1VMAA

Crystal structure of cell division protein ftsy (tm0570) from thermotoga maritima at 1.60 a resolution
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
294
structure length
294
Chain Sequence
b'MGLFDFLKKGLQKTKETFFGRVVKLLKGKKLDDETREELEELLIQADVGVETTEYILERLEEKDGDALESLKEIILEILNFDTKLNVPPEPPFVIMVVGVNGTGKTTSCGKLAKMFVDEGKSVVLAAADTFRAAAIEQLKIWGERVGATVISHSEGADPAAVAFDAVAHALARNKDVVIIDTAGRLHTKKNLMEELRKVHRVVKKKIPDAPHETLLVIDATTGQNGLVQAKIFKEAVNVTGIILTKLDGTAKGGITLAIARELGIPIKFIGVGEKAEDLRPFDPEAFVEVLLSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cell division protein FtsY
publication title Crystal structure of Cell division protein ftsY (TM0570) from Thermotoga maritima at 1.60 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Protein transport
total genus 111
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1vmaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vmaA02
2X2EA 3ECCA 3MWYW 4GSYA 1MRNA 4WAUA 1G1MA 3NBFA 3S1AB 3T34A 1E9BA 2O8DA 3UWOA 4Z8YA 521PA 3QKRB 4FW9A 1L2TA 4A92A 3K0CC 4ARZB 3LBNA 4L4UA 4UNSA 5EE1A 4BZQA 1P2VA 2PT5A 2Q9CA 3OAAD 1LY1A 4JBYA 4PX9A 4A2PA 2JIZA 4RJLA 1K6MA 3PQCA 1ZNWA 1S96A 4FI3C 4RD6A 3VR1A 2ZU6A 3GLGE 3W5IA 3THOA 2DWQA 3KKNA 4PHGA 3NHBA 3QKUA 3BFKA 3W34A 3KFVA 1VTKA 4RD4A 2WOJA 4QKQA 4PZLA 4LUCA 4M1SA 1RIFA 5C2JB 2GCOA 1SHKA 5JSZB 1FX0B 4YDHB 1NN3A 1SXJD 2R44A 3B82A 4BFUA 3VU9B 4NBSA 4HSEA 4A0FA 2QA5A 4MGYR 2XZPA 2PLFA 2C03A 1R2QA 5A5GA 1KY2A 3B13B 3B1WA 5JBQA 2QM8A 3CLVA 4I1SA 4DBLC 1IJFA 2JLQA 2X8AA 3X1YA 3KQHA 2HCJB 4WOPA 4FMDB 3AGPA 5FL7D 4EQ6B 4Q9LA 1XTRA 1PZNA 1IAQA 5CDFA 2JLWA 5AJXA 1BYIA 1D2MA 5EUMA 3QKSA 4B3DA 4C7OA 1P60A 3T1VA 4W5JA 1HE1C 2FFAA 5FOWA 3NDPA 4NYMR 1BYUA 1NLYA 5BWMA 1QHIA 5J47A 4D6PA 1PUIA 2GJ9A 4AKGA 4H9GA 2GCNA 2J41A 3PENA 4UNRA 4XWOA 1GP2A 3GLHA 5IDVA 3ZZTA 5TMPA 4JLPA 1U90A 3EZ6A 2O0JA 4C0HA 2ZVQX 1E2FA 3IILA 4BFYA 1R5NA 4R98A 1TEXA 3QPWA 3LW7A 4MRVA 2H57A 3R7WA 3D8BA 3PUWA 3QXCA 2GXQA 3HYTA 2DY1A 2XTZA 5DN6A 1XD9A 4O0MA 3TVTA 4A82A 4DLVA 2FOLA 1YU9A 2CLSA 2IXFA 1E2MA 2JA1A 3BBPA 4P4UA 2YKGA 1YHNA 1UKEA 2O8BB 3KTAA 4PC3A 5IRCD 1UM8A 1JNYA 2G1KA 4JL8A 4BLTA 3B7GA 3SHFA 4AKEA 1XTJA 3RABA 3IEUA 2PMKA 3NDBB 1WP9A 3LLUA 4IXNA 3LO5A 4O3MA 5G41A 5F2EA 4KYIB 1JR6A 2A5GA 2Q9AA 3Q5EA 2EYUA 3EWAA 5FI0B 3L8YA 3DZ8A 5J4VA 2NTYC 2VPPA 3WNBA 2LWIA 4LK2A 1G3RA 3B60A 4G5RA 1UEJA 2FEMA 3CR8A 4NYJR 2X2FA 2HT6A 2HT1A 3PG5A 2ZS8A 2WMNB 2P65A 3IDQA 4Q18A 2QP4A 1A2BA 1XDBA 2V54A 3C7KA 4P31A 1CEEA 4YMUA 2WWFA 2ZE6A 2BJVA 4U02A 2IX3A 3U60B 3OF5A 4QFMA 1TQ2A 4MA4A 4V0NA 1N5JA 3B1XA 3B6EA 1LS1A 3MJHA 5GJVC 2WAXA 2PMDA 1P2UA 2CLCX 4B73A 2QGNA 1YE8A 3P26A 4Q1DA 5E95A 1FNMA 4NCJA 3AKYA 4KBGA 4I1OA 3PEVA 3QVUA 1N5KA 2ZRMA 3DM5A 2PEYA 2K5UA 4D81A 2ZQ5A 2HJVA 2AXNA 3CNNA 1TU4A 3LW8A 2MMGA 3I4LA 1QHSA 4HDQB 3ZZ0A 1VG1A 1NP6A 1EX7A 4XWKA 4TL6A 4TWZA 1CS4C 4MQBA 2J1LA 1QG4A 5BYJA 3I8XA 1LFDB 3KJEA 4ZI3A 1YJ5A 3RSLA 3TRFA 2ZRDA 2ATXA 1L4UA 3KL4A 3C16C 4W7SA 1IY0A 1S3GA 3Q5DA 1X6VA 3EPHA 3NXSA 3W6PA 1IN6A 3KJIA 4LJAA 4ABYA 2P2LA 1QBKC 2GK7A 2W6JA 4HB0A 4WZBE 2PZEA 1E4YA 3K0CA 1VIYA 3K9HA 4NKRA 4V0LA 4B2IA 1VPLA 4DSOA 4F4CA 3Q7PA 1GKYA 2ZREA 2ZRIA 2CVHA 2EFCB 1E0JA 3L2OB 2RGCA 4BUJA 4F4JA 1KAGA 3OE7A 2V7QA 2W2XA 2ZRGA 1CP2A 3FPAA 2JATA 5F3WB 3EA5A 1PLLA 4Q1FA 4BE7B 2RGNC 4DDUA 3RHFA 1ANKA 1R10A 2JLRA 2V8OA 3HR7A 4XD7D 4ZV4A 2XJ9A 5DLQC 4UXIA 5JSZA 3L0PA 3CKLA 1GITA 4TSFD 4PANA 3V4RA 5JWRA 2ZS9A 1L4YA 2ZI9A 3WP1B 1E99A 3GJ8A 3AVVA 2BBWA 4JLVA 1EXMA 2Z5FA 3A1VA 5KOYA 4JZKA 3CM0A 2PCJA 1JECA 2NO0A 4B35A 2EW1A 3CNLA 2A5YB 1XJQA 4QM7A 3Q3JB 1LS6A 2WAYA 3BERA 2DFTA 4CEHB 4RZ3A 4OK3A 2ZAMA 4MH0R 5J5CA 1IY2A 4DVGA 3W6NA 1ZAKA 2PZGA 2DFNA 1NG1A 1Z0KA 2G88A 2XNDD 5FOVA 3WBKA 4HEJA 2LCFA 2J5XA 4QNMA 4PHFA 4A6XA 1X8LA 4QOSA 1XWIA 1LF0A 2ZE8A 1NN0A 1F2UA 3LNCA 2JLZA 5K8IA 3KQKA 3EARA 1W0KA 3IQXA 4HAWA 1LTQA 5JRJA 1Z06A 4PQFA 2CE7A 3U5ZB 2FSHA 4LBZA 4I4LA 3ZVRA 1KI4A 3A36A 4AK9A 2CCKA 1G20E 2JJ1D 3OIYA 3A6PC 1W7AA 4M21A 1UADA 2A5DA 3A4LA 4YMWA 1X1SA 2RGAA 2ZJBA 1G17A 3GLGB 2VEDA 2ZRCA 4JVLA 2G83A 4D0LB 4IKEA 1Z29A 1W0JD 1DE0A 4JSYA 3NTUA 3PVSA 3H0KA 2AX4A 4IOLA 3R9WA 3KKOA 3QOFA 2GJ8A 1FTNA 4PPNA 5DYGA 3OHMA 1VMAA 4W9MC 3PEWA 1SULA 5CITA 4IJMA 2YOGA 4IXMA 3ZVNA 3C5HA 4JBXA 2C9OA 3EW9A 3OZXA 3AEZA 3N2EA 4WBSA 621PA 4QGFA 1NVXQ 2CLDX 2LKDA 2WSSD 4UXJA 4FMCF 4C3ZA 3L0IB 2ZUDA 4NE2A 1F60A 1S8FA 3EZ2A 4DT1A 5FUVA 4M0LA 4DHEA 2ZPTX 3T61A 2QMUA 1ELOA 1NMZA 1P6XA 2IYUA 1VCIA 2ZIAA 2CL6X 3TE6A 4B47A 2KJQA 3CUEF 2GEDA 4YMSA 1KHTA 3CZQA 3SFZA 2P6RA 2V3CC 1KI6A 2YHSA 3SQXA 2WTUA 1QVRA 1XMJA 1Z6XA 2BKEA 2KBEA 1Q21A 3KFXA 4EKDA 3DOEA 1WBDA 2REOA 5CM8B 4C9BA 1QRAA 3RS2A 4M9SA 1VHLA 3FYHA 4OHXA 2F7SA 1ZMXA 2O5VA 5DHFA 5F9HA 1DO2A 4A8JC 1ZM7A 5C18A 3TMKA 1EGAA 2VHTA 5DYIA 3DHWC 2NG1A 1ZD8A 1RJ9B 5BN5A 2OAP1 1Z2AA 3EC2A 4URYR 2OFWA 3HU2A 1DVRA 3IIJA 3DKPA 2O8FB 2GDJA 2VBCA 4B33A 5B2ZA 2FJUA 5EQTA 1KOFA 4XSGA 1OJLA 4A0HA 2BDTA 2YC4C 4FCWA 2CNWA 4IOJA 4OI0A 3FHOA 4Q1BA 1G41A 2QENA 2ZRNA 3EXAA 3FB4A 3CR7A 2JCSA 2GZDA 1E79A 2ASEA 5AJYA 3ZH9B 2WIAA 3P1JA 2O8FA 1KNXA 2ONJA 3UANA 5HZHA 5JLJA 5F9FA 4IDQA 1VDZA 3PXGA 3TIFA 3X1DA 2ZRBA 4RSGA 1VYTA 3IEVA 4NU0A 3IUYA 2VP5A 1GAJA 2ZJYA 4FWIB 4YQFA 1W46A 3E2IA 4LJYA 1AM4D 721PA 3AVQA 5FH9A 4LJ8A 4A2QA 3T06B 1KMHB 4ZCIA 2H92A 1UBCA 2IF0A 4V02A 3I61A 5GVSA 1OHHA 4QXAA 1XEXA 2BM1A 4D25A 2FU5C 3FGNA 1W36B 4CEIB 1N25A 5ELXA 3AVTA 3THXA 4OHWA 1CULC 2UKDA 2AKAB 3O8BA 4Q1AA 1P9RA 3LBHA 2O52A 1KO5A 1CF4A 4Q47A 1IY1A 4KYUA 3REFA 1KMHA 3ZVLA 4FD2A 821PA 4BFZA 1JJVA 4OQLA 2D7DA 4DDVA 2AD5A 3DMNA 4CEIA 1OLOA 4XWAA 3TKLA 2CCGA 1TUIA 4GPTA 3VKGA 4ZPXA 2NO6A 1BMFA 3CW2A 1EK0A 1T3SA 3VX4A 1OV4A 1P62B 4EUNA 1Q3HA 2F1JA 1LB1B 3GJ4A 1MR3F 4K46A 4RD0A 2FV8A 3QBVA 2RCNA 1ZNXA 2WBLC 3NEYA 2QT1A 1U0HC 2ZE5A 3ZQ6A 3ZS9A 2OUKA 2JJ2A 4UNNA 3FMFA 4TTQA 1Q1BA 2FZLA 4NONA 1KK2A 1I2DA 1UBEA 5CM9C 1ETUA 1AQYA 5M04A 1N6IA 1YR6A 2QROA 3GJ0A 5L8VA 1W4BA 5B58C 1OFTA 3WNDA 1US8A 2FPKA 1Q57A 3BAFA 4HI0E 3UXMA 1GFIA 4LPKA 1MRSA 4XTRA 4R2IA 1KGDA 2W0MA 3EWSA 4DC9A 1FPMA 3MLEA 4FINA 3GLIE 1SVSA 1EWRA 2A3RA 4WVFA 4CDGA 1PUJA 5JJKA 1NIJA 2W6ID 1VYUA 2IHBA 1SXJE 4EJSB 1E98A 1Z0DA 2YNMA 1G21E 2N42A 1XTSA 1KSHA 2QG6A 2GCPA 2VP0A 3U44A 3K70C 3IO3A 4YLGA 5G3YA 2ZYWX 3B2EA 1G4UR 1FW6A 1ZUIA 1ZM3A 2ZR9A 4HUQB 4E09A 3GLHE 4C0LA 1JR3E 1II9A 3PEUA 4IDPA 4OL0A 2GAOA 4B3BA 4PXAA 3W3ZB 1T8TA 4QBFA 1YZUA 4RD3A 2XZLA 4CZ2A 5H1YA 5FTNA 4PFSA 1M2OB 4GL2A 4MYTA 3K09A 3BK7A 4B43A 4PZYA 2P67A 3UG7A 1XTIA 5KPJA 1FNNA 1R8SA 4BFSA 3X1WA 4LYFA 3THWB 3UKDA 1W2HA 3UATA 3LFUA 2ZJOA 2ZRHA 2IS4A 3A4MA 4F93B 1P73A 1EFRA 1N3BA 2GXSA 1NSFA 1M1YE 1X1RA 2YOHA 4WZ6A 3X1ZA 4DEXA 3CPJB 3TLXA 5C4MA 3K9LA 3DPUA 2UZ3A 2J46A 5EP3A 3VX3A 2ZS7A 3AVXA 1XXHE 4L9SA 2W0SA 1CLUA 2JJ8A 3U2QA 3THWA 1K5DA 1R5BA 1N0UA 3BXZA 4ZI2A 4RZ2A 3ZVMA 1YZQA 2IYXA 1A82A 3IBYA 4KFTA 4CW7A 2J3EA 1E1QA 2R6AA 2RGBA 4OHVA 1H8ED 4UKDA 4GZMA 4YXWA 1W1WA 2IYVA 4XH9B 2ZI3A 5EXSA 5JJIA 2FEOA 4JT4A 1G7TA 3T12A 2CE2X 2HYDA 4G3XA 3RC3A 3RS3A 4HB2A 5FUYA 5KNBA 1T0JB 2QRNA 3GEHA 2ZI4A 1C1YA 2J45A 5UKDA 1BH2A 4HAXA 2QE7D 2QAGA 4AYWA 1FP7A 1W48A 1NBMA 4HLQB 5EUQB 4AD8A 1OXVA 2V6JA 4Q9IA 3QE0A 2BBSA 4TMZA 4Z1MA 1C4OA 1KO1A 2F1HA 2KE5A 1GRNA 5JWOA 3T1TA 3K0FB 4QL3A 1WQ1R 1G3QA 2BEJA 4IEEA 2B6HA 3SR0A 2NIPA 5J4KA 4CGZA 3EPLA 1Q0UA 3FFBA 3AP1A 1KJYA 3IHLA 1ZRHA 5K8UA 1DTSA 2C5LA 2F1RA 4ASUA 2J59A 1GOTA 2QZ4A 2IS6A 1G3MA 1NY5A 2D06A 5GVRA 2IEYA 4LYJA 1E69A 1IXSB 2BV3A 2GHIA 4LI0A 4XSHA 5LBIA 3RLFA 1M74A 4L16A 1KK3A 1KI8A 1R7RA 1OKKD 4GMXA 1E1RA 1W4AA 4BEJA 1S2MA 2D2EA 4FXPA 4D4JA 3NH9A 2OBMA 2GZHA 3M1IA 2CL7X 4NYJQ 1NVVR 2CK3D 1TL7C 4GDFA 2ODEA 2ORIA 1W4RA 4M22A 3I32A 1CBUA 1YR7A 1WMSA 3DOFA 2PJRA 2O8CB 1Z6AA 1DAKA 3LXRA 2ZSDA 4F4IA 1Z0IA 5FPHA 1T6NA 1NIPA 4IVQA 2IYSA 2IL1A 3AKEA 1W44A 4X8OA 2VHUA 3GLFA 3K8YA 3QXSA 4HZUA 2JDIA 2B8TA 4QBHA 4LBYA 4CT4B 1NLZA 1WDTA 4PPFA 2CHQA 1UBFA 3ND9A 3P32A 1HEIA 3ADKA 4Q4AB 3L82B 1C9KA 5BN3A 2YWGA 5TV2A 4G01B 1N6PA 5JS7A 3BH0A 3EC1A 2NPFA 3AKDA 3SBEA 3BORA 1TAGA 2OXCA 4R9UC 1KK0A 3VKHA 2BJWA 1Q1ZA 1XD8A 4KVAA 1JQLB 2BVNA 3NC1C 4GT1A 4DUGD 1PVOA 2J0QA 3T5DA 3IIKA 1GZSA 2GBLA 1RYHA 2WMOB 4A9AA 5FR1A 1ZD1A 3GJ5A 1G5TA 2ATVA 3B1ZA 1DG1G 2BC9A 5FBQB 3A4NA 2D2FA 4PO8A 3NC0C 4C0KA 2BBOA 1SVMA 1II0A 1JI0A 1P9WA 4QHSA 2LKCA 5CYOA 1J8YF 1Q20A 4DSTA 1N0VC 3RRYA 2F3TA 3ZQJA 4BLSA 5H8WA 1DO0A 221PA 4A4DA 3O8RA 4XIGS 4HAVA 4LJ7A 4IEIA 3U61B 1E2IA 2OZEA 4DDTA 4URXR 5GJBA 1II8B 1U8AA 1D9ZA 3Q85A 2P0EA 1U2RA 3GEIA 2H17A 1B23P 2QU8A 5B57C 2QAJA 3ZD7A 1EFUA 1SVWA 3S1AA 1OSNA 3FMPB 3QKRA 2FMXA 1AZTA 3I73A 4ARZA 1S0UA 1F2TB 1TADA 2QI9C 2BM0A 2WJHA 3FVQA 2V55B 4V0MA 2HV8A 4JLNA 4CT5A 3FHCB 5CIWA 1WE2A 2NMVA 1AN0A 1U0JA 3RYTC 2OAQ1 2ZI7A 4HAYA 2WOOA 2Z43A 5ANRB 1XB2A 1JR3D 3R8FA 4AI6A 3I92A 1MO3A 3OEHA 1AZSC 1T8UA 3KKQA 3W9YA 1HT2E 1FX0A 1QHGA 2A7QA 2AN9A 2N1BA 2PLRA 3MRSA 3LX5A 4KFRA 2ZRKA 2C95A 3VU9A 2UZIR 2ZYVX 4AYTA 4CVNA 5DI3B 3ONWA 4M9ZA 1NKSA 1U0LA 3GLIB 3P4YA 4HZIA 2VP4A 3CF2A 2WSMA 3VFDA 5DN6D 3QBTA 4NH0A 4JLJA 1SXJB 3JZMA 3JVUA 4U00A 3T1QA 4Z51A 4EQ6A 3OAAA 2ANBA 2CVFA 5C4GB 3NHAA 2RGEA 5C1BA 4WW0A 4XTCS 1YZKA 5FPSA 2F9LA 4YMVA 1UDWA 3NBZC 1OH7A 4BLRA 1NL3A 1Z3IX 2NGRA 3Q9LA 1J90A 4EPWA 3RRZA 4Q7JB 1HE8B 4AYXA 3IBGA 4GBMA 1DADA 4ZDKA 3LRPA 2ZJ2A 3OEEA 3FMOB 2JGNA 3ZJYA 5SZIA 1BO6A 1MABB 2ZETA 3G5UA 2YC2C 4IVRA 4MKIA 5DH9A 3AQ4A 2Y8EA 1Z08A 3TSWA 5FL7A 1KKMA 4BFTA 3ICQB 2FPMA 1N6KA 1S9HA 3ZIAA 3TW8B 1E2KA 4EPYA 2IYZA 5GJWC 3E5HA 4UQOA 1IXZA 4JIMA 3B78A 4TYPA 5FTJA 4KHZA 2O8BA 4M9QA 4Q4HB 4QM6A 5KO2A 1GWNA 4Q02A 4ZKDA 4M1KA 2FFHA 2FF7A 2ZJ5A 4BQSA 1N2CE 3CZPA 3QG1A 5IK2D 4ACBA 4Q7KA 1SKYE 4PSVA 3TQFA 5FI1B 3V00A 3UMSA 1R8QA 2W00A 2OCYC 3QJYA 3ND8A 1D5CA 2FSFA 5FPTA 3VR2A 4EIWA 2ZITA 4DLZA 3SN6A 4K81B 3SBDA 4OI1A 2GVDC 3IGFA 3LX8A 5CLQA 4LRWA 4B44A 4LV5B 1Z6TA 1R0ZA 3AP2A 1J70A 5KU1A 2EFDB 2O0KA 3GJ7A 3WXMA 2BMJA 3ZZUA 2RGDA 4D0GA 2D4HA 2R9VA 3W90A 5EE0A 3DM9B 3C5CA 4LV6A 3VHXA 4HAZA 3NVAA 2W6JD 4GOJA 3GPLA 1FOEB 1V43A 2D7CA 5J40A 3HU1A 1W47A 1DAIA 3NG1A 3BIFA 2IYTA 1GILA 3OE7D 4OI4A 4RVCA 3GP8A 2V7QD 4C0SA 4A1FA 4PAQA 3AVUA 3AF1A 2C96A 4IOMA 1I4DD 5CYPA 4JKYA 4JLKA 1OH8A 3OIWA 3MMPA 1JAHA 2OHFA 1N6OA 3V4FA 4A2WA 2QP9X 1G7CA 2GWHA 1JEDA 4MYCA 5JCZA 2HXSA 2WWXA 4BLPA 2XITA 5CJ2A 1M8PA 3F5FA 4CEJB 2J7PD 5DGXA 3EIQA 1EFHA 1RW4A 1T91A 1HURA 3D7MA 1PLKA 3HWSA 4GI7A 5IT5A 3AP3A 2HLDD 1RZ3A 4G5QA 4DLYA 3NEJA 1KAOA 2WWYA 2FZ4A 3KXLA 2ERYA 4BEBA 4L8GA 4TMXA 5P21A 1YZNA 3WYFA 3IPYA 3QKTA 2ZM5A 1OIXA 3NKVA 1X86B 3OFNA 4EPXA 3CBQA 2ECKA 2J0UB 3K0EA 1T3HA 4TMWA 1ZIOA 2JLXA 4RCYA 3LVRE 4C4PA 3JZAA 4BFXA 3CRMA 2AL7A 3TSZA 2CDNA 1RE0A 2QEQA 4PZZA 4KAXA 3HPRA 5JWHA 3WMEA 5K8LA 2R6DA 1CR2A 4OQXA 5TARA 1XU4A 4V0KA 2F3RA 3IPXA 1DPFA 4KBFA 5J4HA 2CJWB 1CU1A 2CHGA 4JL5A 3TAUA 1Q12A 2GF0A 3WRXC 3VMFA 1WGWA 2IHYA 1X3SA 2JEOA 4JVNA 2RHDA 5FUXA 1W36C 1AS3A 3SS8A 4DJTA 1CR4A 4TYYA 3ASZA 2FGKA 1R6BX 2GETA 2IBMA 2QGZA 3QQ5A 3G0HA 3IO5A 3TUZC 4US1R 1HYQA 1W4CA 2Q3HA 5IF9A 2C9YA 3PUXA 3H4MA 4QBIA 2OLKA 4ESVA 1KSGA 3MUFA 1ONBA 4CEHA 4EDHA 1NNEA 4XD7A 2VH5R 2WWGA 2ZANA 3SE0A 4KFSA 4HLUA 5JHGB 2WIBA 2ZVPX 1ZP6A 1FMJA 4PC7A 4GFDA 4JYBA 2DHRA 1CR0A 2WWWA 4C0AC 3FOZA 2VSFA 3V9PA 3KXIA 3FDIA 1JEEA 3R9IA 3PFIA 2WJGA 4MKFA 3FE2A 121PA 2AHOA 1U8ZA 4LHVA 5EE9A 4DIEA 3R9XA 1AJEA 4PHTA 4BFVA 3T15A 2ORWA 2OG2A 1G3UA 1ZC4A 3LQQA 3KZ1E 4Q03A 5A4JA 3GLGA 2OSBA 5AR1A 3CF0A 4FMBB 3SYNA 4KSBA 1XD2B 5DI9A 4RFSB 2XNDA 4P32A 4TZ0A 4GRAA 4MGKR 1AKYA 1NMXA 4PC1A 4JLMA 3F0TA 1FUUA 3N2IA 3W5JA 3D3QA 4BLOA 4LGMA 4TQ9A 1UEIA 3NH6A 2XGJA 2DBYA 4DB4A 3D6TB 2IWHA 3RC8A 3IIMA 3HR8A 1GKIA 2UVQA 3RRNA 1ZUHA 1JALA 1NMYA 2VF8A 3CF6R 4RFSA 3RS0A 4URWR 2VL7A 1OFUX 2F6RA 2YWFA 4P4SB 2P5SA 1GVNB 3UK6A 3ADCA 3WHKA 1N6LA 3TNFA 4B71A 5HKKD 4R7ZA 1XMIA 2OBLA 2GXUA 2ZSBA 4C2UA 1XCPA 2CNWD 3K09C 1CJUC 2SHKA 1VG8A 1W0JA 3U3RA 1HT1E 2ORVA 4TYQA 1DAMA 2VIIA 4GOXA 1W5TA 3LBIA 1JBKA 5EP2A 4ZDJA 2VHQA 4DIDA 4LZZA 3TK1A 1G9XA 4TN1A 5DNYB 5DHAA 2XX3A 3DL0A 1ZM9A 3WP0A 1G5PA 1Z0FA 2WPDD 4Q19A 4TMTA 1P2SA 2C04A 3KKPA 4R2HA 1E96A 2FSIA 2ZRAA 5AJZA 5HZKA 2WJJA 1KKLA 1NY6A 4GP6A 3CX6A 1Z6GA 1IN5A 4KJZA 1X8KA 1EESA 1RJ9A 4N1AA 5TVKA 1IXRC 5G40A 1OHHD 3VNVA 3DMDA 4A6PA 3EZFA 5IHPA 2Z83A 4PPGA 2ZJZA 4LSGA 1ZBDA 1VCMA 2HJGA 4B6FA 1ZNZA 2RHMA 1QHNA 4TL9A 2AK3A 1SVOA 5JCPA 3KXKA 1UKZA 3ADDA 1DELA 1KO7A 5KDOA 1GDDA 1SKYB 2ZSAA 4HB4A 4P3YA 1TMKA 2P6UA 3FKSA 4Z54A 4I99A 5JFGA 3X1XA 3B9PA 2A5JA 2GEUA 3CRVA 1GL9B 1E94E 2JLVA 5AUPB 2CBZA 1L7VC 2OFXA 3GMTA 5EP4A 2QAGC 2NQ2C 2XOKD 2XSZD 4X8HA 3SYKA 3ADBA 5KHOC 2EYQA 2VHCA 2ZYTX 1BMFD 1NLFA 2BKUA 1OB5A 4MUBA 3H2YA 2OCPA 1G7SA 1U8YA 4Q48A 1XP8A 3FMIA 5FTKA 3H84A 3DO6A 1E9AA 2GJAA 4IOKA 4DWJA 4M8NE 4QGGA 4HAUA 2H5EA 5EJEA 4JSTA 4DEYA 1LV7A 1XTKA 4Q4LA 3EX7C 3QPVA 1QHXA 5EXXA 3WYAA 3FKQA 2JJ2D 4Q21A 4BFWA 4Q4JB 4BLQA 1Q1EA 2OLJA 2DFLA 1E9SA 1Y63A 5EZ6B 3SYLA 2IW3A 4IDNA 4OHYA 2R62A 2MSCB 3MAAC 2RB4A 3A1WA 1BOFA 1K5GA 2XJ4A 3SJCA 1E2QA 1IHUA 3KKMA 2YWHA 1FFHA 4B6EA 4HLCA 5LD2C 2BCJQ 5FL3A 2REBA 4Q1CA 2J7KA 1U81A 2O8EB 4WXPA 2XXAB 4E07A 1E2GA 5KSPA 1NVVQ 1K8RA 1R0YA 2OO7A 5AUQA 3RWOA 3UIEA 2GZAA 1DAFA 1J2JA 1XEFA 2R6GA 3TJZA 2V6IA 1RKBA 2WWHA 3CX8A 2KI5A 1SZPA 2HEIA 4LJ6A 2J0SA 2C78A 4P0TA 3ICEA 4LHXA 1OXSC 3A1UA 3RWMB 4HUTA 1COWD 2X19A 1XEWX 5KDDA 1T4GA 1KMQA 1E2NA 5KNDA 2XXAA 4D26A 3U3KA 1V5WA 2I1VB 1E0KA 3A8TA 2IXEA 3DZDA 2WJVA 2GA8A 3GJXC 3L0OA 5AUNB 3BOSA 2BOVA 1SKQA 1NVUQ 2DFKB 1E3MA 5CDFE 1HV8A 3BB1A 1QHYA 2EFHB 5KNCA 2YVUA 4QJ4A 1UJ2A 4QBGB 1XCMA 2A5FA 3WHLA 5L3RA 4F38A 3L43A 1EFCA 3OIUA 4PQYA 2PCLA 2GBLC 3EZ9A 1KI2A 4I1VA 3AUXA 4TLCA 5SZKB 1XPOA 4TT3A 4JS0A 3HP1A 1ZUNB 4J0QA 4F7WA 5EP1A 4ITRC 3K0AB 2GJKA 3QEJA 2BCGY 4LV8B 4HLDA 4ZIRB 4RZUA 2QQEA 4QJ3A 4PO9A 1UAAA 4Q9HA 4G0NA 3TH5A 3RS7A 1P3JA 3NWJA 2RGGA 2NOAA 2V9PA 3AVOA 4EJSA 1T5LA 4M4SA 4RKEA 2WKPA 3JVVA 3LAWA 3MGCA 3TVDA 2CCJA 2WICA 2ZR0A 4OK5A 3ETLA 4HUQA 5FTLA 2A30A 2ZUBA 2IWRA 1NKTA 2H18A 1SVIA 4OQMA 1E1QD 4A8JB 4KLNA 2ZUCA 2AKYA 2QBYB 2EU8A 2R6FA 5SZJA 1GTVA 4JLBA 4YXWD 2QTFA 3MWLA 4DCTA 4TL8A 3HDTA 2W2VA 4LC0A 4EFNA 1AKEA 3QY0A 1UDXA 1H8HD 2E9SA 3CH4B 1EWQA 4GP7A 1MT0A 2C77A 2VP6A 4WA7A 3U3JA 5JS8A 4MRRA 4ERNA 5GADl 2WVJA 4TYNA 1NBMD 4BRWA 1CJKC 4D4MA 2J0VA 4PO1A 1GNQA 4PTLA 1OYYA 4NYIR 1ZU4A 4MKHA 4N3NA 4QC2A 3SJAA 2HXYA 1RYFA 4LWZA 2H8KA 4NCNA 4XVRA 3QUSA 1YZLA 1E9EA 1I4LD 4OHZA 4DSUA 4F91B 4MDFA 4JT2A 4D4KA 5E7JA 5DIFA 2AFHE 2H1LA 1IM2A 1CRPA 4B48A 1XJ0A 3RANA 1A4RA 2WM9B 4ASUD 3BB4A 2VLIA 1YR9A 3KJHA 1O3YA 2R2AA 1P7CA 2QTVB 3AUYA 1NG9A 2Z4RA 1E0SA 2TMKA 2IUSA 4B3FX 3SOPA 3AKCA 1QVAA 2QT0A 2QM7A 3BWDD 3DKVA 1HH4A 3CRRA 2PEZA 1E9RA 2QQ0A 2WV9A 3M6AA 1SXJC 3PV0A 2BBTA 4OKSA 3RNLA 3WMFA 2DWPA 3B9QA 5L3VA 1Q1QA 4MYUA 2CMKA 5FFMA 3I62A 3WBJA 2VO1A 3I72A 2XZOA 2C8VA 3THYB 2QRZA 1LNZA 2WKQA 3Q72A 1ZYUA 4TLEA 3VR5A 3U4QB 5TXGA 1TQ6A 4E22A 4KXFB 1PV4A 4OI2A 1P2TA 2RH5A 2R8RA 2FA9A 3IKJA 5G3ZA 2D62A 3AB3A 4BZPA 3K0FA 2VHJA 1G291 4JMPA 2REXB 1CRQA 4IDHA 2OCBA 2DB3A 2G6BA 4IFBA 2OE2A 3KUDA 4E5UA 2JLUA 2JDID 2IYYA 1AK2A 3PR1A 2VRWA 5EXPA 1Z0AA 1KO8A 3RVBA 1MKYA 2B7BA 2BEKA 2QE7A 1F6BA 2GRJA 1P4SA 3Q7QA 2BWJA 3LH5A 2IUTA 1M34E 3E70C 3O8CA 3IQWA 4S2EA 1KIMA 2IYWA 4DSNA 3AH8A 4FCVA 4PC2A 2Z0MA 4H1UA 3CO5A 4NHOA 1W2GA 3EA0A 3K70D 2EQBA 4UJ3A 4V0OA 1CTQA 2F43B 1TX4B 1I2MA 2AR7A 2FNAA 1ZJ6A 2GAAA 1GRQA 2AK2A 4LDJA 4LHYA 1P5ZB 2Q6TA 1FQKA 1W49A 2DPXA 2WHXA 4H1VA 5F98A 3WY9A 4UNQA 2O8CA 1D6JA 5KYKA 3HPQA 2ZE7A 3AVPA 2XAUA 3UG6A 1G4AE 4PAMA 1VECA 4DLTA 4IW3B 1JPJA 2HF8A 4DLRA 4OBEA 2GTPA 2JIZD 2Q21A 2EWVA 3U7HB 4FCTA 4K8OA 2Q0HA 4CRWB 1ZC3A 3SEAA 1DARA 1KNQA 2ONKA 4DLXA 3U6BA 4Q4AA 4UNPA 4D80A 3BH6A 1G64A 2R65A 2XEXA 1XF9A 4XJXA 4LHWA 1JXOA 4EPRA 5J4YA 4QHTA 5JMTA 1DAHA 2Q9BA 4QJ5A 1MO6A 2JAQA 3P20A 4WZAE 4DCUA 3ZS8A 4N0DA 4HYYA 4DXAA 1XRJA 1KJWA 2PX0A 1T9HA 5G53C 2O8DB 2YOFA 2RGXA 4PSAA 4Z8XA 1YZGA 4ZDIA 3HYRA 1RVDA 3UPUA 3VAAA 3DVLA 1BKDR 2GNOA 5FBVB 4NPHA 2PH1A 4C0BA 1TPZA 3OEHD 1WB9A 4TZ6A 4Q1EA 2R6CA 2ODNA 4MDEA 3U3MA 4URZR 3RSOA 3BFXA 1Z8FA 4PR0A 4POAA 2DWOA 4LC1A 2NO1A 4DKXA 1AGPA 3TR0A 4WXRA 2GILA 4IFEA 2IEZA 2VA8A 3P27A 2GCOB 1O87A 3W6OA 1II8A 4KU4A 3VR4A 3QXHA 3EZ7A 2V4ZA 5K8TA 3QF4B 5EE3A 5CK4A 5FUWA 1ZCAA 2KB0A 4Q7MB 4R71A 1ZNYA 1ZM4A 3MSXA 4O2LA 4TLAA 4JL6A 4URVR 3LV8A 5LPNA 4DUGA 1GL7A 3AGQA 4G5OA 1F48A 3I5YA 4M1WA 3N5CA 3CIOA 4FMDF 5AWFC 1NN1A 1F2TA 1SVKA 5C46F 2P5TB 5LDDC 4Q00A 4BRUA 3PUYA 3T35A 2KSQA 3QF4A 3QNUA 2QPAA 4BPBA 2F9MA 2JLYA 3PCRB 2QTHA 2QL6A 3OEED 3QKSB 2XNSA 4PSKA 4AWXA 4C7OB 1TF7A 4CYMA 5BW8A 4RCZA 2YJTD 4XVUA 3FFAA 3CONA 1YZTA 3MWKA 5DSZA 4QG7A 1GIAA 1XMSA 2AXPA 1Z22A 2OXRA 3VTKA 5BXQC 1KY3A 2GK6A 5HR5A 1E9CA 2Q3MA 5DI3A 3GLHB 3ZIAD 1ZU5A 3GLIA 2QSYA 4B2PA 2GKSA 2W2TA 1NJGA 1NI3A 4HLUC 1IN7A 2QPOA 1SXJA 5L3SB 2VYFA 1QDEA 4B75A 1AGRA 3R7WB 2ZSFA 3HJNA 4JVMA 3MFYA 1SGWA 4OJQA 4NP6A 1P9NA 3KB1A 1S3SA 3TR5A 2P6NA 4BASA 3QSYA 1JR3A 5FOUA 1RC8A 3FTQA 1XX6A 1QHHB 1B0UA 3KTAB 2GF9A 1FL9A 4A0RA 5SZHB 1OH6A 4A15A 5L3SA 4GMDA 4TLBA 4HATA 1BIFA 4CIDA 1GRRA 1N6RA 2Q3FA 3PIRA 4US0R 4B3GA 3HU3A 3WNCA 1MABA 1OXUA 1XXHB 1NJFA 3EASA 1TF5A 3U7GA 4NZYA 1QHHA 1NRJB 4FWTA 3GCGA 2PZFA 1FQJA 4JLAA 3ZDQA 2BHRA 3OIVA 3SZRA 1LF5A 5FPKA 2PT7A 4E03A 2O0HA 4LCBA 4NTZA 3A37A 2FFBA 3GQBA 1UKVY 4LJ5A 2CXXA 1XXHA 4OQNA 4Q4HA 1Z63A 2MSEB 2QMEA 2HDNB 2IT1A 2AFIE 3I1FA 1VCNA 5JECA 1QG2A 1R0XA 2ZU0C 4JBWA 5FBLB 5TDHA 1F3OA 1SQ5A 3QG5A 4PQRA 3A58B 4AKHA 2ODWA 2PL3A 1KI3A 2AD1A 1HQCA 5KPDA 1TNDA 1CJVC 3EIHA 3B85A 3BB3A 3CB4A 1KI1A 1KJZA 2VSOA 1YQTA 4LYAA 4OK6A 1L8QA 1DAGA 1Q22A 2OM2A 4LBVA 3UWKA 4CF7A 3L8ZA 3WRYC 4KSCA 3NBXX 3K1JA 5HCIA 1IQPA 3CWZA 2CL0X 1N6HA 3BE4A 3REGA 2A9KA 1G7RA 1S9DA 1LVGA 3OFND 1X8JA 4TTPA 4B3CA 5D3MB 4KLZA 1XZQA 5IK2A 3TBKA 1P61B 4DLSA 5FBRB 3RRMA 1G3IA 1Z0JA 2XTNA 2E87A 1XEWY 5BYKA 1E2LA 1Z2CA 3W8RA 2IYQA 2OFOA 3GFOA 1RPZA 1J99A 2GEVA 5E7IA 1ZINA 1NF3A 4DCNA 4US2R 2EVWX 1M7HA 2FX3A 3FWYA 5D3MA 4C2TA 1GG2A 1DAEA 4BWYA 3KQUA 1E0AA 1G5RA 3SFVA 1OIWA 4YDSA 4L9WA 4G1UC 4CEJA 3FHTA 3W8NA 3PUVA 1VKJA 2OT3B 4Y0VA 1SHZA 2I4IA 3Q8XB 1ESNA 5KDLA 5JEDA 2J9RA 4MRNA 2A78A 4LHZA 3U6KA 2IF2A 3T5GA 3E1SA 3I3SR 1FP6A 3A1TA 2YYZA 4EFLA 2DCUA 2L0XA 3LDAA 4Q9JA 4URUR 1CR1A 1IBRA 1EX6A 3IHWA 4RD2A 1T0HB 4MRPA 2W83A 1G19A 1KO4A 3VKWA 1G6OA 1W0KD 2J0UA 3QPUA 1S1MA 4JJZA 1R0WA 1MOZA 4U7DA 5DE3A 5FBWB 3C4JA 4V03A 4D2IA 6Q21A 3B1VA 3EPKA 4HB3A 2J7PA 1IONA 1OT3A 3TW4A 3EG5A 4KV9A 4NCHA 4TMKA 2ZI5A 3MCAA 4DDWA 1XMVA 2HCBA 2HLDA 2OBNA 1R4AA 4ZO4A 5KTYA 1G8GA 4NCKA 4ZCMA 4UXHA 2GJSA 3H86A 2CJWA 1OXTA 2X1VA 5E4FA 2MMCA 2XTMA 4X8LA 1I4TD 2CHVA 2YV5A 4M2LA 1F5NA 1F2UB 1A2KC 2IC5A 4NL4H 4DRZA 3PEYA 3CPHA 1MH1A 3KJGA 3ZD6A 3CWQA 5CB8A 1JAIA 3TQCA 3KB2A 4TSFA 1T5IA 3SU8A 2HUPA 1S1CA 1HUQA 1H65A 4W5WA 5HTKA 1NSTA 4KITB 1N5IA 4FN5A 3SNHA 3EAQA 1RRCA 4AKIA 1U99A 3RS5A 3T1OA 2IA5A 1RRPA 2I3BA 2IXGA 3G82C 4B2LA 2NO9A 4XVQA 1U94A 3F8TA 3TGPA 4ON9A 1HA3A 2ERXA 1E6CA 1OYWA 1XTQA 2IYLD 3BJIC 3I8SA 2IK8A 4B34A 2PBRA 5D3QA 2XB2A 4KO8A 2DYKA 2ZSEA 2QNRA 1T3LA 2BIFA 4KI0A 1G8HA 5LB2A 1SVLA 4LJ9A 3QENA 5CK5A 4EFMA 2B21A 5FR2A 2IUUA 1OF1A 2EFEB 4EPVA 2FWRA 4M1YA 2G9NA 4II7A 2FPLA 2YWEA 1OFIA 4D0NA 3M0EA 2OILA 1ESMA 2VTKA 1QF9A 1ZW6A 1A5TA 2ZRLA 2ZROA 3GJ6A 4LY6A 1YRAA 5GJCA 4DT1B 1XD2A 2QUZA 4AC9A 2C99A 3K9NA 4L15A 4Q7LA 3AF0A 2RAPA 2ZRFA 1NBME 4JLDA 1UFQA 2BMFA 2JJ1A 1OH5A 1Z83A 4JKIA 1TQ4A 1QZXA 2OCAA 4EJSC 1KI6B 1TUEA 1VHTA 4FMCB 8OHMA 2VQSA 3ZGXA 3QIAA 1CJMA 2RMKA 1M7GA 4LX0A 1E2PA 4XOIA 5LB4A 4QGHA 4F92B 4DB2A 1CIPA 3KQLA 1E79D 4M1TA 1PLJA 5HCNA 4P4SA 2QY9A 2F55A 1R5OA 3LVQE 5B64A 3LXXA 2QSZA 1WRBA 3X2SA 3WYGA 4LYHA 1KSJA 4RY2A 2G0TA 4PPQA 3FKSD 3K53A 1IN4A 1CKEA 2Z4SA 3AM1A 2WSSA 1G18A 4MKGA 4DCVA 4MITA 1GL6A 2BMDA 3R20A 5KSZA 2GXAA 4MGIR 4LPSA 4Q9KA 3BS4A 1OW3B 2NPIA 1G6HA 2QPTA 4OJKA 3AVWA 3P4XA 5H70A 5AUOB 3SQWA 3RAPR 1AS0A 1WF3A 2IS2A 5JHHB 4NYIQ 3GFTA 4TQUS 4D82A 1CJTC 1M6NA 4QHYA 4YONB 4PHHA 3SI7A 3EPJA 2H16A 5HKKA 1TTTA 2EFGA 2FDCA 5DISB 1VIAA 3BFVA 3GFPA 1YKSA 1W36D 4HDCA 3I5XA 3CRQA 1E2JA 5JRZA 2MSDB 5CLLA 4KCGA 3GLFE 1HTWA 4GNKA 4ZKEA 1D2EA 3CRW1 1EG7A 1LW7A 421PA 3BC1A 1XFAA 2V1XA 3ASYA 5JZVA 1G8PA 1A1VA 1XEXB 1Z6YA 1KZ7B 2RGNA 1ZIPA 2WPDA 4GZLA 1HQYE 3THXB 1AS2A 2ZJAA 1WA5A 2P3SA 4TLDA 1KI7A 5DO9A 4AG6A 5AJVB 2JLSA 3ZYCA 4BGDA 2WZQA 2FG5A 4DZZA 2VF7A 2ZJ8A 2HF9A 1XBTA 4RKFA 1KDPA 2NZJA 2ODBA 4LOAA 3SDZA 4NMMA 4AG5A 5JI2E 1CXZA 1Z47A 3B5JA 1RRFA 1XCGB 3D31A 4AY2A 5FTMA 4BECA 3K9GA 2ZI6A 5AK0A 2B7CA 3VR3A 4NDZA 3QXXA 5B30A 1OXXK 1BS1A 4RFVA 2WWIA 3LA6A 3DDCA 5H68A 2YZ2A 3VR6A 3MJRA 4YC7A 2ZYUX 1JQJC 3U3OA 1OFHA 4KVGA 4Q4JA 2VP2A 1UF9A 4TMVA 4Q5IA 1IN8A 1Q3TA 2XOKA 2XSZA 2QMHA 1W5SA 2WJIA 1VCOA 4MUAA 1KZGB 3N70A 3KDSE 4Q01A 2QN6A 4QNRA 3LQRA 5BN4A 1E9FA 4YMTA 1HY3A 3RDPA 3VQTA 4N0EA 4V0ME 1GNRA 3C8UA 1IOZA 5J4LA 1Z07A 2O8EA 3C15C 1DG3A 1U9IC 1N0WA 1WCV1 4TT3D 4ZCLA 4G5GA 2BMEA 4JVSB 4PAOA 1OB2A 1FTSA 1US8B 5FOXA 1D8TA 5CIQA 4AIIA 1KK1A 4OQFA 1JB1A 1KTVA 1E9DA 3TSOA 1UBGA 2ZTSA 4GOKA 1XPRA 1G16A 3H1TA 4M53A 3UMFA 2ZRPA 4DCSA 1KI9A 4ILEA 4B32A 1YVDA 2ZR7A 1ZM2A 3CX7A 2KWIA 5JJLA 4HDOB 1RFLA 5FOTA 3KUCA 1EFRD 3U44B 2QMOA 3MG9A 1KDOA 4D4LA 3B1YA 2Z6VA 5FOSA 4LBWA 1KDRA 4X8MA 1VG0B 3QI2A 4M1OA 4EAQA 3BD9A 4TL7A 3U7EB 3QF7A 2H7VA 2G1JA 4UJ5A 1TU3A 4B74A 4G5SA 2KBFA 1TEVA 5EZ5A 4FIDA 5HE9A 2FFQA 3BRWD 2NZ8A 2ANCA 1AIPA 1Z28A 2FSGA 2D3WA 3A1SA 1COWA 4EPTA 2VP9A 4A36A 1OPXA 3K0AA 5KSOA 3CNOA 4DLUA 4ZIRA 2NO7A 3QEOA 5HE8A 1N5LA 5CB6A 1RRGA 1G8FA 3LWNA 3LY5A 2WKRA 3CPEA 4OYHA 1GKUB 3MWJA 3PUZA 1TQDA 1KDTA 2FGJA 4C30A 2B8WA 4TYWA 4IDOA 4QRHA 2C9CA 3AF4A 2CEAA 4O2RA 2I1QA 3VNUA 3F3YA 1Q44A 1YR8A 3C14C 2W6IA 3AV0B 1AQUA 4A8JA 3SC3A 2FH5B 1JPNA 5EE5B 2ZRJA 3PJRA 2QBYA 4P33A 4PC6A 2AWNA 2JASA 4Z1MD 4RZXA 2C98A 2N46A 3TAHA 1JJ7A 3QVVA 3K0SA 1J7KA 2HYIC 3DEFA 3M4YA 1DOAA 1AA9A 2X77A 4DLWA 3NBYC 2QORA 1P72A 1WXQA 5KUTA 2XB4A 1E2EA 4QGAA 2W58A 1Y3AA 3LD9A 4TQAA 4Y0AA 1OE0A 3AVYA 4ESHA 2ZAOA 4C0QC 1FMLA 1D9XA 4P4TA 5JI3E 4IRUB 1FZQA 4BZXA 3C41J 1Z5ZA 3GJ3A 2QAGB 1E32A 2GVZC 2C2HA 2ZXUA 1GSIA 3BGWA 4O25A 3UMRA 4KFUA 2AWOA 1G8YA 2RKOA 3MD0A 1XZPA 4RD1A 1ZCBA 1E1RD 3RS4A 1GNPA 4NYMQ 1N6NA 1E2DA 5CJPA 1VYVA 5EXTA 1D2NA 1H8HA 1PJRA 4B3XA 4L5BA 3OESA 3BH7A 3B8HA 4JJKA 1GUAA 5E7MA 4W5HA 2DR3A 2VSXA 2YINC 5FPYA 4A0GA 3L0SA 4MRSA 3TUJC 5HPYB 5E3HA 4M1MA 1H8EA 1MV5A 3U7FB 1E4VA 2QP3A 4ACAA 1TF2A 1JXMA 4WIAA 1YRBA 1S4QA 4AURA 3THYA 3U4QA 2F1IA 1IJEA 2WJYA 1A7JA 1EFTA 4U5XA 3CH5A 5LD2B 4Q66C 4IHQA 1J8MF 1MO5A 1ODFA 2D74A 4JYCA 1FUKA 4LJ4A 5JEEA 3NIBA 4IVPA 1ZVQA 3KX2A 3KQNA 2IS1A 2PJZA 4I81A 4M9XA 3AF2A 1E2HA 1NN5A 3EIEA 2IYRA 3GD7A 1DEKA 1UKYA 4C0JA 1U9IA 2PX3A 2ZEJA 1U98A 3O8DA 1OIVA 2B92A 4TTRA 1DBSA 1KSFX 2GESA 3GLFB 2OEPA 4HZUB 4I1UA 2EWWA 3R8CA 5TY0A 3PITA 4KODA 5TB5A 3VHLB 2E1RA 4S35A 3J81k 3ZLJA 4B76A 4MYHA 2G3YA 1MO4A 3LLMA 4JLOA 3SJBA 1GM5A 5L3QB 3TUIC 4NCIA 5KSYA 2F43A 3QXJA 1XNJA 1DS6A 1OKKA 3WMGA 4MGZR 2G0NA 2G77B 3K70B 5AJWA 5A0FA 1XPUA 2OV2A 2CK3A 3W3AA 5BQ5A 1UPTA 2V1UA 1VG9B 3GEEA 5L3QA 2FE4A 1ZD9A 2A2ZA 3O47A 1WBBA 1NVWQ 4ZDWA 3SHWA 3AF3A 2FN4A 1P75A 1XJCA 3SJZA 1M7BA 2J87A 1KYIA 2OESA
chains in the Genus database with same CATH superfamily
1C5KA 3ZK7A 2O8DA 4Z8YA 2IYPA 3JQGB 3QKRB 2GPNA 4A92A 4L4UA 4LZLA 5BUOA 3QFTA 1Z38A 2EG5A 3FI9A 4PX9A 4IIFA 1VL1A 5IJ9B 5FBKA 1M67A 3HNLA 1VTKA 1N2JA 1U2TA 2GCOA 1FP2A 4MEBA 3D4PA 4YDHB 1KC3A 1SXJD 4F4DA 4A0FA 2HXGA 5B1SA 4HXEB 1KY2A 3E1GA 2JLQA 2X8AA 1D0IA 3T38A 3AGPA 3ZHYA 3KOUA 4CWAA 1G9SA 1DIOB 1ZBQA 4MQMA 1WXHA 5JTUA 4O6VA 4ZZIA 3PGJA 1QHIA 3QVLA 4KGZA 3HVRA 5HTOA 3P9CA 1CK4A 2P2GA 5ALKA 4JB0A 4MQFA 3HYTA 4YRRA 3T52A 5LZ8A 2FOLA 4PC3A 1N1GA 1CUFA 1XZIA 3PNMA 1XTJA 1M9NA 5AI0A 3ETNA 3A1CA 2Q9AA 3A3OA 4MLCA 3VSCA 2LWIA 3FJOA 4W1QA 3RW0A 4RM2A 5CT8A 4J9UE 2Q62A 4BTLA 4P31A 4QFMA 4JI2B 2AFHA 1QX4A 1NR5A 5HUQA 1HNZB 3M6FA 1N5KA 2C2YA 1ZIDA 3R3ZA 4XWKA 3RARA 3PFNA 4TL6A 2BY4A 4ZV9A 5BQ3A 4EKEA 4DE5A 2XV1A 4YUZA 3C16C 3VZQA 3VBEA 2WUWE 2W6JA 3VTFA 5ALZA 5LQNA 4JBIA 4PZ0A 3M4CA 1JS1X 1U7DA 4Z9AA 1E5DA 1I14A 1NDQA 2Q3EA 4TXMA 2IPMA 2H51A 2XJ9A 4I6JA 5B6IA 2XM0A 4FFNA 3X3HA 5JWRA 3CVVA 1LC0A 1MGOA 1PNTA 1V8DA 4QM7A 1LS6A 2WAYA 1Q0DA 4RLQA 2PFGA 1EU1A 1ZAKA 1CZRA 3PHHA 5HUHA 4AY4A 2RG7A 2LCFA 5LN1A 1QK4A 2QWXA 1JTVA 4FU0A 1J0DA 1R5JA 2ZE8A 4RXTA 5E1BA 5I9NA 4B6QA 4EM6A 1VRVA 1NR7A 4FFMA 2JBHA 4OL9A 3NJRA 1V8FA 4O02B 5FWNA 2ZWMA 3Q9SA 1PT7A 4LZOA 3BXGA 1RXSA 4NHEA 3LEVA 4DBRA 3UH0A 3FSGD 5H9WA 2BEVA 2JD2A 5K3DA 1K5PA 1O0BA 4N5IX 3EZ2A 1GFZA 4UTXA 2YNMC 3T1HB 1X7XB 4MUXA 3CUEF 4AQYB 3KKEA 3SFZA 1KI6A 1I80A 1XMJA 2GR9A 1WBDA 4BCDA 1KPHA 5FRDA 1E58A 3ORQA 5DHFA 4CQMB 1EGAA 4XLNF 1XVIA 3SVTA 4JXJA 2WF7A 3KSUA 4LSZA 3UK1A 1LVHA 2EINC 4A0HA 4S3MA 2IZ5A 2HSBA 1P0QA 2WE7A 2CDCA 1ZMBA 3IEVA 2VP5A 4LNUB 721PA 1AZWA 4R9NA 3FGNA 1QFZA 3KZXA 2XVYA 2R97A 2PP4A 1FRNA 1PFGA 3OLXA 4Q05A 1LDMA 4ZI7A 3LBAA 1ZH8A 3JSZA 2LGJA 1RLMA 3VPXA 4X7MA 3E7DA 2O54A 2EARA 4F97A 1PK7A 1G4WR 1L8XA 2P9HA 3V4ZA 5TR9A 1PL7A 2WF6A 1N6IA 3RH0A 3ZHOA 2IE8A 3QPDA 2UYQA 3IB3A 3GGPA 2DQKA 4WL0A 1YTLA 3ZI0A 4WLNA 5C8VA 1KJIA 4U3JB 2OO3A 3M9LA 4CDGA 5JJKA 1R3UA 1XTSA 2VP0A 3K96A 4CLOB 4IDPA 2PKRA 1KVUA 5JZ9A 2C8LA 3TINA 1ZSVA 1QRSA 1MIHA 5EHGA 2DLCX 5DEOA 1BG6A 2TS1A 4TUYF 1FNBA 1RYBA 2QN1A 3LFUA 1YB5A 3HDGA 5IVDA 1LVUA 1M1YE 4IMRA 3L92A 3MT8A 5B36A 2ZS7A 4IDEA 4W5TA 4RTSA 3VVMA 1HEUA 2Y71A 2Q1XA 3WV5A 4YXWA 4QOHA 4I4TF 3QUCA 1WWPA 4AT1A 1NMSA 1QH8A 1QFSA 3A3NA 4I9UA 3QE0A 4AJ4A 2FOIA 1GFWA 5IDWA 5A4MS 1DGQA 2DPMA 1CLEA 1VKOA 4B3HA 4UE3S 4WH0A 3D7SA 2IY7A 4RGQA 3ZXYA 4QU9A 4ZT7A 2ZTMA 3REQA 4Y7CA 3HQ4O 1KBZA 1S7CA 3DI5A 4ZVSA 2AZTA 1GUZA 2O8CB 1Z6AA 3W0LB 1TT5A 3TLCA 1TLLA 4IVQA 2QVYX 2GBGA 2IL1A 1SUPA 3FYSA 4PPFA 4YRDA 1UBKS 1L8OA 2D54A 4TS9A 4EYSA 2HSJA 4K9MA 3O3MB 1Q1ZA 2BVNA 3NC1C 3ONFA 1PVOA 3K1ZA 3IIKA 4Q37A 4L6CA 4FB5A 2YHIB 1GCUA 4A0SA 3T7IA 1JI0A 3K9BA 2P91A 2WG2A 2F3TA 3O8RA 3AUJB 2IZOA 3LCUA 4KWEA 5B57C 4MB0A 5AW6A 2JFFA 2P62A 1V5GA 4GLBA 1G2PA 4DJDC 1ZJ4A 4E51A 3BMNB 3OCWA 1CDEA 5F7XA 1AZSC 1FX0A 3RUCA 2XS8A 1C8LA 4KFRA 4G1FA 1F8YA 2G4VA 3T1QA 3PLAE 2CSUA 3RR2A 3E48A 3NBZC 4GI5A 1D2AA 1DKRA 2ZETA 3AQ4A 4YGYA 1GPJA 4BFTA 3AOEA 1ISIA 3TW8B 1E2KA 1FTQA 2W9YA 1VRCA 3Q3CA 1I4WA 4DXHA 3OHPA 1DJNA 1WD5A 5C8YB 1M5UA 3EGCA 2I4MA 4H6VA 3WXMA 3ZZUA 2RGDA 5EE0A 4N8EA 1W47A 2FRDC 4N65A 1T2AA 3OE7D 5KYWB 3IE2A 1M1ZA 1PR0A 3MMPA 3SYTA 1T5TA 3QY9A 4BLPA 1I24A 1M8PA 1PEDA 2J7PD 4RPGA 1OCCC 1EFHA 3LZCA 4F9FA 5IT5A 3VDQA 1FMVA 3AP3A 1EB9A 1RZ3A 3OJ0A 3PWSA 3RVSA 4RL6A 1BRTA 3KXLA 8LDHA 5AVOA 4N40A 1H1LA 3C2QA 3ZJVA 5G02A 4OGWA 2QJWA 2XMBA 4BB9A 2QHXA 4YMHA 1R4MB 2WIJA 3SMVA 4RH0A 4RH3A 2HK7A 3G6WA 3IQHX 4MPDA 3NB0A 3FWNA 3TAUA 3E0QA 2IPLA 2H1SA 1YAJA 4FKBA 3SLKA 1R27A 2WMDA 3L8GA 3LBYA 3ACDA 3H2BA 1CYEA 2JIRA 5IF9A 3JYHA 3PUXA 4FNMA 2OLKA 4NX2A 1XCOA 5GAJA 3N0TA 3WIEA 1CPYA 5KVAA 2Q49A 5AVRA 4JQYA 1CR0A 3UJ3X 3N0WA 2BKVA 121PA 3UA3A 3PHCA 3P2EA 2PNJA 1JLKA 4OM7A 2YJGA 3UNXA 4RO0A 4KSBA 3DLTA 3T9FA 1MX9A 4RFSB 4P2BA 5JCOC 4RZQA 3MVEA 1MQ8B 3F0TA 3HYSA 3N0XA 3RRXA 4JNCA 1VHDA 1N6LA 3KXDA 5AVZA 1ADBA 1CJUC 2H1VA 4YJGB 4F21A 3B7PA 1PI3A 2XT9A 2VQDA 2K2QB 3CX6A 5L3ZA 5CA0F 1JKMA 4PZUA 2ZJZA 2QGFA 5EZYB 4EGFA 1Y3CE 1RMTA 4IDCA 2WJ4A 3X1XA 3UMIA 2JLVA 5AUPB 4OYYA 2QAGC 5I48A 2TMYA 3F7NA 1GFSA 1T26A 3S2ZA 3U2MA 1NXSA 3I5PA 2R86A 3U37A 1QTQA 1SNYA 5CW2A 1KARA 3FETA 5EZ6B 1QAQA 1RKEA 3ER9A 1T8SA 1IHUA 1ZXLA 3RIEA 4N6OA 1FFHA 4B6EA 2BGMA 2REBA 2W2LD 1I1OA 4HDMB 1Z17A 3GUUA 3HV2A 1SZPA 4JB3A 3R1IA 4LJ6A 2J0SA 1T4GA 1KMQA 3K4HA 4OGGA 1GQRA 4D26A 5IKPA 3GJXC 1ACLA 2HMQA 5CBPA 2CFIA 4PACA 3UAZA 5LQAA 3V6LA 3WHLA 3OIUA 3M6LA 2PQ0A 4J7YA 4MVJE 2W37A 1UJBA 5EP1A 3GAAA 5CFOA 2GJKA 1Q0GA 4OHMA 1RQ2A 4XWWA 3ZDAA 4G0NA 2HA4A 3NWJA 3TTXA 1U2GC 3OWTA 2E5WA 4JCOA 5DYWA 2MR6A 4GYJA 2EU8A 4EHIA 4RH1A 3TI7A 1QB8A 1GPH1 3RRFA 3U3JA 1X8XA 4Q16A 3HS3A 4D4MA 2KW3C 4JHLA 2X1LA 4MKHA 2XNJA 3ZIUA 4XVRA 4IILA 4YRQA 2WM9B 4MWOA 3M4NA 1O3YA 3LUFA 3RFFA 2RCYA 3BWDD 1ZGZA 3PV0A 3HEBA 3M6AA 5L3VA 2MSNA 2PUBA 3FVVA 2FPXA 4MW3A 3AG3C 3KAPA 4IZHA 4DV4B 4BZPA 1Y37A 1CRQA 1OROA 1SBCA 2JK0A 3HM9A 3Q7QA 3E70C 3RAFC 1MF7A 1ZVJA 1EH5A 4GR5A 1F4LA 1R88A 3WLJA 2GN1A 1DB3A 3JYNA 1HYBA 1YVPA 3STXA 1VMDA 3CNQS 2R6JA 2YZMA 4U7GA 1VL8A 3OLYA 2XAUA 1HFWA 5J2TF 2GTPA 3KU1A 5B7GA 2EFJA 4NZPA 2CB9A 1AXEA 4EPRA 4DCUA 4COOA 3L8IA 4N0DA 3KT0A 1C7EA 3HYRA 1RVDA 5LP6C 5H02A 1JIQA 5ILGA 1MJNA 4NPHA 4C0BA 3E7PA 3LWZA 3NIDB 4R2JA 1G8AA 3ED1A 5ALQA 3WLMA 5D5PA 4K3VA 4WXRA 2CMDA 1YULA 4NAUA 5K8TA 4N6GA 4LJKA 1EVKA 2KB0A 1OBCA 2H2IA 2X5OA 3R40A 4OGFA 1SVKA 5FPQA 2X8JB 3B6IA 4Q00A 1L7EA 2Y0BA 2F1KA 4IZIA 4RCZA 3ZSUA 3P9ZA 4BNGA 2GK6A 1Q14A 4L28A 5DI3A 2BR4A 2CT8A 4XA8A 5ALWA 3WGGA 4RJJA 1FIUA 1XQYA 3A2LA 1BFDA 4RDXA 3IMEA 5FOUA 5EYPB 4OA8A 1QHHB 3WGOA 1M6WA 4BO7A 4GMDA 3TGWA 2VNIA 3DEKA 3WQBA 3PJEA 2Q4EA 2O7QA 2INGX 3PWZA 3ZIBA 2VBFA 2BH9A 4FGUA 5K6AA 2R7QA 4QOIA 3G9QA 3V9AA 2X7HA 1QZTA 5CVJA 1V8PA 1YQ9A 4A5OA 2JK1A 3K1JA 4Q3EA 3Q6MA 1ZCFA 4DLSA 4H7PA 1MEEA 3R5XA 4IDGA 2EW2A 1M1NB 3UB3A 1HKUA 2Y9PB 1YDHA 1ODTC 5L0IA 3UYKA 2VSYA 4ZTUB 3LVFO 1GG2A 2VS1A 4L9WA 4G1UC 3ZWIA 3VOTA 1E3TA 2W6OA 2BFFA 4G1EB 2BGNA 1BN6A 1G6OA 4QRDA 4OP3A 3NGXA 4PBRA 2HU7A 4CIPA 1ZD3A 4DDWA 4L4RA 3VC3A 4BAGA 3X2QC 2HIGA 3PYXA 4DR6B 1OOEA 4UTOA 3DXZA 3H9UA 2R5FA 3TQCA 4FOTA 3WWDA 1JG4A 5FWAA 2VQFB 3R3XA 3E8SA 3F8TA 2WA2A 3GT3A 3HCBA 3ZLUA 1W5AA 3X1JA 3EIWA 2ZUTA 3CS3A 4D0NA 2V03A 4U2GA 3DA8A 3HNPA 4Z9JA 4G5FA 1PL0A 2CLKB 5K3SA 3B9RA 1QXSA 3AF0A 1PO7A 4FYYA 1JFVA 1WW8A 2ASVA 1R9JA 4DB2A 1ORYA 4HMQA 1RYNA 1NW4A 1O89A 3S6JA 5MFPA 3LVQE 2W43A 5BN5B 2NUAB 9ABPA 2Q3DA 4CF5A 1RWOA 1KSJA 4PPQA 1CKEA 4DCVA 1PBNA 5FLKA 3TTWA 4YRZA 5H70A 5CA1B 5JHHB 1U0SY 3JYLA 3BFVA 3OO0A 1GZ4A 4PGAA 3GLFE 3RV4A 4I3HA 3BSYA 1Z6YA 2RGNA 4MW4A 4RV4A 3ENKA 2IZ0A 4WK6A 2Y1LA 2CFTA 1P3DA 4CF3A 1XBTA 5CM2Z 3FPFA 4AG5A 3WHIA 3OZCA 2PZAA 1JV2B 2XHEA 3D1VA 4YCLA 1ZN8A 4JOBA 4WX2B 3IT0A 4KB5A 4P0PB 3CT4A 2QS9A 3KDSE 1B74A 1JA1A 3B3JA 1GNRA 1RP7A 4A6DA 1FA9A 3SZMA 1D0SA 2DM6A 1F0KA 4FDAA 3B5EA 3CZRA 2GM3A 2JW5A 5E6UA 4L76A 1OW6A 4ZAWA 1EFVB 5LQJA 3INNA 2B30A 2QVLA 3HLZA 3TR6A 3U44B 1BR2A 4D4LA 5JDCA 5KVCA 4FIDA 4NJOA 2FFQA 3ZWWA 3EVTA 2D3WA 3ROEA 5DLJA 1YFKA 2C2BA 4MRMB 4ZIRA 3HU5A 5F5LA 2AOVA 3LWNA 4X1YA 2C4KA 4Z4GA 3VNUA 3F3YA 2YWCA 5F1YA 1ULAA 3C7AA 4CG3A 2ZRJA 3HWWA 5JPIA 5L7TA 3E27A 3KSAC 4I8DA 3NBYC 5FNVB 5A5DA 5C0OE 2EW8A 3LD9A 2XYPA 1NZEA 3GEGA 4KRGA 3FPBA 4DJ5X 1NQTA 4BZXA 3T99A 1H5NA 2SCUA 1YI1A 3SZGA 1GSIA 3U7JA 4KFUA 5C1DA 3RS4A 1XELA 3PMRA 4WQMA 2DP4E 2YW9A 2ESRA 2C1ZA 3GA0A 3EF1A 4JOQA 1JIJA 1GUAA 2WB7A 3F47A 1QH9A 2VPWA 5H9VA 3RQSA 5E3HA 2O2GA 2XBMA 3ABOB 3THYA 4M60A 5JYEA 1IJEA 1DCMA 4BNKA 5LD2B 1FZTA 2QYOA 2R751 4RJIA 1IH8A 2P4UA 4C14A 1CG6A 1RXWA 3D5QA 1U9IA 3DT8A 4DY4A 4N82A 1FNSA 2CZCA 4NBWA 1VKRA 4JJ4A 2E1RA 4BO5A 4XVCA 1XNJA 3AR3A 1DPGA 2SECE 1OKKA 5BSHA 4R69A 3ZE6A 2EKQA 4BYGA 2OV2A 2VYVD 4IGIA 2HJ9A 4EFKA 2Y1WA 4CLHA 3V5ZA 1U2DC 3MHTA 2XIQA 2X2EA 4OXNA 3COJA 2F4NA 3UVEA 1U31A 1ZL0A 4ARZB 2WC1A 2VYNA 3WL8A 2EZ9A 2HBYA 3UGOA 3IL2A 2C88A 1LY1A 3UH1A 5BVHA 2ZU6A 3BFKA 4TV8B 4RD4A 1NN3A 2Z08A 1Y1QA 1YONA 3KQHA 1E7QA 3W79A 2ERCA 1MAAA 3R5KA 4XCVA 1JEAA 1EJ6A 1P60A 3VZPA 3NDPA 1IULA 3ZWQA 2DRIA 4AMUA 1EA5A 2B0CA 2J41A 1ONPA 3BT7A 1YZ3A 4P5EA 3JQFC 2YQYA 1X7ZB 1Z2DA 3TNYA 1J5PA 4N8SA 3QXCA 3PF9A 5DN6A 4O0MA 1YU9A 3B7GA 2HFJA 4DV5B 4LDPA 4RUKA 3JQEA 2FYTA 4XVHA 3Q5EA 5FI0B 1ZDMA 1NZDA 3GRFA 5J63A 2IGTA 1DUIA 2V54A 4JJFA 1APBA 4F8JA 3DB1A 1O1YA 3B1XA 1KRHA 3PR3A 4BNUA 1P2UA 2CLCX 4FSHA 1YMUA 5G4KB 3D4BA 1FNMA 4XLLA 4I1OA 3N86A 3G2IA 2J32A 2PEYA 2K5UA 2WYUA 1I5OA 4WRRA 3S55A 4HDQB 3ZDYB 4ESEA 2PIDA 4OIPF 3RSLA 3HCFA 3EZLA 5BSKA 4IH1A 2EKBA 1S3GA 2V97A 3WLKX 1ADJA 3KJIA 4A5SA 10MHA 4D3YA 2D0PB 4O8CA 1PCXA 3K6SB 3Q8LA 3UM9A 3AJRA 3LF1A 1CJBA 3P71T 1PD1A 3FSRA 1WM1A 2ECQA 4E5KA 3ZKAA 1ZD4A 1T01A 5J43A 2F3UA 3GZNB 4F86A 2RHGB 2A5YB 2A58A 4N5MA 2MHRA 2DFNA 2AI3A 1W0CA 2XNDD 5C7YA 2PKQP 3MB5A 3F6SA 4NENB 3VZCA 5A3RA 2I0FA 4BU1A 2Z2KA 4IQ4A 1GDHA 4XYMA 4KK4A 3QW4B 5K4AA 5JIBA 4WLVA 5E0OA 4LERA 1FY2A 4F56A 1SHLA 2G83A 3PVSA 3QOFA 1OXMA 5DYGA 1BXZA 4XYEA 5H5JA 3L0CA 4G26A 1CEQA 1NU8A 4D9HA 2VPZA 3R6GA 2Q1WA 4FYIA 1ELOA 4GU5A 3BG5A 5M7EA 4C5AA 2P6RA 2FR1A 3AHFA 2O7RA 1Q21A 5K0NA 3RAJA 1H2FA 4H7HA 1L4LA 3DG9A 4MNTA 5DYIA 3WGMA 4Z9XA 3HU2A 1DVRA 2FMTA 4LCEA 4X62B 4Y2HA 1MPTA 2X40A 1JHUA 1NR1A 3ZH9B 3VYRB 4FEEA 4OIRF 3S84A 1JRLA 2ZJYA 3KOWA 1IEXA 1BR4A 3AIMA 1UP7A 1XEXA 2HPHA 4FP9A 3AL2A 4WCFB 4D25A 3DQQA 5DW0A 1FUEA 4GH5A 1ZR4A 2OAGA 3UK0A 3RI3A 3WICA 2NZYA 1CF4A 1WZUA 3I1YA 4OQLA 1SQFA 3TKLA 5F2OA 1X9IA 4GPTA 1MX5A 1T3SA 4EB6B 3DV0B 2Y0CA 3MTIA 2G4CA 1WZNA 1NVDA 2HPZA 3FNGA 2BFBB 3ZWNA 2JJ2A 1JLLB 2CXHA 3E9YA 4JQSA 2DWUA 1BA3A 5H3LA 3QWHA 1YR6A 1JMWA 4K9NA 1W4BA 4G5HA 4U2FA 2L6FA 4E94A 4WESB 1US8A 4LISA 2Q3TA 4EECA 1L5MA 2WNSA 2AJLI 3TTSA 4G86A 2QX4A 2P0YA 1QV9A 4BV9A 1I51A 3ONVA 4QVKA 3SSOA 3WGJA 2GCPA 1ZKMA 1ZUIA 1JR3E 1OJ7A 4NV0A 3QWIA 3L04A 3OPQA 2WTMA 2P67A 2HD4A 1PDWA 2I2DA 4W8OA 1W2HA 2GEFA 2JGIA 4C03A 2GXSA 2AZ4A 2WG0A 3TLXA 1A50B 4E5NA 2OEXA 2O3TA 2JL1A 4IICA 1PNVA 3BRWA 2BFMA 4RZ2A 3BHNA 1Y1PA 4POOA 2C1XA 3NM6B 4AX2A 3RRJA 5I4KA 1XA0A 3TRJA 5A5EA 1SOUA 3DBRB 3MFNA 3OZEA 2E89A 2Y0PA 2I4NA 3DLIA 4GXRA 3ZWMA 4I5EA 2B6HA 1Q0UA 1XUOA 4F96A 4YNBA 3QVTA 4JJ7A 4ASUA 1JYEA 1NY5A 6LDHA 1AHHA 4NBUA 3IP7A 2OPBA 2ZTUA 4BVBA 2V0CA 4BQRA 1R7RA 3HKBB 4YRIA 2WU1A 4MQ4A 1ZSYA 4G8DA 1WMSA 3DOFA 4G25A 4RZSA 1DKNA 4A26A 7REQA 3JVIA 1S4MA 3LHKA 2BGTA 2CHQA 4CLEA 1ENZA 1T43A 4BVHA 1VGRA 4EG7A 5DNVA 4K6CA 3FNRA 4YP9A 1L7BA 1JPVA 1QANA 1VJDA 4YN3A 2Z3ZA 1S2GA 4GM0A 2JPDA 3SNKA 3JARA 3U61B 5FADA 1HE2A 1OSNA 3G9TA 1LH0A 1F2TB 4JDPA 2QI9C 1SUIA 4HWKA 2PA0A 4OXQA 4QBKA 2GUWA 1KEZA 1U0JA 1H2RS 2XM4A 2I2XB 2ZBGA 4KI7A 3R8FA 3ONDA 4YAJA 3DJUB 4Q82A 4CV2A 4GP9A 1KH2A 2O6LA 4BQQA 3QFCA 1IOWA 3LZ6A 1TO6A 3QU7A 4PLGA 5F5HA 5ALUA 5ITWA 1T5BA 1T0BA 4WW0A 2VCAA 3BN3A 2F9LA 2YV3A 4EPWA 1HE8B 4GBMA 3P7MA 2YLIA 1LM3B 2YXNA 4HFKB 5IDYA 4JP3A 2Y8EA 3HVIA 3TSWA 5FL7A 5CH8A 2QVGA 4ISBA 4PZPA 4GLLA 2XWBF 4CM4B 2PGIA 2FFHA 3UMBA 3UCFA 4AMZA 4YUAA 3UMSA 5EMMA 2UUCB 2CXPA 3SBDA 4BVKA 2PVSA 1DXYA 3PQ2A 2GVDC 5CI8A 4PX2A 4UDXX 4YUXA 2R9VA 1J4AA 4BMZA 1X38A 4QAJA 2FN9A 4DBVO 2NU9B 2IP4A 4TVBA 2PLNA 4IGEA 3ZGVA 5KYTA 2W6NA 3DC7A 3G1WA 4FCCA 3O0DA 3R5SA 5H83A 5BV8A 2O4UX 1OCZC 2ZIUB 3BCUA 3EIQA 4GI7A 4DRXB 5CDSA 2AOTA 3RSSA 3Q7RA 5G4LA 4C6TA 4BEBA 1U8TA 2QN7A 1D0XA 2V7EA 3K0EA 5C8XA 1K98A 1XKTA 4RCYA 3LVRE 4ZYWA 5KU7A 5K8LA 4L8VA 4OHPA 2HTFA 3VO8A 3A1DA 1E2BA 1Q12A 1Q84A 4O5OA 1X3SA 4ALKA 1YK1A 1CR4A 3OT1B 1KSGA 2R68A 1N0HA 2VH5R 3JD1A 3SE0A 4HLUA 4BP8A 3CE9A 4P5PA 4CM3A 3UYLA 3S1SA 3A32A 1WASA 2LE0A 1DZIA 2EL7A 3FE2A 3Q7TA 2SKEA 1SMYF 3PNBA 3JSEO 2CYAA 3Q15C 1EK5A 1FFXB 3N2IA 3HUUA 2ZKLA 1JALA 4JBNA 5KX5F 1JWBB 4URWR 2VL7A 3VV2A 4MJLA 2GPTA 2AC2A 5LQDA 1XROA 4PLZA 4A16A 1HYEA 3COVA 2WU8A 1UMKA 2BFEA 1L3CA 4OP2A 2XUKA 5KCMA 2XX3A 4NNOA 2GPYA 3NT4A 3KPYA 2P2DA 1KKLA 3C3DA 1P9LA 1NY6A 3ENVA 1WSAA 1PEYA 1J9ZA 3CUKA 3HLYA 1VCMA 2I76A 1KZ6A 2P6UA 1Z8HA 1IY9A 1SCIA 4FD3A 4G07A 4KX3A 1LRJA 2I87A 2HMZA 2I2CA 3SR3A 1THMA 1UM9A 3GEBA 1F14A 1CY0A 4NFSA 4LYYA 4QGGA 4E5YA 4DDKA 3OICA 2PO7A 4GQAA 4LE0A 2XGGA 1ZXXA 3EF3A 4DQXA 4FFPA 1IDOA 1L5RA 1EKYA 5EPOA 2PKWA 1BOFA 2XJ4A 1I7NA 5FL3A 3PEEA 4I8XA 3WQQA 1PNQA 1TM2A 2VHEA 1J2JA 2VDNB 4P9TA 1PFUA 5EJ8A 3BRSA 1QIEA 2V7WA 3U3KA 4KMOA 2WJVA 4W4TA 2GA8A 5I45A 3RJZA 5DTQA 2M9MA 4JQCA 2IOQA 3LUTB 3GDFA 4OVKA 4ESOA 2G7ZA 2YFHA 2I99A 4QFDA 5KTRA 2Q0XA 4NY1A 4RFLA 4MVWA 4M0KA 3H5NA 3OEYA 4A27A 1YUNA 2ZR0A 1TO2E 2QMYA 4DMRA 2V98A 4C6SA 3FFWA 1TTPB 2NYUA 5LYJF 2HW8A 2CUTA 4KLNA 1QH0A 3CH4B 2XA1A 4TYNA 3MMXA 4YI3A 4MVOA 2LPMA 1ZU4A 3SJAA 2P9JA 4C3OB 3IUMA 4MDFA 4D4KA 2AFHE 1FQWA 3GA5A 3DKAA 1JN0A 5BUQA 2JIPA 3HNRA 4GPEA 2QUPA 1NG9A 5L0CA 5C9ZA 4AUNA 2Q4RA 4DCPA 1E9RA 1SXJC 4PTYA 4YALA 1XAJA 3SQLA 2QNIA 1YIOA 4BE9A 2FA9A 3JZDA 3F7TA 4ARIA 2B7LA 2YX1A 3UOGA 3IVGA 5M29A 4ZHQB 3D7RA 5LLSA 4WY8A 3GZJA 1W93A 1TQ8A 5I3CA 4KZPA 4KRFA 2P6VA 2B7BA 5AW0A 1ISPA 2QL7A 2IYWA 3IC5A 4QARA 4DBLE 4RBNA 1CCWA 2DPXA 3D4NA 4UNQA 1BDHA 3AVPA 3EQ9A 3QJGA 4JI6B 3ND5A 3UG6A 1JQ3A 1Z5WA 1JPJA 3U9SA 3RHTA 5AOAA 4ZJUA 2EWVA 3OLVA 3ADOA 4ES6A 4BEMJ 1OY1A 4IIEA 4K9KA 3WL4A 1OXBB 1MX1A 4DXAA 3VHRA 1BKDR 4X92A 1HLDA 1YE3A 1I6KA 1AGPA 4IFEA 1V9CA 2IEZA 2G9QA 2PWAA 2KLBA 4MVJD 4O2LA 4TLAA 4TV9F 4K7JA 4NU6A 2H0QA 3L0YA 1HDXA 3PTZA 3B70A 1OA0A 1L4HA 3URKA 3OEED 4CYMA 1YQEA 5DHSA 3AQCA 2I55A 3OA0A 2AF3C 4NE9A 3CZ5A 3GLIA 1LNQA 3A31A 3ORFA 1JEYA 1U5BB 2JCBA 2PR7A 1RC0A 4NVRA 4B4WA 4D9FA 3EISA 4GBGA 2E4WA 4E4YA 2GF9A 1OC2A 4MVJI 2P2CA 1KEVA 3H2IA 6REQA 3GA7A 5DP2A 4Q3NA 3G79A 4JEMA 1FQJA 1PJ8A 2O0HA 3A37A 1N78A 3JQ6A 5FO0A 4LJ5A 4Q4HA 2UYHA 4J94A 2AP3A 3B6KA 5THQA 3DS8A 5FBLB 2QX6A 3A0RB 1DOWA 3EIXA 2VSOA 4LBVA 3JAMA 4F9EA 3WRYC 1UANA 1R0BA 1FSFA 4RNCA 1FFTC 4KLZA 4P7JA 2Z30A 1Z0JA 2E87A 2OFOA 1KU2A 2QDKA 3BL5A 1Z2PX 1JMVA 3TOZA 3GC6A 2FX3A 2JIBA 2ZQZA 1MJHA 3GPDG 1OIWA 2I7CA 1JVBA 1UINA 1P17A 5TPWB 3Q3GE 3RQEA 1POXA 3WQHA 2FXVA 4OGLA 1D0VA 5DE3A 3JRNA 3EQ6A 4G89A 4HB3A 2JCXA 3TW4A 4TMKA 5A6BA 3IDAA 2V65A 3IKMB 4KN5A 1JEQB 5KTOA 2YV5A 1ZW1A 1PFWA 1RS0A 1OZ0A 2DYSC 1PDVA 3INGA 1SB8A 1E5VA 2HLHA 3BPSA 3IV6A 4PZAA 4B2LA 1RRPA 3KSDO 3GWNA 4D79A 3G5LA 3TW0A 2BZ0A 4KO8A 2Q1SA 2XB6A 1A9XA 4PWZA 3DLAA 2GPAA 4UNIA 4H0NA 2G9NA 3ZDEA 1OFIA 1GCOA 2OILA 1ESMA 3EXG1 3G7UA 2W22A 2P9EA 4JGGA 4C29A 4AC9A 2C99A 2QM0A 4UCXA 2QXYA 2B94A 1Z83A 5F7JA 1T2NA 2OCAA 2J31A 3PTAA 1M7GA 4G9GA 1UOEA 1B1AA 5HCNA 2IUYA 3AHJA 2DY0A 1L5OA 5DYTA 3T8YA 2AE1A 4C4SA 2OYCA 3AG6A 3L79A 2N1MA 2QW1A 4KLAA 3DCIA 3W5HA 1QV7A 1YDGA 3R20A 1C1XB 2DT8A 1PT6A 4D82A 3BIWA 1OFUA 4U8GA 1I3NA 2H16A 5HKKA 3JQ7A 1OR2A 2Z98A 1T1SA 3L8EA 4FOPA 1HTWA 2BM9A 3NHUA 3CRW1 4K6OA 1LW7A 3MT0A 4GZLA 1UWKA 1QPZA 4QGSA 2B4QA 4HDNA 3HJAA 4XJVA 4MX8A 3STWA 1JQ5A 4BE4A 3SSNA 1NVMB 3DTNA 5DBHX 4RIGA 5D5HA 4JEHA 1DCFA 2DLDA 5HIMA 4BMXA 3O9VA 2YZ2A 3Q4GA 4IWYA 5AK5A 2TSYB 2ZYUX 3PC8C 5E4YA 4Q4JA 3KKKA 4ITVA 2PT9A 4ARSA 3PE6A 2UUOA 3DTVB 1N9GB 1RI5A 4JI4B 4MW8A 1KU0A 3BILA 4PLFA 5CNIA 3UPDA 1YVRA 1JHAA 3LU1A 2PBZA 2ZRPA 4BU0A 1PR6A 2V3VA 4G1VA 4O4IF 2CGEA 4IARA 1YAUO 3B1YA 1HE9A 1QGUA 4UPEA 2YXEA 1Z28A 3A1SA 3RC1A 2GYUA 2VP9A 1T9ZA 5CB6A 1F6WA 3GLTA 3SC2A 4IDOA 1QBGA 2HQSA 4UTZA 4HEHA 3VI4B 1XVLA 4ZO8A 1NVBA 5EOVA 4DJAA 2QR2A 4LDRA 1OE0A 3WK4A 3JQAB 2H7XA 5AI9A 5E6SA 1F7UA 3NRCA 1QP8A 1GUFA 3ZE9A 4I4TB 1HDEA 1KP3A 1ZITA 1VYVA 1P5FA 5EXTA 5FXMA 2WTNA 2NZUG 3OQIB 2O1EA 5CFRA 1AKUA 3G02A 4HRYA 1H8EA 2QP3A 3DUWA 4WIAA 1IRXA 2AC4A 3SFTA 5EKDA 3QVXA 5BV1A 1MO5A 3G2PA 3KX2A 1LFAA 3UJ6A 4J76A 4C06A 5FIUA 3ZHZA 2JGKA 3L7IA 4HXYA 3LUHA 5DLPA 5ER6A 4KODA 4LF9B 1TWCA 1ZN2A 1WL8A 3LLMA 2F43A 3G2HA 3QXJA 3RK4A 7GPBA 5EIAA 3BJEA 3TIVA 3RTCA 1OV6A 1NQUA 3EK2A 3W77A 4MCHA 2NAFA 2QTZA 3OT5A 1RIIA 1RXYA 3ENWA 4M7PA 2WHRA 2OKUA 5AVSA 1P7VA 1EZ1A 4A2PA 3PQCA 2I6GA 3Q98A 4BQEA 2FSSA 3E4CA 1GR1A 3W34A 3IPLA 4K28A 2O0LA 4M1SA 1NA5A 4DMGA 1KDYA 2PMCA 4TXJA 1T9CA 2PUGA 1HNXB 2O2YA 3RTEA 4DTIA 3NJ8A 2HCJB 3RUEA 3CLUD 2ZYHA 1IAQA 1BROA 2ZIWB 1A4IA 3ZKWA 4EX6A 5BWMA 4FNOA 1XZBA 4ZZ0A 4EYGA 3U0BA 3GLHA 4JLPA 4KPUA 3LCMA 3PDIB 3SEFA 4C0HA 4OQPA 1EXNA 1VGVA 3QV1A 1AN9A 5L45A 2E1PA 1YHNA 3KTAA 1JYSA 3NX4A 2JAHA 3WB1A 2YKZA 1E59A 1MXHA 1JJBA 4G5RA 4HG2A 3ZTTA 4MEAA 3FTDA 5SYAA 2X0NA 3RYHB 4FWVA 4BJ1A 3NBMA 2XVZA 3E15A 1PR1A 4Q1DA 3EDOA 2WT9A 2DHQA 3PEVA 3BMQA 3HABA 3QYAA 1NBHA 1O0CA 2QZ9A 2A0YA 2MYPA 2LD4A 1W52X 3BE5A 2FR8C 2OZPA 3WLQA 3TRFA 1KZ1A 4CDVA 3UMHA 3CNEA 2Q7XA 4NOMA 2LSEA 4FI3F 3EPHA 1E1DA 5J59A 4JTDB 1UK9A 3H5LA 1S2DA 1KZHA 3DVAB 4V0LA 1WUTA 2V7QA 2W2XA 3W1WA 1QYDA 4NJEA 2YTZA 1XEAA 3VTAA 4MINA 3U8VA 2VT3A 5COAA 2C07A 1NVTA 5C7IO 1C3XA 3DQZA 5LC1A 1EUDB 2IDJA 1BMQA 1BWPA 3BWBA 1BCRB 3H2ZA 1EGHA 4WXMA 3BERA 4J90A 4OK3A 2ZAMA 3QPBA 3TRIA 2PZGA 2CHUA 3ZH2A 4PHFA 3W2FA 1PYOA 3LNCA 3ZWPA 1I7DA 1Z06A 1UH5A 3PB3A 1KI4A 5JNVA 3HA3A 3J81A 5BW5A 3OIYA 3U81A 3A6PC 3L6BA 3A2NA 2BGRA 1DE0A 4M9RA 4P81A 3R9WA 5CLHA 1CS0A 3DDUA 1V47A 2C9OA 2H7VC 3EXHC 5F1OA 1PGNA 2WSSD 2GF2A 4K9SA 1S2OA 3LSTA 5BOSB 4JCCA 5AVVA 3CCBA 3SQXA 1Y1LA 1NXPA 4IHKA 1GO2A 3H1EA 5HKAA 2PFSA 1UT5A 3KQQA 3ODPA 1Y1TA 4N3AA 2WIFA 4U7PB 5AHOA 5L6MB 5B2ZA 5JTTA 4EUKB 1JKIA 3HM2A 2AOUB 2OMEA 3OCJA 1UEXC 4OI0A 5CA0B 1G41A 4XPWA 3DOUA 1R6XA 3PXGA 4N6HA 3TIFA 4BQOA 1BEUB 4NEQA 2ZRBA 3E53A 2OUIA 3RUFA 4LJ8A 1KMHB 2YZ7A 3I61A 5HBGA 3THXA 3PIIA 1ISRA 3P97A 2O52A 3CJRA 1UG7A 3DVRX 3KLNA 2J9BA 4GI3A 3T3OA 4E2XA 3E3OA 4JZYA 4Y6SA 5L51A 2VPIA 4QSMA 5GV7A 3CBGA 4WINA 3HRHA 4Z0PA 3BMCA 1KFCB 2OK7A 3DEIA 3FPHA 4FYKA 4CMGA 4W7IA 1PZMA 3IIEA 5CYFA 4D8TA 1JE1A 2QTMA 5B58C 2JJQA 3Q1LA 1K88A 1T35A 4D4XA 1A69A 2PS9A 4FOOA 1KGDA 1EX1A 4WVFA 1FSPA 2IUEA 4AJNA 5G3YA 3B2EA 4BP1A 1O6ZA 4BIIA 1XVUA 4BP3A 1SU4A