1VMAA

Crystal structure of cell division protein ftsy (tm0570) from thermotoga maritima at 1.60 a resolution
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
294
structure length
294
Chain Sequence
MGLFDFLKKGLQKTKETFFGRVVKLLKGKKLDDETREELEELLIQADVGVETTEYILERLEEKDGDALESLKEIILEILNFDTKLNVPPEPPFVIMVVGVNGTGKTTSCGKLAKMFVDEGKSVVLAAADTFRAAAIEQLKIWGERVGATVISHSEGADPAAVAFDAVAHALARNKDVVIIDTAGRLHTKKNLMEELRKVHRVVKKKIPDAPHETLLVIDATTGQNGLVQAKIFKEAVNVTGIILTKLDGTAKGGITLAIARELGIPIKFIGVGEKAEDLRPFDPEAFVEVLLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Cell division protein ftsY (TM0570) from Thermotoga maritima at 1.60 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Protein transport
molecule keywords cell division protein FtsY
total genus 111
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1vmaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vmaA02
5BXQC 1Q3TA 4CZ2A 2XTZA 4ABYA 1D2EA 1FPMA 1MKYA 5AUPB 5C2JB 1F2UA 1OKKD 3A37A 1G5RA 1G17A 1P62B 3QQ5A 1WDTA 3NBZC 1CEEA 1XD2B 1ZNWA 3EIHA 4BFYA 4QJ4A 4PZYA 2UZ3A 2O8CA 4JLBA 1V5WA 2FU5C 3K1JA 4EPTA 5KNBA 3QKSA 3IIJA 421PA 1TUEA 1ZM4A 1CR1A 3LXXA 3MFYA 4HZUB 4KSBA 4DIDA 4KBFA 1PUJA 4PAMA 4WBSA 1FFHA 3GJ5A 4PSKA 4KAXA 1GOTA 4JLPA 4PANA 1E9DA 1KMQA 3IHWA 4UXHA 3TW8B 3MJRA 4G01B 4Q66C 4DWJA 2O8BA 3IBGA 3LWNA 3EWAA 3PR1A 3QKRA 4LHVA 4ILEA 4IOLA 1T0HB 1S2MA 2HUPA 3TW4A 2QM8A 4HLCA 3ZZUA 2HYIC 2AFHE 2DFKB 3IO3A 3PQCA 1KK0A 2F43A 5CLQA 5ANRB 2PZFA 3AF2A 5DO9A 4DDTA 5BYKA 4FINA 1PLJA 1C4OA 5FH9A 2WWHA 5FOVA 3K70B 4UXIA 2BDTA 4TWZA 1W2GA 5DSZA 4LJ6A 4BECA 1G3UA 2XZLA 1I4TD 4Q19A 2C9CA 2CL0X 2XZPA 4XVRA 4LBYA 3WYGA 3SJBA 3EC1A 3WXMA 2KWIA 3V4FA 1LNZA 1NN1A 1JPJA 3W9YA 5KDDA 2ZRGA 3CH4B 3QKSB 2ZI9A 3FWYA 2PJZA 3ZVNA 3EZ2A 3TSWA 3F3YA 3P27A 1AQYA 1EFTA 1XPRA 2KB0A 2QPAA 1KJYA 2CL6X 1WB9A 3GLFE 2O8DA 3MUFA 2PMDA 2ZRFA 1WP9A 8OHMA 4Q00A 2Z4SA 2OBLA 3TAUA 4BFZA 1NP6A 1OH5A 4DLVA 2PCJA 2WKQA 5FBLB 4JKYA 1FMJA 1QHIA 1P7CA 4TSFA 1Z06A 3LAWA 4IVQA 5IK2D 1ZU4A 5FBWB 1R0WA 2VHCA 1MABB 2OCBA 4XVUA 1RFLA 4MA4A 2HT6A 3L0OA 4QGHA 2QRZA 2WTUA 2ORWA 3TLXA 3O8CA 4HSEA 4Q1DA 1WMSA 4FXPA 2C04A 2IYSA 3TK1A 4ZDJA 2W2VA 3OAAA 1JI0A 1DAMA 1L2TA 1XTIA 2R6CA 2ZRMA 1M74A 3ZVMA 4ZI2A 1ZD1A 2BBWA 4I81A 1XMJA 3RNLA 2JIZD 1R10A 1JECA 3AVOA 4Q4LA 3EPHA 1W47A 1KSGA 1ESNA 1K6MA 4A2PA 4PC1A 1JJVA 5D3MA 4L4UA 1WCV1 5EUMA 1G1MA 1VYTA 4HDCA 3TQFA 5G41A 5GJWC 2BOVA 2JLXA 3U61B 4GI7A 4PFSA 4JYCA 2DFNA 1KDRA 4HB2A 5JI2E 2N1BA 1T4GA 5G53C 4EJSA 3HP1A 3OFND 2UKDA 3WMGA 2J46A 4E09A 5C18A 1OJLA 3H0KA 1G6HA 4C2UA 2ONJA 1W4RA 1XEXB 2ODBA 4OJKA 3HDTA 2CVFA 4BRWA 1M1YE 2WZQA 1ZP6A 2FFBA 3LDAA 4DCNA 3C14C 2O8BB 3IQXA 1U9IA 3TSOA 1DBSA 4AYTA 1R0YA 5K8LA 3MSXA 2J45A 2CE2X 2FSFA 2KBFA 4YMUA 2MSDB 2J0VA 2W0MA 4CT4B 4MQBA 1Z0IA 1DAHA 1II8B 1VG1A 4CEIA 2H7VA 1XTJA 4OK6A 4N0EA 1KNXA 1EFRA 2CLSA 3B85A 5FOWA 2GEDA 5J5CA 3G0HA 1CU1A 2C9OA 1D8TA 2E1RA 1HV8A 4W9MC 4IXMA 3UWOA 3QBTA 1R6BX 3A36A 3JVVA 3AGPA 3K0AB 4L9SA 3FHOA 4PSAA 3W34A 4DRZA 3K9NA 4URUR 3ZQ6A 5AUNB 4PAQA 1IXRC 2BMJA 5EXXA 4TYYA 2ZI3A 4GMXA 5FFMA 1R4AA 5FI0B 1AQUA 5KYKA 4X8OA 4DSNA 4NHOA 1OXSC 4D4MA 4Q9JA 2CE7A 2OUKA 2WPDD 1AJEA 2ERXA 1HE8B 1RVDA 3BB4A 4QOSA 3PXGA 4KV9A 2ZEJA 3RRMA 2IYUA 1N6NA 4LC0A 4YDHB 1NG9A 4F4IA 1ZUIA 4DEXA 4Q7JB 5E7IA 2NG1A 2GESA 1QHYA 2BM0A 4KYUA 2Q21A 2FZLA 4DCSA 1SGWA 3QXXA 5LBIA 4B2PA 1CJUC 3LNCA 3BH7A 1AGPA 4KVGA 3KXKA 3VNVA 2BJVA 1KOFA 3LFUA 4MYHA 4B34A 1KKMA 3LV8A 3WYAA 3VNUA 1GG2A 5HE9A 2JDIA 3KKPA 1RRPA 2YV5A 3AGQA 3PJRA 1Y3AA 2FF7A 3B1YA 3EZ9A 3Q7PA 4NDZA 2OXCA 4IW3B 1V43A 4RFSA 5FPHA 1E32A 5H8WA 1FMLA 2AK3A 4M1WA 1ZM2A 4LUCA 1YHNA 2QPTA 3EW9A 3WY9A 2QT1A 3CKLA 5FOSA 2IYQA 3E5HA 4W5HA 1UJ2A 1S0UA 4B3XA 4O3MA 3LBHA 5JZVA 3QENA 3NIBA 1JAHA 4BEJA 1PV4A 4D0NA 3F8TA 1ZNYA 1GWNA 3IO5A 2G3YA 2ZJ2A 1GNRA 4QBGB 4TMZA 3OIYA 1G19A 3CF2A 3CM0A 1MABA 3NKVA 3Q85A 3W6OA 4DLTA 4CF7A 1FL9A 2ODEA 1S1MA 3ADCA 1Q1QA 4B35A 3IBYA 1WQ1R 4G0NA 3VHXA 4CEIB 1S4QA 2D2FA 1QHHB 5AJZA 2RMKA 2WJIA 1TF5A 4B44A 4C0KA 2OBMA 1CP2A 4BFSA 1ZD8A 2G88A 1VHLA 3AQ4A 2PBRA 4C0BA 5J47A 1GIAA 3U7HB 1E0SA 5E95A 3QEOA 2XGJA 4A0GA 2IUTA 5FBVB 2QROA 3TR5A 2Q9AA 3O47A 4B6FA 1OYYA 3X1XA 3MCAA 2ZS9A 1ETUA 1E1RA 3SEAA 3R20A 2YWHA 2ZE6A 2NO6A 3NTUA 3SOPA 4XWAA 1LB1B 3ND9A 4TYWA 5SZIA 2J9RA 5B30A 1Z0AA 5IF9A 4I4LA 1J90A 2QMUA 3OE7A 4DVGA 2XXAB 3LW7A 1Z08A 1A82A 2HYDA 3NBXX 4DEYA 3SYNA 4EIWA 2JDID 3IHLA 3NDPA 1GUAA 4HDQB 2IXEA 4BASA 4MGKR 2FMXA 5KTYA 1YZQA 4D6PA 1YZLA 1W36D 2J7KA 4FN5A 1RZ3A 1I4LD 3QVVA 4MDEA 1U0LA 2BIFA 3HWSA 2Z0MA 4A2WA 2R44A 1GL7A 2ZRAA 4JLKA 3RVBA 2CLCX 4M1KA 4XSHA 1U90A 4PO8A 3KJGA 3QEJA 3VTKA 2ZI6A 4BGDA 3AM1A 2ZU6A 1SVSA 2DHRA 1A2BA 4MKIA 3I73A 4PHTA 3A4LA 4LPKA 5FL7D 1QHXA 1E96A 5FR1A 4BFVA 621PA 3U60B 4BPBA 2ECKA 3B8HA 2QI9C 3K70C 4RFVA 5DNYB 5D3QA 2AHOA 5FPKA 2A9KA 1GAJA 2PL3A 2ZM5A 3CBQA 1YRBA 3ASZA 4MYUA 2CEAA 4TL8A 1XCPA 4JLNA 1UADA 1RRCA 2PEZA 2XZOA 1LV7A 3CH5A 1VPLA 2BBOA 4DLUA 5GJBA 3WNBA 2AKYA 3GLIE 3W8NA 1YE8A 2AWOA 3DPUA 4Q48A 2ONKA 2J1LA 4KCGA 2GBLA 2JJ1D 4OQMA 1IJFA 3AF0A 1YR6A 3GLFA 5GJVC 1HYQA 4BZXA 3B7GA 1HE1C 4WXPA 3NG1A 3CX7A 1G7RA 2V8OA 3LLUA 3KQNA 1TAGA 3A58B 3DEFA 2ZYTX 3VKHA 3T1OA 3MWYW 4YDSA 1EGAA 2C77A 3SJCA 4C7OA 1PUIA 4B48A 2FSGA 3CNNA 2YC2C 5KO2A 1SVOA 4IVPA 1EWQA 1U8AA 3W3AA 2IL1A 1TEVA 2D3WA 4J0QA 1VHTA 1KHTA 4DDWA 2VBCA 2V1XA 4RD1A 2BKUA 3ZQJA 1RC8A 2F3RA 1KMHB 2OCYC 3B60A 1K5DA 1QHHA 2GTPA 5BN4A 3EIQA 4K8OA 4EPWA 2FPMA 4NPHA 3B1WA 4IDPA 1MV5A 3GLHE 4V0MA 1K8RA 4M21A 4DXAA 4B73A 2N46A 3EIEA 3AP1A 5EE5B 5FOUA 4TMKA 1XEWX 4POAA 3W6PA 3ZS9A 4F92B 3OFNA 3EAQA 1R7RA 2GZDA 3UMFA 3ZVLA 1OFTA 4YMWA 3AVUA 4NONA 2ZRNA 4ZKDA 2O0HA 1DOAA 2CHVA 5KSYA 2OHFA 1EXMA 1G18A 4QGGA 1UKYA 4DCTA 1TQDA 1TF7A 1KTVA 1GSIA 1UAAA 3EPKA 1W5TA 2R6AA 1ZM9A 4DSTA 5JECA 1F5NA 3FHTA 4EQ6A 1FTNA 1P73A 4YMTA 5C46F 1KDPA 4HAWA 5JWOA 2ZE7A 4MYCA 1SKYB 4PHHA 1TTTA 3LVRE 2J5XA 1XMSA 1KSFX 2NTYC 4Q7MB 4M1TA 4CT5A 3VKWA 4JYBA 2AN9A 4B75A 1M34E 1G7SA 5HKKA 1S96A 1W4CA 3CRMA 3MWKA 4B3DA 2FSIA 4OHXA 4XSGA 2CXXA 2QNRA 1R5NA 2ZYWX 1X3SA 2PT7A 2QG6A 4JS0A 2H17A 2O5VA 5JI3E 3TR0A 1SULA 1E2FA 2AX4A 5FTJA 1N5LA 1DAEA 2GCOB 2XX3A 2YYZA 4P4SA 1RYHA 1YZNA 4JLVA 4LSGA 1E9EA 2ANCA 3LX8A 1A5TA 1Q1ZA 4OQNA 1ZBDA 4Q4HA 1OIWA 3N5CA 4L16A 2N42A 3UG7A 2FH5B 1EX7A 3GEEA 1FX0B 2XB2A 2CNWD 1E98A 1IONA 1D2NA 2G77B 3DL0A 3Q7QA 4TYNA 4AYXA 2JA1A 3GP8A 1NI3A 2BBTA 4G5QA 4DDUA 1S3GA 2KSQA 3THYB 4QL3A 3TKLA 3OAAD 4C2TA 1FNNA 3N2IA 3DZDA 3UANA 1E9FA 1OE0A 2GAAA 3K0EA 4US0R 1YRAA 5JCPA 4AY2A 1T5IA 1U9IC 1NN0A 3OESA 4TQ9A 4C30A 1DE0A 1JB1A 1UDXA 1DAKA 3FDIA 2GWHA 4LC1A 2FZ4A 2QN6A 1BH2A 5IK2A 2HCJB 3Q3JB 2H16A 2W2XA 3ZD7A 2J0QA 2ZSEA 1NLFA 4HAUA 4GL2A 1W2HA 2RGXA 2XEXA 3B9PA 1W48A 3KQKA 1AA9A 1N6LA 3QSYA 5SZKB 2OT3B 1SXJC 4LYAA 3HU1A 1KI9A 1WBBA 3LLMA 4I1OA 1LY1A 1MT0A 2QP9X 4RKEA 1Q0UA 1VG0B 1EESA 1T3HA 3L0SA 2C03A 2ORVA 3BB3A 4JIMA 2A2ZA 2C78A 2QBYB 2REOA 1HQCA 3IILA 1P72A 1ZINA 1G8PA 3PUVA 2D2EA 2JGNA 1US8A 1ONBA 1N25A 3NWJA 3GLIA 3IIMA 4G5RA 4Q1EA 2WM9B 3O8DA 5J40A 3P1JA 1G4UR 4M9QA 2G6BA 4CEJA 5L3QA 1S9HA 1MO6A 1YJ5A 4DB2A 3ADKA 3BE4A 4IXNA 3SBEA 1CJVC 2VRWA 3FFAA 1KI2A 1VMAA 2H92A 4ZCLA 1Q3HA 5GADl 3I8SA 1U0JA 2WWWA 2DPXA 1DG3A 3KJHA 3UWKA 2RGBA 1G9XA 3A6PC 4GOJA 4JBWA 3AUYA 1LF0A 2B6HA 1SVLA 5BQ5A 1GNQA 5J4LA 2LCFA 3B1ZA 1NY5A 2XJ9A 2WMOB 3FE2A 4G5SA 1KAGA 4M1OA 3W90A 1Q21A 4AG5A 5IHPA 2LWIA 5FTNA 2QSYA 3NBYC 4RD3A 2QE7A 3NH6A 3BOSA 4NP6A 2BCGY 2ATVA 4FD2A 1TADA 4KITB 1AS0A 2GDJA 4YXWA 5J4VA 4DSOA 5F9HA 3IQWA 4DLRA 1IN7A 3KXIA 2V7QA 2GCOA 4MRRA 4P4SB 2XNDA 2ZREA 3KFXA 3GLGB 4UJ5A 1Y63A 1T3SA 2RGNC 3GJ4A 2DFLA 1T8UA 2QUZA 2QMEA 2G1JA 4HB3A 4EFLA 1UKZA 3AEZA 2GJ8A 2X77A 1XRJA 2NOAA 3BXZA 1MR3F 4LV6A 121PA 3BD9A 2GCPA 1G3IA 3RANA 4DLSA 4FIDA 4KJZA 5JMTA 2HLDD 3P26A 1NJGA 5TXGA 3AVPA 2I4IA 1OXUA 4E07A 3GLIB 1L8QA 1PJRA 2OESA 3NVAA 3LX5A 4Z51A 1J7KA 3ZVRA 3MGCA 4DUGA 1W44A 4LYHA 1VIYA 2IYTA 4Q7KA 1X8JA 5FUXA 2CL7X 2LKCA 2RGNA 3OE7D 3C4JA 4LJ9A 1SKQA 1CRQA 2IYVA 4HUQB 4EFMA 1E0AA 2TMKA 1PLLA 1Z2CA 2Q3HA 2ZJZA 2Q9CA 2JLVA 4NYJQ 4BRUA 5A0FA 1MH1A 3ZLJA 4C0AC 1G291 1P60A 3B2EA 2A78A 3Q8XB 3L8ZA 4D82A 5L8VA 2NO0A 4ZO4A 1P75A 1RW4A 1Z6TA 4EPRA 1W4BA 3I92A 2NO1A 1BMFA 1J99A 3TUZC 3PEYA 1D2MA 4FW9A 2Z4RA 4JVMA 4ZPXA 5KHOC 2ZRHA 1JR3E 4Q9IA 1OH6A 3A1UA 3AB3A 2ZRIA 1EG7A 5IRCD 3S1AB 1G7TA 2JEOA 1XP8A 1LVGA 2BVNA 1IM2A 3I32A 4LJ7A 2IHBA 1NBMA 3RYTC 1OXXK 1VG8A 4HZUA 1JNYA 3R9WA 1NVVQ 3MAAC 4PTLA 2ZQ5A 1XNJA 5AK0A 3DO6A 1A7JA 1JXOA 3EA5A 1R2QA 4P33A 4CEJB 4AI6A 4ZIRA 4Q9LA 3MMPA 4GBMA 1YKSA 1GL9B 1OH7A 1OT3A 5AUOB 1BKDR 1CR0A 4DCVA 2H5EA 2ZRDA 1KK2A 1JPNA 4GMDA 3QI2A 4CIDA 1IN4A 2OV2A 3ONWA 1P2SA 4CW7A 3QOFA 1N0UA 1X1RA 4PPGA 5EZ5A 3SYLA 3ADDA 1A2KC 2W6ID 3CIOA 3EZ6A 4HAVA 4ZCMA 2QMHA 1BIFA 4LK2A 5L3QB 4OQLA 1AS3A 4HLUA 1GM5A 4C9BA 4XOIA 5DHAA 1JALA 3BFVA 2NO7A 3LQRA 1Z22A 2ATXA 2EYUA 3P20A 2P6UA 3SFVA 3MWJA 1WF3A 5DN6A 1DVRA 1OLOA 2XB4A 1Z0FA 2FGJA 5JBQA 2A5JA 3N70A 1NN5A 4MGYR 3OEHD 3QXCA 2B92A 4RD0A 2JLZA 3QBVA 3SHFA 2BEKA 4L9WA 4JLMA 1AKYA 2VP5A 1TQ6A 4MUAA 3QUSA 2GEVA 1DS6A 2O8DB 2ODNA 1OSNA 3THWA 5HR5A 1TNDA 1XX6A 2J41A 4PC3A 3D7MA 4KSCA 4U5XA 4PO9A 2LKDA 2VA8A 5AJYA 1A4RA 4DT1A 3TNFA 3QIAA 5HKKD 1Z28A 3GD7A 2P65A 2QQEA 4A82A 2EFHB 1T91A 2JLRA 4JKIA 3WYFA 4A9AA 1KSJA 4AK9A 1A1VA 1P9WA 4IHQA 4ZKEA 4URVR 4QGAA 821PA 2GNOA 3BERA 4V0NA 5AWFC 1HUQA 1XMIA 1RJ9B 2F43B 4XJXA 1U94A 1J8MF 2HEIA 3MJHA 4PC7A 2WJYA 3LH5A 4P3YA 1KK3A 2JLUA 4TZ0A 1G64A 1GFIA 2G1KA 1IXSB 1OV4A 4QKQA 5K8UA 2F1IA 1N5IA 2KE5A 2WIBA 3L43A 1U0HC 2V3CC 1E2DA 4HZIA 2AD1A 3DMNA 4TL7A 3SR0A 4QRHA 2WICA 2OZEA 5EP4A 3KZ1E 1KDOA 4AC9A 4W5JA 1ELOA 5DI3A 5G3ZA 2RAPA 3A1TA 1H65A 3WNCA 3LO5A 3M0EA 1UBCA 4EJSB 4M53A 1Z3IX 1XWIA 2QAGB 2HJVA 3AH8A 4RJLA 3VR1A 3BK7A 4D0LB 1EFCA 4TLDA 3VFDA 2R65A 3VX4A 2AKAB 2VEDA 4ACBA 4CYMA 1XTSA 5CDFE 3ZIAA 3HJNA 3LBIA 3N2EA 2QGNA 2NO9A 3CF6R 4O0MA 4ASUD 1MO5A 1UPTA 2R62A 2FEMA 2HF8A 3K0AA 3KUDA 1DTSA 4MRPA 2EFDB 3WMEA 1COWD 3P4XA 3CUEF 1ESMA 5FPYA 2IUSA 1X1SA 3KDSE 4IDHA 3AF3A 1ZYUA 4R9UC 4ZDIA 3HR8A 4G3XA 2ERYA 4PPQA 4M1MA 1Z6AA 4IVRA 1XU4A 2D7CA 4MGIR 2A30A 2CHGA 2GXUA 1VTKA 1SXJB 2WSMA 4JLAA 2KI5A 2R2AA 4MKFA 3SI7A 3SHWA 3UATA 3VU9A 3BH0A 3CNOA 1QVAA 2G0TA 2OSBA 3BC1A 4R2HA 4PC6A 2FA9A 2FE4A 2OM2A 2G83A 4PQRA 5HZHA 3DOFA 3QY0A 4HAZA 4TSFD 1T8TA 4C0QC 1R0XA 1XZPA 1VCNA 4LBWA 1XTQA 2H8KA 1T5LA 2Q0HA 3TQCA 3WHLA 4EFNA 5LPNA 4DLZA 3K70D 2VHTA 3MD0A 3BJIC 1ANKA 2OG2A 4DT1B 1Z07A 1KY3A 1IY0A 1SXJD 2ORIA 4D0GA 4F7WA 5TMPA 4AKHA 3RSOA 2ZJYA 2AXNA 4JBYA 3GFTA 3NH9A 2GEUA 4M8NE 2VIIA 2IX3A 3DVLA 1N6KA 1MO3A 1KI1A 3H86A 4X8MA 1NIPA 1U8YA 2IA5A 4B32A 4NCIA 4BE7B 3FHCB 2P0EA 3G82C 5LD2B 1KDTA 3K09C 3RRYA 1JBKA 2MSEB 1D9XA 3EWSA 3WRXC 3K0SA 4B47A 1TU3A 2QRNA 4R2IA 4MUBA 3A1VA 3HPRA 1IN6A 1GZSA 1DARA 1G8YA 5JRJA 3DMDA 2V4ZA 1XJ0A 1E4YA 3BGWA 4WZAE 5DYIA 4US1R 4UKDA 4W7SA 1S3SA 4IEIA 4TYQA 3TVTA 1QBKC 4RCYA 1FNMA 3U3RA 1KI7A 4DCUA 3EG5A 1ZC3A 1IBRA 1N0WA 3A1WA 3E1SA 3RRZA 3K0CA 5HZKA 2I1VB 5AUQA 1EK0A 1OHHD 2OILA 1G3RA 3CO5A 1GL6A 4HDOB 4Y0VA 3ZJYA 5JEDA 2ANBA 4HAYA 5JRZA 4CVNA 1F48A 4GT1A 2VP6A 3BIFA 2IYRA 2WSSA 1NNEA 3HYTA 1E4VA 1X86B 2QQ0A 2A3RA 3ZD6A 1X8LA 5EE9A 2C98A 1ZMXA 1WA5A 2CBZA 1BMFD 3VAAA 2PMKA 2W6JD 1NSFA 4D80A 3GCGA 3T5DA 3ICEA 1E2QA 1K5GA 3CRQA 3PEVA 1Z6XA 1DPFA 1X6VA 4PXAA 2WJJA 1OHHA 4ZDKA 1KGDA 2YC4C 3THYA 2ZJOA 2ZSBA 1DG1G 4A36A 2QTVB 3MRSA 4O25A 4RZ3A 4C4PA 4JLOA 2Q3MA 4D25A 1GKIA 1G8HA 3Q5EA 5FTKA 2DCUA 2ZYUX 3H84A 3TRFA 4OI0A 2CCJA 1UBGA 1W0KD 2EW1A 2F9MA 3QF7A 4OQFA 5LB2A 2GZAA 3PFIA 1T6NA 3MWLA 3C16C 3SQXA 3GJ0A 1ZM7A 1FQKA 3JVUA 4Z54A 2GF9A 2IUUA 2WPDA 2W00A 2O8CB 1U81A 2QTHA 3UK6A 3QKUA 2QGZA 3RS4A 5KPDA 2YOGA 3VR3A 1GRRA 1T3LA 2BKEA 5FPSA 5K8TA 1G3MA 4C0SA 4R98A 1HTWA 2VQSA 4TLAA 3THOA 3I5XA 3RS7A 4LHZA 2IBMA 3AVXA 3B1VA 3RSLA 1D6JA 4DSUA 3DM9B 3IEUA 3BB1A 1UFQA 2XSZD 1TUIA 4LOAA 1EWRA 3GMTA 4LJ5A 1CJTC 4GSYA 4JSTA 3GQBA 4TL6A 3ZH9B 1FP7A 1E6CA 2IXGA 2RKOA 3GLFB 3W6NA 1LW7A 1IQPA 5FR2A 4TMWA 3TUIC 5C1BA 3RRNA 1XBTA 2YZ2A 1FUUA 3GEHA 3IGFA 3TIFA 1QZXA 3ETLA 4TTPA 1MO4A 1ZCAA 4TMXA 2QP3A 4B43A 4RZXA 3ZIAD 3RS0A 2XSZA 3VR4A 2AFIE 4URZR 2F1RA 2ZIAA 5B64A 5KOYA 3QPUA 1SZPA 4XD7A 2L0XA 4F93B 4CEHA 5JJLA 5G3YA 2JCSA 3QF4A 4A15A 3E70C 3I3SR 2D62A 3R8FA 3H1TA 1NBME 3L8YA 1N5JA 3RC3A 4ARZA 1T0JB 1ZCBA 2C8VA 1IY2A 2VHUA 4TTQA 1L7VC 3CPHA 3UPUA 2O8FA 1VG9B 3GLGE 4OI1A 3D31A 4E5UA 4M9XA 1OH8A 2DFTA 3KKOA 2CMKA 4ESHA 1UM8A 3AVTA 1Q20A 1IY1A 1D9ZA 5CIWA 5JWHA 2ZSDA 5JCZA 3FVQA 3KJIA 1Q57A 1W7AA 1BYUA 1E2IA 1GNPA 1Z83A 1Q1EA 3OHMA 1QF9A 2QAJA 2DR3A 4NBSA 4F4JA 1GVNB 3DDCA 4NE2A 1JR6A 2V54A 4B3GA 4HEJA 1DEKA 2BCJQ 6Q21A 1P9RA 3BH6A 4UNRA 1G6OA 3CB4A 4NU0A 1IAQA 2ZTSA 4Q9HA 2XXAA 4TQUS 3CF0A 4BLQA 2IYLD 2W6JA 2V7QD 3ZZ0A 3RABA 3NBFA 4LX0A 3SJAA 4ZV4A 1PVOA 3BORA 4UJ3A 1DO0A 1KI6A 2WVJA 4S35A 1FP6A 1N6HA 4MGZR 2ZS8A 4O2RA 2RCNA 5KDOA 2D7DA 1ZAKA 4QNMA 3T12A 2GA8A 2B8TA 1OIXA 4A1FA 2UVQA 2HLDA 2O0KA 4ESVA 1UKVY 4IRUB 4P31A 4EDHA 5CK5A 2GXSA 4HB0A 1E2PA 4DBLC 3WRYC 3L0PA 5A5GA 4YQFA 2IS2A 4EJSC 1JAIA 3U3MA 2QAGC 3RAPR 3GJ6A 4IFEA 3L0IB 4KLNA 5UKDA 1JR3D 4LV8B 3W3ZB 4LCBA 2FFAA 2Y8EA 1AIPA 1QDEA 1P4SA 3I4LA 4A6PA 1YZGA 1M7BA 2AR7A 2Q6TA 2UZIR 2V9PA 1M7HA 1XEXA 1XD9A 2VSFA 3K0FB 3U4QB 4A4DA 3EA0A 1SVMA 2FX3A 1YQTA 1IN8A 2VHQA 4JJZA 1KI8A 2B7CA 2CJWA 2NPIA 5JS8A 2O0JA 3JZAA 3R7WA 4ZIRB 2OE2A 4A92A 3KTAB 3WP0A 2C95A 4QG7A 3THWB 2NMVA 4M2LA 5BWMA 1R5BA 3A1SA 4GP6A 1G8GA 1KO7A 2OCAA 5F98A 1DAGA 1TPZA 4TYPA 3WBJA 2A7QA 4KFSA 1XXHB 2A5FA 1CTQA 1NLYA 4KFUA 4Q4HB 5JHHB 3VX3A 1FQJA 2BWJA 3MLEA 3AP3A 2EFGA 1UEJA 1B0UA 1ZIOA 221PA 1E0KA 4Q1FA 4B2IA 4JL8A 2BJWA 2H57A 3QF4B 2KJQA 3GPLA 1GILA 3SDZA 2XNDD 4JL5A 1FTSA 1H8EA 5F2EA 5FUWA 3AF4A 4K81B 2ZVQX 4HI0E 4LHWA 2OO7A 4WZBE 4QFMA 4Z8YA 3VU9B 3WHKA 2ODWA 4O2LA 3QPVA 4QXAA 3BBPA 3SJZA 2JJ2A 1KZ7B 4QHYA 4BZQA 2FV8A 1H8HA 4DUGD 1E9SA 1GTVA 1Z29A 1XD2A 2P6NA 1NG1A 3B9QA 3KKQA 4P32A 1CLUA 1E3MA 1E2HA 2RGCA 5CM9C 2D74A 2VL7A 1NMXA 1W0JA 2IT1A 3K9GA 4A8JC 2BHRA 3EZ7A 1F2TA 5DGXA 2GVDC 2JIZA 1UKEA 1JEEA 1BOFA 2J0SA 5F9FA 2WWFA 3KX2A 2F9LA 3HU3A 5C4MA 2ASEA 1SHKA 1CR2A 2VSXA 4US2R 3VHLB 4BLTA 4OI4A 2IYWA 1G3QA 1KO5A 5KNDA 5DI3B 5J4HA 4FI3C 2JATA 2Z5FA 3BAFA 1OW3B 4XVQA 4B3FX 2ZU0C 2ZSAA 1HT2E 1W0JD 1G41A 2CK3D 1T9HA 2GBLC 2OEPA 5FTLA 2IS4A 2AL7A 3FPAA 5FI1B 2ZUDA 2FSHA 4A6XA 1NJFA 3OIVA 5HCNA 2XTMA 5P21A 2WJVA 2YHSA 1BYIA 2FG5A 1NBMD 2Z43A 2GXQA 4OKSA 1Z6GA 4BFUA 1QHNA 2ZE5A 2PLRA 2G0NA 1GKUB 5BN3A 2VP9A 3V4RA 1BS1A 1XXHA 3KKMA 3REFA 4NTZA 3LVQE 4I1SA 5EUQB 4V03A 4QBFA 4B3CA 2GETA 4BUJA 2BV3A 3T1TA 5L3RA 4PX9A 2PCLA 5AJWA 1BO6A 2OAQ1 4DDVA 3W8RA 4PO1A 4M0LA 3KL4A 4XTCS 1KY2A 1SVKA 3CRVA 2WOOA 1NMYA 2IEYA 2FFHA 2EWWA 2QZ4A 4RZUA 2QY9A 3RWMB 5TARA 4MDFA 4HATA 3FGNA 1N6PA 3K0FA 4GZLA 2W0SA 4B33A 2J59A 2GRJA 2W2TA 3B82A 3HU2A 5TDHA 3V9PA 3GJ8A 1HQYE 4FWIB 1G5TA 4H9GA 4XH9B 3EXAA 4NMMA 2PJRA 1KNQA 5K8IA 4BLPA 2OLJA 1XTKA 1F6BA 1G5PA 5EE1A 1OKKA 2BMEA 4D2IA 3C41J 3EARA 1ZJ6A 2ZUCA 1Z5ZA 3PEUA 4JSYA 5AR1A 4NYMR 1NVVR 4M22A 1NIJA 5CK4A 4Q4JA 3T61A 1KO8A 4TZ6A 1W4AA 3IUYA 2YWGA 2BMDA 4IJMA 3GJ3A 5AJXA 2GILA 2ZUBA 3UMSA 3NC0C 2QSZA 4URYR 2P5TB 4JJKA 3AP2A 1JJ7A 4NZYA 1KO4A 1Z0DA 1FZQA 1O3YA 2IWHA 1EFHA 4V0KA 1II9A 2OFWA 2GHIA 4Q21A 3FMOB 5EP2A 1QG4A 3LXRA 4ERNA 2E9SA 1ZC4A 3RS5A 2X19A 2IHYA 4D81A 4DLXA 1WGWA 3UIEA 1E2LA 721PA 4IDNA 3WMFA 1N6IA 5CITA 3B6EA 1OFUX 3ZS8A 3BWDD 3VKGA 5EP1A 1DAFA 5L3SB 1UBEA 2J3EA 2P5SA 2VO1A 3LA6A 2KBEA 3PV0A 1S8FA 4LBVA 1HEIA 1L4YA 4UNNA 3SN6A 3PCRB 3I8XA 5D3MB 1XPUA 3D3QA 2CJWB 4KHZA 3KQLA 3QKTA 5JHGB 4Y0AA 4KU4A 4DJTA 4ZI3A 2ZROA 1QRAA 2R6DA 1HA3A 3SC3A 4BFTA 1E2EA 2RB4A 2WKPA 3D8BA 4KXFB 3G5UA 4BZPA 2YWEA 1OFHA 1NN3A 1Z0KA 2QMOA 3HYRA 2XTNA 3IPXA 3PUZA 5DHFA 3U3JA 4EPXA 5JS7A 4DB4A 5H68A 3T34A 1M7GA 2FJUA 3A8TA 3LBNA 3I61A 2QM7A 3K9HA 4DIEA 1XDBA 3RC8A 1WRBA 2IW3A 2R6GA 4UNSA 4LJ4A 1CBUA 2ZANA 1B23P 3AF1A 4QBIA 4OYHA 3PEWA 3CW2A 2XAUA 4HAXA 4RD2A 4OHYA 3ZZTA 3TGPA 4QNRA 2C96A 1GDDA 2IEZA 5HTKA 2ZETA 3QG1A 2CCKA 4WAUA 2JAQA 2NIPA 4ACAA 2IWRA 2DB3A 4IKEA 2NQ2C 1ZD9A 3OEED 1IJEA 4M1YA 4PPFA 1JQLB 4Z8XA 3U6KA 4B71A 2ZJBA 1E1QD 2CHQA 2ZYVX 4MRNA 2DY1A 1XEFA 5FOTA 3TH5A 3NHBA 4KO8A 4IFBA 4CDGA 5F3WB 2X1VA 2ZPTX 1E2MA 3FB4A 4IOJA 4KFRA 4TT3D 4G5GA 4EAQA 1CIPA 3FMIA 2C99A 2GKSA 1NF3A 1X8KA 1YU9A 3RHFA 4D4KA 1XTRA 2GXAA 3HR7A 4IDOA 2FEOA 2P2LA 4TMTA 2J7PD 5TV2A 4AKEA 4X8HA 4C0JA 2GJAA 4GRAA 1E9CA 3K09A 1XXHE 1VIAA 1Z63A 5E7JA 5SZJA 1D5CA 3ECCA 2VYFA 1ZM3A 1FOEB 4JVNA 3UMRA 2PZEA 3DZ8A 1XCMA 3BS4A 4LPSA 3U3KA 1OF1A 1P9NA 1KI4A 1DO2A 2P6RA 4NYIQ 3LRPA 3C7KA 2IYXA 2O8EA 1YZUA 4GOXA 4D4LA 4P4TA 4CEHB 2ZAOA 3I62A 3AVYA 1TU4A 4TMVA 4I1VA 4XIGS 5DH9A 5TVKA 3K9LA 3Q72A 2IS1A 1GKYA 2ZITA 1E99A 3A4MA 1TMKA 1VKJA 4U7DA 1RJ9A 5L3SA 5TY0A 1YZTA 4Q01A 2EU8A 2QE7D 2RH5A 3NEJA 3SS8A 1C9KA 5GJCA 4NCJA 3CRRA 1II8A 2PEYA 1OIVA 2OBNA 2WBLC 4PC2A 1LS1A 2FOLA 4TN1A 2EFCB 5B57C 3CR8A 3KUCA 4Q02A 3PG5A 5B58C 1E1RD 3SZRA 2WOJA 5CJ2A 2RGDA 3DM5A 3E2IA 2DWPA 5KSZA 4XD7D 2PZGA 2VHJA 2DWQA 4DLWA 1WE2A 2AXPA 4Q9KA 1ZUHA 2FNAA 3C8UA 2DWOA 4I99A 1KI6B 5JLJA 4BLRA 4ZCIA 1HT1E 3PITA 5DE3A 1J70A 2YVUA 5FBQB 1RE0A 1E9RA 4B2LA 4NKRA 1XCGB 2RHMA 1XJCA 4UQOA 4OHZA 3GEIA 2ZS7A 3GJXC 5FTMA 3CONA 2OCPA 4D4JA 4XWKA 4DKXA 4Q03A 1OXVA 4Q47A 5BW8A 3OF5A 3ZGXA 3QG5A 4TQAA 5EJEA 3SFZA 2V6JA 3THXA 1E9BA 5CIQA 4C0HA 4A0RA 3B78A 2WV9A 4TL9A 3IKJA 1OB5A 1NL3A 2ZJ8A 4OHVA 4PZZA 3U44B 4N3NA 4JBXA 5E4FA 2ZI5A 4EQ6B 4BFWA 1OXTA 4OJQA 2JJ1A 4A0FA 1XZQA 4AIIA 1QHGA 3EZFA 4P4UA 2CNWA 1OFIA 5BN5A 3K8YA 3AVVA 1F60A 1AM4D 4HLDA 2XITA 2J87A 1VECA 4LHXA 4Q5IA 1NVXQ 3CWZA 4OK5A 3W5JA 2CVHA 3AKEA 3IPYA 2Q3FA 4FCVA 2J0UB 4MYTA 4PSVA 4RKFA 5CDFA 2O8FB 4WZ6A 1CS4C 4U02A 2VP4A 2WAYA 3IIKA 5FBRB 4L8GA 3OZXA 4N0DA 2R8RA 4OBEA 4AG6A 1AGRA 2FDCA 4OI2A 2B21A 2WSSD 5H70A 1EX6A 1WBDA 3CX6A 1AZTA 4IEEA 4D26A 2FPLA 1JEDA 4C3ZA 4BQSA 4WOPA 4TLEA 1R0ZA 2IF2A 5FL7A 3UXMA 2WWYA 1I2DA 3OEHA 3U44A 4RCZA 3VQTA 3L2OB 3DKPA 3UKDA 2ZXUA 1AKEA 4G5OA 4HYYA 2ZI7A 1M2OB 3AKDA 4YMSA 2HV8A 1O87A 3TJZA 3C15C 3GFPA 2PX0A 4P0TA 2IYZA 2DBYA 2JJ8A 5CM8B 2VPPA 5E3HA 3EPJA 1P3JA 1P61B 3P32A 3QXHA 2PT5A 4QC2A 3KB1A 5DISB 1W49A 2R6FA 1DAIA 4LYJA 1ZNZA 5EE0A 5BYJA 1RPZA 1LTQA 4V02A 4GFDA 2FN4A 2X8AA 1XEWY 1CF4A 3R9XA 1N0VC 1H8ED 1YR8A 2J0UA 5FUYA 3SE0A 1KI3A 2QEQA 3M4YA 3R7WB 3PUXA 2QAGA 4DC9A 4PPNA 4M9SA 4WVFA 1G16A 3WBKA 4JT2A 1L4UA 3TAHA 5HCIA 2O8EB 1XF9A 2VF8A 3AV0B 4GOKA 3C5HA 1ZNXA 2RGGA 5DLQC 5C4GB 5DN6D 3GLGA 2IK8A 4JT4A 4RVCA 2AK2A 4KFTA 1GRQA 1XMVA 4R71A 4MH0R 4G1UC 3CR7A 2PH1A 4JLJA 1RYFA 5KUTA 4RFSB 4L5BA 1VCMA 2IXFA 3LW8A 1JXMA 3W5IA 2GCNA 5AJVB 5GVRA 2HF9A 1ODFA 4OHWA 5IDVA 3GLHA 2WAXA 1XJQA 1NSTA 3WNDA 5FOXA 4CGZA 3U6BA 2C9YA 1FX0A 4EKDA 4F91B 1LFDB 4FMDF 4A8JA 1RRGA 4UXJA 5J4KA 4UNQA 1RRFA 2YINC 1KIMA 3B13B 2QORA 1TF2A 1KK1A 5KNCA 4FCTA 4WA7A 3U5ZB 3R9IA 3CZPA 1W5SA 2CLDX 4LBZA 1PZNA 4Q1BA 3T35A 2ZRPA 1CXZA 1Q12A 2EYQA 3HPQA 3X2SA 3CNLA 4GNKA 2WWXA 4E03A 5KPJA 3Q9LA 4NH0A 1I4DD 2BBSA 3O8BA 2PLFA 4BEBA 4YLGA 1P6XA 2PX3A 1NKSA 4C7OB 2A5GA 2OXRA 3DKVA 2Q9BA 1P2VA 3ZDQA 2XOKA 4RD6A 4XWOA 1EFUA 3K53A 3RWOA 3X1DA 1G21E 4B74A 2OLKA 2GJ9A 4KODA 5DIFA 3CLVA 4PHFA 2DYKA 4TLCA 4ASUA 5L3VA 5JSZA 1Z8FA 3X1YA 3UG6A 4S2EA 1COWA 3A4NA 5EXPA 3ND8A 4Q4AB 2B8WA 3H2YA 3PUWA 1Q44A 2B7BA 1G20E 5FL3A 2GJSA 4MKGA 5A4JA 3TSZA 2MSCB 1F2TB 5TB5A 1JR3A 1CKEA 4FWTA 2GVZC 1TL7C 3U2QA 4PAOA 3K0CC 5KDLA 4BLOA 1CR4A 2WWGA 3ZYCA 4Z1MA 1LF5A 2QTFA 3OEEA 4ON9A 4MKHA 2WWIA 4AD8A 3KTAA 2VSOA 3R8CA 1NY6A 5CJPA 4YMVA 1MOZA 4LZZA 1J8YF 4EPYA 3KQHA 1J2JA 1P2TA 3ICQB 3ASYA 2RHDA 3V00A 4UNPA 2YOFA 1ZRHA 2WKRA 2ZJAA 4I1UA 4KBGA 3QNUA 4QHSA 1DELA 2WHXA 2ZVPX 2NGRA 4PHGA 1IN5A 2FPKA 1NLZA 2REBA 4OK3A 2ZAMA 4NYJR 4X8LA 4LV5B 2H1LA 5JJIA 4KI0A 4CRWB 1LS6A 4HUTA 4Q1AA 4QBHA 4RSGA 3KXLA 2JASA 3I72A 3CPJB 4AWXA 2WJGA 1EFRD 2F1JA 3MG9A 4NYIR 4C0LA 4JLDA 4EPVA 4OQXA 5JFGA 3T5GA 4K46A 1E9AA 2A5DA 2P67A 5E7MA 1QVRA 4XTRA 5LB4A 3S1AA 1HURA 2XOKD 3SNHA 4IOMA 4M4SA 1E79A 4QHTA 1YVDA 2E87A 1WXQA 2ZRBA 1HH4A 5DI9A 3BFXA 1TX4B 1UEIA 4AKGA 2CDNA 2HCBA 2ZRJA 4Q4JB 5B2ZA 2ZE8A 1TQ2A 4IOKA 2V55B 1W46A 4GDFA 3TUJC 2NZJA 4LRWA 1ZU5A 2FGKA 2O52A 3FMPB 4H1UA 4JZKA 5GVSA 1QG2A 4A2QA 3U7EB 5EQTA 5JJKA 1AZSC 1Z6YA 3B5JA 3LD9A 2XNSA 2VH5R 3O8RA 4JL6A 3TMKA 5HPYB 1IHUA 5DYGA 3F5FA 5KSPA 1KAOA 3REGA 3CRW1 4DHEA 1NKTA 1G7CA 4LJ8A 4M1SA 3NEYA 2EQBA 2NPFA 3PUYA 3U3OA 1NRJB 1R8SA 1HY3A 3U7GA 3VR2A 1E0JA 1YR9A 2RGAA 4BFXA 2Z6VA 3VMFA 3FYHA 2GAOA 1KO1A 1U2RA 5JSZB 2C5LA 2W58A 4WXRA 4MRVA 1VCIA 3T1QA 2YJTD 4ZDWA 3KFVA 2AWNA 3DHWC 4ARZB 1S1CA 1Q1BA 3EC2A 4LDJA 5CB6A 3P4YA 4RY2A 2HXYA 4F4CA 3FOZA 3SBDA 4LYFA 2K5UA 4FMCB 1VYVA 3U7FB 3CX8A 3J81k 4V0OA 3SYKA 3ADBA 2QT0A 2QPOA 4II7A 3QKRB 2ZRKA 3H4MA 4A8JB 1KKLA 3GFOA 1Z47A 1KMHA 4GZMA 2IYYA 2JJ2D 4AYWA 4QM6A 1JQJC 4DLYA 2D4HA 1W0KA 3CPEA 3GLHB 4Q4AA 2ZR9A 4RD4A 4TT3A 4QJ5A 1UF9A 4LHYA 4NCKA 3M1IA 3QXSA 1KJZA 2BEJA 3AKCA 3FTQA 4FMDB 4PQYA 3LQQA 5EXTA 5SZHB 2AD5A 1DADA 2JLYA 2FWRA 2Z83A 4PR0A 1Z2AA 5CYPA 1UBFA 3AVWA 4Q7LA 1TQ4A 1SXJA 1W1WA 3QXJA 1E1QA 3DOEA 4LJAA 2R9VA 4B76A 4LY6A 2F55A 2I1QA 1OYWA 2OAP1 1CULC 3SU8A 3QPWA 4TTRA 2VP0A 3EASA 5CLLA 1VDZA 4URWR 3QJYA 4OL0A 1SHZA 3TVDA 1F2UB 2IC5A 3U4QA 1NVUQ 1E94E 4MITA 1CJKC 2D06A 1E2KA 2QL6A 2YKGA 3AVQA 3Q5DA 521PA 3I5YA 1P5ZB 2J7PA 1W36C 2F6RA 2NZ8A 3PVSA 2MMGA 4KVAA 3AUXA 4IDQA 1AS2A 1OPXA 1KYIA 1KJWA 3QE0A 1U99A 4L15A 5G40A 2G9NA 4V0LA 2WMNB 1PLKA 1G4AE 4EUNA 2GJKA 1FUKA 2OFXA 2QENA 2V6IA 2QU8A 3RS2A 2FFQA 2ZR7A 3M6AA 1IXZA 5IT5A 1I2MA 3IEVA 4URXR 2F7SA 2QBYA 5EZ6B 1E79D 3RS3A 1CJMA 4BWYA 1F3OA 4YXWD 4NYMQ 2F1HA 2BMFA 2I3BA 4KYIB 1U98A 3X1WA 4FMBB 2ZRLA 3AKYA 3FMFA 1FW6A 1SVIA 3NDBB 3NHAA 3TE6A 2GK6A 4NCHA 1M6NA 3KQUA 5EP3A 1E2GA 3NXSA 1RIFA 4ITRC 4Z1MD 4HB4A 5J4YA 2C2HA 1E2NA 3FKQA 5JEEA 1N5KA 2V1UA 1UDWA 4MRSA 1R5OA 1ZIPA 3KKNA 2ZR0A 3PENA 1M8PA 1QHSA 3THXB 4AURA 1VCOA 1MRSA 3SQWA 3C5CA 4NCNA 1Z0JA 3RDPA 2X2FA 1KZGB 3PIRA 4RZ2A 2GZHA 3EPLA 5ELXA 1SVWA 4B6EA 4F38A 2RGEA 4N1AA 4QM7A 1SKYE 1GP2A 4GP7A 3GJ7A 2P3SA 1RKBA 4BLSA 1TEXA 2HJGA 2W83A 5FUVA 2OFOA 2GK7A 1N2CE 1SXJE 1US8B 2EFEB 5H1YA 2WJHA 4V0ME 1S9DA 3FKSA 3NC1C 4R7ZA 1YZKA 1NVWQ 4QGFA 3BRWD 4U00A 5LDDC 1E2JA 1ZW6A 5EE3A 1GITA 4HUQA 1G8FA 1OB2A 4WIAA 4JVLA 4FCWA 1N3BA 4TLBA 2VF7A 1E69A 2YWFA 1II0A 2BC9A 1XFAA 2HXSA 4QJ3A 2JLSA 3L82B 3RLFA 3T15A 3OIUA 4LJYA 2GF0A 4B3BA 4Q1CA 2IS6A 3FKSD 2ZI4A 1ZVQA 3WP1B 5EXSA 4AKIA 2HDNB 2VTKA 1YR7A 2WIAA 2QA5A 3JZMA 2XJ4A 4DZZA 3TBKA 5CYOA 1MRNA 1NMZA 5JWRA 4GPTA 2SHKA 2EVWX 2F3TA 2CK3A 2YOHA 2IF0A 2BM1A 2ZJ5A 3KB2A 2YNMA 2HT1A 1U8ZA 5LD2C 1XB2A 1VYUA 3I1FA 2CCGA 1AN0A 5HE8A 4HLQB 1XD8A 3LY5A 4M9ZA 1N6RA 3QVUA 4NL4H 1C1YA 2H18A 4YC7A 5CB8A 1Q22A 4WW0A 4HLUC 1IOZA 4LGMA 1ZUNB 4Q18A 2EWVA 4PQFA 2A5YB 3OIWA 1N6OA 2VP2A 1XPOA 2ZSFA 4FMCF 3T1VA 5M04A 3F0TA 2REXB 5KU1A 3FFBA 1H8HD 1GRNA 3VR6A 2VLIA 4LWZA 4YONB 1P2UA 1W36B 2QP4A 3EX7C 4JMPA 2W6IA 3IDQA 3T06B 1CRPA 1AK2A 2ZRCA 4A0HA 2JLWA 3D6TB 3BFKA 3KJEA 4KLZA 1R8QA 3VR5A 2X2EA 1SQ5A 3CWQA 2MMCA 5FPTA 4E22A 5KSOA 4JVSB 4LI0A 3CZQA 3B1XA 4W5WA 1KSHA 3X1ZA 4H1VA 2JLQA 4PZLA
chains in the Genus database with same CATH superfamily
4PLYA 4CZ2A 2XTZA 4ABYA 3E03A 4AL0A 3BICA 3FCYA 4FFVA 4NC9A 4DQLA 1L5YA 2IXDA 3BTOA 4YFYA 3F6SA 5BWLA 3OCUA 3NGMA 4NG5A 1F2UA 1OKKD 4AN1A 3CKYA 2ZYGA 3KEMA 2V6BA 3TD9A 1RXWA 1G5RA 3QQ5A 2RHLA 3W2IA 3OE4A 5CGQB 1LJ8A 4RPKA 3EIHA 4BFYA 3RKOF 1OX4B 2SBTA 5CDUA 3KXPA 4LMPA 3WDSA 2DF8A 5ICSA 3SKYA 1D1BA 5KNBA 4GXNA 4QPNA 5AXCA 1DUIA 3WGJA 5EXDA 3DMGA 4UVDA 2OKUA 3GARA 1TUEA 4Z4IA 3IOCA 1DJLA 3QVJA 1CR1A 3AGTA 4BJ6A 3EXG2 3IP3A 5E33A 3MBOA 3OKAA 1LJUA 4GO1A 1HTTA 2IZ0A 2QHXA 3G0IA 1TJ5A 3R5SA 4FX2A 4YREA 3ZWWA 4E1VA 4ZVKA 4ZEVA 4D42A 3K8OE 1JYSA 4L28A 4EA9A 1KMQA 1PL8A 4KXWA 4OD0A 5F52A 3RU2A 4DWJA 1KQFA 3MOIA 4IIJF 2VZEA 2YJZA 2HQRA 2YDYA 4FFLA 5T8KA 3JYOA 1JDPA 3B53X 3L4EA 1WMBA 4NV3A 1Z26A 4GE3A 2XRYA 5ARBA 3TW4A 4HLCA 3NBQA 3LHSA 3I34X 2Z5LA 3D0QA 3AF2A 4CL8A 2I8CA 4B3JA 2Y76A 4D9EA 2O2HA 1SUCA 2ISSD 1PT9A 2BDTA 2QTMA 5F12A 1B4DA 1W2GA 3MW8A 3PXXA 2OO3A 5DSZA 1IC6A 1G3UA 5BQOA 1NXVA 2PZMA 2XWSA 3PQEA 3KVRA 1A8SA 4YGXB 1QPGA 3WL4A 4EW2A 2XZPA 3AU9A 4GW3A 3WYGA 2Q1SA 256BA 3BQNB 1MHTA 1JWLA 2P91A 1REQA 1LNZA 1UZAA 4TKVB 1F8XA 1JHYA 1UDAA 1AQJA 5FI5A 3CQ9A 4B6SA 3AERA 4EATA 4I7EA 3JWIA 4KGXA 3K1IC 2Y3IA 3OIGA 3F7TA 4RACA 1KZYC 4A2CA 1AKVA 2Y1WA 2QPAA 3NBMA 4D9NA 1SR2A 4ZCSA 4EG8A 4FZRA 1UL1X 2O7RA 3TS1A 1FTWA 5CVCA 2O0MA 2RG1A 2JGLA 3E61A 3A6FA 1JQ3A 1IWOA 1X3LA 2Z4SA 4Q00A 4Y7CA 5HBGA 2VT3A 1VL1A 1J9EA 1L8LA 1PS9A 3D0OA 4DLVA 1E89A 4QUJA 2XY4A 1P7CA 2JCGA 1M73E 4IVQA 3QU5A 4OLFA 4QPJC 1ZU4A 4RADA 5FBWB 1R0WA 3ZHVA 1MABB 4YRBA 1BFKA 4AF8A 3OF3A 5K3FA 2OBYA 3R3XA 1KU0A 4OMDA 2BDEA 1ENPA 4Q1DA 2XQVA 1WMSA 5J63A 2C04A 3L6UA 3TK1A 4P08A 5JVDA 4XYMA 1LPSA 2ES4A 2C31A 2L82A 3BMQB 3PTLA 1M74A 3I04M 3TGWA 4U0JA 1P5RA 3RNLA 1XMJA 2O8NA 4G07A 2J0WA 2JIZD 3OWHA 4GDMA 4PVDA 3TJRA 3AVOA 4C4OA 4S12A 1R18A 1ZHTA 1E84A 4JEHA 1DCFA 4NJEB 4YV0A 3IE2A 1K6MA 1S7CA 1UP7A 3LDHA 2Z9CA 5IAAA 3HA3A 4PLCA 5D3MA 4L4UA 4TVOA 5D1HA 1NHWA 1G1MA 5EEGA 1K06A 2IEBA 2HX1A 5K9ZA 2UAGA 1MMDA 2ZFUA 5G41A 2BOVA 4OPMA 5D1NA 1R4MB 4U5HA 5FWXA 3SAJA 3G8DA 3WADA 3WNZA 4JYCA 3T7CA 2Q1YA 1VYIA 1ORDA 4RL4A 5F3RA 2JGMA 4AJ1A 4ZXFA 3NJRA 2CVPA 4YQEA 3L06A 3PHF2 1T4GA 3ANYB 3B20A 4JTDB 2ZXRA 1JIIA 3HP1A 1BDMA 3I37X 3OFND 3FW1A 3NX4A 4BQPA 5JXWA 3H2BA 4BO7A 3WMGA 2FUCA 4HGPA 2VYQA 5KMGB 1OJLA 5D3KA 4ALKA 5K3FB 2QS9A 4BYGA 5FFFA 2BGNA 3GWZA 1MQVA 1LE4A 2H52A 2ODBA 4NY3A 3FIUA 2NZXA 2PFGA 3U4AA 2A6PA 4R8LA 4HNAB 3COVA 2F3QA 3L6RA 4LJLA 4F5EA 5LXTA 1SOMA 4NDAA 2O8BB 1TMYA 3M3PA 2V4MA 4O8CA 3UBMA 2VB6A 2B3DA 2BGIA 3G4ZA 4E2WA 1IXKA 3HVRA 4IIBA 5AKXA 1EWVA 4YMUA 3SLRA 4RVNA 2W0MA 4GL4A 4PR3A 3JY6A 4NK4A 5DDIP 4G1BA 1RLJA 1II8B 2XTJA 1B15A 3BWBA 4XPZA 2WMDA 1VG1A 4P5PA 5CFNA 5DWQA 5EKUA 1KEWA 2A9RA 5GV8A 4BV3A 3ERCA 3IC5A 4RX1A 1ACMA 3PDHA 3ZEIA 4CJXA 2W45A 4UD2A 3FYUB 2GEDA 3ESAA 3LQFA 5EPEA 4DCCA 2C9OA 5L6MB 3A6EA 1MJNA 3DQPA 3QVSA 2ISQA 3MZ0A 4RMNA 2YZSA 1KA9H 4IZIA 4KN6A 4N41A 4YGYA 1DXYA 5SY4A 1QOZA 3HRHA 3P9YA 3HNOA 3K0AB 4P82A 4IIEA 1M1UA 1SELA 3ZE7A 1N2GA 1SURA 3M70A 2FEAA 1NBAA 3H6GA 1HKHA 2Z57A 3CYFA 5EXXA 4TYYA 4I9UA 5FFMA 1Z5PA 1Q0DA 1R4AA 1XI2A 2JARA 1E85A 1P7YA 2UXDB 3B2QA 3PD1A 3AHHA 2H1HA 3ZGYA 3DKAA 4NHOA 4Y2VA 5BV1A 2XYRA 2JGDA 3O83A 4Q9JA 2QJOA 1D5WA 4V2UA 4B6RA 3PXUA 5A0TA 4MV7A 1AJEA 4ZT5A 4P34A 5JFOA 5KYXB 1MG0A 2VA9A 2ZZNA 1N6NA 2GR9A 1YRYE 1S8NA 3E7WA 4ALNA 4DEXA 4ZXPA 4Q7JB 4BO8A 1AKMA 1B6TA 1RPNA 3KAJA 4QJBA 3KYIA 1E5DA 6CHYA 1C0EA 2CB0A 2PX6A 2VAWA 3M6VA 1N0IA 3OU6A 1MU0A 4H1TA 1KYYA 1EM8B 1VGVA 3EZNA 1EUDA 4ER0A 3MOSA 1K5PA 2GNAA 2X8JA 4UE6A 1ULSA 1JV2B 3BH7A 1IU9A 1KQ3A 2H9IA 2I3AA 3WYBA 4ZP1A 1RLUA 4WERA 3H4IA 4C21A 3GORA 5FLXA 1OOEA 4TTVA 3HB1A 5H02A 1JLHA 3A6GA 2C61A 3CV3A 2P79A 3DOJA 1CPYA 4DLAA 5LL6P 1J1IA 3G0DA 3VNUA 3TG2A 3B8EA 3RUAA 3HY4A 2WWRA 3PJRA 4BE4A 3ELYA 5DGTA 4ETNA 2C84A 1E6UA 3B1YA 1CY1A 4PSCA 2ISCA 3AZOA 4Q3NA 4ZVVA 2UUPA 3ZBPA 3GA0A 4HFNA 2XA1A 4LXGA 4WFJA 4XGNA 4ZOBA 4ZRMA 4M1WA 2WUGA 2FXVA 3Q87B 1YHNA 2IU3A 3GVIA 3KUXA 3WY9A 2GBIA 2YIDA 4KXUA 3MTEA 5FOSA 2IYQA 5HSGA 5AVOA 3BMOA 1C3LA 1UJ2A 2XHEA 1S0UA 3T7JA 5T8KC 1PT7A 4FNMA 5JTUA 1ZAYA 3C4QA 3PX2A 1G0OA 5TS3A 2VDQB 4IQFA 2G28A 1PV4A 1QWSA 1T8SA 3IO5A 1H85A 4OF4A 3D5EA 2G3YA 4F21A 3S7ZA 1GNRA 1CEYA 2EJVA 1FTGA 1GAWA 1YS9A 1VJRA 1S8AA 2GPJA 3POVA 3OIYA 3RODA 2OD2A 4FYMA 3WTCA 3RAFC 1GDTA 1HETA 3WYNA 1UXJA 3W6OA 1W2WB 4E1AA 4CF7A 1JBQA 4K3VA 1S1MA 2V5AA 2BTEA 2FY8A 2YIMA 4AULA 2FVXA 1GGKA 2NVWA 4H7DA 2AN4A 1Y1RA 4G65A 3O0TA 1OX6A 2W71A 4TTAA 1YI8A 3IJEB 1QHHB 4JCHA 5AJZA 1GGHA 2WJIA 3Q10A 3OPYI 4LXTA 4ZZ3A 2OBMA 2YQYA 1XC7A 4J49A 5CFMA 3UB4A 2BRUA 2G88A 2I6TA 2PBRA 3NZEA 1SCUB 4C0BA 1B1AA 1KWGA 2ET6A 1WUYA 1LD3A 5F23A 1CE8A 1PJBA 2Q07A 4FYIA 2O2CA 4IDGA 3RQIA 4A0GA 4CLOB 5IJZA 2P61A 1N9GA 5KJEA 1HNZB 2DUMA 4XKJA 2R1VA 3HV0A 2ACEA 2EDAA 1Y5RA 1A2OA 4YCCA 1T2UA 1O5TA 1POXA 4ZYUA 2JZCA 4QVGA 5JO0A 3ETCA 3FJ1A 4ZFNA 1J07A 3HKDA 1JIJA 2PAFA 2ZE6A 1XRQA 3MTQA 4QLOA 4E33A 3EGEA 4B5LA 1L4HA 1T9CA 4B84A 2PMBA 5F7JA 3EFEA 3HA7A 3HNPA 4I4LA 4MUJA 5KINB 1WXFA 2OV3A 4R9RA 1SVNA 3FROA 1TYAE 2QMUA 4N0MA 1LPAB 4DVGA 4CQJA 1XU9A 1FTYA 3JCUQ 1SHUX 1XVVA 1YQEA 2XZDA 3BHJA 2E37A 2YMLA 4KC0A 4TTTS 3ENZA 1CUXA 2C9MA 5JD3A 1Z08A 3MUEA 5IN4A 3V5YA 3FWHA 4BJTA 4EIWA 3R5HA 4XIJA 3IHLA 1HE9A 4IV8A 4HDQB 4MNDA 2ATIA 5E9QA 4MGKR 4BASA 2EZ4A 3CG0A 3F1LA 3NONA 1YZLA 4A10A 1HE5A 4D6PA 1W36D 3HWSA 4CR8A 1NQTA 4YT4A 2Z0MA 3RSHA 4A2WA 4FFBB 2Y0EA 2ZRAA 3RRFA 4N6NA 4A2NB 5CLHA 4XSHA 3ZWPA 3W5SA 3KJGA 1LBIA 4YAWA 4A3SA 2Q3BA 3RCBA 2ZI6A 3AM1A 4WEOA 2PSHA 1CPQA 1SVSA 3I5MA 1V6AA 2PSJA 2JKZA 3IT1A 3OVMA 2A0XA 3W2GA 1PWHA 4PHTA 3A4LA 3C39A 1GQRA 2IIPA 3HGMA 4J91A 3GYBA 1YDWA 4QBKA 4AROA 2ECKA 3N8IA 1U6KA 1DWQA 2AOXA 3L0YA 4HQNA 4ME6A 2AE1A 5D3QA 2Q2WA 2VTVA 2D6FA 4EQZA 1SC3A 5CA1B 1F2DA 4GRIA 5HQ3A 4PZAA 3AKZA 1V1RA 2X8LA 3R0XA 5T67A 4MROA 4MUXA 3NB0A 1NJ6A 4MS4B 1RHQA 2B5OA 4HRAA 1M6VB 3LQYA 1HE3A 1LV7A 4CBEA 1BXRB 1K05A 1Y8RA 3WNBA 4RELA 3K9FC 4CG1A 4I8IA 4TMYA 5EIWA 2NACA 1YE8A 1V9CA 4Q48A 2J1LA 2ONKA 4NMXB 2JJ1D 4UBMA 4OQMA 3HC7A 4X6UA 3ZHYA 4F60A 1WXIA 3STWA 1KQPA 2E5WA 3VR5H 5IVPA 5GJVC 3GLFA 4KRXA 2BKLA 1HYQA 2VATA 4EEXA 4IIUA 1CUHA 4J30B 5BPHA 3OT1A 5HIAA 4NAUA 1BDBA 3DEFA 2IZ7A 2HA5A 3CJRA 1AO3A 5DBOA 2VF5X 2OXEA 4ZVSA 4N47A 2C77A 4L9AA 4EHHA 5J58A 2QIOA 2Q1XA 1ZHOA 2Z3ZA 1KBOA 4OMUA 1R6DA 4BO6A 1CVRA 1PR1A 1SVOA 5LA6F 5SY6A 4ALIA 3W3AA 3W9BA 3W2EA 2D3WA 3WDMA 5DHSA 3LKZA 1B73A 2VBCA 2QXUA 3JQBA 4MQ5A 3O26A 3T95A 3T5PA 2LDXA 2EPLX 1XIVA 4GMFA 1Q3KA 4GE0A 3VSDA 3F2VA 4FM9A 2DTEA 3A7EA 3BXEA 4JY7A 4K8OA 1M2VA 2QNIA 2A0FA 3GC6A 4NPHA 3OP1A 1SBNE 5A3SA 2XAAA 1NP3A 4UBIA 2ZDGA 4V0MA 3WK8A 1ZMOA 2ICAA 3AJRA 4A4AA 3EIEA 4JE9A 2OFPA 3D6UA 3RAEC 1GQSA 2Q1UA 2WVHA 4F84A 1L5RA 3V9AA 1XEWX 3R3YA 3W6PA 2XLDA 2I54A 2IOHA 2QW0X 1OAAA 2V03A 3OFNA 3C7DB 4Q93A 2ZTMA 5ITWA 2Z6QA 3T5CA 4Y0NA 3UMFA 3IMKA 3ZCUA 4YMWA 1JA1A 4NONA 2B9VA 4ZKDA 1RMYA 4LY9A 2G9QA 3WMXA 2C2BA 2QV7A 4BB5A 3I30X 3KPWA 1SA0A 2DUUA 2OZKA 1Z4KA 1WU8A 1I9CA 2WL8A 1IHYA 1FQOA 1KTVA 4XM1A 1TVKA 2P9TA 4Q3KA 2HK6A 6NULA 2B30A 3L0CA 3LTNC 3R0VA 5L0GA 4MO9A 2F64A 1I33A 1H2AS 2MSNA 1U3WA 1KDPA 1T6UA 3FB1A 3K6JA 4QQ8A 4HAWA 3K35A 3RTDA 2XADA 4KO3S 3HXOA 1GTSA 2BD0A 3JQBC 4QVKA 1CLEA 2EEZA 3EUFA 1V95A 3LVRE 3P96A 4R8SA 3SKVA 2NTYC 2JG3A 2DBRA 5JSKA 5C8YB 5FYDA 4AJKA 4AX8A 1YAUO 4MCAA 1YA4A 2PPLA 4JYPA 4MW5A 5K0BA 5I3ZA 3DL7A 2PUTA 2RGYA 1TGVA 1UPUA 1TWGA 1L3CA 1UOEA 1M34E 3KT8A 4X7BA 1S96A 4QE3A 1CD5A 1ULZA 4QU0A 5D5HA 5K3SA 2VPZA 3GUCA 4OHXA 1WY5A 2CXXA 4EGJA 2ZYWX 1FRNA 5IMSA 2QG6A 2VVTA 3ILSA 3RUEA 2O5VA 3JPWA 1LWNA 3Q7SA 5JI3E 3P2KA 1FSGA 1EVKA 2VEOA 2I3GA 1WNTA 4PIVA 4ZAFA 3IPLA 1N5LA 2XX3A 2YYZA 2VZ0A 1YZNA 1TWHA 3GIDA 5J1SB 1Q1ZA 3NHUA 1JHUA 4FGZA 5ER6A 1ZBDA 3VI4B 3V6MA 3E8MA 4YAIA 2VDWB 4DCJA 3GOHA 4D4GA 1QP8A 1FX0B 1G2QA 1DBWA 3KM0A 4LGVA 2Q6LA 1B76A 2FMUA 3UICA 1RWWA 2ZXEA 4AL1A 1IONA 1H93A 3PPWA 4OQZA 2VASA 4YR9A 4TM7A 2Y0DA 3UB2A 4P53A 1ZQ9A 3GP8A 2HU8A 2G62A 2WIKA 3KCQA 3M5PA 4ZVRA 2IBSA 4DDUA 3G50A 3FOFC 3D59A 1S3GA 4TZKA 5HK8A 5JOQA 1ZL0A 5C32A 4AJOA 3RRJA 5B5SA 2I34A 4HVTA 5LMCA 2JKYA 2QTZA 3DJFA 5EJGA 1E9FA 1NJ5A 4PGFA 4US0R 1TD1A 1EI7A 1YRAA 5CCEA 3PNMA 3I9V6 4BJ5A 1T5IA 4D99A 2H1FA 4AZSA 1PVDA 2ZBFA 3DMTC 4D5EA 1NONA 1JSLA 2CMHA 2GWHA 3MPUA 4LC1A 3IAHA 4OGFA 1K1EA 4BP3A 1OX5A 4DPKA 1WP4A 1L4NA 4JENA 2O8VA 1B14A 5BT8A 3UGPA 3R6TA 1NQXA 4WSOA 3VO8A 3ABZA 1FQWA 2EJBA 1O97D 4HAUA 3ZGZA 1W2HA 3RS8A 4IL5A 1FNCA 1V11A 3HCOA 2W42A 3USZA 4RTSA 2Q8QA 3G2OA 3DNFA 3KQKA 1DEOA 3QSYA 1TLLA 3IDAA 1U9ZA 4QOJA 1SXJC 3OTWA 3WB1A 1ID8A 4I8XA 4RDCA 3CNBA 1BW9B 1YK0A 2JHFA 3LLMA 4AZ3A 2QP9X 3LL4A 4M89A 1C3OA 3GL9A 4U9EA 3UJ6A 3IQFA 4RMIA 2NZUG 1CQXA 1T3HA 3AXSA 3NHPA 3M6IA 4ONEA 4R2MA 3T3GA 1Y6FA 2C03A 1RKQA 2ORVA 3BB3A 3CLKA 4WY8A 2A2ZA 2I3ZA 3PFGA 4K03A 2W8BB 5EA2A 2REOA 5LMZA 3IILA 1ZINA 1UJMA 1DJMA 1ONBA 4UTOA 1KP2A 4P6IC 4YMLA 4G5RA 4BO1A 3HB7A 3L0DA 3C24A 5J40A 5K0SA 3MJDA 3TCXB 4CN8A 2G6BA 1GPJA 5L3QA 2AFRA 3K9QO 9ATCA 3TQIA 5TF0A 2VDVE 1Q0FA 2VSNA 4ZVOA 4E5DA 4OX9B 3VXKA 1ZN8A 4YRDA 1CJVC 2VRWA 4BJ3A 2FMKA 4CMEC 2BR4A 3ROGA 2H3HA 5K99A 3MLGA 4I1MA 1H2YA 3I8SA 3VDQA 4WT7A 5BVHA 3LKVA 2IHJA 5AD1A 1THZA 5M2QA 1QKRA 3EYWA 4JBWA 5EOVA 4Z7OB 4HZGA 5J4LA 4UEJA 1Q0TA 4XJVA 3L01A 2LCFA 3I5AA 2XJ9A 3IALA 3PNBA 4LE0A 1QB7A 3EJWA 4XLTA 1V45E 4Y2QA 4AG5A 4YPOA 1UODA 1MN6A 2E85A 2V3WA 1RZUA 1KXZA 5DGCA 1T1SA 1ORJA 5B2EA 3AM3A 3ZGNA 5BN3B 2Y99A 2APJA 3NBYC 3G0CA 1PJQA 3DVAA 4IDFA 4C05A 1XWWA 4JW1A 4NP6A 3CMCO 3PCXA 3PMRA 1OBHA 2BW0A 2SNIE 3DFZA 4FD2A 3FAZA 4YXWA 4R68A 4DJAA 4ZC8A 1C7QA 2VTBB 4G0OA 4DSOA 4LNUA 4DXDA 4WJLA 3ZTZA 3IQWA 4XA8A 1LUAA 4EF4A 2XCIA 4LERA 2C5HA 4JODA 4MRRA 4BNDA 1TZKA 4HWRA 3KFXA 1NBIA 3UV6A 3V5ZA 1Y63A 2OZVA 3RSZA 4RTQA 1T3SA 2RGNC 1A5BB 2O2EA 1KEUA 2V26A 2DFLA 1S89A 2AH5A 4ITVA 3TVYA 4EFLA 3NMKA 4CR7A 2GJ8A 5BURA 2W7TA 2NOAA 4UCQA 4LV6A 4FSDA 1G3IA 4FIDA 4KJZA 4DREA 3PHJA 4QFDA 2HKVA 1NJGA 1V74B 3SEOA 1EB9A 1TCUA 1COZA 1VBFA 2AC7A 2X76A 3D43A 3DWFA 1PJRA 3F9CA 3FNQA 5JASA 1TJ4A 4QOIA 3LX5A 4TM8A 4HGZA 5FORA 1HY5A 2BFNA 2XQJA 2R03A 5EK0A 4LYHA 5JAOA 1VIYA 2IYTA 4Q12A 4Q7KA 1Q0RA 1TYCA 4R2LA 2ID8A 2H9AA 1UK6A 4IQ8A 1IIBA 1U1IA 1ODLA 1SKQA 1M0TA 2E4AA 4IIHA 1JDUA 2L17A 4HUQB 2OYRA 3OLWA 4CIXA 1Z2CA 2G5GX 2JKVA 2Q3HA 4ZZ0A 3ZJTA 3R40A 3CZ5A 3DTVA 1JKJB 2OCCC 1N2EA 2JLVA 3V2UA 1E3IA 3ZUGA 5DCLA 1G291 3F9IA 4UVIA 4EX7A 5DWVA 3N0XA 3H97A 3B2EA 2A78A 3GDOA 3JD3A 2BKAA 3L8ZA 2QM0A 3Q8XB 4H35A 4X90A 5JE8A 5DFAA 4YUWA 4CV2A 1P75A 1Z6TA 2X8JB 3I92A 2EPOA 1NVAA 2WYOA 3ZWQA 5C53B 1T5TA 2Z4RA 1KVSA 2ZRHA 1W85A 1R8JA 1R6AA 3WIDA 1C02A 4J0GA 3JAKA 4QUGA 1PNQA 3BK1A 5F5FA 1CS0A 3ZDBA 2KQ9A 1Q0LA 2R7NA 2FDRA 3A1UA 5CBPA 3HUDA 3E1KA 3LPMA 1JHRA 5IRCD 5KOJA 1HPLA 4LJ7A 3EIXA 1IDOA 1EWYA 2IHBA 2OKGA 3E8XA 3MF4A 4U5CE 3AONB 4HZUA 3TM5A 1MIOB 4D9CA 4E4YA 1NVVQ 2PO5A 3CAXA 2ZQ5A 4PZCA 1XNJA 5AK0A 1C9YA 3HBFA 3IFSA 1Q2XA 3TZBA 4D4NA 1JXOA 4N9WA 4IJKA 3SLGA 5E9JA 4CEJB 1PTKA 2WG2A 1ESZA 1YBAA 4HF7A 1YKSA 1GL9B 1OH7A 1TU0A 3HK2A 3ZLVA 2PBEA 2XUIA 3PFFA 5TEVA 1ZZPA 1I3KA 4C7VA 2C29D 3F7MA 5A62A 4DUPA 2H5EA 4U7PB 2AC2A 3VZBA 5HKBA 2HN9A 2TMDA 1VM6A 4GMDA 4YROA 2B4AA 5CDGA 2NSJA 2PWPA 2R68A 2ILTA 1GN8A 1KRHA 3IKVA 4KRYA 4AQYB 1DLIA 4FX5A 2FPWA 1N1CA 4EYKA 4HV4A 3QWHA 3W9SA 4ZOCA 1N0UA 3IUQA 3MBIA 5EZ5A 1TD9A 4L3VA 1U0TA 2BE7A 3SYLA 4G4SP 3COJA 3EZ6A 2V74B 4R1MA 2SKDA 1ECPA 1NA5A 5L3QB 4Q3EA 5EKDA 1PU2A 1NW3A 2XNKA 1JALA 3N0TA 3DCNA 5CBPB 3AF6A 3EOBI 1V8OA 4U9IS 3LAYA 1MQSA 2JIOA 2PKXA 3FN4A 2AOWA 4M9CA 5KQPA 2KNHA 4YT5A 2P6UA 3GP3A 1O94A 3DULA 1MIOA 3P5SA 1KP9A 4AW9A 5H0IA 5A6VA 1T6YA 1U3DA 4KDRA 2TMVP 1NN5A 4ZO6A 3WLMA 2EDCA 5CM2Z 1QU2A 3A1EA 1HXHA 5FFNA 1EUYA 3HTXA 3SHFA 1UC4B 2FWNA 3C5WP 2BEKA 2GZMA 2FMFA 2DY0A 4BJ5C 1RQLA 1M3SA 3EVBA 4JLMA 1YQGA 4J3JA 5FBKA 2H1RA 3TW6A 5JRAA 5BR1A 3A04A 1VGRA 2B4QA 2AEFA 3QUSA 4HNUA 3GANA 5JT1A 2DHDA 4BLOA 2C54A 2QX9A 1VB3A 3UBTA 2HRQA 3LT2A 4PC3A 2DH5A 1RC0A 4MP8A 1SU8A 4PNEA 3VZCA 4GQHA 1UJ6A 3NIWA 1PFKA 4WUVA 3KSBC 4PAGA 2ZIGA 1BOOA 3RRXA 4ZJUA 1R4MA 4KBLA 2VJNA 3QIAA 1G4WR 3DAFA 1DOWA 2QQ5A 4KAAA 3TNFA 1D0VA 1DOHA 3GD7A 3OLYA 4WWHA 3V2IA 4C20A 3OQNA 4EJFA 4U3JB 2DH6A 2QQEA 4TOIA 4WBNB 1IOWA 2X6TA 3HYSA 3G0OA 4A82A 3WYFA 4OSEA 3BJRA 5LLDA 4BQNA 1A1VA 4NJEA 4G6ZA 5L0DA 1Q15A 4HTFB 4FYYA 3UFXA 3BERA 3N5KA 4WLEA 1ENZA 3VJLA 4BC1A 4GVLA 2F43B 1RJ9B 4GWKA 2Q0SA 3ZGLA 3ABRB 3H8VA 4FFRA 2HEIA 2I78A 5D86A 3O8NA 1KK3A 4JQOA 1A9PA 3K94A 3TTUA 5JS6A 1OV4A 4QKQA 1P45A 5EZQA 1NSGB 4XCXA 4S04A 1RCFA 3FG9A 1LV8A 1U0HC 4RNDB 3F8WA 4CSAA 1OLSA 2QUBA 3NYRA 3K7DA 2HQBA 1GCAA 4XASA 3ZE6A 3L05A 3ZBQA 2GBPA 3S2YA 5EMJA 2PNOA 1E9VA 1YGYA 1NW5A 5TQ0A 3RS9A 3OWTA 3OD5A 1MO2A 4W5JA 3ZEAA 3I2KA 5HZGA 4A73A 1DBIA 2WT8A 5DI3A 3KSZO 1G38A 3WGTA 1AG9A 1HDGO 1QF7A 1H65A 1YULA 4UAGA 1C9MA 5H3HA 2CMGA 1Z3IX 3IBCA 1JHOA 2QAGB 4LW8A 4AJJA 5B3KA 4IXWA 4RJLA 7MHTA 4C88A 3ZDYB 3AHCA 3VX4A 1KOJA 1YMQA 2FZVA 3CZRA 5CDFE 2E5FA 3DPSA 4XEFA 1MO5A 2BCEA 5KZMB 4FS8A 5EAIA 4X6YA 1QRDA 2JI9A 3P4XA 4JJ8A 4BTEA 3WGVA 2HY7A 2HAEA 3AESA 1BKYA 7YASA 5C4IA 5C8ZA 4HBGA 3MD9A 3KDSE 3H9GA 4OHOA 1YZCA 3GX1A 3PUJA 4R9UC 4RHEA 5C7IO 3BT7A 3JQRA 4FEAA 1L5GB 1KAHA 3H11B 1IUKA 4M1MA 1Z6AA 4IVRA 3WIBA 1YL5A 5E38A 5KREA 2ZXFA 1SIWA 5LIPA 2C9BA 1BZYA 3P9ZA 4FESA 1IPEA 1IBSA 2GXUA 5CURA 1GGQA 1SXJB 2MR6A 4U2EA 4ZQGA 5DJ5A 2KI5A 2C4HA 2R2AA 2R7KA 2B36A 4MWOA 3CLSC 5KOYA 3TXAA 3PE4A 1NPYA 2CW5A 5GY7A 2XL6A 4C07A 2GDZA 3OA0A 4X00A 2OSBA 3G7NA 3KZKA 2IOQA 4YUVA 4FFWA 1AA6A 1ETHA 1U4SA 2P11A 5FOQA 1SCDA 2XL4A 1UAGA 5AK6A 1C3OB 1UZLA 2A1TS 4I50F 5CLJA 2G83A 1V7PC 3IT0A 4PQRA 1DEHA 2WM2A 2WVQA 3H1GA 3DOFA 4PIMA 5FUBA 2FF5A 1ULHA 4HAZA 4MQUA 4LRQA 2VDKB 3K71B 4NE7A 3WG7C 1HYGA 2JCVA 2OZLA 1XZPA 3IDFA 4Z49A 8ADHA 4G37A 2Z8YM 2IPLA 1XTQA 4LBWA 2REQA 3TQCA 3PWKA 2YLGA 4RZSA 3WHLA 1IG0A 4DC1A 2VHTA 5FCLA 2JI6A 3LS2A 4NS4A 3MD0A 2Y1LA 1J8VA 2OG2A 2R4UA 1GNSA 4D0GA 2Z6AA 5EGNA 3SR4A 5EKSA 3KEGA 2G5PA 3RSOA 4PRLA 2PR2A 3QLUA 5TVGA 3B2NA 2IV2X 3NH9A 2ENUA 3PZBA 4ZAYA 1O6CA 4QXQA 1D1SA 2DERA 2EIXA 4OIQF 1KI1A 2YQ4A 3M6XA 2C0CA 2IA5A 4B32A 2ESRA 1RVV1 4YS6A 5H16A 3UV7A 3BIOA 3HV2A 3NYWA 1TW3A 1YD7A 3G82C 4NR0A 3T3NA 5G0SA 3A9CA 3LWZA 4IO1A 1GQFA 3K09C 3GM2A 1QTNA 1KEZA 4ZLDA 2J33A 1D9XA 4KMRA 3ZJUA 5IT4A 5A69A 3EWSA 4QG3A 1QAQA 2JIQA 3LUFA 4FGKA 2IELA 2NQ8A 1IVYA 4MW1A 1TU3A 3UY4A 4MUBA 2I8LA 2H2AA 2FWMX 3A1VA 3ZC4A 3HPRA 1W30A 4P83A 2ILVA 4Y6RA 1DARA 1G8YA 4QDJA 1EUQA 3DMDA 4ZEWA 5HA5A 3BGWA 1XJ0A 2WP0A 3RVDA 4K6CA 5LDGA 3JQQA 4UKDA 4FNOA 4R9SA 4RO0A 4US1R 4WX2B 1QBKC 4E70A 1FNMA 5K0TA 5LJIA 2PFSA 1MC5A 4NARA 5E1OA 2MINA 3EG5A 2PH5A 3OC0A 3M15A 5ECDA 2UYOA 4JQCA 5IC5A 5LZ8A 4OD4A 2IBTA 4D9KA 3L07A 4HP8A 2QRHA 4NZNA 3SF0A 4JGBA 4MHOA 1K98A 1XCLA 1VL0A 2B4TO 2HPHA 3DDNA 5ALOA 1UXGA 4RV9A 5D51S 2I80A 3IUMA 3FGZA 5JRZA 2UYHA 4BVLA 2NW6A 4GT1A 5AESA 5KYYB 3EY4A 4JH0A 3JX9A 2OORC 2GPTA 2R84A 3T38A 13PKA 4OLBA 2VRBA 3TPZA 3KYBA 4O29A 4BFLA 3D6HA 1X8LA 4ND7A 2BZ0A 2J09A 1CY7A 3IODA 4ML3A 1WMEA 1PS0A 3F49S 3L3BA 1VI2A 1WA5A 3BQMB 3KPUA 2AJ8A 3LECA 3LPNA 1NSFA 3I05A 4MVOA 3GCGA 3LX6A 1TCVA 1AE1A 1K5GA 3EOAI 2GBCA 3S29A 1DPFA 4ECAA 1Q7BA 1JNXX 4RH0A 4WNIA 3CVUA 2YC4C 3PFWO 1PZGA 3ZBUA 2BGMA 1U8XX 4V1CA 2V7XA 1L3IA 2Y0CA 4NJMB 5C31A 2P2ZA 2ORYA 4BKMA 1QAOA 4L9RA 1RWKA 2QRJA 4BMXA 5AXBA 3IMCA 2AEEA 3U17A 1Z8HA 1ZOSA 3BWCA 1YCDA 5FTKA 3V2HA 5AVXA 2DCUA 5JMOA 3I5PA 2FP3A 1OGYA 2LGJA 3EW7A 3N24A 1WB5A 4ZV7A 1U5BB 2WK1A 3HJUA 3PGMA 4LOLA 4OQFA 3EVCA 5AVZA 5KQRA 3UJNA 1AX9A 2GZAA 3OLQA 3TRIA 2P1AA 3AZQA 4NABA 3CT6A 3SQXA 5DN9A 3L6EA 1ZM7A 1EA7A 4HNSA 4RK1A 4KR9A 3T9FA 1FFDA 2J9ZB 3TD2A 5TJ5E 1Y4SA 2YOGA 2C42A 1VCHA 3VR3A 5CCXA 5EMHA 1APBA 1YJAA 1GRRA 1T3LA 2R7TA 4WIAA 1BGWA 5C7OO 3VSBA 3FTNA 4YWQA 1Z62A 1WEKA 2GBFA 1HTWA 4HEA1 2NP6A 3U5TA 1TGYA 3I5XA 2R1TA 2IBMA 3QBJA 3WYDA 3LNTA 1A8HA 4FILA 5CPBA 5BWNA 3DD5A 1D6JA 4DPLA 2DT5A 3IEUA 3O8QB 1ADJA 3U3BA 5DXJA 5E6UB 5BQ3A 4A1OA 1L5WA 4LJ5A 1TUBA 4W9RA 3GQBA 1CY6A 2ZTHA 5AM5A 4K6OA 3GRUA 4FLFA 4BNNA 1FP7A 4K9NA 4B9AA 4YCNA 2PPVA 3W6NA 3WGLA 3GLFB 1IQPA 1WXXA 4ZVUA 2O9JA 2MDTA 3NM5A 3WS7A 5LQMA 4OUKX 4RGVA 2YJGA 5ALVA 3VZQA 1GAEO 5C1BA 3IQEA 3X1YA 4ZI7B 1BXGA 1FUUA 1K4MA 1RR6A 3SHVA 1YA8A 3TB6A 3TIFA 5JH7A 4GC9A 1ZN9A 3F97A 1TLFA 1QC5A 1ZCAA 2E6UX 3GRFA 3QA9A 3PXCX 4RZXA 1EP9A 5EWJB 4URZR 7AT1A 3OF2A 1SBHA 3OQ1A 5JW6A 2DM6A 1WM1A 2JX0A 2HH9A 4M8LA 2H4XA 4ZGWA 2BEWB 2L0XA 4F93B 5DK4A 5JNVA 4CEHA 1D6SA 2Q7XA 9GPBA 2C20A 2INGX 3B7PA 3ZHZA 1GCGA 3U7QA 1X8XA 3SQMA 4CM5A 1AGNA 1N5JA 2F3PA 2A86A 1GPKA 1ZCBA 1M6WA 1V0JA 2C8VA 3DE5X 1IY2A 2VHUA 1WU7A 2PK3A 2X3FA 4HGNA 3KH2A 1VG9B 3EN0A 4ZU3A 4S05A 4BNYA 1S05A 5HFAA 3K8QA 5SYAA 1VBKA 2FZCA 5TGZA 4OI1A 3LUGA 3TE7A 3KKOA 3DEKA 1K3FA 2MYTA 1JAZA 2B2CA 1IY1A 3C7JA 1PZEA 2O50A 2R7XA 5CIWA 5JWHA 2X5KO 3KJIA 4BNTA 4XDGA 4EVSA 1BYUA 4XLZA 1DLJA 1Q1EA 2PFKA 2JL1A 3HP4A 2G71A 3VRCA 2HSQA 2DR3A 1VLHA 1GVNB 3IR7A 1ODSA 2JGFA 4UMEA 2JI7A 4BTVA 1T1IA 2YJ4A 1JG4A 1JLRA 2VZ8A 2GS9A 4JKOA 3LSYA 6Q21A 3EEOA 2PE5A 3OY7A 1W8DA 5GINE 2PLWA 1E7MA 1B8NA 3M6LA 2ZTSA 1ZJWA 2E49A 1Q19A 2GERA 5FWXB 4XDZA 3ACBA 3GEGA 3M5DA 4TQUS 2UZ1A 2IYLD 5ALJA 1V48A 2H48A 2W6JA 1KFEB 4PTZA 3RABA 4ZHSA 4CKBB 4LX0A 5BY2A 1YQWA 2VCYA 3T3MB 3BORA 1PVOA 3KKKA 1CUBA 3C8GA 2P9GA 1EBFA 1GR0A 4BO5A 1DO0A 1T10A 2QTLA 3TNLA 2P2NA 1LGYA 5F51A 5H3CA 2RCNA 2G63A 2JFOA 4IR7A 5D5PA 5FNVA 5TS2A 1J39A 3SXPA 5ETJA 2VBGA 4EJMA 1NI4B 2HLDA 2O0KA 1UKVY 3IA7A 2ZJ4A 2M6KA 2EIKC 1DT3A 2VYNA 2L6GA 1Z8DA 1C3EA 4HB0A 4XX1A 3G9QA 3VVMA 4EUFA 3DNPA 3L0PA 4HQ6A 1Z5VA 1LPNA 1WL8A 1R12A 2ZZKA 3O3CA 3P71T 1OW6A 1WUIS 2HBRA 4EJSC 1B3RA 2R79A 3VYWA 2QAGC 3RAPR 2VN8A 3GJ6A 5EI5A 4DRXA 1OFUA 1FFYA 2GLXA