QUZA 1HA3A 1OLOA 3TVDA 3PEVA 4Q4LA 3K0AB 1T0HB 3CF6R 4LSGA 1T0JB 4MGYR 3JVVA 1RZ3A 1CR1A 3HU2A 3K0CC 5BYJA 4NYJR 1NBME 1X1RA 1G5PA 4L9SA 2ORWA 4PANA 2D2EA 3GLIA 1KK0A 4PTLA 4AD8A 1E1RA 3RDPA 4C0QC 1LF5A 4V02A 4QBGB 1G3QA 1XXHB 3H4MA 4BRUA 4QBHA 3T12A 4Q9KA 4MRVA 3I3SR 4HAXA 4OQMA 3U6KA 1BMFA 1G3UA 2IXEA 1II9A 2P6UA 2EFCB 4BEJA 3X1WA 2OFXA 1AZTA 1ZUIA 4B75A 1U81A 2OAP1 2IEZA 2QP3A 2XNDD 4UXIA 2VHJA 2O8CB 1ANKA 1WP9A 2B7BA 5JWHA 1GL9B 5D3QA 2C95A 2NPFA 1YU9A 2QMUA 4PSAA 3GJ7A 4Q5IA 1CXZA 2R9VA 4IDHA 3CX8A 4C0KA 1FUKA 3B9PA 1ZM9A 3NEJA 4BLPA 3VNUA 1I4TD 2D4HA 4OQNA 4P4TA 1X3SA 3CF2A 4I1UA 1NSFA 4QM6A 2A5JA 2X2EA 3N2EA 1AQUA 4PR0A 1K8RA 2V1XA 6Q21A 4UNPA 4DCVA 3LH5A 1G291 3QXJA 4KHZA 2PZGA 4DUGA 4ZI3A 1OFIA 1Z2AA 4ZCMA 5AUOB 4QGHA 1HE8B 2BMEA 1N6RA 2W6IA 1DG3A 1GRQA 5A4JA 3L82B 1N2CE 4F91B 2JDID 4AKIA 3EAQA 1G21E 1PLKA 2LKDA 2CCKA 2QAGB 4K8OA 2X1VA 3A6PC 2ORVA 3LDAA 4CYMA 1ZD1A 4Z8XA 4HDCA 4XSHA 1GTVA 4FW9A 5JBQA 3MRSA 4BEBA 3IUYA 1IOZA 3PJRA 4WVFA 5FPTA 4ASUD 4PC1A 1S1CA 4YMSA 3RS3A 1F48A 2W6JD 3KQUA 3C41J 1M8PA 3SR0A 3TQFA 3CR8A 2ZRDA 1VG9B 4Q1FA 3TH5A 4QBIA 1RYHA 1R5NA 1EK0A 2Q0HA 2BM0A 1YZTA 4JBXA 4OHZA 4D25A 1WE2A 2A7QA 2VP0A 3GMTA 2ZJYA 1E2HA 5DN6D 5JRZA 1OYYA 4JLAA 4ZKEA 1OIWA 1KI6A 1GP2A 1R4AA 4KYIB 2VP5A 4DWJA 2ZRLA 5HE8A 2CMKA 3IHWA 2ZJAA 3EIEA 2EWWA 4PC6A 1F2TB 3THXB 4IJMA 1XXHE 4AYWA 1EXMA 1G5RA 1TU4A 5DIFA 3I73A 1TNDA 3NBYC 4B3BA 1Z8FA 2RGAA 1R0WA 5FUVA 1CJVC 3QEOA 4PPQA 4RKFA 3TAHA 4URYR 1RRPA 2XJ9A 5LDDC 2FX3A 2ZRBA 5DE3A 3IEUA 2R62A 3BFXA 3B2EA 3I72A 3DKVA 4RD1A 1NY6A 2HT1A 4ARZA 2QROA 1N6KA 2AWNA 1WDTA 3IIKA 2PEYA 4LPKA 5FBLB 4EPYA 2RMKA 1TEXA 5ANRB 2MSDB 4TL9A 3D6TB 1FOEB 5AJVB 3THYB 2FPLA 4AY2A 2BMDA 1VG0B 5TXGA 1K5GA 1CRQA 1Z6GA 1HUQA 5FTJA 4UQOA 2ZJ5A 3C8UA 3CZPA 4LJ7A 4TSFA 5L3SA 5AJWA 5KSZA 1RPZA 3AKYA 5SZKB 2XZLA 5GJBA 4ZIRB 4YXWA 2D62A 3SBDA 3UK6A 2G0NA 1PV4A 3NXSA 2YINC 4URVR 3I8SA 1HY3A 4PFSA 1FQKA 1DAEA 3VKWA 5F9FA 4IDPA 1W46A 2CLSA 5G40A 1XCGB 2EWVA 1RJ9B 4PSKA 4MGKR 4PX9A 3WP1B 1NY5A 2VP4A 1X8KA 1SVKA 3LLUA 5EQTA 5LBIA 5C1BA 2UZIR 3RLFA 4A6PA 3IILA 1DG1G 4I81A
chains in the Genus database with same CATH superfamily
5KYNA 1EQ1A 4RLSA 4MS4A 4RGQA 4OXYA 3RC9A 1Z08A 3KPUA 1WVIA 3K0HA 5JNWA 3WV4A 1TGYA 3KEFA 1SG0A 4CTMA 2CSXA 1LQ2A 1GRCA 2P9FA 4TTAA 1DBIA 3WIVA 4ZQHA 3JVUA 4G1CA 5CP8A 4HB0A 4L0DA 3BT7A 4A7PA 4O4IA 4EBJA 3X43A 4NOLA 4F3YA 5JD6A 4UM5A 4PAGA 1SQSA 5C80A 2A30A 1DXHA 5GIOE 1D3AA 3N2NA 3A6KA 3U2LA 1NDHA 3WK8A 2AJDA 3FYUA 1PV2A 1GPKA 5H4HA 5FOTA 1OSNA 2OORA 3C8GB 4BS9A 2FPOA 2C2ZA 4OI2A 2G72A 4D92A 3GC6A 1HFJA 4LOIA 4BGUA 3WRVA 2PX8A 3GNSA 4ZTZB 1LXCA 2K4MA 2PGXA 5HEKA 2G40A 3L34A 1U9CA 1YAJA 1L6IA 2G1AA 3SFZA 4TYWA 3CH5A 4ZDJA 1QHGA 3OJXA 4BMPB 1HE9A 3BK2A 1AHNA 3LLCA 2IT1A 1K88A 1RXIA 2F3SA 3DEAA 1M33A 1XQVA 4AYXA 4H16A 3WP0A 3WQHA 3VKFA 4YAJA 4FKMA 1KOFA 4FB5A 2GLXA 4C89A 5K8IA 3AI7A 3LC0A 3CRQA 3UIEA 2R03A 2Q7XA 3X1OA 2IM8A 3ZR4B 3OP4A 2ETSA 1GQ2A 3WK4A 3VR4A 4D9CA 2FZCA 1OASA 2PN1A 1BQ3A 4Q3KA 3UWPA 5E3HA 2P4QA 2HADA 4TMFA 5LNK1 5ALEA 4AJJA 3KXIA 3UH0A 2JI9A 3P2EA 2HWWA 2IBFA 2G77B 1AUQA 4YXWD 3DAFA 2C1EA 3MSXA 4OYLA 3HJUA 4UD6A 1S2DA 1A9YA 4N12A 2WD7B 1LX6A 3EHNA 2RHRA 2RAVA 1FE8A 1ZW3A 4E5KA 2OVFA 2ZUWA 1C7ZA 5JMTA 3JYQA 2C03A 2ZAOA 3QXSA 3RVNA 4AJ2A 3WB2A 2WJWA 4IJQA 4PZDA 3P2JA 1T25A 5LZ8A 4GYTA 4PHTA 4Y9TA 5DB4A 5FOXA 4AJLA 1Q1BA 3UFXA 3ZDYB 4ZVNA 2WHQA 5JECA 1U2SA 3AIOA 2PUAA 4JI5B 4MVJD 3AQ4A 5GM2A 3SGLA 5B37A 2IS2A 4FT4A 3A2LA 2PXHA 1RAGA 2WE8A 1NDQA 2JFUA 3H97A 3LW8A 1GQYA 3MQ2A 4C4ZA 4DPMA 4N7BA 3KQTA 3RHFA 3TK0A 3QELA 1WKVA 2HRRA 2V26A 4D3YA 4ZHQA 2PO5A 5LZ5A 4DOZA 4LFCB 4UUNA 4FMDB 3ASUA 3KJIA 2LIVA 4IJ5A 2HOQA 3THWA 1E3DA 1P5ZB 2W42A 1WNFA 4YFYA 1SCNE 4L4SA 2ZRMA 2WJHA 1XJ0A 1XDGA 5ADVA 4IXTA 1E7RA 1BTOA 1GR1A 1P3Y1 4DJJA 3M49A 5HCUA 1G9TA 1XD8A 2A6EF 3EGIA 2KGOA 2YR0A 2WAAA 1M67A 1NOKA 2YLDA 4JYAB 1C9DB 2VIIA 4E09A 3TDMA 3M5CA 4Y2VA 1RKQA 4WBXC 4UDNA 3A27A 5ALFA 3GRZA 3OU7A 3PHLA 4QXPA 1XQXA 4Q3BA 4KFTA 4ETMA 1BE0A 3BAFA 1GTZA 4MR8B 1KAMA 4OGFA 5HDQA 1CS0A 4LBZA 1DKLA 5IJ9A 1OBFO 2WR8A 3NDBB 3ORRA 1V6SA 2HQRA 3LNCA 4J16A 2BC9A 5J4VA 4JTCB 4UM8B 4QPNA 4HC4A 4GZ3A 1E6MA 2AMYA 3I6ZA 2JFZA 1I5RA 3OE4A 3D8SA 4NBTA 1Q1AA 2CLHB 1MV5A 3EZYA 4A8JC 3QNUA 2KC3A 2CBGA 3JQPA 3DL7A 1J5EB 2NMVA 1K75A 2R68A 3ZBQA 3LNMB 1E2PA 3NUZA 3HNOA 3WLIA 2KJQA 3H65A 4J7YA 3E9DA 3TJMA 1QTQA 2PG3A 2ACKA 3L0ZA 1G4US 1UPBA 2O1XA 4OQPA 4K1LA 1W7AA 1EWQA 1QSGA 4DCOA 1QM5A 5HQJA 1Y82A 3ZI7A 1L8QA 4QU0A 1P72A 4DLLA 4P83A 5K3DA 1D4AA 3K2BA 4YCBA 1RKBA 3TZLA 2FQWA 4G9BA 4YRJA 2XWSA 1PTJA 3PSHA 5D3MB 3R8XA 5ED4A 4F4JA 5ES4B 2Z6UA 5DLDA 4LSWA 3Q0TA 3IQCA 2QM0A 2ZRJA 3EASA 5ECGC 2ZQ5A 4XZ3A 3AF0A 4PCAA 4TL6A 3C3KA 1T8TA 4JP5A 4K6MA 3RC3A 4MPRA 4DV1B 1ZHXA 2O59A 3T9OA 4OEHA 5CJPA 4E0BA 4OL0A 2OV4A 2ZQYA 2I4MA 3D2LA 4YP9A 3K33A 4MW3A 5GOTA 2QP4A 1KJ9A 3UJCA 3EZIA 3ZWYA 1CUUA 3TNFA 2RH9B 4MUEA 1YCDA 5ERGB 4I99A 3NHMA 5BQGA 4WVLA 3D8RA 4B40A 5ICFA 2JD1A 3KYBA 3U3FA 1V5WA 3K73O 1R88A 2EP5A 2PKEA 4ZDIA 1C2YA 4XTCS 4AIIA 2P4SA 2QY9A 3QPVA 2X8AA 1OE0A 3ZXYA 3OD5A 5KYVA 2WHEA 3KAKA 3LTEA 3TOZA 1RVV1 3P5BA 2O3TA 3LESA 5ARCA 5REQA 4IF4A 1DPFA 3E35A 1TAUA 2QUBA 4QYWA 1WX1A 4ZIRA 3N2IA 4IVRA 1AXRA 2W8BA 2ZB3A 4KZKA 1V6CA 3M9LA 2RK4A 2REQA 3U9SA 4UMFA 1Z15A 3BCHA 1G38A 1HKUA 2YYYA 4EI7A 4IHQA 1XMQB 2GN9A 1FJGB 1H6BA 3V97A 3O3OB 3OVMA 3D3QA 1ADFA 1PJ4A 4FNAA 2IE8A 4R81A 1DOAA 4RF5A 4D3DA 5FTWA 5LOVF 4F8YA 2N47A 1H5UA 4WUTA 5JZMA 4OJTA 4MS2A 2A0UA 1WWKA 3N7TA 2B1GA 1VECA 2FPKA 5LWHA 3FPCA 4L78A 2QQ5A 4Y6QA 1DWUA 5JH7A 5C34B 3P26A 3P4YA 1RJEA 1F38A 4IQ0A 3G2HA 1L5QA 1YBFA 4G1FA 5L4SA 3NBAA 3FUWA 3I92A 1LA2A 4PNPA 4XPYA 3IJEB 1I2CA 1C41A 3SF0A 4NENA 2VQ3A 3DE8A 5A6BA 2CDBA 3TLYA 5LKAA 1I2AA 4XQEA 2OZLB 4CQMA 2ZIWB 1Z5NA 1NYQA 4FUTA 3U81A 2W2KB 3WYFA 4BN4A 3CPJB 4C01A 4ISCA 3O1JC 1N78A 1G6KA 3T38A 1E77A 1U5BB 1WSDA 1WY7A 3D02A 1NVBA 2O3QA 4NFLA 3ORSA 3QF7A 4R0NA 3FWYA 1INLA 1Y42X 3RVZA 2IOQA 2A4MA 3WIOA 1PK9A 3QUSA 4XPIA 2H31A 2HCFA 3CUYA 1ZOIA 1I3NA 3DT8A 4GOMD 4FYJA 1I1QB 3H4TA 4XVHA 2WMOB 3AOGA 2WV9A 6AT1A 2PYZA 1P9RA 2R7QA 3SXPA 3AYXB 2EP7A 2JASA 2J0QA 1AV6A 2R8YA 4KXYA 3UOAB 3UNXA 1XCLA 1DJNA 2P30A 4QXRA 2C5SA 4XRRA 2D5RB 5KDDA 2I3ZA 4S1VA 1UWCA 1GZVA 2E48A 3MG9A 1E9FA 1IN7A 4JBLA 1C8KA 2O3JA 1AKQA 1KVRA 2HHCA 3O3CA 5F1KA 4F3NA 3NEAA 2UDPA 3ZU4A 3GELA 4L5AA 3U7FB 1VDZA 1COWA 2YS7A 3CB4A 4US2R 1CQWA 1OT3A 3N8GA 1OX4B 5EPOA 1TM2A 2AR9A 2I80A 2KE5A 4KR9A 3ZGLA 4G0QA 4BO9A 4EHFA 3GJ8A 5K4AA 1RQLA 5JZVA 2FW8A 3DYBA 3UVEA 4JA0A 4PQEA 4J0GA 1F8GA 1E9DA 2FN9A 1T9DA 2PWZA 3AF2A 4HAOA 2ZRHA 4PC3A 4BJ3A 4CS8A 2ID4A 3C15C 1JEAA 2WWYA 4MA5A 3OHMA 2FRDC 3WLJA 2ODTX 1F7UA 4X6LA 4HRYA 1HETA 1T1SA 4D56A 4N40A 5JAPA 1F4VA 4R5MA 2JFYA 1R6VA 3RANA 3AU9A 1APCA 2VHUA 5JSKA 4HQRA 3OURA 1N7JA 4KK4A 2XMDA 2WHPB 2XXBA 4R8MA 4RPLA 2J3QA 3AVYA 3S70A 4RFSB 2YWEA 4L3VA 4XCVA 4OLHA 3U4QA 4RY8A 3H5WA 4G5XA 3ER9A 4KFUA 1AZLA 1P6XA 1YZKA 4ODIA 4NBSA 1JFRA 3MUFA 1ISIA 5EKSA 3TGWA 4PPGA 1F5NA 4CIBA 2EX4A 2O5EA 1WZNA 1U9YA 1XZDA 4I4TB 3N0RA 4ZAZA 4GFDA 1JWAB 2AJLI 5ALMA 5FP0A 4IIJB 3RSOA 3WBJA 3PGVA 3L6EA 4URWR 3N2GB 4CCWA 3EQ7A 3V5NA 4C07A 2AMJA 4LTMA 3WJ7A 1JIKA 4LOLA 1QH1A 1KC1A 1K3UB 5LQAA 3P0RA 3T3MB 3WGIA 3HCWA 5CA1A 3BHMA 5KMGB 2FEAA 3HVKA 2BWJA 1PQYA 2Q5OA 2OILA 3W5BA 3JQRA 5IAAA 1RM0A 4F4UA 3CISA 3LCCA 2NO1A 2XT0A 3ONEA 1JSRA 2ZBGA 4KQ2A 3JZAA 2UUCB 2CV0A 2A68F 1FP2A 2PGNA 1BWPA 1GD1O 4N39A 1XTUA 2GZHA 4G8DA 3AKEA 1SVNA 3S29A 4GUAA 1OR2A 3EPHA 3RFFA 3LSYA 2APJA 1TYEB 3CYFA 1MJNA 1JFFA 3VR2D 2BHLA 3JCZA 3LQYA 4NC3A 1T1IA 5I7OA 1E5QA 4AO6A 1WB4A 3WJAA 4YO8A 4BFCA 2Z08A 4JUDX 3G8YA 1SAYA 3QKSB 3QW4B 3IGFA 5E4TA 3C5WP 5CTJA 4GMGA 1YB1A 4JI4B 3OZTA 4XLTA 3L7MA 3EOAI 3IDZA 2GEBA 4CMIA 3B52X 3FI9A 4K6OA 2BEWB 4HQFA 1EFVB 4QGGA 4XVUA 5AJTA 3QEMB 3I76A 4MQ4A 5CEFA 2YL3A 4G84A 2HTEA 1GLNA 1QFMA 1Z22A 3V8VA 2GN2A 4NCBA 2H7BA 4YL3A 1JQEA 2VYND 4N3BA 1HYQA 5BUQA 4U5XA 3JT1A 5CXSA 4MW9A 4LOJA 2ZAMA 4DTCA 4WJKB 4IIVA 3ADDA 3KH2A 4NABA 3VNBA 3O8OB 1NI5A 1SQ5A 4BFYA 2VPZA 3BJRA 2OCBA 3BXOA 3IDFA 4CDAA 3RK1A 3DM5A 2H9IA 5KHAA 1G60A 3KQLA 3F47A 3DL2A 3UZUA 2IY9A 1K97A 1Y8AA 3BSFA 1XPOA 5KOJA 3VJRA 1DOZA 4O2BA 2A8YA 4BQPA 4M0PA 1QUEA 1KYZA 4UREA 3C8GA 4MDFA 1V4NA 4NFYA 3K9NA 2O2ZA 1I4EB 2Z15A 2HWUA 1T0UA 1ZQ9A 3WR5A 5KTOA 3QPUA 3MLBA 5EIHA 1UMDA 4CWAA 3ZC4A 4QFBA 2P77A 1JIIA 4UBOA 1CUHA 5TVKA 1OREA 4KIUA 4O4LA 1PHRA 2YVKA 3R3VA 4P4LA 1RXWA 3KZCA 4EO4A 1HMDA 4AO7A 5I7FA 2F1JA 4QU5A 1XDBA 1E60A 3I3OA 3MB5A 1BFDA 1GQOA 4XPXA 2MSKA 4DLNA 2I6QA 2FGYA 2EQ5A 1FDIA 4L27A 1J7KA 2HK9A 3LVFO 2ZYAA 5AJHA 1WCYA 1QP7A 3HBLA 4UTRA 1POXA 1W5BA 4M0EA 1CETA 3HDJA 1GRNA 5JZSA 3ADCA 1PWXA 2BFAA 4KMOA 2CXXA 3KYJA 1P1IA 4G56A 3IXQA 1HNNA 2A3NA 2B94A 3BRQA 5BVGB 3WWEA 2ILTA 4YGYA 1YQQA 2H29A 3CX4A 5TGTA 2OGSA 1ULAA 5KNDA 1UDCA 1YC2A 3TOSA 1NTRA 4R9NA 2M98A 4CZ2A 1O5IA 2GD6A 3TRFA 4BC1A 4FSDA 3FAKA 3RC8A 4YV1A 5BN5B 2PPLA 2J9FB 2C88A 1JR6A 1P7CA 2HB6A 3ODGA 1M2KA 1HTBA 4D8VA 3DZIA 2J6HA 4NQZA 1UCFA 2AFIA 2E55A 1D1CA 3JVVA 4OCZA 4Y7DA 5F9MA 3O03A 4WECA 4IDEA 3PDIB 2OHJA 4GOND 5D84A 3I3SR 2IHJA 1AUEA 2NVWA 5F5NA 4EFDA 1ZUIA 3V2HA 4Q0MA 1ANKA 4KPGA 1WP9A 3GJ7A 1E5DA 1T9KA 3B9PA 1R8YA 3W9SA 1NVKA 1JLRA 4H7KA 3IERA 3GQBB 4EUKB 4CUJA 3WSVA 5EVCA 3LH5A 3PWTA 1Y5MA 5JC8A 5ED0A 1YJGA 1VLTA 1E85A 3DZGA 5D8DA 1FVXA 2W6JD 5BMVB 1R5NA 1U7WA 3EVDA 2Q0HA 2BM0A 1MQAA 1XYGA 2PNOA 5C1IA 1R6AA 3KJFA 4A5OA 4DM7A 4GZ6A 2QD1A 5JFTA 1L1RA 4HQ0A 3IQGX 4DCCA 4J1TA 2R62A 5F23A 4KWTA 7GPBA 3N86A 3SQOA 1O6GA 4DL9A 1LRKA 2VFAA 3OLZA 3PUKA 4FKZA 4Z4EA 4UQOA 4CETA 3ZHSA 4H6XA 4JJFA 4FOPA 1XTVA 2CNBA 5K2OA 4S2UA 3EZXA 4AJ1A 5LBIA 2YFHA 3ZBTA 1DPGA 1MN6A 4HH0A 2JGLA 5BVHA 4KACA 3D0RA 1ZHTA 3TI9A 3VC1A 4W1RA 1M0TA 2RI6A 3KWMA 1MORA 1T4CB 4MR8A 3WA7A 5L6LB 4XWKA 4MUMA 5FTLA 1G8HA 3ICWA 3R9WA 1NULA 3I53A 1REQB 1ZW1A 1X19A 1HY5A 3EHMA 4ZARA 1Q20A 1I4OA 1TADA 2CLLB 1F9EA 3S0XA 5BPFA 1BGVA 4IUCS 4KYUA 4B5KA 4YRTA 3ZDDA 1VL5A 1KL7A 3BORA 2TRSB 2JIDA 4R6WA 2UUOA 1XQYA 3T0FA 2ZE5A 1J42A 5K0JA 4TWBA 5DNVA 2XPCA 3ZD7A 3VX3A 2WOJA 4CCYB 3VRHA 2R65A 1VYHA 1Z3CA 2BOVA 3D6NB 1H6GA 1GZHB 5F5XA 1Y3DE 3GUZA 3TLKA 4YT4A 2BAGA 1NU9C 1PO7A 1T3TA 4P98A 3ADBA 1R3DA 3NFRA 8ABPA 1VL8A 1U8TA 2HMZA 1AU9A 3OKAA 4RTJA 4F97A 3SBEA 2X0NA 4IIGA 3UC5A 3UAOA 1YKSA 5T3TA 4I08A 2O2GA 5E4JA 5H68A 3WTBA 1R16A 5D1HA 4Y0AA 2RGEA 1DEKA 2N1BA 2CHQA 4KITB 5HQ3A 1V5IA 1X92A 1R50A 3A3YA 1EP2B 3QW2A 4Y2PA 4N9WA 4L75A 4IIDA 3ESQA 4EWLA 1UADA 2NACA 3VJKA 1VJ1A 1ONNA 3MBKA 3AXSA 1YBAA 3GEPA 3HM2A 1ZYUA 4PY2A 4LJ5A 2GMWA 3R74A 1YL5A 3RVLA 1X70A 3NTLA 2JC3A 3TPCA 3UKDA 1XPUA 5U1PA 4BV2A 1W4CA 3E0QA 1YHZA 3A1VA 4M7WA 4OO3A 2V5UA 1OYVA 1VIMA 3ZWIA 4M9QA 5B7NA 5HVNA 4OKNA 2BBOA 3ZCPA 2GR9A 1ULZA 2DUUA 2X5XA 1ZW6A 4BRWA 4TSFD 5F77A 3TZBA 3QBJA 4KN8A 4B17A 4YUZA 2QVLA 4MJXA 1QFJA 4BKMA 4CNQA 2JFOA 4AFNA 4C5AA 2VF2A 3CWZA 3PTZA 4DDKA 2OBLA 1NJ1A 4NX2A 3ZCVA 4E2ZA 3SZ3A 2NQ8A 3M4BA 3U9LA 4B2YA 4XWJA 4HB3A 4R2MA 3VNAA 1EUDA 4JC4A 3D64A 3IV7A 3ROXA 2C3MA 3GGJA 1NC3A 4PGHA 2O7VA 1Q0ZA 3TCXB 5EAIA 2CMGA 4LYEA 3IVRA 2LUOA 5ALKA 2O07A 3E5NA 5DO9A 3PTAA 2R9RB 2VTVA 2QL7A 5E3AA 1NM5A 2PKCA 2HEGA 3LCVB 2AW5A 3FVVA 4Y2GA 3J7TA 2VTBB 4MV8A 2YW9A 5C4MA 1A5BB 4EX6A 4P8RA 1TD9A 2Q27A 4QUIA 4ND4A 1A2QA 4EECA 2MTBA 4MS3B 2RAPA 2P8SA 4TYQA 1FFHA 4I66A 4I3GA 4F0JA 4EHPA 1VMIA 3PQ4A 2H8KA 2FEXA 3GJ3A 1X1AA 4M1KA 3UGJA 1BH2A 1WQ4A 3SAJA 4TRRA 4TT3A 1JX6A 2CMFA 2X1MA 1K98A 1C3OA 2FZ4A 1W93A 1AVOB 5EE9A 1W36B 2Y92A 3LUKA 3Q4GA 1UKVY 4G1EB 1Z07A 4D44A 1A0BA 2W2KA 4XOIA 3B82A 5KUTA 5ALPA 1D6NA 2H51A 2X40A 3HWX1 4HS4A 5F4ZA 4NYMQ 2JFNA 4LGCA 1ZA1A 3I37X 3HA3A 3RRBA 4BG0A 2QPLA 2O5CA 4IF6A 4F56A 1KH2A 2X9VA 2WQ7A 2VZ8A 1CJUC 4FGUA 1ZM4A 3AEKA 3SBXA 1TYZA 3RSLA 3JYPA 3UUFA 2NU8B 1KGDA 4WLNA 3A8TA 1E4VA 3FVWA 2B92A 1J33A 1TUGA 1H9CA 2XX3A 2PL9A 4MUNA 5EWMA 5EP2A 1T10A 2PL1A 5D92A 2QYOA 3WWOA 2CKDA 4S3MA 3K5PA 3GEMA 2FGKA 4OHKA 4IS3A 4LGYA 5AIBA 4KAXA 5CNKA 4PVDA 3MS4A 4C7BA 1Y4AE 2IF0A 1ZDMA 3Q5GA 1Y8CA 1J07A 3TRJA 4BKPA 1KXJA 5IASA 2CVQA 3ITDA 1FPMA 2Q0XA 3R6DA 2FN3A 2EFEB 3QG1A 4GBGA 4CKCB 5EHXA 4C2UA 4ZYUA 1LDNA 2VRNA 1MMAA 2ICAA 3NYJA 3AHCA 2PX0A 1OX4A 5TPWA 1G7SA 1DAHA 1RLTA 2XUFA 4NYJQ 2ODPA 4MWOA 3HVRA 1R10A 2VBGA 1PR5A 1AOXA 3IT3A 3PC8C 3Q7PA 3JVEA 3VOSA 3A6FA 2RCYA 2ZT5A 3E9RA 1SRQA 3MGKA 1XL0A 3W5UA 2BGNA 1R6XA 2WIBA 1FYWA 2YC4C 1EHCA 3FPBA 1Y3AA 5C0OE 2JFFA 4JT4A 1L4EA 4RV4A 4JYPA 2CDCA 2WSYB 4DWOA 3VDNB 1MCZA 3K6BA 2VRWA 3DBRA 4DLTA 5LA6A 3CUVA 3EEOA 5C35A 1QYXA 2WHPA 1CB0A 4GG1A 3HV2A 5JNSA 4P3PA 4RFSA 3V1UA 1C8LA 4DR4B 1DTWB 2GYWA 2TMKA 4ANJA 3IEEA 5M5BA 4L9WA 3C4QA 5CTAA 3CW2A 4Q00A 2VBCA 2CXNA 2V6FA 1DJOA 3DOEA 5KNCD 4LHVA 4AU1A 1GNRA 4V1CB 1Z5ZA 3P4UA 4I4TA 5EQFA 1RRCA 3JWGA 4II7A 4JL8A 4B3SB 4PC7A 2H17A 4CIXA 3C6MA 3EIOA 2XSZA 3HFGA 1ZL2A 2PJUA 1HDIA 1NRIA 3OUTA 1GNLA 5B3KA 2AOTB 3W34A 2EX0A 3PU6A 4WINA 4QGBA 5JPIA 1CNEA 2GNAA 3IHTA 2WFMA 2DFKB 4O1IA 1NZJA 3H11B 1WLYA 5KMGA 2UZAA 4TUYB 3KOZA 2DC1A 4JI0B 4GEGA 1YVEI 1TTTA 4OQQA 2BONA 1UKEA 4J7AA 1E5TA 2OXFA 3LLMA 5FNVB 3ACBA 1Z0AA 1FPQA 4X8LA 4J32B 1A97A 1GEEA 1P3JA 3GJ6A 4POAA 1O6CA 3AY3A 5ALWA 3E8XA 2IELA 2PZFA 2LBPA 3PNKA 1YJ8A 1MAWA 2JIQA 4YT2A 5IN4A 2XD4A 3FWHA 1SKYE 2NAFA 5DGIA 4YY3B 4MDEA 3FPGA 4IH9A 4X95A 2VATA 3GAFA 5E9JA 4AQ7A 4X85A 2I4TA 4M1OA 3MCUA 2FOLA 2QRQA 4QC2A 3RRNA 1XDWA 1L4UA 2OMEA 4XE5A 3Q1LA 3O8CA 2YOGA 3QKSA 4O6NA 1NF2A 4R69A 1E32A 1PN3A 2QYSA 1XU7A 4CF5A 2H7OA 3IBFA 1GPNA 3OZ7A 4D57A 6GPBA 3ASYA 3SLKA 3NQ41 4MZDA 3PC2A 1PJRA 4BE9A 3LAWA 3QEMA 2PFKA 3QVMA 4GI3A 4YRPA 3PRKE 1MO6A 2Q4DA 4PC2A 2ZQZA 4L5BA 3PCXA 3PZRA 4YCSA 1T5BA 1JGTA 4LYJA 2JAXA 1MNEA 4J2TA 1EDOA 1GZDA 1RDFA 3FSEA 2PZLA 2RBEA 3LXRA 4FFMA 5EMKA 5JBNA 3O8OA 2YWAA 4H7FA 1QPUA 3T4UA 4GKJB 2EDCA 1EGAA 1OLSB 3L92A 1NJSA 3ILXA 5GZ3A 1JE0A 3B1KA 1G7RA 1QYRA 1R4MB 4QOFA 2CZCA 1ECBA 1S3FA 2RJOA 4LYGA 5ALHA 1QCYA 4X3PA 5K5EA 1NAIA 3CSSA 3HYLA 1TF5A 3EIFA 5LUAA 3KB8A 5K3BA 3V4SA 4H17A 3GEGA 1Z74A 2C4WA 3DLAA 2Z2IA 3ILHA 5C51B 4MGHA 3HB4X 1EKYA 5L53A 3SVZA 1E2QA 4Y6RA 1X7YB 5WRFA 3KKEA 4YWJA 1G4UR 3IUJA 1G5ZA 3U2MA 3FMOB 1N3IA 4EDHA 4CFYA 1LQUA 3OQBA 4MW7A 1XVLA 1GQAA 2FPWA 4NPAA 2FSPA 2CFRA 1ZD8A 4FYPA 5K01A 4MRMA 1YYXA 3MELA 4EGCB 2Q5IA 1XPRA 2LZ0A 3N7UA 4F9EA 3LLIA 5EMNA 1AS3A 4C14A 5K3OA 2Q7RA 1KERA 5KNBH 2VZLA 4MR9B 5FADA 3DBVO 5AW9A 1W25A 2C1XA 2Z04A 3TRDA 2W7TA 4Q1CA 2Q3BA 2GBPA 4CKZA 2C29D 3ND7A 3CNHA 3RCBA 2JBWA 3G7NA 3DHVA 4FYXA 2DI3A 3HCBA 4DY6A 3ZX5A 1GGFA 3D6JA 5BVGA 1PVDA 2W11A 4B3MB 1IN5A 1GUFA 1EJ6A 1Z2CA 3W04A 2NG1A 5DU2A 1HSOA 2JFXA 1Z0DA 2UUPA 3IAEA 3VTZA 1YNSA 1XRJA 4PK4A 3ZGVA 1PGPA 1H6DA 2R7OA 5JSHA 1UFRA 2BGMA 3I83A 5B3JA 4YJFB 2O9XA 1V5EA 3ETGA 3PDIA 4ND6A 4S0ZA 1DRKA 2HWXA 3NTXA 3EA4A 4EB3A 3VTFA 1LBEA 1JYSA 2XQFA 1HE4A 4KO3S 4H1WA 1CY6A 3AR2A 3R3HA 3BXPA 4IO1A 3HR4A 3P9SA 2JIOA 2Q8PA 2OLJA 4EUKA 2TMYA 4E3WA 4Z0TA 2VYFA 3OQNA 3C7KA 3ZVMA 1I3KA 2ONKA 1VMKA 3MTQA 4X1KB 3L6CA 5CLQA 5LYJB 4MPTA 1NMZA 5DX0A 2PJDA 1EK6A 3EBOA 2C0PA 1SC1A 4KH0A 4YCCA 2VPQA 1OFGA 3TYXA 5BMVA 5C3MA 3HHPA 2EFHB 4ETIA 2FMKA 4AKEA 1PWYE 2BM9A 4TMVA 3BXZA 3MIZA 1CUFA 3BRJA 4QHSA 4TLDA 2QK4A 1A9SA 2I03A 1TTQB 2QZSA 4K6CA 3WO1A 2A6HF 2ZRQA 1XTJA 4R16A 1YI1A 3TOMA 3G9TA 4BZQA 5JJKA 2AG1A 3CEAA 3LIPA 3TEFA 3AZPA 2AD1A 1P1FA 4X9XA 3NAZA 2E4UA 4YDSA 3EBLA 5LD2C 4W5TA 1CERA 3QSYA 1JDNA 4NS4A 3JAMA 3FCAA 2OMKA 1YZGA 1HZZC 2ZPUA 4DBLE 3PHIA 3USCS 4TTTS 2VDNB 3NHPA 2W2OA 3ILVA 2XYPA 1IL0A 3HXLA 1J24A 2V4UA 2GS9A 1M7BA 4B4DA 1QTIA 3E4CA 3U44B 5JZBA 4YMIA 2NVUB 4DDHA 1JDPA 1T4CA 4JXKA 4I9NA 4S24A 1UODA 4P08A 3TDKA 1HORA 2H2FA 2NADA 2M1XA 2ZG6A 3GEBA 3NONA 3UK2A 1UBLS 4NU6A 1E9CA 1REQA 3ZSUA 2F3RA 1ECLA 5I45A 3MJRA 1ZHOA 2RSEB 3ZV7A 3AV0B 4DPKA 3O4IA 2WTNA 3S8YA 1OQAA 3T9DA 1RHMA 2RI0A 3T41A 3GA0A 2ZBPA 1I33A 4L3OA 5HBGA 3K70B 3EZNA 1T1JA 4IGAA 3GD7A 1XRQA 2WJIA 4DR3B 5ALVA 2JS7A 2X0CA 5HCIA 1M8GA 1PDWA 5DHRA 4Z4IA 4PIPA 1IHUA 2GVZC 3H5IA 3G59A 3DTNA 1TLTA 5DTRA 4GWLA 1NXOA 1V96A 3LBHA 1TFUA 2IUEA 1NQUA 3CR7A 4LNUA 2ZJ1A 4BP3A 3IA2A 3PL1A 3KD2A 4G5HA 4KHPB 3HKEA 4IMJB 3SIXA 4JURI 3RK0A 1Y6DA 3G8CA 1OXVA 2VUSA 3HNJA 3RYIB 1D5WA 2JFHA 1EBFA 1ABBA 3VXKA 4K05A 2AEJA 2O3RA 2I78A 2AMFA 5JEEA 2IY8A 1S4MA 2FNAA 3EBPA 2PRYA 5HUJA 1S1MA 4WJZA 3LEOA 3M2TA 2AD5A 3A26A 1P5HA 3HCOA 3F6BX 3ZNPA 1F4LA 3AOUA 3USZA 1B4DA 3CSUA 3WMEA 3KVYA 3JZMA 5C8VA 4N8EA 4ND7A 5KVVA 3KSUA 2PGLA 4LWZA 3P9CA 1KY2A 1JEYA 1J49A 4JTDB 2VZ9A 1XRMA 3ROEA 2D2IA 1E9RA 2VDMB 3IPYA 2QAIA 4PX5A 3IFSA 4TMKA 3GYGA 1DZIA 4CTOA 2XWQA 5JNLA 2CWDA 4JHXA 4UVGA 5ENDA 1NNEA 2CYDA 1UP4A 4AL4A 1WF6A 1E7QA 2GUWA 4E4YA 1T0HB 1GGQA 1U6KA 1D4ZA 3CF6R 1CR1A 5I7UA 1JS1X 3H8WA 2M6RA 3SPXA 4NECA 1USUA 1FMVA 2V7WA 2CMDA 1NQWA 3A6ZA 1UBSB 3F6CA 4DTIA 3U6KA 5BR1A 2IXEA 4B85A 3VBEA 1QLEC 4U0JA 1CPRA 3C4VA 1JB9A 5IC6A 4CTJA 2R7WA 2FW1A 2QJFA 1MA3A 5IYZB 1I4TD 3PPIA 1G98A 4DMFA 2V58A 4BGIA 3T7SA 2BF7A 4PR0A 6REQB 1PFQA 2HA7A 1JFLA 3VR5H 4EG8A 3NW9A 4EYQA 3AY7A 5JBQA 4KNVA 3IUYA 5EC8A 5FEUA 4PC1A 5H0IA 2GPTA 2IGBA 3CR8A 1O94A 2H11A 2ZZKA 1WE2A 4RHUA 3U8PA 4MHSA 2GDZA 2XLVA 1NVTA 3LC7O 3E1KA 4LY9A 2JFVA 2Y66A 1IK6A 3HZOA 2XQJA 2RGAA 3G5AA 3QEOA 4R2KA 4REQB 1A71A 2FX3A 5DE3A 1LRJA 3HSYA 3IIKA 4YYEA 3EY9A 2CGEA 2FPLA 3E23A 2EAUA 2ZJ5A 3FMSA 1M1YB 5GONB 1T6YA 3KBBA 1HY3A 4X65B 1FQKA 5F9FA 4Z99A 2LRHA 1WXXA 4NZZA 5GP1A 4EJ2A 1K3FA 2Q2OA 2V7EA 3UMYA 3LLUA 1M6TA 2COUA 1UEJA 1TCVA 1YL7A 5J4LA 4FUQA 4UULA 4F4FA 5AK5A 3I12A 5D1NA 1MRZA 5HQTA 4R32A 2XIJA 1TJYA 3ZQKA 1H23A 4ZMBA 3KTAA 1U9ZA 1LD3A 3WGMA 5B7GA 2XGMA 5TARA 1T6ZA 2O5VA 1W85B 1E7YA 5J58A 3L8MA 3WNQA 3A4LA 2J4FA 1UUFA 4DV6B 3VC3A 3WDMA 2PIAA 1MZVA 4JX9A 4EUSA 1FP1D 1UFKA 4FMCB 4YH1A 4HB2A 1WMDA 4CF6A 1GDTA 5I51A 2CLKB 2NU7B 2NU8A 3LGXA 2ADFA 2HDHA 2C5GA 2A88A 1OOEA 3K1IA 2YMPA 2Y27A 1ML4A 1Q57A 1GWNA 3AG2C 4Z9XA 1N6LA 3FPEA 5F28E 3RFXA 4RK1A 1FLDA 1QV6A 1GZUA 2FJPA 2RHGB 4XOUA 4JJGA 3KYCA 3B60A 2EW8A 1Q95A 1IQUA 2HPVA 3N0XA 1GCOA 5FDFA 1W2HA 4P86A 3S2YA 1JR3A 4WCFC 4B6PA 2DPHA 2GPNA 3QLVC 3HN6A 3PEWA 3LBFA 4CKCA 4HZGA 3PCVA 4ALLA 3P32A 2QRNA 2IIBA 3VKGA 1G5TA 2GEVA 4XM1A 1QGAA 2YIVX 2NLOA 4KN9S 1VJGA 3K30A 1VDMA 3ZWKA 4CHTA 1TRHA 3E18A 4XEVA 1EP1B 4ERNA 3OQVA 2GJ9A 1SU4A 1JA9A 1J2RA 1LVGA 2OAQ1 3G7UA 3IQFA 5LMCA 4US1R 3TKYA 4PACA 4AC9A 2EF0A 4RXTA 3BZUA 2VCYA 4JVOA 5LBTA 2NUPB 4DV7B 2QTCA 3B8EA 2IYZA 3FROA 3CKLA 3D7MA 3NHFA 1A7UA 1Z88A 5DN6A 1JJAA 1XA4A 5DM4A 4J3JA 5LQUA 5EYPA 5K8VA 1I4LD 3WYBA 4MKGA 5HIIA 5JS2A 1Z16A 1KQ3A 3K72B 2QSUA 5E9WA 2WKRA 3RS4A 1XHLA 3HB7A 4XWGA 1UXIA 2CW5A 3I9OA 2OV6A 4Q82A 3IUBA 2LK4A 3KE9A 1C50A 1QO0A 5I9TA 4QYXA 1X1TA 1DTWA 2JK0A 4BAUA 2D1TA 2R7UA 3A9WA 4QTTB 2B3DA 4L72A 5B4TA 3HTXA 1FJXA 2WDZA 5PGMA 4V1CA 2EC5A 3ZWMA 3L4BC 1KIAA 1MUUA 1NBEA 3HU1A 3NHRA 1ZK4A 4W5WA 1PG0A 3CONA 1HI9A 2RGNC 3WMGA 2Z43A 2WWIA 4QARA 4FN4A 2C4KA 2W70A 1TM1E 3PC6A 3MIIA 4J03A 5ICSA 4DQKA 3L7YA 4LXXA 4EKWA 1YB4A 3BGIA 2QRGA 2I1WA 2OCKA 2BHSA 2Q2QA 1YRAA 3GGGA 2CLIB 4W4TA 3H11A 2ECQA 1ZVVA 4TUYA 5B4UA 4DJEC 1M7HA 5H9WA 1CJKC 1CQJB 1WZEA 2PS1A 4Q9NA 1ESNA 3EFBA 2A59A 4P22A 5AYVA 1QNFA 1UKAA 2X2OA 2PX6A 3PE3A 3WX0A 3RH0A 4EARA 3BG5A 4H3VA 4U5HA 1RTTA 3GW8A 5HKOA 2BKLA 3ROMA 2CB9A 1EK1A 2KJGA 5GAJA 4DLZA 2FN8A 3MPOA 3UW3A 1RYMA 1CHDA 3EXEB 1E59A 1J0XO 3GFSA 4JX8A 2JKVA 2OBXA 1SCKA 3W8FA 3L18A 4MIKA 1KYYA 1G8FA 3FVQA 4HDSB 4EHDA 1T0IA 5IUNC 5LL6P 3NGMA 5PNTA 1GPYA 1FVFA 1GV1A 2JGRA 2ZJFA 2XBLA 4ZD6A 4J6EA 3VR4D 2G71A 2D5AA 4BX9A 5KTTA 4AYTA 4WLFA 2VK8A 4OUKX 4F4CA 2MWQA 5JAQA 4HYQA 4NCNA 1OTXA 5EKXA 1YIDA 5K3CA 1KMHB 3CEXA 2PH1A 2P78A 4UFPA 4M98A 1RWQA 1PI3A 2ZRFA 2WT9A 1V25A 2BE7A 3ENWA 2C2GA 3D5EA 1Z7EA 1NXSA 4OSPA 5CDTA 4L22A 4TKVB 5JI3E 2NZWA 4BVAA 3DLTA 4OB7A 4RM3A 5JCOA 4Z7OB 2P35A 1OLSA 5JFOA 1ELOA 2R44A 1GEGA 3HY4A 3B1VA 1KU2A 3E22B 1R4MA 4S2EA 2NU6A 3JATB 2XXAB 5EFZA 2AI1A 2W4MA 4JVMA 3GY0A 3ZY4A 4DLVA