3K1IC

Crystal strcture of flis-hp1076 complex in h. pylori
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
119
structure length
119
Chain Sequence
b'QQIAKFSRDMKNINESVGALQVLQIACKKLFNKSMGLEDKDALQASIIKQELREIVENCQFLASPLFDTQLNIAINDEIFSMIVVNPLDLLENVGEFQAYLEEKLNEIKELLGYLSESL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar protein
publication title Molecular interaction of flagellar export chaperone FliS and cochaperone HP1076 in Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Chaperone
total genus 40
structure length 119
sequence length 119
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16522 FliS_cochap Flagellar FLiS export co-chaperone, HP1076
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1890 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3k1iC00
3K1IC 3K1HA
chains in the Genus database with same CATH superfamily
3SXMA 3H65A 2OEXA 1FTSA 4DBQA 1ZVZA 3EFOB 4LDQA 2Q9AA 1HW1A 1UFBA 2WVOA 5D92A 4DJ9A 1MQVA 1OCOC 1S05A 2OU6A 3GEIA 3UR3C 4O6MA 1WOLA 2CCYA 2IBFA 3EZHA 3O55A 1YDIA 1OKKD 2A0BA 4FWVA 4P6IC 4A2NB 2DGJA 2H7OA 4C3BA 1V55C 1RMVA 1YYJA 3GM3A 256BA 3DJNB 3RVZA 1TWCA 4JW1A 4AX2A 1Z5ZA 4C7OA 1HE1A 4U5DE 3Q7LA 3W2WA 5T3WA 3S28A 2AVKA 1KNYA 5E3CA 2XM0A 1I4YA 3OA1A 2YHSA 1TR2A 3JRTA 2XRHA 3IQ5A 3JZ0A 1Y6DA 1WATA 1ZZPA 2J7PD 3GM1A 4IAQA 3B0VC 1Q0MA 1GGQA 1XZPA 2NUTA 2JD3A 2XL6A 1YA7O 4CDYA 3U2LA 1EA8A 1O3UA 1TFKB 3RQFA 4X0RA 4XPYA 1FMWA 4U5GA 3X1OA 2CGEA 2WVQA 2Y69C 3N0TA 4KNWA 1NSGB 1G4US 1YA9A 3BEHA 3N2ZB 3ZVRA 1U89A 2ZXOA 1BDJB 1AEPA 2IYLD 2TMVP 4DVYP 4OD5A 4CSAA 2QY9A 3EJNA 1AVOB 2HJMA 2IXOA 3GORA 1T6IA 3DXJF 2P6VA 2WZFA 3NG1A 4BEJA 4CS9A 3EG9A 4CS9C 5IY5C 3OEOA 3K6BA 2M64A 5L0JA 1TWGA 1TWHA 1T01A 2ZD9A 3ZTMA 1D1BA 4ER9A 3WG7C 2KQ9A 5BUOA 1D0YA 3POVA 3FAPB 5CI8A 1TQGA 3T4RA 4G7OF 3S9OA 1LS4A 3B0PA 1ZHTA 3RH3A 1K05A 2P7VA 2W4BA 1FFHA 4BJ5A 1F1MA 4JURI 4CSAC 1OCCC 1D1AA 4KC9A 4BJ5C 4XEFA 4AE4A 4N4WA 1RCPA 3HJCA 4RBNA 2LSEA 3NMJA 3UMIA 3X2QC 4N06A 4EBBA 2VH3A 4W8KA 5EK0A 3V5ZA 4CS8A 3U8VA 1QQ3A 2XL4A 4PJNA 2R7VA 2KW3C 3GEEA 1FFTC 2J8WA 3ZQYA 3TULA 2FFHA 3ASOC 4E7ZA 5A6AA 3R7CA 4JVSA 4OD4A 1C03A 4MVOA 3ZC4A 3FMSA 3C62A 2PFDA 1V74B 1Q0DA 1LIHA 4G7ZF 4LACB 4YT5A 1FNTc 3LEOA 3A9CA 3F47A 1OXBA 3QW0A 4K1OA 4QI0A 4DRIB 3I4UA 1O87A 1KU2A 4MW3A 3EQLF 3FHDA 3QTHA 3JTLO 2ZXWC 2F22A 3MYIA 3HNJA 2PX3A 3K33A 1HY5A 5COMA 3LAYA 5L0GA 2YKZA 3B29A 3JYYA 2KGOA 1T9KA 3DI5A 1JR8A 2CNWD 2HS5A 3CQZA 1D1CA 3IEEA 2PNOA 5KYUB 4D4XA 5L0CA 2XXAA 1Z7Qc 3EHMA 3GM2A 1GS9A 2O9XA 2PF4E 4DRJB 1EI7A 2ZXPA 4JTAB 3SNHA 5JRAA 1MMNA 4MVSA 2G3VA 1HE9A 1BBHA 1H7IA 5KYXA 1U6HA 3RFYA 3OWTA 4G7HF 4OIPF 2VB6A 4AK9A 4WGZA 3RQGA 1CGOA 4OINF 3EHNA 2CW0F 3RVYA 3IPMO 2L9JA 1LE2A 3SXYA 5TJ5E 1UG7A 1RKCA 1IZMA 4G0HA 2DB4A 2XLWA 4J30B 3KH2A 3CEXA 4GYTA 3K66A 5E2QA 1VMAA 4J32B 5AGFA 1C02A 1ZU4A 2H7VC 2HSQA 2R7OA 2GWWA 1R4TA 4GEHA 3U5SA 4QI2A 1Z23A 3T9OA 2G62A 3LUTB 3NYJA 1PV3A 3NMKA 4LDRA 5B3IA 5AC4A 5FCLA 1LI7A 4OIOF 2IXMA 1ZHWA 1Z3IX 1JRAA 4ULVA 1R5ID 3ECSA 3TJ5A 4U5HA 3KYIA 4P9FA 2VCCA 2QE9A 2WB7A 2NSFA 1XZQA 2BE5F 2Z15A 3G4XA 2NPUA 3ATPA 3NKDA 2PBEA 2VASA 4YT8A 5A6BA 3FDQA 4C7OB 2C03A 2UUHA 4NC3A 4BPMA 3AGUA 1RJ9A 3DAFA 4HFKB 1TFOB 2A1DD 2BL2A 4MTOA 1VTMP 1VLSA 2EPOA 3L0IA 4MNDA 4NTAA 4XLNF 3C8ZA 3TOLA 3ZIBA 1D0XA 1SR2A 3EPVA 4BEMJ 3M79A 1IW7F 1OW8A 3SP1A 2YL1A 2PX0A 4PJLA 2HZ8A 3B71A 1H6GA 3B9QA 2YLIA 4I3MA 1BR2A 4P9TA 3T6BA 3TOMA 4CDAA 4XEKA 4CJOA 4DXWA 1M56C 1OXKA 3DZAA 2J9WA 4JJFA 1G8XA 2L6HA 4MTFA 1VYIA 4WGYA 1FR0A 3W8IA 3DE9A 2HSBA 4C3DA 3LLIA 1U0BB 4YT4A 4ZLCA 4MVQA 1VB5A 2Q4FA 4A4AA 3SEOA 1BR4A 2W4MA 3CAXA 2L6FA 2XLMA 3ABMC 3C8GD 3LNMB 2V26A 1Q0KA 2Y3DA 2OEVA 3FXHA 3U3BA 2W45A 3C8GB 3DD7A 3Q7GA 2VCBA 3DKAA 3W2VA 2YEVA 4AL1A 5A6JA 3S90A 4RDAA 3U0CA 4JE9A 1NZEA 2WZGA 3RW0A 3T6GB 1I4ZA 1LM3B 2LCHA 4AE4B 4LDKA 1V4AA 3EGXB 2OG2A 1TKNA 1WASA 1ZHXA 3EFOA 2R7SA 2HUJA 2HJ3A 4XQ1A 2CYDA 3F46A 1ZW2A 2B0JA 5D91A 3QW1A 1E83A 3RKOF 4N6HA 2OKUA 3NKEA 3IQCA 2YQYA 2LD6A 2H7BA 4I44A 2J46A 1OCRC 3GODA 3S84A 1RKEA 4NTBA 3JYHA 3U9JA 3PDMP 4JCZA 4YJWA 4Z9JA 2OCCC 3AG1C 4U5EE 3WODF 1QKRA 3UGOA 2V3CC 5T3TA 3AG2C 3PCVA 1EQ1A 2B0HA 1ORJA 5BQIA 1QSPA 2YL3A 1A7DA 2IXPA 3C7JA 1YZAA 2XM4A 3DM5A 2XL8A 1CGME 4MVZA 5L0DA 3BRJA 3K1HA 3KYJA 3JSEO 1JOGA 2FGYA 1WWPA 4IAOA 2NSGA 5JT4A 3UMKA 4CJGA 2J9BA 4BJTA 1HMDA 2J7PA 3M1CB 2A68F 1MMAA 2A69F 4Q5SF 2VC9A 4WJ0A 4EUKB 1NLXA 1YYXA 1MNDA 1XWJA 4MS2A 2GAQA 2OQMA 2Y3HA 4IWBA 3S29A 4FAPB 5FZTA 4B6IA 2J0XA 4Z9IA 3QZCA 4JRZA 4UDVA 1N1CA 1HW2A 2JPUA 2A0UA 3HLZA 3JRMO 5L3VA 3UGPA 1OQCA 5L3QA 2AU5A 2R25A 1M57C 4I1OB 2HFIA 1ORSC 4C3EA 4W8PA 3SXZA 5F5FA 4CX9A 1NU9C 2KK1A 2UUIA 3V7OA 3VM6A 3ASNC 4JTCB 3RF3A 3NMIA 3O6XA 3AJMA 2ZPAA 3AQCA 1ZHYA 2H8AA 2IM8A 2J0WA 3ZDLA 1QZXA 5KYWA 3HKKA 4PK4A 1OCZC 2I8BA 1I5NA 2YL0A 3PHF2 2AP3A 4EHPA 3J06A 3JCUQ 4JC7A 3L34A 2XS1A 3V5YA 4R32A 1HMOA 4PFOA 2Y3GA 3TQOA 5HSWA 4O79A 3AG4C 2OOCA 1H9GA 1C17M 3H2VA 3AGTA 2NUPA 2Y3BA 1T6QA 2J9VA 4ANJA 3M4BA 4ULWA 1J8YF 5A6KA 1G4WR 2YLDA 3RQEA 1A41A 5A6BD 3O39A 3QMKA 5JVEA 1EKYA 3LS1A 2RD9A 1JAFA 3SXKA 2MWQA 3AOUA 4K7BA 2VCAA 3T6JA 2XSEA 1Z63A 2AWCA 3EH1A 1RJ9B 3GEHA 3V5XA 3US6A 2FAPB 1MMGA 1KTMA 1WGWA 2YZSA 4YK5A 4XLPF 5CIVA 3AG3C 1QPUA 3MX3A 2DI3A 3CZ6A 1Y4CA 1BZ4A 2YWAA 3MYFA 4YN0B 2PP4A 3EGDA 3Q6NA 1E85A 2MYSA 4KI2A 1YVIA 4DOZA 2DYRC 5E3AA 1Q0GA 3L8IA 1A7EA 4JCHA 4M63A 3RIPA 1K40A 2XLEA 4OIRF 1LI5A 2L6GA 3MBGA 4XTKA 5KYUA 2ASRA 2GDCA 4JJGA 4DRHB 1LS1A 3ITFA 4U5FE 4E18A 3CSKA 1T5OA 1O5HA 1GQAA 5KYYB 5JUAA 4IARA 1LE4A 1V54C 1DOVA 3GANA 4CS7A 1M2VA 4HE8D 1RXQA 4JEAA 3RYLA 1APCA 2NUTB 3K1IA 4Q7CA 2EIKC 1ST6A 3JSZA 2KSFA 3K1IC 4MVUA 2R7TA 3C18A 1YJGA 2R02A 3E9VA 4KNVA 2Y39A 5DLJA 4BJ6A 2EILC 2I15A 2AWYA 4RD9A 4BJ6C 3PMRA 4CS8C 1PCXA 2YLGA 2HV7A 2QLAA 4I1MA 2KYHA 3A11A 1NBBA 3TJ6A 3HNLA 5BQGA 3ZSUA 1NG1A 3HNKA 1YZCA 1S7ZA 2L81A 1DOWA 3EG9B 3B0UX 2XLHA 5EHHA 1PD0A 4CIPA 2QNLA 3WAQA 3S27A 1CPRA 2P1AA 2WVNA 3FVYA 4JIOA 4OIQF 5JS5A 5B3SC 4MVMA 1WTYA 3W4YA 4EKWA 1ORYA 5DQZA 5KYNA 1ZHZA 2R7QA 2G3KA 2EIJC 3ABKC 3FOPA 4KBLA 3Q6MA 1RKEB 3IQ6A 3UNGC 2KNHA 1G5ZA 1VLTA 2QUPA 4NCQA 1E2XA 4PR9A 4YL0A 1FAPB 4U9EA 5HV9A 5K0IA 3H2UA 1JPNA 3C63A 1VYKA 3E70C 1LPEA 2J45A 4MVRA 5COGA 2LK4A 3AQBA 1SMYF 3U2MA 4D4NA 4XWJA 4DVZA 2Q9BA 2EIMC 4AL0A 4ONSA 2EPKX 2A6EF 1QVXA 3ABLC 3I5PA 4JTDB 4NQFA 3NYMA 5EGYA 4YL1A 2OJQA 2XS8A 4EWCA 3WHNA 4N6CA 4NTFA 2GFHA 1D0ZA 2WZLA 2EINC 2HMZA 2R03A 1OKKA 3EZIA 1ZW3A 3NRHA 1MNEA 5JP7A 1T6UA 2WL8A 1OW7A 3GWNA 3IHUA 4PJMA 4EBKA 4K0DA 4LERA 5COFA 3LS0A 4L6RA 4JZAA 5CI9A 5DS6A 2YRFA 3MFNA 4DBRA 2LFDA 2ZXRA 3UMHA 5JLIA 2P61A 4XPXA 3EH2A 2XLVA 1NFNA 4NY3A 5JSLA 1OR3A 3S0XA 2W9YA 3VF0A 3VRCA 1H9TA 3U3FA 4EIYA 1B68A 2R7RA 4WABA 3LJBA 4IB4A 1E86A 1ZU5A 3C8GA 3HNIA 5KYWB 2JX0A 4U9DA 2LP4A 2XXAB 4EBJA 1L7CA 1TWAA 1FMVA 3FOOA 1CGNA 2KC3A 1M2OA 2EPNA 1L3PA 3ZG1A 1W2WA 3EGXA 2E87A 2LIGA 4G78A 1E84A 4E0IA 3QVZA 5KYXB 5KYYA 2HV6A 3DM9B 4HFFB 2D4UA 4U5CE 1A0BA 1SF8A 1ZYRF 2NUPB 1Z6AA 4IJJA 3VAYA 1YARO 2C04A 5AC5A 3N24A 2R05A 2OJED 1JMWA 4E17A 5B1AC 1LKXA 4U5BE 2J9UA 1CPQA 2Q00A 4LLCA 4MW8A 1QLEC 1AUEA 4LLEA 5L0HA 2IXNA 2DYSC 3TD7A 1GM5A 3VYWA 2Q3TA 5A69A 3R2PA 4CBEA 2YVKA 3FAJA 4XPWA 2LQGA 2EPMX 4O6NA 3ZWIA 5DQTA 4Q4ZF 3G50A 3NDBB 2YL7A 3L1MA 3KKBA 2LFFA 2BC5A 2ICWG 2Q7RA 5L0FA 3KMIA 4HEAJ 1SYQA 3GWLA 2XLOA 3EGDB 4H4KC 3U9MA 5B1BC 4FESA 4JKVA 2XLDA 3SYNA 3M4CA 2R7XA 2D5RB 5GPGB 5T1DB 1Q0FA 2HKVA 3QVYA 3DJUB 3W8HA 1NFOA 5F5HA 3DAGA 3KPHA 4BJ1A 4ZLDA 1OW6A 1A7VA 1OR2A 5DVWA 1BR1A 5F28E 2R9RB 1M2VB 4YT2A 1VK5A 4IGGA 4F4BA 2R7UA 2KJGA 2A6HF 5E33A 2GA0A 2Q9CA 3DE8A 4PJJA 2MHRA 1LVKA 1WN0A 3JT1A 3NYLA 2X51A 1MMDA 3ZQVA 1VOMA 4MQ9F 2CNWA 2QTVA 3L8JA 1SZIA 4PACA 3LNRA 2RSEB 4O7GA 4O6YA 3TK0A 5DS4A 3SZRA 2EPLX 3LLKA 3LEVA 4YL3A 5L0IA 5DS5A 4Z9HA 2IOQA 2HMQA 3IQTA 4CDVA 2M4EA 2ETSA 4QDLA 2NG1A 1YLMA 4MTGA 2R7WA 3MLGA 1PD1A 3G4ZA 3M15A 4J7TA 1M6TA 3I5QA 4YWQA 4CIHA 4IRUA 4JEBA 2X0CA 1K04A 4GQHA 1JPJA 4E0HA 2P0NA 3LESA 3HTKC 3O10A 1J8MF 1NU7D 2L7AA 3DWWA 3DMDA 3K7DA 4FX5A 4PFPA 4E7SA 4XEVA 3ZTZA 2CDQA 4BG0A 3KL4A 5BQHA 3U8PA 4J7YA 1YAUO 4H54A
chains in the Genus database with same CATH topology
3H65A 1FTSA 4DBQA 3EFOB 2Q9AA 2WVOA 5D92A 1OCOC 3UR3C 4O6MA 3EZHA 4FWVA 4P6IC 1OKKD 4A2NB 2DGJA 2H7OA 4C3BA 1V55C 3DJNB 4AX2A 1TWCA 4JW1A 4C7OA 1Z5ZA 4U5DE 3Q7LA 3W2WA 5T3WA 3S28A 5E3CA 4FX5A 3OA1A 2YHSA 1TR2A 3JRTA 2XRHA 3S29A 5KYYA 2R7XA 2J7PD 3B0VC 2NUTA 2JD3A 4X0RA 3X1OA 1FMWA 4U5GA 2CGEA 2WVQA 2Y69C 3N0TA 4KNWA 3N2ZB 3ZVRA 2ZXOA 2IYLD 4DVYP 4OD5A 4CSAA 2QY9A 3EJNA 2IXOA 3NG1A 4CS9A 5IY5C 4CSAC 3DXJF 2P6VA 2WZFA 4BEJA 4CS9C 3EG9A 3OEOA 3K6BA 1TWGA 1TWHA 1D1BA 3WG7C 2KQ9A 5BUOA 1D0YA 3POVA 5CI8A 3T4RA 4G7OF 3B0PA 1ZHTA 3RH3A 2P7VA 2W4BA 1FFHA 4BJ5A 4JURI 1OCCC 1D1AA 4KC9A 4BJ5C 4AE4A 3HJCA 4RBNA 2LSEA 3UMIA 3X2QC 4N06A 4EBBA 2VH3A 4W8KA 2XL4A 4PJNA 2R7VA 2KW3C 1FFTC 2FFHA 3ASOC 4E7ZA 4JVSA 4OD4A 3ZC4A 2PFDA 4G7ZF 4LACB 4YT5A 3F47A 4QI0A 3I4UA 1O87A 1KU2A 3EQLF 3FHDA 2ZXWC 2PX3A 3K33A 3LAYA 2KGOA 2CNWD 3CQZA 1D1CA 3IEEA 5KYUB 2XXAA 3EHMA 2O9XA 2PF4E 2ZXPA 3SNHA 1MMNA 2G3VA 5KYXA 3RFYA 4G7HF 3OWTA 4OIPF 2VB6A 4AK9A 4OINF 3EHNA 2CW0F 2L9JA 4G0HA 1IZMA 4J30B 3KH2A 4GYTA 3K66A 5E2QA 1VMAA 4J32B 1ZU4A 2H7VC 2R7OA 4GEHA 4QI2A 1Z23A 2G62A 3NYJA 5FCLA 4OIOF 2IXMA 1ZHWA 1Z3IX 3ECSA 4U5HA 2WB7A 2BE5F 2Z15A 3NKDA 3FDQA 2VASA 4YT8A 4C7OB 2C03A 1RJ9A 3DAFA 4HFKB 2A1DD 3L0IA 4MNDA 4XLNF 3ZIBA 1D0XA 3EPVA 1IW7F 3SP1A 2PX0A 4PJLA 4CS8A 3B9QA 4I3MA 1BR2A 3T6BA 1M56C 3DZAA 2J9WA 4JJFA 1G8XA 1VYIA 3W8IA 4C3DA 3LLIA 4YT4A 4ZLCA 3SEOA 1BR4A 2W4MA 3ABMC 2V26A 2Y3DA 2W45A 3DD7A 3Q7GA 3W2VA 2YEVA 4RDAA 1NZEA 2WZGA 4AE4B 3EGXB 2OG2A 1TKNA 1ZHXA 3EFOA 2R7SA 3F46A 2B0JA 5D91A 3RKOF 3NKEA 2H7BA 4I44A 2J46A 1OCRC 3GODA 3JYHA 4YJWA 2OCCC 3AG1C 4U5EE 3WODF 3UGOA 2V3CC 5T3TA 3AG2C 3DM5A 2IXPA 3K1HA 2FGYA 4IAOA 3UMKA 4BJTA 2J7PA 3M1CB 2A68F 1MMAA 2A69F 4Q5SF 4WJ0A 1MNDA 2Y3HA 4IWBA 4B6IA 2J0XA 3QZCA 1N1CA 3HLZA 5L3VA 3UGPA 5L3QA 1M57C 4I1OB 5F5FA 4C3EA 1NU9C 3V7OA 3ASNC 3O6XA 2ZPAA 3AQCA 1ZHYA 2J0WA 1QZXA 5KYWA 4PK4A 1OCZC 2I8BA 3PHF2 3JCUQ 3L34A 4PFOA 2Y3GA 5HSWA 4O79A 3AG4C 2NUPA 2Y3BA 2J9VA 4ANJA 4ULWA 1J8YF 3O39A 3QMKA 3LS1A 2MWQA 4K7BA 3T6JA 2XSEA 1Z63A 3EH1A 1RJ9B 1MMGA 1WGWA 2YZSA 4XLPF 3AG3C 3MX3A 3CZ6A 4YN0B 2PP4A 3EGDA 3Q6NA 2MYSA 4KI2A 4DOZA 2DYRC 5E3AA 4JCHA 4M63A 3RIPA 4OIRF 5KYUA 4XTKA 4JJGA 1LS1A 3ITFA 4U5FE 3CSKA 1O5HA 5KYYB 1V54C 3GANA 4CS7A 1M2VA 4HE8D 3RYLA 2NUTB 4Q7CA 2EIKC 1ST6A 3JSZA 3K1IC 2R7TA 3E9VA 4KNVA 2Y39A 5DLJA 4BJ6A 2EILC 4RD9A 4BJ6C 3PMRA 4CS8C 1PCXA 2HV7A 4I1MA 3ZSUA 1NG1A 3B0UX 1S7ZA 2L81A 3EG9B 5EHHA 1PD0A 3S27A 2WVNA 3FVYA 4OIQF 5B3SC 5KYNA 5DQZA 1ZHZA 2R7QA 2G3KA 2EIJC 3ABKC 4KBLA 3UNGC 3Q6MA 2KNHA 1JPNA 1VYKA 3E70C 2J45A 3AQBA 1SMYF 4XWJA 4DVZA 2Q9BA 2EIMC 2A6EF 3ABLC 3I5PA 3NYMA 5EGYA 4EWCA 2GFHA 1D0ZA 2WZLA 2EINC 1OKKA 3EZIA 3NRHA 1MNEA 2WL8A 4PJMA 4K0DA 4LERA 3LS0A 4JZAA 5CI9A 5DS6A 4DBRA 2ZXRA 3UMHA 3EH2A 4NY3A 3S0XA 2W9YA 2R7RA 3LJBA 1ZU5A 5KYWB 2XXAB 1TWAA 1FMVA 1M2OA 3ZG1A 1W2WA 3EGXA 2E87A 5KYXB 2HV6A 3DM9B 4HFFB 4U5CE 1SF8A 1ZYRF 2NUPB 1Z6AA 4IJJA 3VAYA 2C04A 3N24A 5B1AC 1LKXA 4U5BE 2J9UA 4LLCA 1QLEC 4LLEA 2IXNA 2DYSC 3TD7A 3VYWA 2Q3TA 4CBEA 3FAJA 4O6NA 5DQTA 4Q4ZF 3NDBB 3KKBA 3KMIA 4HEAJ 4H4KC 3EGDB 5B1BC 4FESA 3SYNA 2D5RB 5T1DB 3DJUB 3W8HA 5F5HA 3DAGA 4BJ1A 4ZLDA 5DVWA 1BR1A 1M2VB 4YT2A 1VK5A 4F4BA 2R7UA 2KJGA 2A6HF 5E33A 2Q9CA 4PJJA 1LVKA 3JT1A 3NYLA 2X51A 1MMDA 1VOMA 4MQ9F 2CNWA 2QTVA 1SZIA 3LNRA 4O7GA 4O6YA 5DS4A 3SZRA 3LLKA 3LEVA 5DS5A 2IOQA 2M4EA 4QDLA 2NG1A 2R7WA 3MLGA 1PD1A 3I5QA 4YWQA 4CIHA 4IRUA 1JPJA 3LESA 3HTKC 4PFPA 1J8MF 1NU7D 3DMDA 3K7DA 4E7SA 2CDQA 4BG0A 3KL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1I C;  3K1H A; 
#chains in the Genus database with same CATH topology
 3SXM A;  3H65 A;  2OEX A;  1FTS A;  4DBQ A;  1ZVZ A;  3EFO B;  4LDQ A;  2Q9A A;  1HW1 A;  1UFB A;  2WVO A;  5D92 A;  4DJ9 A;  1MQV A;  1OCO C;  1S05 A;  2OU6 A;  3GEI A;  3UR3 C;  4O6M A;  1WOL A;  2CCY A;  2IBF A;  3EZH A;  3O55 A;  1YDI A;  1OKK D;  2A0B A;  4FWV A;  4P6I C;  4A2N B;  2DGJ A;  2H7O A;  4C3B A;  1V55 C;  1RMV A;  1YYJ A;  3GM3 A;  256B A;  3DJN B;  3RVZ A;  1TWC A;  4JW1 A;  4AX2 A;  1Z5Z A;  4C7O A;  1HE1 A;  4U5D E;  3Q7L A;  3W2W A;  5T3W A;  3S28 A;  2AVK A;  1KNY A;  5E3C A;  2XM0 A;  1I4Y A;  3OA1 A;  2YHS A;  1TR2 A;  3JRT A;  2XRH A;  3IQ5 A;  3JZ0 A;  1Y6D A;  1WAT A;  1ZZP A;  2J7P D;  3GM1 A;  4IAQ A;  3B0V C;  1Q0M A;  1GGQ A;  1XZP A;  2NUT A;  2JD3 A;  2XL6 A;  1YA7 O;  4CDY A;  3U2L A;  1EA8 A;  1O3U A;  1TFK B;  3RQF A;  4X0R A;  4XPY A;  1FMW A;  4U5G A;  3X1O A;  2CGE A;  2WVQ A;  2Y69 C;  3N0T A;  4KNW A;  1NSG B;  1G4U S;  1YA9 A;  3BEH A;  3N2Z B;  3ZVR A;  1U89 A;  2ZXO A;  1BDJ B;  1AEP A;  2IYL D;  2TMV P;  4DVY P;  4OD5 A;  4CSA A;  2QY9 A;  3EJN A;  1AVO B;  2HJM A;  2IXO A;  3GOR A;  1T6I A;  3DXJ F;  2P6V A;  2WZF A;  3NG1 A;  4BEJ A;  4CS9 A;  3EG9 A;  4CS9 C;  5IY5 C;  3OEO A;  3K6B A;  2M64 A;  5L0J A;  1TWG A;  1TWH A;  1T01 A;  2ZD9 A;  3ZTM A;  1D1B A;  4ER9 A;  3WG7 C;  2KQ9 A;  5BUO A;  1D0Y A;  3POV A;  3FAP B;  5CI8 A;  1TQG A;  3T4R A;  4G7O F;  3S9O A;  1LS4 A;  3B0P A;  1ZHT A;  3RH3 A;  1K05 A;  2P7V A;  2W4B A;  1FFH A;  4BJ5 A;  1F1M A;  4JUR I;  4CSA C;  1OCC C;  1D1A A;  4KC9 A;  4BJ5 C;  4XEF A;  4AE4 A;  4N4W A;  1RCP A;  3HJC A;  4RBN A;  2LSE A;  3NMJ A;  3UMI A;  3X2Q C;  4N06 A;  4EBB A;  2VH3 A;  4W8K A;  5EK0 A;  3V5Z A;  4CS8 A;  3U8V A;  1QQ3 A;  2XL4 A;  4PJN A;  2R7V A;  2KW3 C;  3GEE A;  1FFT C;  2J8W A;  3ZQY A;  3TUL A;  2FFH A;  3ASO C;  4E7Z A;  5A6A A;  3R7C A;  4JVS A;  4OD4 A;  1C03 A;  4MVO A;  3ZC4 A;  3FMS A;  3C62 A;  2PFD A;  1V74 B;  1Q0D A;  1LIH A;  4G7Z F;  4LAC B;  4YT5 A;  1FNT c;  3LEO A;  3A9C A;  3F47 A;  1OXB A;  3QW0 A;  4K1O A;  4QI0 A;  4DRI B;  3I4U A;  1O87 A;  1KU2 A;  4MW3 A;  3EQL F;  3FHD A;  3QTH A;  3JTL O;  2ZXW C;  2F22 A;  3MYI A;  3HNJ A;  2PX3 A;  3K33 A;  1HY5 A;  5COM A;  3LAY A;  5L0G A;  2YKZ A;  3B29 A;  3JYY A;  2KGO A;  1T9K A;  3DI5 A;  1JR8 A;  2CNW D;  2HS5 A;  3CQZ A;  1D1C A;  3IEE A;  2PNO A;  5KYU B;  4D4X A;  5L0C A;  2XXA A;  1Z7Q c;  3EHM A;  3GM2 A;  1GS9 A;  2O9X A;  2PF4 E;  4DRJ B;  1EI7 A;  2ZXP A;  4JTA B;  3SNH A;  5JRA A;  1MMN A;  4MVS A;  2G3V A;  1HE9 A;  1BBH A;  1H7I A;  5KYX A;  1U6H A;  3RFY A;  3OWT A;  4G7H F;  4OIP F;  2VB6 A;  4AK9 A;  4WGZ A;  3RQG A;  1CGO A;  4OIN F;  3EHN A;  2CW0 F;  3RVY A;  3IPM O;  2L9J A;  1LE2 A;  3SXY A;  5TJ5 E;  1UG7 A;  1RKC A;  1IZM A;  4G0H A;  2DB4 A;  2XLW A;  4J30 B;  3KH2 A;  3CEX A;  4GYT A;  3K66 A;  5E2Q A;  1VMA A;  4J32 B;  5AGF A;  1C02 A;  1ZU4 A;  2H7V C;  2HSQ A;  2R7O A;  2GWW A;  1R4T A;  4GEH A;  3U5S A;  4QI2 A;  1Z23 A;  3T9O A;  2G62 A;  3LUT B;  3NYJ A;  1PV3 A;  3NMK A;  4LDR A;  5B3I A;  5AC4 A;  5FCL A;  1LI7 A;  4OIO F;  2IXM A;  1ZHW A;  1Z3I X;  1JRA A;  4ULV A;  1R5I D;  3ECS A;  3TJ5 A;  4U5H A;  3KYI A;  4P9F A;  2VCC A;  2QE9 A;  2WB7 A;  2NSF A;  1XZQ A;  2BE5 F;  2Z15 A;  3G4X A;  2NPU A;  3ATP A;  3NKD A;  2PBE A;  2VAS A;  4YT8 A;  5A6B A;  3FDQ A;  4C7O B;  2C03 A;  2UUH A;  4NC3 A;  4BPM A;  3AGU A;  1RJ9 A;  3DAF A;  4HFK B;  1TFO B;  2A1D D;  2BL2 A;  4MTO A;  1VTM P;  1VLS A;  2EPO A;  3L0I A;  4MND A;  4NTA A;  4XLN F;  3C8Z A;  3TOL A;  3ZIB A;  1D0X A;  1SR2 A;  3EPV A;  4BEM J;  3M79 A;  1IW7 F;  1OW8 A;  3SP1 A;  2YL1 A;  2PX0 A;  4PJL A;  2HZ8 A;  3B71 A;  1H6G A;  3B9Q A;  2YLI A;  4I3M A;  1BR2 A;  4P9T A;  3T6B A;  3TOM A;  4CDA A;  4XEK A;  4CJO A;  4DXW A;  1M56 C;  1OXK A;  3DZA A;  2J9W A;  4JJF A;  1G8X A;  2L6H A;  4MTF A;  1VYI A;  4WGY A;  1FR0 A;  3W8I A;  3DE9 A;  2HSB A;  4C3D A;  3LLI A;  1U0B B;  4YT4 A;  4ZLC A;  4MVQ A;  1VB5 A;  2Q4F A;  4A4A A;  3SEO A;  1BR4 A;  2W4M A;  3CAX A;  2L6F A;  2XLM A;  3ABM C;  3C8G D;  3LNM B;  2V26 A;  1Q0K A;  2Y3D A;  2OEV A;  3FXH A;  3U3B A;  2W45 A;  3C8G B;  3DD7 A;  3Q7G A;  2VCB A;  3DKA A;  3W2V A;  2YEV A;  4AL1 A;  5A6J A;  3S90 A;  4RDA A;  3U0C A;  4JE9 A;  1NZE A;  2WZG A;  3RW0 A;  3T6G B;  1I4Z A;  1LM3 B;  2LCH A;  4AE4 B;  4LDK A;  1V4A A;  3EGX B;  2OG2 A;  1TKN A;  1WAS A;  1ZHX A;  3EFO A;  2R7S A;  2HUJ A;  2HJ3 A;  4XQ1 A;  2CYD A;  3F46 A;  1ZW2 A;  2B0J A;  5D91 A;  3QW1 A;  1E83 A;  3RKO F;  4N6H A;  2OKU A;  3NKE A;  3IQC A;  2YQY A;  2LD6 A;  2H7B A;  4I44 A;  2J46 A;  1OCR C;  3GOD A;  3S84 A;  1RKE A;  4NTB A;  3JYH A;  3U9J A;  3PDM P;  4JCZ A;  4YJW A;  4Z9J A;  2OCC C;  3AG1 C;  4U5E E;  3WOD F;  1QKR A;  3UGO A;  2V3C C;  5T3T A;  3AG2 C;  3PCV A;  1EQ1 A;  2B0H A;  1ORJ A;  5BQI A;  1QSP A;  2YL3 A;  1A7D A;  2IXP A;  3C7J A;  1YZA A;  2XM4 A;  3DM5 A;  2XL8 A;  1CGM E;  4MVZ A;  5L0D A;  3BRJ A;  3K1H A;  3KYJ A;  3JSE O;  1JOG A;  2FGY A;  1WWP A;  4IAO A;  2NSG A;  5JT4 A;  3UMK A;  4CJG A;  2J9B A;  4BJT A;  1HMD A;  2J7P A;  3M1C B;  2A68 F;  1MMA A;  2A69 F;  4Q5S F;  2VC9 A;  4WJ0 A;  4EUK B;  1NLX A;  1YYX A;  1MND A;  1XWJ A;  4MS2 A;  2GAQ A;  2OQM A;  2Y3H A;  4IWB A;  3S29 A;  4FAP B;  5FZT A;  4B6I A;  2J0X A;  4Z9I A;  3QZC A;  4JRZ A;  4UDV A;  1N1C A;  1HW2 A;  2JPU A;  2A0U A;  3HLZ A;  3JRM O;  5L3V A;  3UGP A;  1OQC A;  5L3Q A;  2AU5 A;  2R25 A;  1M57 C;  4I1O B;  2HFI A;  1ORS C;  4C3E A;  4W8P A;  3SXZ A;  5F5F A;  4CX9 A;  1NU9 C;  2KK1 A;  2UUI A;  3V7O A;  3VM6 A;  3ASN C;  4JTC B;  3RF3 A;  3NMI A;  3O6X A;  3AJM A;  2ZPA A;  3AQC A;  1ZHY A;  2H8A A;  2IM8 A;  2J0W A;  3ZDL A;  1QZX A;  5KYW A;  3HKK A;  4PK4 A;  1OCZ C;  2I8B A;  1I5N A;  2YL0 A;  3PHF 2;  2AP3 A;  4EHP A;  3J06 A;  3JCU Q;  4JC7 A;  3L34 A;  2XS1 A;  3V5Y A;  4R32 A;  1HMO A;  4PFO A;  2Y3G A;  3TQO A;  5HSW A;  4O79 A;  3AG4 C;  2OOC A;  1H9G A;  1C17 M;  3H2V A;  3AGT A;  2NUP A;  2Y3B A;  1T6Q A;  2J9V A;  4ANJ A;  3M4B A;  4ULW A;  1J8Y F;  5A6K A;  1G4W R;  2YLD A;  3RQE A;  1A41 A;  5A6B D;  3O39 A;  3QMK A;  5JVE A;  1EKY A;  3LS1 A;  2RD9 A;  1JAF A;  3SXK A;  2MWQ A;  3AOU A;  4K7B A;  2VCA A;  3T6J A;  2XSE A;  1Z63 A;  2AWC A;  3EH1 A;  1RJ9 B;  3GEH A;  3V5X A;  3US6 A;  2FAP B;  1MMG A;  1KTM A;  1WGW A;  2YZS A;  4YK5 A;  4XLP F;  5CIV A;  3AG3 C;  1QPU A;  3MX3 A;  2DI3 A;  3CZ6 A;  1Y4C A;  1BZ4 A;  2YWA A;  3MYF A;  4YN0 B;  2PP4 A;  3EGD A;  3Q6N A;  1E85 A;  2MYS A;  4KI2 A;  1YVI A;  4DOZ A;  2DYR C;  5E3A A;  1Q0G A;  3L8I A;  1A7E A;  4JCH A;  4M63 A;  3RIP A;  1K40 A;  2XLE A;  4OIR F;  1LI5 A;  2L6G A;  3MBG A;  4XTK A;  5KYU A;  2ASR A;  2GDC A;  4JJG A;  4DRH B;  1LS1 A;  3ITF A;  4U5F E;  4E18 A;  3CSK A;  1T5O A;  1O5H A;  1GQA A;  5KYY B;  5JUA A;  4IAR A;  1LE4 A;  1V54 C;  1DOV A;  3GAN A;  4CS7 A;  1M2V A;  4HE8 D;  1RXQ A;  4JEA A;  3RYL A;  1APC A;  2NUT B;  3K1I A;  4Q7C A;  2EIK C;  1ST6 A;  3JSZ A;  2KSF A;  3K1I C;  4MVU A;  2R7T A;  3C18 A;  1YJG A;  2R02 A;  3E9V A;  4KNV A;  2Y39 A;  5DLJ A;  4BJ6 A;  2EIL C;  2I15 A;  2AWY A;  4RD9 A;  4BJ6 C;  3PMR A;  4CS8 C;  1PCX A;  2YLG A;  2HV7 A;  2QLA A;  4I1M A;  2KYH A;  3A11 A;  1NBB A;  3TJ6 A;  3HNL A;  5BQG A;  3ZSU A;  1NG1 A;  3HNK A;  1YZC A;  1S7Z A;  2L81 A;  1DOW A;  3EG9 B;  3B0U X;  2XLH A;  5EHH A;  1PD0 A;  4CIP A;  2QNL A;  3WAQ A;  3S27 A;  1CPR A;  2P1A A;  2WVN A;  3FVY A;  4JIO A;  4OIQ F;  5JS5 A;  5B3S C;  4MVM A;  1WTY A;  3W4Y A;  4EKW A;  1ORY A;  5DQZ A;  5KYN A;  1ZHZ A;  2R7Q A;  2G3K A;  2EIJ C;  3ABK C;  3FOP A;  4KBL A;  3Q6M A;  1RKE B;  3IQ6 A;  3UNG C;  2KNH A;  1G5Z A;  1VLT A;  2QUP A;  4NCQ A;  1E2X A;  4PR9 A;  4YL0 A;  1FAP B;  4U9E A;  5HV9 A;  5K0I A;  3H2U A;  1JPN A;  3C63 A;  1VYK A;  3E70 C;  1LPE A;  2J45 A;  4MVR A;  5COG A;  2LK4 A;  3AQB A;  1SMY F;  3U2M A;  4D4N A;  4XWJ A;  4DVZ A;  2Q9B A;  2EIM C;  4AL0 A;  4ONS A;  2EPK X;  2A6E F;  1QVX A;  3ABL C;  3I5P A;  4JTD B;  4NQF A;  3NYM A;  5EGY A;  4YL1 A;  2OJQ A;  2XS8 A;  4EWC A;  3WHN A;  4N6C A;  4NTF A;  2GFH A;  1D0Z A;  2WZL A;  2EIN C;  2HMZ A;  2R03 A;  1OKK A;  3EZI A;  1ZW3 A;  3NRH A;  1MNE A;  5JP7 A;  1T6U A;  2WL8 A;  1OW7 A;  3GWN A;  3IHU A;  4PJM A;  4EBK A;  4K0D A;  4LER A;  5COF A;  3LS0 A;  4L6R A;  4JZA A;  5CI9 A;  5DS6 A;  2YRF A;  3MFN A;  4DBR A;  2LFD A;  2ZXR A;  3UMH A;  5JLI A;  2P61 A;  4XPX A;  3EH2 A;  2XLV A;  1NFN A;  4NY3 A;  5JSL A;  1OR3 A;  3S0X A;  2W9Y A;  3VF0 A;  3VRC A;  1H9T A;  3U3F A;  4EIY A;  1B68 A;  2R7R A;  4WAB A;  3LJB A;  4IB4 A;  1E86 A;  1ZU5 A;  3C8G A;  3HNI A;  5KYW B;  2JX0 A;  4U9D A;  2LP4 A;  2XXA B;  4EBJ A;  1L7C A;  1TWA A;  1FMV A;  3FOO A;  1CGN A;  2KC3 A;  1M2O A;  2EPN A;  1L3P A;  3ZG1 A;  1W2W A;  3EGX A;  2E87 A;  2LIG A;  4G78 A;  1E84 A;  4E0I A;  3QVZ A;  5KYX B;  5KYY A;  2HV6 A;  3DM9 B;  4HFF B;  2D4U A;  4U5C E;  1A0B A;  1SF8 A;  1ZYR F;  2NUP B;  1Z6A A;  4IJJ A;  3VAY A;  1YAR O;  2C04 A;  5AC5 A;  3N24 A;  2R05 A;  2OJE D;  1JMW A;  4E17 A;  5B1A C;  1LKX A;  4U5B E;  2J9U A;  1CPQ A;  2Q00 A;  4LLC A;  4MW8 A;  1QLE C;  1AUE A;  4LLE A;  5L0H A;  2IXN A;  2DYS C;  3TD7 A;  1GM5 A;  3VYW A;  2Q3T A;  5A69 A;  3R2P A;  4CBE A;  2YVK A;  3FAJ A;  4XPW A;  2LQG A;  2EPM X;  4O6N A;  3ZWI A;  5DQT A;  4Q4Z F;  3G50 A;  3NDB B;  2YL7 A;  3L1M A;  3KKB A;  2LFF A;  2BC5 A;  2ICW G;  2Q7R A;  5L0F A;  3KMI A;  4HEA J;  1SYQ A;  3GWL A;  2XLO A;  3EGD B;  4H4K C;  3U9M A;  5B1B C;  4FES A;  4JKV A;  2XLD A;  3SYN A;  3M4C A;  2R7X A;  2D5R B;  5GPG B;  5T1D B;  1Q0F A;  2HKV A;  3QVY A;  3DJU B;  3W8H A;  1NFO A;  5F5H A;  3DAG A;  3KPH A;  4BJ1 A;  4ZLD A;  1OW6 A;  1A7V A;  1OR2 A;  5DVW A;  1BR1 A;  5F28 E;  2R9R B;  1M2V B;  4YT2 A;  1VK5 A;  4IGG A;  4F4B A;  2R7U A;  2KJG A;  2A6H F;  5E33 A;  2GA0 A;  2Q9C A;  3DE8 A;  4PJJ A;  2MHR A;  1LVK A;  1WN0 A;  3JT1 A;  3NYL A;  2X51 A;  1MMD A;  3ZQV A;  1VOM A;  4MQ9 F;  2CNW A;  2QTV A;  3L8J A;  1SZI A;  4PAC A;  3LNR A;  2RSE B;  4O7G A;  4O6Y A;  3TK0 A;  5DS4 A;  3SZR A;  2EPL X;  3LLK A;  3LEV A;  4YL3 A;  5L0I A;  5DS5 A;  4Z9H A;  2IOQ A;  2HMQ A;  3IQT A;  4CDV A;  2M4E A;  2ETS A;  4QDL A;  2NG1 A;  1YLM A;  4MTG A;  2R7W A;  3MLG A;  1PD1 A;  3G4Z A;  3M15 A;  4J7T A;  1M6T A;  3I5Q A;  4YWQ A;  4CIH A;  4IRU A;  4JEB A;  2X0C A;  1K04 A;  4GQH A;  1JPJ A;  4E0H A;  2P0N A;  3LES A;  3HTK C;  3O10 A;  1J8M F;  1NU7 D;  2L7A A;  3DWW A;  3DMD A;  3K7D A;  4FX5 A;  4PFP A;  4E7S A;  4XEV A;  3ZTZ A;  2CDQ A;  4BG0 A;  3KL4 A;  5BQH A;  3U8P A;  4J7Y A;  1YAU O;  4H54 A; 
#chains in the Genus database with same CATH homology
 3H65 A;  1FTS A;  4DBQ A;  3EFO B;  2Q9A A;  2WVO A;  5D92 A;  1OCO C;  3UR3 C;  4O6M A;  3EZH A;  4FWV A;  4P6I C;  1OKK D;  4A2N B;  2DGJ A;  2H7O A;  4C3B A;  1V55 C;  3DJN B;  4AX2 A;  1TWC A;  4JW1 A;  4C7O A;  1Z5Z A;  4U5D E;  3Q7L A;  3W2W A;  5T3W A;  3S28 A;  5E3C A;  4FX5 A;  3OA1 A;  2YHS A;  1TR2 A;  3JRT A;  2XRH A;  3S29 A;  5KYY A;  2R7X A;  2J7P D;  3B0V C;  2NUT A;  2JD3 A;  4X0R A;  3X1O A;  1FMW A;  4U5G A;  2CGE A;  2WVQ A;  2Y69 C;  3N0T A;  4KNW A;  3N2Z B;  3ZVR A;  2ZXO A;  2IYL D;  4DVY P;  4OD5 A;  4CSA A;  2QY9 A;  3EJN A;  2IXO A;  3NG1 A;  4CS9 A;  5IY5 C;  4CSA C;  3DXJ F;  2P6V A;  2WZF A;  4BEJ A;  4CS9 C;  3EG9 A;  3OEO A;  3K6B A;  1TWG A;  1TWH A;  1D1B A;  3WG7 C;  2KQ9 A;  5BUO A;  1D0Y A;  3POV A;  5CI8 A;  3T4R A;  4G7O F;  3B0P A;  1ZHT A;  3RH3 A;  2P7V A;  2W4B A;  1FFH A;  4BJ5 A;  4JUR I;  1OCC C;  1D1A A;  4KC9 A;  4BJ5 C;  4AE4 A;  3HJC A;  4RBN A;  2LSE A;  3UMI A;  3X2Q C;  4N06 A;  4EBB A;  2VH3 A;  4W8K A;  2XL4 A;  4PJN A;  2R7V A;  2KW3 C;  1FFT C;  2FFH A;  3ASO C;  4E7Z A;  4JVS A;  4OD4 A;  3ZC4 A;  2PFD A;  4G7Z F;  4LAC B;  4YT5 A;  3F47 A;  4QI0 A;  3I4U A;  1O87 A;  1KU2 A;  3EQL F;  3FHD A;  2ZXW C;  2PX3 A;  3K33 A;  3LAY A;  2KGO A;  2CNW D;  3CQZ A;  1D1C A;  3IEE A;  5KYU B;  2XXA A;  3EHM A;  2O9X A;  2PF4 E;  2ZXP A;  3SNH A;  1MMN A;  2G3V A;  5KYX A;  3RFY A;  4G7H F;  3OWT A;  4OIP F;  2VB6 A;  4AK9 A;  4OIN F;  3EHN A;  2CW0 F;  2L9J A;  4G0H A;  1IZM A;  4J30 B;  3KH2 A;  4GYT A;  3K66 A;  5E2Q A;  1VMA A;  4J32 B;  1ZU4 A;  2H7V C;  2R7O A;  4GEH A;  4QI2 A;  1Z23 A;  2G62 A;  3NYJ A;  5FCL A;  4OIO F;  2IXM A;  1ZHW A;  1Z3I X;  3ECS A;  4U5H A;  2WB7 A;  2BE5 F;  2Z15 A;  3NKD A;  3FDQ A;  2VAS A;  4YT8 A;  4C7O B;  2C03 A;  1RJ9 A;  3DAF A;  4HFK B;  2A1D D;  3L0I A;  4MND A;  4XLN F;  3ZIB A;  1D0X A;  3EPV A;  1IW7 F;  3SP1 A;  2PX0 A;  4PJL A;  4CS8 A;  3B9Q A;  4I3M A;  1BR2 A;  3T6B A;  1M56 C;  3DZA A;  2J9W A;  4JJF A;  1G8X A;  1VYI A;  3W8I A;  4C3D A;  3LLI A;  4YT4 A;  4ZLC A;  3SEO A;  1BR4 A;  2W4M A;  3ABM C;  2V26 A;  2Y3D A;  2W45 A;  3DD7 A;  3Q7G A;  3W2V A;  2YEV A;  4RDA A;  1NZE A;  2WZG A;  4AE4 B;  3EGX B;  2OG2 A;  1TKN A;  1ZHX A;  3EFO A;  2R7S A;  3F46 A;  2B0J A;  5D91 A;  3RKO F;  3NKE A;  2H7B A;  4I44 A;  2J46 A;  1OCR C;  3GOD A;  3JYH A;  4YJW A;  2OCC C;  3AG1 C;  4U5E E;  3WOD F;  3UGO A;  2V3C C;  5T3T A;  3AG2 C;  3DM5 A;  2IXP A;  3K1H A;  2FGY A;  4IAO A;  3UMK A;  4BJT A;  2J7P A;  3M1C B;  2A68 F;  1MMA A;  2A69 F;  4Q5S F;  4WJ0 A;  1MND A;  2Y3H A;  4IWB A;  4B6I A;  2J0X A;  3QZC A;  1N1C A;  3HLZ A;  5L3V A;  3UGP A;  5L3Q A;  1M57 C;  4I1O B;  5F5F A;  4C3E A;  1NU9 C;  3V7O A;  3ASN C;  3O6X A;  2ZPA A;  3AQC A;  1ZHY A;  2J0W A;  1QZX A;  5KYW A;  4PK4 A;  1OCZ C;  2I8B A;  3PHF 2;  3JCU Q;  3L34 A;  4PFO A;  2Y3G A;  5HSW A;  4O79 A;  3AG4 C;  2NUP A;  2Y3B A;  2J9V A;  4ANJ A;  4ULW A;  1J8Y F;  3O39 A;  3QMK A;  3LS1 A;  2MWQ A;  4K7B A;  3T6J A;  2XSE A;  1Z63 A;  3EH1 A;  1RJ9 B;  1MMG A;  1WGW A;  2YZS A;  4XLP F;  3AG3 C;  3MX3 A;  3CZ6 A;  4YN0 B;  2PP4 A;  3EGD A;  3Q6N A;  2MYS A;  4KI2 A;  4DOZ A;  2DYR C;  5E3A A;  4JCH A;  4M63 A;  3RIP A;  4OIR F;  5KYU A;  4XTK A;  4JJG A;  1LS1 A;  3ITF A;  4U5F E;  3CSK A;  1O5H A;  5KYY B;  1V54 C;  3GAN A;  4CS7 A;  1M2V A;  4HE8 D;  3RYL A;  2NUT B;  4Q7C A;  2EIK C;  1ST6 A;  3JSZ A;  3K1I C;  2R7T A;  3E9V A;  4KNV A;  2Y39 A;  5DLJ A;  4BJ6 A;  2EIL C;  4RD9 A;  4BJ6 C;  3PMR A;  4CS8 C;  1PCX A;  2HV7 A;  4I1M A;  3ZSU A;  1NG1 A;  3B0U X;  1S7Z A;  2L81 A;  3EG9 B;  5EHH A;  1PD0 A;  3S27 A;  2WVN A;  3FVY A;  4OIQ F;  5B3S C;  5KYN A;  5DQZ A;  1ZHZ A;  2R7Q A;  2G3K A;  2EIJ C;  3ABK C;  4KBL A;  3UNG C;  3Q6M A;  2KNH A;  1JPN A;  1VYK A;  3E70 C;  2J45 A;  3AQB A;  1SMY F;  4XWJ A;  4DVZ A;  2Q9B A;  2EIM C;  2A6E F;  3ABL C;  3I5P A;  3NYM A;  5EGY A;  4EWC A;  2GFH A;  1D0Z A;  2WZL A;  2EIN C;  1OKK A;  3EZI A;  3NRH A;  1MNE A;  2WL8 A;  4PJM A;  4K0D A;  4LER A;  3LS0 A;  4JZA A;  5CI9 A;  5DS6 A;  4DBR A;  2ZXR A;  3UMH A;  3EH2 A;  4NY3 A;  3S0X A;  2W9Y A;  2R7R A;  3LJB A;  1ZU5 A;  5KYW B;  2XXA B;  1TWA A;  1FMV A;  1M2O A;  3ZG1 A;  1W2W A;  3EGX A;  2E87 A;  5KYX B;  2HV6 A;  3DM9 B;  4HFF B;  4U5C E;  1SF8 A;  1ZYR F;  2NUP B;  1Z6A A;  4IJJ A;  3VAY A;  2C04 A;  3N24 A;  5B1A C;  1LKX A;  4U5B E;  2J9U A;  4LLC A;  1QLE C;  4LLE A;  2IXN A;  2DYS C;  3TD7 A;  3VYW A;  2Q3T A;  4CBE A;  3FAJ A;  4O6N A;  5DQT A;  4Q4Z F;  3NDB B;  3KKB A;  3KMI A;  4HEA J;  4H4K C;  3EGD B;  5B1B C;  4FES A;  3SYN A;  2D5R B;  5T1D B;  3DJU B;  3W8H A;  5F5H A;  3DAG A;  4BJ1 A;  4ZLD A;  5DVW A;  1BR1 A;  1M2V B;  4YT2 A;  1VK5 A;  4F4B A;  2R7U A;  2KJG A;  2A6H F;  5E33 A;  2Q9C A;  4PJJ A;  1LVK A;  3JT1 A;  3NYL A;  2X51 A;  1MMD A;  1VOM A;  4MQ9 F;  2CNW A;  2QTV A;  1SZI A;  3LNR A;  4O7G A;  4O6Y A;  5DS4 A;  3SZR A;  3LLK A;  3LEV A;  5DS5 A;  2IOQ A;  2M4E A;  4QDL A;  2NG1 A;  2R7W A;  3MLG A;  1PD1 A;  3I5Q A;  4YWQ A;  4CIH A;  4IRU A;  1JPJ A;  3LES A;  3HTK C;  4PFP A;  1J8M F;  1NU7 D;  3DMD A;  3K7D A;  4E7S A;  2CDQ A;  4BG0 A;  3KL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...