3K1IC

Crystal strcture of flis-hp1076 complex in h. pylori
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
119
structure length
119
Chain Sequence
QQIAKFSRDMKNINESVGALQVLQIACKKLFNKSMGLEDKDALQASIIKQELREIVENCQFLASPLFDTQLNIAINDEIFSMIVVNPLDLLENVGEFQAYLEEKLNEIKELLGYLSESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar protein
publication title Molecular interaction of flagellar export chaperone FliS and cochaperone HP1076 in Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Chaperone
total genus 40
structure length 119
sequence length 119
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16522 FliS_cochap Flagellar FLiS export co-chaperone, HP1076
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1890 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3k1iC00
3K1IC 3K1HA
chains in the Genus database with same CATH superfamily
3GM2A 2YVKA 1LM3B 2G62A 1CGNA 1EA8A 2KW3C 4I1OB 1WASA 4JW1A 3VYWA 4JTAB 2IOQA 4A4AA 2OOCA 4R32A 2IXOA 2VASA 4O6YA 1ZHTA 1ZU4A 3G4ZA 2Y3GA 3SP1A 4AK9A 2HUJA 3TQOA 4E17A 4DBQA 3HLZA 5BUOA 4O6NA 2VCCA 4NTAA 4HFFB 4BEJA 4GYTA 2WZLA 1T6UA 2R03A 4PR9A 4JEBA 2NPUA 2H8AA 1MNEA 1G4US 3WHNA 1WATA 4JTCB 4MVQA 2Q7RA 4MVOA 4MW3A 4ULVA 5L0FA 1YJGA 1ZW2A 2YRFA 1OCCC 3DM9B 3JYYA 1A41A 3LLIA 1G8XA 4IWBA 4K7BA 4O79A 4WJ0A 4O7GA 1I4ZA 5JP7A 4MTOA 5E33A 3EJNA 2WVNA 5JUAA 4KNVA 2V3CC 3NYJA 2NG1A 4ER9A 4YT5A 5KYUA 3H2UA 4XQ1A 3Q7LA 3CZ6A 3AJMA 4PFPA 4AE4B 2QUPA 4DVYP 4L6RA 2Q4FA 5AC4A 3N0TA 1QVXA 1VK5A 4NQFA 1D0YA 3ITFA 3MYIA 2I15A 4DJ9A 2KYHA 5L3VA 1OXBA 4OIPF 2VH3A 1TWHA 1ZHZA 3EFOB 3QW1A 4JC7A 3N24A 4U5FE 1PD0A 1YYJA 1JPJA 3Q6MA 4HFKB 5KYWA 2RD9A 4WABA 3AG2C 3GEEA 3MYFA 1TR2A 3K33A 4IGGA 4U5GA 5EK0A 4CJOA 3T4RA 1VTMP 1TFKB 256BA 1Q0MA 1ZHWA 4PACA 2BC5A 3FMSA 1S7ZA 3OA1A 4YL1A 4O6MA 2QLAA 3EG9B 2HV6A 4FWVA 3NYMA 1FNTc 3L1MA 5L0IA 3FOPA 3S84A 4N6CA 3FDQA 5DLJA 2NSFA 4JVSA 4ANJA 2L6FA 4YT4A 4LDQA 3CEXA 4D4NA 3GODA 1OCZC 4DRHB 1O5HA 2F22A 1YA9A 2PX3A 4IARA 3UMHA 2XM0A 3U2MA 1WN0A 1ORSC 3U5SA 2J8WA 3C8GD 4MNDA 1LI5A 1AUEA 3O55A 3LJBA 4W8KA 3PCVA 1D0XA 2XL6A 3BEHA 2L81A 2GA0A 1AEPA 2WZGA 3DM5A 3ZQYA 4DOZA 1R4TA 4EBBA 4B6IA 3RW0A 1JOGA 2ETSA 3DI5A 3I5QA 3LEOA 1HW2A 3LESA 2WVQA 1KU2A 1YAUO 2PX0A 5B3IA 1B68A 4MTGA 4PJNA 2YQYA 1JRAA 2KC3A 3AQCA 1RCPA 1EQ1A 3EFOA 2QTVA 1T5OA 3T9OA 2W4BA 3M1CB 5FCLA 1OKKA 3B0VC 2DI3A 5T1DB 3QVYA 5DS4A 1ZW3A 1ZU5A 1TWAA 2OU6A 1A7VA 4G0HA 4AL1A 2WVOA 3PDMP 2CGEA 1O3UA 2J45A 4CS8A 2Q3TA 1LS1A 2PFDA 4FX5A 3B71A 2ASRA 2AWCA 4LDRA 3F46A 2HS5A 3EG9A 1BDJB 2YL7A 2ZPAA 3K7DA 3WG7C 1QLEC 3AG1C 2Y69C 3HNJA 1Z3IX 4XEKA 3ZG1A 2KNHA 5F5FA 2A69F 4E0IA 4EUKB 1Z23A 1MMGA 2EINC 4C7OB 3SXZA 5L0CA 4Q5SF 3UMIA 3C18A 2NUTA 2LD6A 3NG1A 4QI2A 3M15A 1YLMA 3FHDA 3POVA 3MBGA 4A2NB 2HSBA 2IYLD 2OCCC 3C63A 4N6HA 2EIJC 3H2VA 2FAPB 4U5CE 4EKWA 3MFNA 5EGYA 2J0XA 3JYHA 5KYYB 5T3TA 4MS2A 1Y6DA 2HMZA 4ONSA 1S05A 3W8HA 3KH2A 2HMQA 1WOLA 3IQTA 4CJGA 4PFOA 4U5HA 3EZIA 1JR8A 2I8BA 2P0NA 4C3EA 2JPUA 3GWNA 5HV9A 1ZZPA 4XWJA 1GM5A 5F28E 3EHNA 3T6BA 4Z9HA 3DD7A 1UFBA 3ECSA 3HNLA 4K0DA 3CQZA 3WODF 5CIVA 2AVKA 1SYQA 4OD5A 2PNOA 1FFTC 1HW1A 2IXMA 1LPEA 3C8GA 3DAFA 3L8IA 3RQEA 2R7XA 2DGJA 2VB6A 1A0BA 4J32B 1H6GA 4YWQA 2HKVA 2R9RB 2EIKC 2YHSA 3AGUA 3E70C 1YYXA 2AP3A 2WL8A 3TJ5A 2PBEA 2R7SA 3M4BA 2YLGA 4OD4A 2XRHA 2D4UA 4U5EE 3ZDLA 3X2QC 1V54C 2IM8A 3GM3A 3LUTB 3KKBA 3ZIBA 3W2WA 3ABLC 4MVMA 3X1OA 2HJMA 5COMA 1D1BA 2M4EA 4AL0A 2W4MA 2J9UA 1E83A 2XLWA 4IAQA 1RJ9B 1M56C 1M6TA 1OKKD 1FFHA 2HV7A 2XLMA 3EGDB 2P1AA 4KBLA 3WAQA 2OQMA 1J8YF 2J7PA 2ZXOA 1BR4A 5A69A 2WZFA 3AOUA 3FVYA 4IAOA 3B0PA 5KYYA 1CPRA 4C3DA 3DAGA 4YT2A 4H4KC 1E84A 5KYXA 4MVZA 4I1MA 2NUPB 1U0BB 1U89A 1ORJA 4IJJA 2H7VC 2OEVA 1CGOA 3A9CA 4N06A 4EBKA 1TFOB 4JTDB 2YZSA 3RQFA 1NZEA 4YK5A 4EWCA 1RXQA 1YZCA 3I4UA 4ULWA 3V5XA 1VLSA 3ZTZA 3GORA 4JJFA 2EPOA 2R25A 3LAYA 1ST6A 3ASNC 4OIRF 3RKOF 1GQAA 3VRCA 1GGQA 3JCUQ 3NMIA 4Z9JA 1OCOC 2A0BA 2ICWG 4PJMA 1Z6AA 3ZSUA 1SF8A 5AGFA 2O9XA 2IXPA 1RKCA 4P9TA 1QSPA 1M2VB 4P9FA 1VB5A 1DOVA 2DYRC 2LFDA 2OJED 1FR0A 4KC9A 2AWYA 4C3BA 3PMRA 3DJNB 1JAFA 4CS9A 2OKUA 2EPKX 4GQHA 2A1DD 2B0HA 3KMIA 4WGZA 1TWGA 2LSEA 4LACB 1I4YA 2EPLX 5E3CA 2R7WA 3AQBA 5K0IA 3MLGA 1XZPA 2V26A 1H9TA 3EGDA 4YL0A 4JE9A 4CSAA 4E7ZA 5DQTA 3GANA 5D92A 4LDKA 3K1IA 5T3WA 3B9QA 4QI0A 2XL8A 4HEAJ 1VOMA 4I3MA 2XXAB 1LS4A 1M57C 2C03A 4KI2A 3AG4C 3SNHA 2UUIA 2Q9AA 3HJCA 4DXWA 5DS5A 2P6VA 4GEHA 1HMOA 3UMKA 4BEMJ 1ZYRF 4AE4A 2DYSC 5FZTA 4BJ1A 3LS0A 1QKRA 4LLEA 2MWQA 4CDYA 1BBHA 1SR2A 2XLOA 5L0JA 2CW0F 4MVRA 3EQLF 4NC3A 3RH3A 4Z9IA 1RKEB 2HSQA 2J46A 1EI7A 4NCQA 1AVOB 2KGOA 3T6GB 1YARO 4U5DE 2QE9A 3FAJA 3DXJF 4X0RA 3ZQVA 1HE1A 2RSEB 2A0UA 2EIMC 2GWWA 2J7PD 3MX3A 4MQ9F 3SXYA 3GWLA 3NRHA 1E85A 3EZHA 3JSZA 4EHPA 3IQ6A 1M2VA 2BL2A 4CS9C 2XM4A 4G78A 5L0DA 3QW0A 4JZAA 1PCXA 5JT4A 1O87A 1YDIA 2W9YA 3H65A 4MVUA 1EKYA 1T01A 5JSLA 4K1OA 4E0HA 1Y4CA 2P61A 4G7OF 5F5HA 2XSEA 1A7EA 1NG1A 2X51A 2Q00A 3Q7GA 1E86A 1KTMA 4YJWA 3K1IC 2FFHA 2G3KA 2CCYA 2QNLA 1J8MF 1I5NA 3DE9A 3K66A 4LLCA 3TOLA 1LE2A 3U8PA 1NLXA 2LQGA 5HSWA 4UDVA 2JD3A 2NSGA 3L8JA 1MNDA 1NU9C 2B0JA 3AG3C 3DMDA 1F1MA 4BJ5A 3NMKA 5E3AA 4CX9A 1BZ4A 1GS9A 2L9JA 3DJUB 1T6QA 3AGTA 3B0UX 2GDCA 2Y3BA 3JZ0A 5E2QA 3U2LA 3S0XA 2A6HF 5KYNA 3U3FA 1QZXA 1ZVZA 1V4AA 2YKZA 3NKEA 3KPHA 4JRZA 4E7SA 3W8IA 3S90A 1RKEA 3V7OA 4DBRA 2XLEA 3ABKC 4JJGA 2A68F 4I44A 4CS8C 1BR1A 5B1AC 3OWTA 3IPMO 3O6XA 5BQIA 1OCRC 5BQHA 3JT1A 2EPMX 3O39A 2LK4A 3DWWA 5COFA 2EPNA 4PJJA 1N1CA 1KNYA 3ATPA 2A6EF 3KYIA 4XPYA 2R02A 1Q0GA 5KYUB 2XL4A 3JTLO 3ZTMA 4FAPB 3IQCA 1OW7A 4W8PA 3L0IA 2M64A 3F47A 1D1CA 2HZ8A 3GEIA 3LNRA 1NSGB 4U5BE 5CI9A 1Q0FA 5L0HA 1VMAA 2L6HA 4LERA 4C7OA 1TWCA 5DQZA 2GFHA 4DVZA 4DRIB 4XPWA 4BJ6A 3U0CA 3A11A 3ZC4A 4BJ5C 1FMWA 3LNMB 2ZXPA 3EHMA 3LS1A 1K04A 3TOMA 2MYSA 3ASOC 3DKAA 5KYWB 1G4WR 2H7BA 1XWJA 5L0GA 3RVZA 5L3QA 4RDAA 4G7HF 3SEOA 2KJGA 3FXHA 4G7ZF 3KL4A 2CNWA 3VF0A 5DVWA 2VCAA 1TKNA 2XLDA 4F4BA 2J9BA 2P7VA 1NFOA 1LE4A 3CAXA 3G4XA 3K6BA 1MMNA 2ZD9A 4XTKA 4YL3A 5AC5A 3NMJA 3M4CA 2J0WA 5JS5A 1UG7A 3C62A 4M63A 3W2VA 2J9VA 5B1BC 1WWPA 3GEHA 5A6JA 1ZHYA 1OR3A 3JRMO 1RMVA 4JKVA 3CSKA 1L7CA 3G50A 3SXKA 2E87A 2YEVA 3ABMC 5COGA 3US6A 1LIHA 3M79A 4ZLDA 2Y3HA 2J9WA 3C8ZA 1NBBA 2YLDA 2R7QA 3K1HA 1QPUA 3BRJA 1BR2A 4N4WA 5A6KA 1APCA 3QTHA 3VM6A 2Z15A 4BJ6C 1HY5A 3QVZA 4BPMA 3QMKA 5DS6A 5D91A 1SMYF 3R2PA 4YT8A 3RF3A 4NTBA 2YL3A 1IZMA 2ZXWC 3HNKA 4J30B 1D1AA 1RJ9A 4DRJB 2L6GA 3Q6NA 1NFNA 5JVEA 3N2ZB 3FOOA 4KNWA 5B3SC 3NYLA 2R7OA 3U8VA 4CBEA 1C17M 1FAPB 1VYIA 3EGXB 3KYJA 4P6IC 3HKKA 3S9OA 3U9JA 1Z63A 2YLIA 4EIYA 2NUPA 1YVIA 4JIOA 1DOWA 3TK0A 1OW6A 4HE8D 1PD1A 3JSEO 3RIPA 3U9MA 1MQVA 1PV3A 5TJ5E 3UR3C 3LEVA 3VAYA 1K05A 1T9KA 4CDVA 5A6BA 2LIGA 3UGOA 2R05A 4BJTA 2NUTB 4JCHA 2TMVP 1YZAA 1W2WA 5EHHA 3RQGA 4MVSA 3DE8A 2KK1A 1WGWA 3O10A 4RD9A 2HJ3A 4JEAA 4WGYA 5JRAA 2XS1A 2CDQA 2R7RA 2XS8A 4XPXA 1NU7D 3SZRA 3FAPB 2CNWD 1C02A 1WTYA 3S27A 4CS7A 4XLNF 1VLTA 3RVYA 1G5ZA 4D4XA 1CPQA 2OJQA 2ZXRA 2R7VA 1SZIA 1E2XA 1ORYA 2XLHA 4J7YA 2D5RB 2JX0A 2Y3DA 3SYNA 4EBJA 4AX2A 1LI7A 2VC9A 4MW8A 3V5ZA 4CSAC 2YL0A 1IW7F 1JMWA 1TQGA 3NKDA 3J06A 1VYKA 3RYLA 2BE5F 3HNIA 4U9DA 2QY9A 5A6AA 3C8GB 1A7DA 5IY5C 5GPGB 2PF4E 1V55C 3I5PA 1FMVA 2VCBA 3SXMA 4J7TA 3EGXA 1OR2A 3U3BA 2XXAA 4NTFA 4JURI 3HTKC 2PP4A 4CIPA 1QQ3A 2W45A 3R7CA 2L7AA 2X0CA 4CIHA 1CGME 2R7TA 4ZLCA 2MHRA 2OEXA 1H9GA 4U9EA 2LFFA 3IEEA 2YL1A 3TJ6A 1K40A 1L3PA 1YA7O 4IRUA 3LLKA 4BG0A 3UNGC 3JRTA 4E18A 1OW8A 1Q0KA 1LVKA 1LKXA 4PJLA 3OEOA 4RBNA 3GM1A 3UGPA 2R7UA 3TULA 4CDAA 1MMDA 2C04A 2G3VA 1D0ZA 2AU5A 5BQGA 4OINF 3NDBB 3ZVRA 2Q9CA 3EPVA 3QZCA 2Y39A 1XZQA 4IB4A 4PK4A 3PHF2 3T6JA 3B29A 1HE9A 1Q0DA 1T6IA 1Z5ZA 2DB4A 2OG2A 4XLPF 3IHUA 2WB7A 2HFIA 3V5YA 3EH2A 1HMDA 2LP4A 3IQ5A 3L34A 3W4YA 3ZWIA 5KYXB 2UUHA 2XLVA 4XEVA 4Q7CA 1FTSA 1MMAA 5CI8A 1H7IA 2GAQA 1JPNA 5JLIA 1V74B 3EH1A 2IBFA 4QDLA 2H7OA 3C7JA 4OIQF 5A6BD 2EILC 2FGYA 4XEFA 1OQCA 2CYDA 2KQ9A 3E9VA 1OXKA 4Q4ZF 4H54A 3TD7A 4JCZA 3DZAA 2LCHA 1C03A 2Q9BA 4YN0B 2YWAA 2KSFA 4MTFA 4NY3A 3S28A 4OIOF 1U6HA 1M2OA 2IXNA 4FESA 1Z7Qc 1R5ID 3S29A 1ZHXA 3RFYA
chains in the Genus database with same CATH topology
2G62A 2KW3C 4I1OB 4JW1A 3VYWA 2IOQA 2IXOA 2VASA 4O6YA 1ZHTA 1ZU4A 3SP1A 2Y3GA 4AK9A 5BUOA 4DBQA 3HLZA 4O6NA 4BEJA 4HFFB 4GYTA 2WZLA 1MNEA 3DM9B 1OCCC 3LLIA 4K7BA 4WJ0A 4OIQF 1G8XA 4IWBA 4O79A 4O7GA 5E33A 3EJNA 2WVNA 4KNVA 2V3CC 3NYJA 2NG1A 4YT5A 5KYUA 3Q7LA 3CZ6A 4PFPA 4AE4B 4DVYP 3N0TA 1VK5A 1D0YA 3ITFA 4OIPF 5L3VA 2VH3A 1TWHA 1ZHZA 3EFOB 3N24A 4U5FE 1PD0A 1JPJA 3Q6MA 4HFKB 5KYWA 3AG2C 1TR2A 3K33A 4U5GA 3T4RA 1ZHWA 1S7ZA 4O6MA 3EG9B 2HV6A 4FWVA 3NYMA 3FDQA 5DLJA 4ANJA 4JVSA 4YT4A 3GODA 1OCZC 1O5HA 2PX3A 3UMHA 4MNDA 3LJBA 4W8KA 1D0XA 2L81A 2WZGA 3DM5A 4DOZA 4EBBA 4B6IA 3I5QA 3LESA 2WVQA 1KU2A 2PX0A 4PJNA 3AQCA 3EFOA 2QTVA 2W4BA 3M1CB 5FCLA 1OKKA 3B0VC 5T1DB 5DS4A 1ZU5A 1TWAA 4G0HA 2WVOA 2CGEA 2J45A 4CS8A 2Q3TA 1LS1A 2PFDA 4FX5A 3F46A 3EG9A 2ZPAA 3K7DA 3WG7C 1QLEC 3AG1C 2Y69C 1Z3IX 3ZG1A 5F5FA 2KNHA 2A69F 1Z23A 1MMGA 2EINC 4C7OB 4Q5SF 3UMIA 2NUTA 3NG1A 4QI2A 3FHDA 3POVA 4A2NB 2IYLD 2OCCC 2EIJC 4U5CE 5EGYA 2J0XA 3JYHA 5KYYB 5T3TA 3W8HA 3KH2A 4PFOA 4U5HA 3EZIA 2I8BA 4C3EA 4XWJA 3T6BA 3EHNA 4G7ZF 3DD7A 3ECSA 4K0DA 3WODF 3CQZA 4OD5A 3DAFA 1FFTC 2IXMA 2R7XA 2DGJA 2VB6A 4J32B 4YWQA 2EIKC 2YHSA 3E70C 2WL8A 2R7SA 4OD4A 2XRHA 4U5EE 3X2QC 1V54C 3KKBA 3ZIBA 3W2WA 3ABLC 3X1OA 1D1BA 2M4EA 2W4MA 2J9UA 1RJ9B 1M56C 1OKKD 1FFHA 2HV7A 3EGDB 4KBLA 1J8YF 2J7PA 2ZXOA 1BR4A 2WZFA 3FVYA 4IAOA 3B0PA 5KYYA 4C3DA 4YT2A 3DAGA 4H4KC 5KYXA 4I1MA 2NUPB 4IJJA 2H7VC 4N06A 2YZSA 1NZEA 4EWCA 3I4UA 4ULWA 4JJFA 3RKOF 4OIRF 3LAYA 1ST6A 3ASNC 3ZSUA 3JCUQ 1OCOC 4PJMA 1Z6AA 1SF8A 2O9XA 2IXPA 1M2VB 2DYRC 4KC9A 4C3BA 3PMRA 3DJNB 4CS9A 2A1DD 3KMIA 1TWGA 2LSEA 4LACB 5E3CA 2R7WA 3AQBA 3MLGA 2V26A 3EGDA 4CSAA 4E7ZA 5DQTA 3GANA 5D92A 5T3WA 3B9QA 4QI0A 4HEAJ 1VOMA 4I3MA 2XXAB 1M57C 2C03A 4KI2A 3AG4C 5DS5A 2Q9AA 3HJCA 2P6VA 4GEHA 3UMKA 1ZYRF 4AE4A 2DYSC 4BJ1A 3LS0A 4LLEA 2MWQA 2CW0F 3EQLF 3RH3A 2J46A 2KGOA 4U5DE 3FAJA 4X0RA 3DXJF 2EIMC 2J7PD 3MX3A 4MQ9F 3NRHA 3EZHA 3JSZA 1M2VA 4CS9C 4JZAA 1PCXA 1O87A 2W9YA 3H65A 4G7OF 5F5HA 2XSEA 1NG1A 2X51A 3Q7GA 4YJWA 3K1IC 2FFHA 2G3KA 4ZLDA 1J8MF 3K66A 4LLCA 5HSWA 2JD3A 1MNDA 1NU9C 2B0JA 3AG3C 3DMDA 4BJ5A 5E3AA 2L9JA 3DJUB 3B0UX 2Y3BA 5E2QA 3S0XA 2A6HF 5KYNA 1QZXA 3NKEA 4E7SA 3W8IA 3V7OA 4DBRA 3ABKC 4JJGA 2A68F 4I44A 4CS8C 1BR1A 5B1AC 3OWTA 3O6XA 1OCRC 3JT1A 3O39A 4PJJA 1N1CA 2A6EF 5KYUB 2XL4A 3L0IA 3F47A 5CI9A 1D1CA 3LNRA 4U5BE 3SNHA 1VMAA 4LERA 4C7OA 1TWCA 5DQZA 2GFHA 4DVZA 4BJ6A 3ZC4A 4BJ5C 1FMWA 2ZXPA 3EHMA 3LS1A 2MYSA 3ASOC 5KYWB 2H7BA 5L3QA 4RDAA 4G7HF 3SEOA 2KJGA 3KL4A 2CNWA 5DVWA 1TKNA 4F4BA 2P7VA 3K6BA 1MMNA 4XTKA 2J0WA 4M63A 3W2VA 2J9VA 5B1BC 1ZHYA 3CSKA 2E87A 2YEVA 3ABMC 2Y3HA 2J9WA 2R7QA 3K1HA 1BR2A 2Z15A 4BJ6C 3QMKA 5DS6A 5D91A 1SMYF 4YT8A 1IZMA 2ZXWC 4J30B 1D1AA 1RJ9A 3Q6NA 3N2ZB 4KNWA 5B3SC 3NYLA 2R7OA 4CBEA 1VYIA 3EGXB 4P6IC 1Z63A 2NUPA 4HE8D 1PD1A 3RIPA 3UR3C 3VAYA 3LEVA 3UGOA 4BJTA 2NUTB 4JCHA 1W2WA 5EHHA 3S28A 1WGWA 4RD9A 2CDQA 2R7RA 3SZRA 1NU7D 2CNWD 3S27A 4CS7A 4XLNF 2ZXRA 2R7VA 1SZIA 2D5RB 2Y3DA 3SYNA 4AX2A 4CSAC 1IW7F 3NKDA 1VYKA 3RYLA 2BE5F 2QY9A 5IY5C 2PF4E 1V55C 3I5PA 1FMVA 3EGXA 2XXAA 4JURI 3HTKC 2PP4A 4CIHA 2W45A 2R7TA 4ZLCA 3IEEA 4BG0A 4IRUA 3LLKA 3UNGC 3JRTA 1LVKA 1LKXA 4PJLA 3OEOA 4RBNA 3UGPA 2R7UA 1MMDA 2C04A 2G3VA 1D0ZA 3NDBB 4OINF 3ZVRA 2Q9CA 3EPVA 3QZCA 2Y39A 4PK4A 3PHF2 3T6JA 1Z5ZA 4XLPF 2OG2A 2WB7A 3EH2A 5KYXB 3L34A 4Q7CA 1FTSA 1MMAA 5CI8A 1JPNA 3EH1A 4QDLA 2H7OA 2EILC 2FGYA 2KQ9A 3E9VA 4Q4ZF 3TD7A 3DZAA 4YN0B 4OIOF 2Q9BA 4NY3A 4FESA 1M2OA 2IXNA 3OA1A 3S29A 1ZHXA 3RFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1I C;  3K1H A; 
#chains in the Genus database with same CATH topology
 3GM2 A;  2YVK A;  1LM3 B;  2G62 A;  1CGN A;  1EA8 A;  2KW3 C;  4I1O B;  1WAS A;  4JW1 A;  3VYW A;  4JTA B;  2IOQ A;  4A4A A;  2OOC A;  4R32 A;  2IXO A;  2VAS A;  4O6Y A;  1ZHT A;  1ZU4 A;  3G4Z A;  2Y3G A;  3SP1 A;  4AK9 A;  2HUJ A;  3TQO A;  4E17 A;  4DBQ A;  3HLZ A;  5BUO A;  4O6N A;  2VCC A;  4NTA A;  4HFF B;  4BEJ A;  4GYT A;  2WZL A;  1T6U A;  2R03 A;  4PR9 A;  4JEB A;  2NPU A;  2H8A A;  1MNE A;  1G4U S;  3WHN A;  1WAT A;  4JTC B;  4MVQ A;  2Q7R A;  4MVO A;  4MW3 A;  4ULV A;  5L0F A;  1YJG A;  1ZW2 A;  2YRF A;  1OCC C;  3DM9 B;  3JYY A;  1A41 A;  3LLI A;  1G8X A;  4IWB A;  4K7B A;  4O79 A;  4WJ0 A;  4O7G A;  1I4Z A;  5JP7 A;  4MTO A;  5E33 A;  3EJN A;  2WVN A;  5JUA A;  4KNV A;  2V3C C;  3NYJ A;  2NG1 A;  4ER9 A;  4YT5 A;  5KYU A;  3H2U A;  4XQ1 A;  3Q7L A;  3CZ6 A;  3AJM A;  4PFP A;  4AE4 B;  2QUP A;  4DVY P;  4L6R A;  2Q4F A;  5AC4 A;  3N0T A;  1QVX A;  1VK5 A;  4NQF A;  1D0Y A;  3ITF A;  3MYI A;  2I15 A;  4DJ9 A;  2KYH A;  5L3V A;  1OXB A;  4OIP F;  2VH3 A;  1TWH A;  1ZHZ A;  3EFO B;  3QW1 A;  4JC7 A;  3N24 A;  4U5F E;  1PD0 A;  1YYJ A;  1JPJ A;  3Q6M A;  4HFK B;  5KYW A;  2RD9 A;  4WAB A;  3AG2 C;  3GEE A;  3MYF A;  1TR2 A;  3K33 A;  4IGG A;  4U5G A;  5EK0 A;  4CJO A;  3T4R A;  1VTM P;  1TFK B;  256B A;  1Q0M A;  1ZHW A;  4PAC A;  2BC5 A;  3FMS A;  1S7Z A;  3OA1 A;  4YL1 A;  4O6M A;  2QLA A;  3EG9 B;  2HV6 A;  4FWV A;  3NYM A;  1FNT c;  3L1M A;  5L0I A;  3FOP A;  3S84 A;  4N6C A;  3FDQ A;  5DLJ A;  2NSF A;  4JVS A;  4ANJ A;  2L6F A;  4YT4 A;  4LDQ A;  3CEX A;  4D4N A;  3GOD A;  1OCZ C;  4DRH B;  1O5H A;  2F22 A;  1YA9 A;  2PX3 A;  4IAR A;  3UMH A;  2XM0 A;  3U2M A;  1WN0 A;  1ORS C;  3U5S A;  2J8W A;  3C8G D;  4MND A;  1LI5 A;  1AUE A;  3O55 A;  3LJB A;  4W8K A;  3PCV A;  1D0X A;  2XL6 A;  3BEH A;  2L81 A;  2GA0 A;  1AEP A;  2WZG A;  3DM5 A;  3ZQY A;  4DOZ A;  1R4T A;  4EBB A;  4B6I A;  3RW0 A;  1JOG A;  2ETS A;  3DI5 A;  3I5Q A;  3LEO A;  1HW2 A;  3LES A;  2WVQ A;  1KU2 A;  1YAU O;  2PX0 A;  5B3I A;  1B68 A;  4MTG A;  4PJN A;  2YQY A;  1JRA A;  2KC3 A;  3AQC A;  1RCP A;  1EQ1 A;  3EFO A;  2QTV A;  1T5O A;  3T9O A;  2W4B A;  3M1C B;  5FCL A;  1OKK A;  3B0V C;  2DI3 A;  5T1D B;  3QVY A;  5DS4 A;  1ZW3 A;  1ZU5 A;  1TWA A;  2OU6 A;  1A7V A;  4G0H A;  4AL1 A;  2WVO A;  3PDM P;  2CGE A;  1O3U A;  2J45 A;  4CS8 A;  2Q3T A;  1LS1 A;  2PFD A;  4FX5 A;  3B71 A;  2ASR A;  2AWC A;  4LDR A;  3F46 A;  2HS5 A;  3EG9 A;  1BDJ B;  2YL7 A;  2ZPA A;  3K7D A;  3WG7 C;  1QLE C;  3AG1 C;  2Y69 C;  3HNJ A;  1Z3I X;  4XEK A;  3ZG1 A;  2KNH A;  5F5F A;  2A69 F;  4E0I A;  4EUK B;  1Z23 A;  1MMG A;  2EIN C;  4C7O B;  3SXZ A;  5L0C A;  4Q5S F;  3UMI A;  3C18 A;  2NUT A;  2LD6 A;  3NG1 A;  4QI2 A;  3M15 A;  1YLM A;  3FHD A;  3POV A;  3MBG A;  4A2N B;  2HSB A;  2IYL D;  2OCC C;  3C63 A;  4N6H A;  2EIJ C;  3H2V A;  2FAP B;  4U5C E;  4EKW A;  3MFN A;  5EGY A;  2J0X A;  3JYH A;  5KYY B;  5T3T A;  4MS2 A;  1Y6D A;  2HMZ A;  4ONS A;  1S05 A;  3W8H A;  3KH2 A;  2HMQ A;  1WOL A;  3IQT A;  4CJG A;  4PFO A;  4U5H A;  3EZI A;  1JR8 A;  2I8B A;  2P0N A;  4C3E A;  2JPU A;  3GWN A;  5HV9 A;  1ZZP A;  4XWJ A;  1GM5 A;  5F28 E;  3EHN A;  3T6B A;  4Z9H A;  3DD7 A;  1UFB A;  3ECS A;  3HNL A;  4K0D A;  3CQZ A;  3WOD F;  5CIV A;  2AVK A;  1SYQ A;  4OD5 A;  2PNO A;  1FFT C;  1HW1 A;  2IXM A;  1LPE A;  3C8G A;  3DAF A;  3L8I A;  3RQE A;  2R7X A;  2DGJ A;  2VB6 A;  1A0B A;  4J32 B;  1H6G A;  4YWQ A;  2HKV A;  2R9R B;  2EIK C;  2YHS A;  3AGU A;  3E70 C;  1YYX A;  2AP3 A;  2WL8 A;  3TJ5 A;  2PBE A;  2R7S A;  3M4B A;  2YLG A;  4OD4 A;  2XRH A;  2D4U A;  4U5E E;  3ZDL A;  3X2Q C;  1V54 C;  2IM8 A;  3GM3 A;  3LUT B;  3KKB A;  3ZIB A;  3W2W A;  3ABL C;  4MVM A;  3X1O A;  2HJM A;  5COM A;  1D1B A;  2M4E A;  4AL0 A;  2W4M A;  2J9U A;  1E83 A;  2XLW A;  4IAQ A;  1RJ9 B;  1M56 C;  1M6T A;  1OKK D;  1FFH A;  2HV7 A;  2XLM A;  3EGD B;  2P1A A;  4KBL A;  3WAQ A;  2OQM A;  1J8Y F;  2J7P A;  2ZXO A;  1BR4 A;  5A69 A;  2WZF A;  3AOU A;  3FVY A;  4IAO A;  3B0P A;  5KYY A;  1CPR A;  4C3D A;  3DAG A;  4YT2 A;  4H4K C;  1E84 A;  5KYX A;  4MVZ A;  4I1M A;  2NUP B;  1U0B B;  1U89 A;  1ORJ A;  4IJJ A;  2H7V C;  2OEV A;  1CGO A;  3A9C A;  4N06 A;  4EBK A;  1TFO B;  4JTD B;  2YZS A;  3RQF A;  1NZE A;  4YK5 A;  4EWC A;  1RXQ A;  1YZC A;  3I4U A;  4ULW A;  3V5X A;  1VLS A;  3ZTZ A;  3GOR A;  4JJF A;  2EPO A;  2R25 A;  3LAY A;  1ST6 A;  3ASN C;  4OIR F;  3RKO F;  1GQA A;  3VRC A;  1GGQ A;  3JCU Q;  3NMI A;  4Z9J A;  1OCO C;  2A0B A;  2ICW G;  4PJM A;  1Z6A A;  3ZSU A;  1SF8 A;  5AGF A;  2O9X A;  2IXP A;  1RKC A;  4P9T A;  1QSP A;  1M2V B;  4P9F A;  1VB5 A;  1DOV A;  2DYR C;  2LFD A;  2OJE D;  1FR0 A;  4KC9 A;  2AWY A;  4C3B A;  3PMR A;  3DJN B;  1JAF A;  4CS9 A;  2OKU A;  2EPK X;  4GQH A;  2A1D D;  2B0H A;  3KMI A;  4WGZ A;  1TWG A;  2LSE A;  4LAC B;  1I4Y A;  2EPL X;  5E3C A;  2R7W A;  3AQB A;  5K0I A;  3MLG A;  1XZP A;  2V26 A;  1H9T A;  3EGD A;  4YL0 A;  4JE9 A;  4CSA A;  4E7Z A;  5DQT A;  3GAN A;  5D92 A;  4LDK A;  3K1I A;  5T3W A;  3B9Q A;  4QI0 A;  2XL8 A;  4HEA J;  1VOM A;  4I3M A;  2XXA B;  1LS4 A;  1M57 C;  2C03 A;  4KI2 A;  3AG4 C;  3SNH A;  2UUI A;  2Q9A A;  3HJC A;  4DXW A;  5DS5 A;  2P6V A;  4GEH A;  1HMO A;  3UMK A;  4BEM J;  1ZYR F;  4AE4 A;  2DYS C;  5FZT A;  4BJ1 A;  3LS0 A;  1QKR A;  4LLE A;  2MWQ A;  4CDY A;  1BBH A;  1SR2 A;  2XLO A;  5L0J A;  2CW0 F;  4MVR A;  3EQL F;  4NC3 A;  3RH3 A;  4Z9I A;  1RKE B;  2HSQ A;  2J46 A;  1EI7 A;  4NCQ A;  1AVO B;  2KGO A;  3T6G B;  1YAR O;  4U5D E;  2QE9 A;  3FAJ A;  3DXJ F;  4X0R A;  3ZQV A;  1HE1 A;  2RSE B;  2A0U A;  2EIM C;  2GWW A;  2J7P D;  3MX3 A;  4MQ9 F;  3SXY A;  3GWL A;  3NRH A;  1E85 A;  3EZH A;  3JSZ A;  4EHP A;  3IQ6 A;  1M2V A;  2BL2 A;  4CS9 C;  2XM4 A;  4G78 A;  5L0D A;  3QW0 A;  4JZA A;  1PCX A;  5JT4 A;  1O87 A;  1YDI A;  2W9Y A;  3H65 A;  4MVU A;  1EKY A;  1T01 A;  5JSL A;  4K1O A;  4E0H A;  1Y4C A;  2P61 A;  4G7O F;  5F5H A;  2XSE A;  1A7E A;  1NG1 A;  2X51 A;  2Q00 A;  3Q7G A;  1E86 A;  1KTM A;  4YJW A;  3K1I C;  2FFH A;  2G3K A;  2CCY A;  2QNL A;  1J8M F;  1I5N A;  3DE9 A;  3K66 A;  4LLC A;  3TOL A;  1LE2 A;  3U8P A;  1NLX A;  2LQG A;  5HSW A;  4UDV A;  2JD3 A;  2NSG A;  3L8J A;  1MND A;  1NU9 C;  2B0J A;  3AG3 C;  3DMD A;  1F1M A;  4BJ5 A;  3NMK A;  5E3A A;  4CX9 A;  1BZ4 A;  1GS9 A;  2L9J A;  3DJU B;  1T6Q A;  3AGT A;  3B0U X;  2GDC A;  2Y3B A;  3JZ0 A;  5E2Q A;  3U2L A;  3S0X A;  2A6H F;  5KYN A;  3U3F A;  1QZX A;  1ZVZ A;  1V4A A;  2YKZ A;  3NKE A;  3KPH A;  4JRZ A;  4E7S A;  3W8I A;  3S90 A;  1RKE A;  3V7O A;  4DBR A;  2XLE A;  3ABK C;  4JJG A;  2A68 F;  4I44 A;  4CS8 C;  1BR1 A;  5B1A C;  3OWT A;  3IPM O;  3O6X A;  5BQI A;  1OCR C;  5BQH A;  3JT1 A;  2EPM X;  3O39 A;  2LK4 A;  3DWW A;  5COF A;  2EPN A;  4PJJ A;  1N1C A;  1KNY A;  3ATP A;  2A6E F;  3KYI A;  4XPY A;  2R02 A;  1Q0G A;  5KYU B;  2XL4 A;  3JTL O;  3ZTM A;  4FAP B;  3IQC A;  1OW7 A;  4W8P A;  3L0I A;  2M64 A;  3F47 A;  1D1C A;  2HZ8 A;  3GEI A;  3LNR A;  1NSG B;  4U5B E;  5CI9 A;  1Q0F A;  5L0H A;  1VMA A;  2L6H A;  4LER A;  4C7O A;  1TWC A;  5DQZ A;  2GFH A;  4DVZ A;  4DRI B;  4XPW A;  4BJ6 A;  3U0C A;  3A11 A;  3ZC4 A;  4BJ5 C;  1FMW A;  3LNM B;  2ZXP A;  3EHM A;  3LS1 A;  1K04 A;  3TOM A;  2MYS A;  3ASO C;  3DKA A;  5KYW B;  1G4W R;  2H7B A;  1XWJ A;  5L0G A;  3RVZ A;  5L3Q A;  4RDA A;  4G7H F;  3SEO A;  2KJG A;  3FXH A;  4G7Z F;  3KL4 A;  2CNW A;  3VF0 A;  5DVW A;  2VCA A;  1TKN A;  2XLD A;  4F4B A;  2J9B A;  2P7V A;  1NFO A;  1LE4 A;  3CAX A;  3G4X A;  3K6B A;  1MMN A;  2ZD9 A;  4XTK A;  4YL3 A;  5AC5 A;  3NMJ A;  3M4C A;  2J0W A;  5JS5 A;  1UG7 A;  3C62 A;  4M63 A;  3W2V A;  2J9V A;  5B1B C;  1WWP A;  3GEH A;  5A6J A;  1ZHY A;  1OR3 A;  3JRM O;  1RMV A;  4JKV A;  3CSK A;  1L7C A;  3G50 A;  3SXK A;  2E87 A;  2YEV A;  3ABM C;  5COG A;  3US6 A;  1LIH A;  3M79 A;  4ZLD A;  2Y3H A;  2J9W A;  3C8Z A;  1NBB A;  2YLD A;  2R7Q A;  3K1H A;  1QPU A;  3BRJ A;  1BR2 A;  4N4W A;  5A6K A;  1APC A;  3QTH A;  3VM6 A;  2Z15 A;  4BJ6 C;  1HY5 A;  3QVZ A;  4BPM A;  3QMK A;  5DS6 A;  5D91 A;  1SMY F;  3R2P A;  4YT8 A;  3RF3 A;  4NTB A;  2YL3 A;  1IZM A;  2ZXW C;  3HNK A;  4J30 B;  1D1A A;  1RJ9 A;  4DRJ B;  2L6G A;  3Q6N A;  1NFN A;  5JVE A;  3N2Z B;  3FOO A;  4KNW A;  5B3S C;  3NYL A;  2R7O A;  3U8V A;  4CBE A;  1C17 M;  1FAP B;  1VYI A;  3EGX B;  3KYJ A;  4P6I C;  3HKK A;  3S9O A;  3U9J A;  1Z63 A;  2YLI A;  4EIY A;  2NUP A;  1YVI A;  4JIO A;  1DOW A;  3TK0 A;  1OW6 A;  4HE8 D;  1PD1 A;  3JSE O;  3RIP A;  3U9M A;  1MQV A;  1PV3 A;  5TJ5 E;  3UR3 C;  3LEV A;  3VAY A;  1K05 A;  1T9K A;  4CDV A;  5A6B A;  2LIG A;  3UGO A;  2R05 A;  4BJT A;  2NUT B;  4JCH A;  2TMV P;  1YZA A;  1W2W A;  5EHH A;  3RQG A;  4MVS A;  3DE8 A;  2KK1 A;  1WGW A;  3O10 A;  4RD9 A;  2HJ3 A;  4JEA A;  4WGY A;  5JRA A;  2XS1 A;  2CDQ A;  2R7R A;  2XS8 A;  4XPX A;  1NU7 D;  3SZR A;  3FAP B;  2CNW D;  1C02 A;  1WTY A;  3S27 A;  4CS7 A;  4XLN F;  1VLT A;  3RVY A;  1G5Z A;  4D4X A;  1CPQ A;  2OJQ A;  2ZXR A;  2R7V A;  1SZI A;  1E2X A;  1ORY A;  2XLH A;  4J7Y A;  2D5R B;  2JX0 A;  2Y3D A;  3SYN A;  4EBJ A;  4AX2 A;  1LI7 A;  2VC9 A;  4MW8 A;  3V5Z A;  4CSA C;  2YL0 A;  1IW7 F;  1JMW A;  1TQG A;  3NKD A;  3J06 A;  1VYK A;  3RYL A;  2BE5 F;  3HNI A;  4U9D A;  2QY9 A;  5A6A A;  3C8G B;  1A7D A;  5IY5 C;  5GPG B;  2PF4 E;  1V55 C;  3I5P A;  1FMV A;  2VCB A;  3SXM A;  4J7T A;  3EGX A;  1OR2 A;  3U3B A;  2XXA A;  4NTF A;  4JUR I;  3HTK C;  2PP4 A;  4CIP A;  1QQ3 A;  2W45 A;  3R7C A;  2L7A A;  2X0C A;  4CIH A;  1CGM E;  2R7T A;  4ZLC A;  2MHR A;  2OEX A;  1H9G A;  4U9E A;  2LFF A;  3IEE A;  2YL1 A;  3TJ6 A;  1K40 A;  1L3P A;  1YA7 O;  4IRU A;  3LLK A;  4BG0 A;  3UNG C;  3JRT A;  4E18 A;  1OW8 A;  1Q0K A;  1LVK A;  1LKX A;  4PJL A;  3OEO A;  4RBN A;  3GM1 A;  3UGP A;  2R7U A;  3TUL A;  4CDA A;  1MMD A;  2C04 A;  2G3V A;  1D0Z A;  2AU5 A;  5BQG A;  4OIN F;  3NDB B;  3ZVR A;  2Q9C A;  3EPV A;  3QZC A;  2Y39 A;  1XZQ A;  4IB4 A;  4PK4 A;  3PHF 2;  3T6J A;  3B29 A;  1HE9 A;  1Q0D A;  1T6I A;  1Z5Z A;  2DB4 A;  2OG2 A;  4XLP F;  3IHU A;  2WB7 A;  2HFI A;  3V5Y A;  3EH2 A;  1HMD A;  2LP4 A;  3IQ5 A;  3L34 A;  3W4Y A;  3ZWI A;  5KYX B;  2UUH A;  2XLV A;  4XEV A;  4Q7C A;  1FTS A;  1MMA A;  5CI8 A;  1H7I A;  2GAQ A;  1JPN A;  5JLI A;  1V74 B;  3EH1 A;  2IBF A;  4QDL A;  2H7O A;  3C7J A;  4OIQ F;  5A6B D;  2EIL C;  2FGY A;  4XEF A;  1OQC A;  2CYD A;  2KQ9 A;  3E9V A;  1OXK A;  4Q4Z F;  4H54 A;  3TD7 A;  4JCZ A;  3DZA A;  2LCH A;  1C03 A;  2Q9B A;  4YN0 B;  2YWA A;  2KSF A;  4MTF A;  4NY3 A;  3S28 A;  4OIO F;  1U6H A;  1M2O A;  2IXN A;  4FES A;  1Z7Q c;  1R5I D;  3S29 A;  1ZHX A;  3RFY A; 
#chains in the Genus database with same CATH homology
 2G62 A;  2KW3 C;  4I1O B;  4JW1 A;  3VYW A;  2IOQ A;  2IXO A;  2VAS A;  4O6Y A;  1ZHT A;  1ZU4 A;  3SP1 A;  2Y3G A;  4AK9 A;  5BUO A;  4DBQ A;  3HLZ A;  4O6N A;  4BEJ A;  4HFF B;  4GYT A;  2WZL A;  1MNE A;  3DM9 B;  1OCC C;  3LLI A;  4K7B A;  4WJ0 A;  4OIQ F;  1G8X A;  4IWB A;  4O79 A;  4O7G A;  5E33 A;  3EJN A;  2WVN A;  4KNV A;  2V3C C;  3NYJ A;  2NG1 A;  4YT5 A;  5KYU A;  3Q7L A;  3CZ6 A;  4PFP A;  4AE4 B;  4DVY P;  3N0T A;  1VK5 A;  1D0Y A;  3ITF A;  4OIP F;  5L3V A;  2VH3 A;  1TWH A;  1ZHZ A;  3EFO B;  3N24 A;  4U5F E;  1PD0 A;  1JPJ A;  3Q6M A;  4HFK B;  5KYW A;  3AG2 C;  1TR2 A;  3K33 A;  4U5G A;  3T4R A;  1ZHW A;  1S7Z A;  4O6M A;  3EG9 B;  2HV6 A;  4FWV A;  3NYM A;  3FDQ A;  5DLJ A;  4ANJ A;  4JVS A;  4YT4 A;  3GOD A;  1OCZ C;  1O5H A;  2PX3 A;  3UMH A;  4MND A;  3LJB A;  4W8K A;  1D0X A;  2L81 A;  2WZG A;  3DM5 A;  4DOZ A;  4EBB A;  4B6I A;  3I5Q A;  3LES A;  2WVQ A;  1KU2 A;  2PX0 A;  4PJN A;  3AQC A;  3EFO A;  2QTV A;  2W4B A;  3M1C B;  5FCL A;  1OKK A;  3B0V C;  5T1D B;  5DS4 A;  1ZU5 A;  1TWA A;  4G0H A;  2WVO A;  2CGE A;  2J45 A;  4CS8 A;  2Q3T A;  1LS1 A;  2PFD A;  4FX5 A;  3F46 A;  3EG9 A;  2ZPA A;  3K7D A;  3WG7 C;  1QLE C;  3AG1 C;  2Y69 C;  1Z3I X;  3ZG1 A;  5F5F A;  2KNH A;  2A69 F;  1Z23 A;  1MMG A;  2EIN C;  4C7O B;  4Q5S F;  3UMI A;  2NUT A;  3NG1 A;  4QI2 A;  3FHD A;  3POV A;  4A2N B;  2IYL D;  2OCC C;  2EIJ C;  4U5C E;  5EGY A;  2J0X A;  3JYH A;  5KYY B;  5T3T A;  3W8H A;  3KH2 A;  4PFO A;  4U5H A;  3EZI A;  2I8B A;  4C3E A;  4XWJ A;  3T6B A;  3EHN A;  4G7Z F;  3DD7 A;  3ECS A;  4K0D A;  3WOD F;  3CQZ A;  4OD5 A;  3DAF A;  1FFT C;  2IXM A;  2R7X A;  2DGJ A;  2VB6 A;  4J32 B;  4YWQ A;  2EIK C;  2YHS A;  3E70 C;  2WL8 A;  2R7S A;  4OD4 A;  2XRH A;  4U5E E;  3X2Q C;  1V54 C;  3KKB A;  3ZIB A;  3W2W A;  3ABL C;  3X1O A;  1D1B A;  2M4E A;  2W4M A;  2J9U A;  1RJ9 B;  1M56 C;  1OKK D;  1FFH A;  2HV7 A;  3EGD B;  4KBL A;  1J8Y F;  2J7P A;  2ZXO A;  1BR4 A;  2WZF A;  3FVY A;  4IAO A;  3B0P A;  5KYY A;  4C3D A;  4YT2 A;  3DAG A;  4H4K C;  5KYX A;  4I1M A;  2NUP B;  4IJJ A;  2H7V C;  4N06 A;  2YZS A;  1NZE A;  4EWC A;  3I4U A;  4ULW A;  4JJF A;  3RKO F;  4OIR F;  3LAY A;  1ST6 A;  3ASN C;  3ZSU A;  3JCU Q;  1OCO C;  4PJM A;  1Z6A A;  1SF8 A;  2O9X A;  2IXP A;  1M2V B;  2DYR C;  4KC9 A;  4C3B A;  3PMR A;  3DJN B;  4CS9 A;  2A1D D;  3KMI A;  1TWG A;  2LSE A;  4LAC B;  5E3C A;  2R7W A;  3AQB A;  3MLG A;  2V26 A;  3EGD A;  4CSA A;  4E7Z A;  5DQT A;  3GAN A;  5D92 A;  5T3W A;  3B9Q A;  4QI0 A;  4HEA J;  1VOM A;  4I3M A;  2XXA B;  1M57 C;  2C03 A;  4KI2 A;  3AG4 C;  5DS5 A;  2Q9A A;  3HJC A;  2P6V A;  4GEH A;  3UMK A;  1ZYR F;  4AE4 A;  2DYS C;  4BJ1 A;  3LS0 A;  4LLE A;  2MWQ A;  2CW0 F;  3EQL F;  3RH3 A;  2J46 A;  2KGO A;  4U5D E;  3FAJ A;  4X0R A;  3DXJ F;  2EIM C;  2J7P D;  3MX3 A;  4MQ9 F;  3NRH A;  3EZH A;  3JSZ A;  1M2V A;  4CS9 C;  4JZA A;  1PCX A;  1O87 A;  2W9Y A;  3H65 A;  4G7O F;  5F5H A;  2XSE A;  1NG1 A;  2X51 A;  3Q7G A;  4YJW A;  3K1I C;  2FFH A;  2G3K A;  4ZLD A;  1J8M F;  3K66 A;  4LLC A;  5HSW A;  2JD3 A;  1MND A;  1NU9 C;  2B0J A;  3AG3 C;  3DMD A;  4BJ5 A;  5E3A A;  2L9J A;  3DJU B;  3B0U X;  2Y3B A;  5E2Q A;  3S0X A;  2A6H F;  5KYN A;  1QZX A;  3NKE A;  4E7S A;  3W8I A;  3V7O A;  4DBR A;  3ABK C;  4JJG A;  2A68 F;  4I44 A;  4CS8 C;  1BR1 A;  5B1A C;  3OWT A;  3O6X A;  1OCR C;  3JT1 A;  3O39 A;  4PJJ A;  1N1C A;  2A6E F;  5KYU B;  2XL4 A;  3L0I A;  3F47 A;  5CI9 A;  1D1C A;  3LNR A;  4U5B E;  3SNH A;  1VMA A;  4LER A;  4C7O A;  1TWC A;  5DQZ A;  2GFH A;  4DVZ A;  4BJ6 A;  3ZC4 A;  4BJ5 C;  1FMW A;  2ZXP A;  3EHM A;  3LS1 A;  2MYS A;  3ASO C;  5KYW B;  2H7B A;  5L3Q A;  4RDA A;  4G7H F;  3SEO A;  2KJG A;  3KL4 A;  2CNW A;  5DVW A;  1TKN A;  4F4B A;  2P7V A;  3K6B A;  1MMN A;  4XTK A;  2J0W A;  4M63 A;  3W2V A;  2J9V A;  5B1B C;  1ZHY A;  3CSK A;  2E87 A;  2YEV A;  3ABM C;  2Y3H A;  2J9W A;  2R7Q A;  3K1H A;  1BR2 A;  2Z15 A;  4BJ6 C;  3QMK A;  5DS6 A;  5D91 A;  1SMY F;  4YT8 A;  1IZM A;  2ZXW C;  4J30 B;  1D1A A;  1RJ9 A;  3Q6N A;  3N2Z B;  4KNW A;  5B3S C;  3NYL A;  2R7O A;  4CBE A;  1VYI A;  3EGX B;  4P6I C;  1Z63 A;  2NUP A;  4HE8 D;  1PD1 A;  3RIP A;  3UR3 C;  3VAY A;  3LEV A;  3UGO A;  4BJT A;  2NUT B;  4JCH A;  1W2W A;  5EHH A;  3S28 A;  1WGW A;  4RD9 A;  2CDQ A;  2R7R A;  3SZR A;  1NU7 D;  2CNW D;  3S27 A;  4CS7 A;  4XLN F;  2ZXR A;  2R7V A;  1SZI A;  2D5R B;  2Y3D A;  3SYN A;  4AX2 A;  4CSA C;  1IW7 F;  3NKD A;  1VYK A;  3RYL A;  2BE5 F;  2QY9 A;  5IY5 C;  2PF4 E;  1V55 C;  3I5P A;  1FMV A;  3EGX A;  2XXA A;  4JUR I;  3HTK C;  2PP4 A;  4CIH A;  2W45 A;  2R7T A;  4ZLC A;  3IEE A;  4BG0 A;  4IRU A;  3LLK A;  3UNG C;  3JRT A;  1LVK A;  1LKX A;  4PJL A;  3OEO A;  4RBN A;  3UGP A;  2R7U A;  1MMD A;  2C04 A;  2G3V A;  1D0Z A;  3NDB B;  4OIN F;  3ZVR A;  2Q9C A;  3EPV A;  3QZC A;  2Y39 A;  4PK4 A;  3PHF 2;  3T6J A;  1Z5Z A;  4XLP F;  2OG2 A;  2WB7 A;  3EH2 A;  5KYX B;  3L34 A;  4Q7C A;  1FTS A;  1MMA A;  5CI8 A;  1JPN A;  3EH1 A;  4QDL A;  2H7O A;  2EIL C;  2FGY A;  2KQ9 A;  3E9V A;  4Q4Z F;  3TD7 A;  3DZA A;  4YN0 B;  4OIO F;  2Q9B A;  4NY3 A;  4FES A;  1M2O A;  2IXN A;  3OA1 A;  3S29 A;  1ZHX A;  3RFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...