3K1IC

Crystal strcture of flis-hp1076 complex in h. pylori
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
119
structure length
119
Chain Sequence
QQIAKFSRDMKNINESVGALQVLQIACKKLFNKSMGLEDKDALQASIIKQELREIVENCQFLASPLFDTQLNIAINDEIFSMIVVNPLDLLENVGEFQAYLEEKLNEIKELLGYLSESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular interaction of flagellar export chaperone FliS and cochaperone HP1076 in Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Chaperone
molecule keywords Flagellar protein
total genus 40
structure length 119
sequence length 119
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16522 FliS_cochap Flagellar FLiS export co-chaperone, HP1076
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1890 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3k1iC00
3K1HA 3K1IC
chains in the Genus database with same CATH superfamily
1AEPA 3E9VA 3ZWIA 4CS9A 1C03A 2L6GA 4U5BE 3SXKA 1NG1A 2EILC 2LQGA 2V26A 3JT1A 3DD7A 3DWWA 4J7YA 2AWYA 2FAPB 2LFFA 2R25A 2YHSA 3GEEA 4JTAB 4RBNA 4XEVA 1TQGA 4M63A 1ORSC 5E2QA 3U5SA 3DI5A 1OR2A 3EJNA 2HV6A 4H4KC 4DBRA 4Q4ZF 3MX3A 3HJCA 2H7VC 4YT8A 1D1AA 5L0FA 2XLWA 1RJ9A 2PF4E 4JE9A 4L6RA 2Q3TA 4J32B 2H7BA 3FDQA 2LP4A 4K1OA 2A1DD 2Q9CA 3UMKA 1A0BA 3DAGA 3EQLF 2VCCA 3UMIA 5L0CA 2WZLA 1S7ZA 3E70C 3JYYA 1FMVA 1OKKD 3AG4C 3L0IA 4CDYA 1XWJA 2HJ3A 2EPNA 2NUPB 3EFOA 5CI9A 5IY5C 4BEMJ 3L1MA 2VCBA 3MBGA 3V7OA 2CNWA 2NSFA 3ASNC 4U5DE 4MTFA 1EI7A 3IQ5A 3UNGC 5EGYA 1WOLA 4UDVA 1NU9C 3R7CA 1BBHA 4K0DA 4D4NA 1CPRA 1ORJA 1VMAA 4CS8C 5BQIA 1FAPB 2G62A 2MHRA 3FAPB 3G4XA 3IEEA 4PJLA 2OJED 2A0UA 4O6YA 4QI0A 3CQZA 3NYLA 3I5PA 2W9YA 4EBKA 3LJBA 1YJGA 3DJUB 3GODA 2XXAB 3KKBA 1W2WA 3LLKA 1FTSA 3JCUQ 2LFDA 3CAXA 1YZCA 1Q0KA 2EPOA 2WZGA 4U5EE 3ZSUA 2L6FA 4GYTA 3HKKA 3LUTB 4MQ9F 2X0CA 4MS2A 3UGPA 3KL4A 2GDCA 4BPMA 3NMIA 2P0NA 2YLGA 5T3TA 2KYHA 4EBJA 4E7ZA 5KYYB 4G7OF 1OQCA 2I8BA 3G50A 1YYJA 2IXOA 2OCCC 1VLTA 2J8WA 3C62A 2QNLA 4OD5A 1E85A 1YA7O 3EGDB 4N6CA 4LDKA 2YWAA 1K40A 1CGOA 1ZW3A 3Q7LA 1LE4A 1G8XA 3C63A 2EINC 2CCYA 5GPGB 1KTMA 3LNRA 2KQ9A 2X51A 4XEKA 5DS6A 2GWWA 3AOUA 3JSZA 2JD3A 4OD4A 2LK4A 1L3PA 3K33A 1DOVA 4KI2A 1YLMA 1Q0DA 2IYLD 2RD9A 4LERA 4MTOA 5AC4A 3B0PA 3FOOA 3AGTA 2YZSA 3K66A 1H6GA 2R03A 4FESA 3S29A 4LDQA 5AGFA 2CGEA 1Q0FA 2WZFA 3DXJF 5CI8A 3SZRA 1TWHA 4JZAA 3W4YA 1GGQA 2EPLX 3DM5A 3HLZA 3X2QC 4CDAA 4EIYA 5B3IA 4ANJA 1CPQA 1T9KA 3B9QA 3W8IA 5AC5A 1CGNA 4JRZA 3KPHA 3WAQA 1PV3A 2Y3DA 1VB5A 3S9OA 2ZXPA 3H65A 4MW3A 5TJ5E 2P61A 2HSQA 3GM1A 3M4BA 1B68A 1KU2A 3TJ5A 4HEAJ 2HV7A 2HZ8A 3X1OA 1V54C 2Q9BA 1SR2A 4U9EA 5A6JA 4P9TA 4YL0A 2UUIA 2VH3A 1YVIA 3O6XA 2GA0A 5L3QA 1RMVA 4U9DA 3B71A 3DE8A 3TQOA 2HUJA 4YT4A 3BEHA 1ZZPA 4WGYA 1ZU5A 5L0DA 4OIRF 4BG0A 2MWQA 3HTKC 2WVQA 2BE5F 1AUEA 2YVKA 2XRHA 1ZHTA 3VRCA 4Q5SF 4CIHA 1JPJA 1RKCA 2M64A 2GFHA 1OW6A 2LD6A 3AG2C 4PJMA 4A4AA 3ITFA 2R9RB 4YK5A 3U8PA 4C7OB 4JTCB 4MTGA 3VF0A 1WASA 5JVEA 3RFYA 3DM9B 1TKNA 3NG1A 4MVOA 2UUHA 4YL3A 2XSEA 4O6MA 4K7BA 5BUOA 2E87A 1MMDA 3GORA 1VTMP 5COGA 4HE8D 1UFBA 4DOZA 2YEVA 3POVA 2QLAA 1JMWA 4Z9HA 2J0WA 3RF3A 1PCXA 5KYWB 2KNHA 2YKZA 3QW0A 1I5NA 1HMOA 4MVQA 4CS7A 2I15A 2Q7RA 1D0ZA 2YRFA 3SNHA 3LEOA 2IXPA 3EGXB 3CSKA 4DVZA 3SXMA 4HFKB 5A6KA 1MMNA 2IM8A 5FCLA 4IWBA 4KC9A 1NZEA 4MVMA 4JC7A 3ZDLA 1LIHA 3RKOF 3U3FA 5A69A 2KK1A 2W4BA 2EIMC 2A6HF 2A6EF 1Y6DA 2PBEA 4PK4A 1E84A 3CZ6A 1YAUO 2M4EA 2B0HA 3IPMO 3GM2A 3EPVA 4R32A 3U2MA 1IW7F 2ZXWC 2Y3BA 3G4ZA 4NTAA 3PDMP 3S84A 3AQBA 1M2OA 3ABMC 3U3BA 4G78A 2EPKX 1G4WR 2HS5A 3AJMA 2A69F 4XLNF 3RQFA 4XTKA 4AK9A 5L0HA 2EIJC 2BC5A 1PD0A 3JTLO 3L8JA 1K04A 3M79A 4C3BA 4I1MA 4P6IC 4XEFA 4XPXA 5KYXA 4PFOA 1C02A 4U5CE 1A7VA 4I3MA 2DYRC 3T4RA 1XZQA 5T3WA 2YLIA 2HMZA 1LVKA 4MNDA 3W8HA 1O3UA 2J9BA 5L0IA 1O87A 4JCZA 4PFPA 1JPNA 1LM3B 1KNYA 3ZQYA 1APCA 4JTDB 4GEHA 2J9VA 3WODF 3T6BA 2J46A 3QTHA 4ULWA 1ORYA 3U8VA 2L6HA 3U9MA 4C3EA 4D4XA 5JSLA 2ZD9A 3SYNA 3M15A 4E0IA 5JUAA 3IQ6A 3VM6A 3HNKA 1YDIA 2Q4FA 1GS9A 3NKDA 4CJOA 3RYLA 1Y4CA 1RXQA 3F47A 2VB6A 4Z9JA 1WTYA 1VLSA 4I44A 4I1OB 2EPMX 3GWLA 1HE1A 3RQEA 4BJ1A 4XLPF 1LKXA 4CBEA 1V4AA 5KYNA 3L8IA 4W8KA 1LS4A 1QVXA 3EG9A 4E7SA 4OIPF 1EQ1A 3GEIA 5E33A 3K1IC 1SMYF 4FWVA 1J8YF 4PJNA 3DKAA 4AE4B 3ZG1A 3RW0A 1CGME 1OW8A 3EZIA 3FXHA 5B1BC 2ZXOA 2OJQA 4N6HA 1O5HA 2EIKC 1Z7Qc 1LPEA 4C3DA 2KJGA 3HNIA 2FFHA 4LACB 4MVSA 5JS5A 4MW8A 4U5FE 5DLJA 5KYXB 3A11A 1H9GA 1Z3IX 3NDBB 4NCQA 4YT5A 3DMDA 3S90A 1Z23A 2R7QA 2VC9A 5E3CA 4JKVA 3KYJA 5L0GA 1ST6A 4HFFB 3EFOB 3A9CA 2PNOA 4F4BA 3N2ZB 4A2NB 4JVSA 2J9UA 4WABA 1LS1A 3TD7A 1QZXA 2FGYA 1G4US 2KGOA 2CW0F 2HFIA 4CDVA 2PP4A 2OOCA 4JEAA 3ZVRA 4BEJA 4YL1A 1PD1A 4IAQA 5BQGA 1T5OA 3ZIBA 3ZTZA 4CJGA 1E83A 4NY3A 1WATA 1OCRC 2XLDA 4NQFA 3VAYA 3WHNA 5KYUB 5DQZA 2Q9AA 1VYKA 3NMKA 2YL0A 1J8MF 4XWJA 3O55A 4ZLDA 3J06A 5DQTA 4EUKB 1JOGA 1D0XA 2LCHA 3ECSA 3FVYA 5HSWA 1T01A 1M6TA 1WN0A 3TOMA 3DE9A 1EKYA 2XS1A 3ABKC 3EH2A 4G7ZF 3S27A 4GQHA 2R7TA 1FFTC 5K0IA 3RVYA 4BJ5C 1I4ZA 5DVWA 5E3AA 4G0HA 1R4TA 1EA8A 3FAJA 2KSFA 3IQTA 3V5XA 1OXKA 5B3SC 5D92A 3W2WA 3S28A 3R2PA 2HKVA 4RD9A 4YN0B 4G7HF 4LDRA 2Y3GA 3U0CA 4CX9A 2KW3C 2Y69C 1A7DA 3NRHA 3WG7C 1NBBA 1AVOB 4YT2A 3EZHA 3F46A 4EKWA 3B0UX 2F22A 1LE2A 4J7TA 1BR1A 2QUPA 2W4MA 2NG1A 4IGGA 1JRAA 4J30B 4RDAA 3NYMA 4ZLCA 3JYHA 1OKKA 1M2VA 2WVNA 3H2VA 3LLIA 5DS5A 4OIOF 2QE9A 3H2UA 3OEOA 4OIQF 4AL1A 3EGDA 3MFNA 5JP7A 3RIPA 4MVUA 4FAPB 3IQCA 4BJ6A 1TFOB 3AG3C 2OEXA 2WL8A 2ICWG 5HV9A 1H7IA 3NKEA 1G5ZA 5KYYA 3DAFA 2AU5A 3LNMB 2DB4A 4DVYP 1MNEA 4YWQA 1V55C 3NYJA 3RVZA 5BQHA 1FNTc 1HW2A 1TWAA 2XLVA 4O6NA 3T6GB 4ULVA 4CSAA 1OCZC 2VCAA 4PACA 2XS8A 2NSGA 1ZW2A 1VYIA 2IBFA 2JX0A 4O7GA 3LESA 1YARO 2NPUA 3ATPA 1BR4A 2P6VA 3MYIA 1BR2A 1ZHZA 2B0JA 4AL0A 1Q0GA 4QI2A 4X0RA 1R5ID 3C8GA 1T6QA 4BJTA 1Z5ZA 5A6BA 2OG2A 3BRJA 1ZHYA 2J7PD 5KYUA 4IRUA 4DXWA 3KYIA 3SXZA 3ZC4A 2R7RA 2Z15A 2IXMA 4CSAC 2OQMA 3VYWA 1TWCA 3DJNB 1D1BA 3Q6MA 2XL4A 1TR2A 4C7OA 3EHMA 5JRAA 4PJJA 3RH3A 1L7CA 1K05A 1QQ3A 3ABLC 3RQGA 3M4CA 1QLEC 1NFNA 1UG7A 3LEVA 5COMA 4JEBA 3PMRA 2BL2A 2HJMA 4NTBA 3TK0A 1S05A 2ETSA 3PCVA 3Q7GA 1OW7A 5KYWA 2CYDA 3DZAA 4NC3A 4OINF 1V74B 1U6HA 2YLDA 3M1CB 5F5HA 5L3VA 4CS9C 5DS4A 1T6IA 2R7XA 2R7OA 2XLEA 1MNDA 3C8ZA 2XLHA 1JAFA 4MVZA 3JZ0A 4DRIB 4E17A 3US6A 5JLIA 2TMVP 1IZMA 2V3CC 3B29A 4JURI 1C17M 1M2VB 1GQAA 3QVZA 2D5RB 2J45A 3L34A 1HE9A 3N0TA 1LI5A 5JT4A 2RSEB 3QZCA 4DJ9A 3UMHA 3EG9B 4B6IA 3EHNA 1A41A 1Q0MA 1D0YA 5T1DB 3IHUA 3SEOA 2YL7A 2YL1A 2G3KA 4DRJB 4PR9A 2XLMA 4MVRA 3QVYA 1QKRA 5D91A 4IARA 2L7AA 2ZXRA 4W8PA 2JPUA 2R7VA 2Y3HA 4BJ5A 4LLCA 1ZVZA 1FFHA 1HW1A 2OKUA 4XQ1A 2P7VA 5L0JA 4U5HA 3C7JA 3T9OA 4AX2A 2QY9A 4KNWA 3QW1A 2J9WA 3LS0A 3ZTMA 2J0XA 4Z9IA 4JJGA 3I4UA 4WJ0A 4AE4A 1RCPA 1YYXA 1OR3A 1NFOA 2XL6A 1NU7D 4NTFA 1U89A 2WVOA 3AQCA 1FMWA 4EHPA 4JW1A 1WGWA 3OWTA 2L81A 1NSGB 4XPYA 3NMJA 4ONSA 4E18A 2C04A 3U9JA 3UGOA 1ZU4A 256BA 2NUTB 1DOWA 1OCOC 4IB4A 3FMSA 3EH1A 1D1CA 5CIVA 1RKEB 4LLEA 3PHF2 2L9JA 1QSPA 2DI3A 2Q00A 3B0VC 2A0BA 3TOLA 4DRHB 2XM0A 4Q7CA 2R7UA 3K6BA 4ER9A 3AGUA 2PX3A 1VOMA 4FX5A 3Q6NA 1MQVA 2XL8A 1NLXA 2W45A 3K1HA 3O39A 3ASOC 1F1MA 2MYSA 1XZPA 1SF8A 4P9FA 5B1AC 2OU6A 4EBBA 4DBQA 1FR0A 2XM4A 4U5GA 2LIGA 2A68F 3O10A 3MYFA 3GANA 4IJJA 1BDJB 4N06A 3ZQVA 3C8GB 4KNVA 2OEVA 1SZIA 2LSEA 2Y39A 1TFKB 2ASRA 3OA1A 3K1IA 1MMAA 1VK5A 1ZHWA 2HSBA 2WB7A 1U0BB 2KC3A 4H54A 3SXYA 1H9TA 1QPUA 3EGXA 2H7OA 1WWPA 2AP3A 1LI7A 2QTVA 4N4WA 3W2VA 2PFDA 3K7DA 5EK0A 2R05A 4CS8A 5F5FA 2H8AA 2XLOA 5EHHA 2IOQA 2ZPAA 3S0XA 3FHDA 4WGZA 1GM5A 3JRMO 1YZAA 2R02A 1TWGA 2YL3A 2R7WA 3JSEO 5FZTA 1HY5A 2GAQA 1OCCC 4JIOA 1E86A 2PX0A 2G3VA 3LAYA 2O9XA 1RKEA 1ZYRF 1MMGA 1RJ9B 2AWCA 2C03A 1ZHXA 3TULA 3V5ZA 2YQYA 4O79A 3GM3A 1Z63A 2R7SA 3UR3C 1HMDA 4IAOA 5A6BD 2DGJA 5F28E 3U2LA 3MLGA 1BZ4A 3JRTA 1T6UA 2CDQA 2IXNA 4YJWA 1SYQA 1E2XA 2XXAA 3I5QA 5A6AA 2NUPA 3HNLA 3KH2A 2D4UA 2HMQA 3C18A 5COFA 2VASA 1YA9A 4BJ6C 4E0HA 2NUTA 4QDLA 2J7PA 2P1AA 3LS1A 3T6JA 3TJ6A 3GWNA 3QMKA 2AVKA 2DYSC 3FOPA 1Z6AA 1I4YA 3KMIA 3C8GD 3CEXA 3N24A 1N1CA 4JCHA 2CNWD 1OXBA 3GEHA 3V5YA 3AG1C 1A7EA 3HNJA 4JJFA 1JR8A 3SP1A 4KBLA 4EWCA 4CIPA 1M56C 1M57C 4XPWA
chains in the Genus database with same CATH topology
3E9VA 4CS9A 4U5BE 1NG1A 2EILC 2V26A 3JT1A 3DD7A 2YHSA 4RBNA 4M63A 5E2QA 3EJNA 2HV6A 4H4KC 4DBRA 3MX3A 3HJCA 2H7VC 4YT8A 1D1AA 1RJ9A 2PF4E 3FDQA 2Q3TA 4J32B 2H7BA 2A1DD 2Q9CA 3UMKA 3DAGA 3EQLF 3UMIA 2WZLA 1S7ZA 3E70C 3L0IA 1FMVA 1OKKD 3AG4C 2NUPB 3EFOA 5CI9A 5IY5C 3V7OA 2CNWA 4U5DE 3ASNC 3UNGC 5EGYA 1NU9C 4K0DA 1VMAA 4CS8C 2G62A 4PJLA 3IEEA 4O6YA 4QI0A 3CQZA 3NYLA 3I5PA 2W9YA 3LJBA 3DJUB 3GODA 2XXAB 3KKBA 1W2WA 3LLKA 1FTSA 3JCUQ 2WZGA 4U5EE 3ZSUA 4GYTA 4MQ9F 3UGPA 3KL4A 5T3TA 4E7ZA 5KYYB 4G7OF 2I8BA 2OCCC 2IXOA 4OD5A 3EGDB 3Q7LA 1G8XA 2EINC 3LNRA 2KQ9A 2X51A 5DS6A 3JSZA 2JD3A 4OD4A 3K33A 4KI2A 2IYLD 4LERA 3B0PA 2YZSA 3K66A 4FESA 3S29A 2CGEA 2WZFA 3DXJF 5CI8A 3SZRA 1TWHA 4JZAA 3DM5A 3HLZA 3X2QC 4ANJA 3W8IA 3B9QA 2Y3DA 2ZXPA 3H65A 1KU2A 4HEAJ 2HV7A 3X1OA 1V54C 2Q9BA 3O6XA 2VH3A 5L3QA 4YT4A 1ZU5A 4OIRF 4BG0A 2MWQA 3HTKC 2WVQA 2BE5F 2XRHA 1ZHTA 4Q5SF 4CIHA 1JPJA 3AG2C 2GFHA 4PJMA 4C7OB 3ITFA 3RFYA 3DM9B 1TKNA 3NG1A 2XSEA 4O6MA 4K7BA 5BUOA 2E87A 1MMDA 4HE8D 4DOZA 2YEVA 3POVA 2J0WA 1PCXA 5KYWB 2KNHA 4CS7A 1D0ZA 3SNHA 2IXPA 3EGXB 3CSKA 4DVZA 4HFKB 1MMNA 5FCLA 4IWBA 4KC9A 1NZEA 3RKOF 2W4BA 2EIMC 2A6HF 2A6EF 4PK4A 3CZ6A 2M4EA 3EPVA 1IW7F 2ZXWC 2Y3BA 3AQBA 1M2OA 3ABMC 4Q4ZF 4AK9A 2A69F 4XLNF 4XTKA 2EIJC 1PD0A 4C3BA 4I1MA 4P6IC 5KYXA 4PFOA 4U5CE 4I3MA 2DYRC 3T4RA 5T3WA 3W8HA 1LVKA 4MNDA 1O87A 4PFPA 1JPNA 4GEHA 2J9VA 3WODF 3T6BA 2J46A 4ULWA 4C3EA 3SYNA 3NKDA 3RYLA 3F47A 2VB6A 4I44A 4I1OB 4BJ1A 4XLPF 1LKXA 4CBEA 5KYNA 4W8KA 3EG9A 4E7SA 4OIPF 5E33A 3K1IC 1SMYF 4FWVA 1J8YF 4PJNA 4AE4B 3ZG1A 3EZIA 5B1BC 2ZXOA 1O5HA 2EIKC 4C3DA 2KJGA 2FFHA 4LACB 5KYXB 4U5FE 5DLJA 1Z3IX 3NDBB 4YT5A 3DMDA 1Z23A 2R7QA 5E3CA 1ST6A 4HFFB 3EFOB 4F4BA 3N2ZB 4A2NB 4JVSA 2J9UA 1LS1A 3TD7A 1QZXA 2FGYA 2KGOA 2CW0F 2PP4A 3ZVRA 4BEJA 1PD1A 4NY3A 3VAYA 1OCRC 5KYUB 5DQZA 2Q9AA 1VYKA 1J8MF 4XWJA 4ZLDA 5DQTA 1D0XA 3ECSA 3FVYA 5HSWA 3ABKC 3EH2A 4G7ZF 3S27A 2R7TA 1FFTC 4BJ5C 5DVWA 5E3AA 4G0HA 3FAJA 5B3SC 5D92A 3W2WA 3S28A 4RD9A 4YN0B 4G7HF 2Y3GA 2KW3C 3NRHA 2Y69C 3WG7C 4YT2A 3EZHA 3F46A 3B0UX 1BR1A 2W4MA 2NG1A 4J30B 4RDAA 3NYMA 4ZLCA 3JYHA 1OKKA 1M2VA 2WVNA 3LLIA 5DS5A 4OIOF 3OEOA 4OIQF 3EGDA 3RIPA 4BJ6A 3AG3C 2WL8A 3NKEA 5KYYA 3DAFA 4DVYP 1MNEA 4YWQA 1V55C 3NYJA 1TWAA 4O6NA 4CSAA 1OCZC 1VYIA 4O7GA 3LESA 1BR4A 2P6VA 1BR2A 1ZHZA 2B0JA 4QI2A 4X0RA 4BJTA 1Z5ZA 2OG2A 1ZHYA 2J7PD 5KYUA 4IRUA 3ZC4A 2R7RA 2Z15A 2IXMA 4CSAC 3VYWA 1TWCA 3DJNB 1D1BA 3Q6MA 2XL4A 1TR2A 4C7OA 3EHMA 4PJJA 3RH3A 3ABLC 1QLEC 3LEVA 3PHF2 3PMRA 3Q7GA 5KYWA 3DZAA 4OINF 3M1CB 5F5HA 5L3VA 4CS9C 5DS4A 2R7XA 2R7OA 1MNDA 2V3CC 1IZMA 4JURI 1M2VB 2D5RB 2J45A 3L34A 3N0TA 3QZCA 3UMHA 3EG9B 4B6IA 3EHNA 5T1DB 1D0YA 3SEOA 2G3KA 5D91A 2R7VA 2ZXRA 2Y3HA 4BJ5A 4LLCA 1FFHA 2P7VA 4U5HA 4AX2A 2QY9A 4KNWA 2J9WA 3LS0A 2J0XA 4JJGA 3I4UA 4WJ0A 4AE4A 1NU7D 2WVOA 3AQCA 1FMWA 4JW1A 1WGWA 3OWTA 2L81A 2C04A 3UGOA 1ZU4A 2NUTB 1OCOC 3EH1A 1D1CA 4LLEA 2L9JA 3B0VC 4Q7CA 2R7UA 3K6BA 2PX3A 1VOMA 4FX5A 3Q6NA 2W45A 3K1HA 3O39A 3ASOC 2MYSA 4EBBA 1SF8A 5B1AC 4DBQA 4U5GA 2A68F 3GANA 4IJJA 4N06A 4KNVA 1SZIA 2LSEA 2Y39A 3OA1A 1MMAA 1VK5A 1ZHWA 2WB7A 3EGXA 2H7OA 2QTVA 3W2VA 4CS8A 2PFDA 3K7DA 5F5FA 5EHHA 2IOQA 2ZPAA 3S0XA 3FHDA 1TWGA 2R7WA 1OCCC 2PX0A 2G3VA 3LAYA 2O9XA 1ZYRF 1MMGA 1RJ9B 2C03A 1ZHXA 4O79A 1Z63A 2R7SA 3UR3C 4IAOA 2DGJA 3MLGA 3JRTA 2CDQA 2IXNA 4YJWA 2XXAA 3I5QA 2NUPA 3KH2A 2VASA 4BJ6C 2NUTA 4QDLA 2J7PA 3LS1A 3T6JA 3QMKA 3ZIBA 2DYSC 1Z6AA 3KMIA 3N24A 4JCHA 1N1CA 2CNWD 3AG1C 4JJFA 3SP1A 4KBLA 4EWCA 1M56C 1M57C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1H A;  3K1I C; 
#chains in the Genus database with same CATH topology
 1AEP A;  3E9V A;  3ZWI A;  4CS9 A;  1C03 A;  2L6G A;  4U5B E;  3SXK A;  1NG1 A;  2EIL C;  2LQG A;  2V26 A;  3JT1 A;  3DD7 A;  3DWW A;  4J7Y A;  2AWY A;  2FAP B;  2LFF A;  2R25 A;  2YHS A;  3GEE A;  4JTA B;  4RBN A;  4XEV A;  1TQG A;  4M63 A;  1ORS C;  5E2Q A;  3U5S A;  3DI5 A;  1OR2 A;  3EJN A;  2HV6 A;  4H4K C;  4DBR A;  4Q4Z F;  3MX3 A;  3HJC A;  2H7V C;  4YT8 A;  1D1A A;  5L0F A;  2XLW A;  1RJ9 A;  2PF4 E;  4JE9 A;  4L6R A;  2Q3T A;  4J32 B;  2H7B A;  3FDQ A;  2LP4 A;  4K1O A;  2A1D D;  2Q9C A;  3UMK A;  1A0B A;  3DAG A;  3EQL F;  2VCC A;  3UMI A;  5L0C A;  2WZL A;  1S7Z A;  3E70 C;  3JYY A;  1FMV A;  1OKK D;  3AG4 C;  3L0I A;  4CDY A;  1XWJ A;  2HJ3 A;  2EPN A;  2NUP B;  3EFO A;  5CI9 A;  5IY5 C;  4BEM J;  3L1M A;  2VCB A;  3MBG A;  3V7O A;  2CNW A;  2NSF A;  3ASN C;  4U5D E;  4MTF A;  1EI7 A;  3IQ5 A;  3UNG C;  5EGY A;  1WOL A;  4UDV A;  1NU9 C;  3R7C A;  1BBH A;  4K0D A;  4D4N A;  1CPR A;  1ORJ A;  1VMA A;  4CS8 C;  5BQI A;  1FAP B;  2G62 A;  2MHR A;  3FAP B;  3G4X A;  3IEE A;  4PJL A;  2OJE D;  2A0U A;  4O6Y A;  4QI0 A;  3CQZ A;  3NYL A;  3I5P A;  2W9Y A;  4EBK A;  3LJB A;  1YJG A;  3DJU B;  3GOD A;  2XXA B;  3KKB A;  1W2W A;  3LLK A;  1FTS A;  3JCU Q;  2LFD A;  3CAX A;  1YZC A;  1Q0K A;  2EPO A;  2WZG A;  4U5E E;  3ZSU A;  2L6F A;  4GYT A;  3HKK A;  3LUT B;  4MQ9 F;  2X0C A;  4MS2 A;  3UGP A;  3KL4 A;  2GDC A;  4BPM A;  3NMI A;  2P0N A;  2YLG A;  5T3T A;  2KYH A;  4EBJ A;  4E7Z A;  5KYY B;  4G7O F;  1OQC A;  2I8B A;  3G50 A;  1YYJ A;  2IXO A;  2OCC C;  1VLT A;  2J8W A;  3C62 A;  2QNL A;  4OD5 A;  1E85 A;  1YA7 O;  3EGD B;  4N6C A;  4LDK A;  2YWA A;  1K40 A;  1CGO A;  1ZW3 A;  3Q7L A;  1LE4 A;  1G8X A;  3C63 A;  2EIN C;  2CCY A;  5GPG B;  1KTM A;  3LNR A;  2KQ9 A;  2X51 A;  4XEK A;  5DS6 A;  2GWW A;  3AOU A;  3JSZ A;  2JD3 A;  4OD4 A;  2LK4 A;  1L3P A;  3K33 A;  1DOV A;  4KI2 A;  1YLM A;  1Q0D A;  2IYL D;  2RD9 A;  4LER A;  4MTO A;  5AC4 A;  3B0P A;  3FOO A;  3AGT A;  2YZS A;  3K66 A;  1H6G A;  2R03 A;  4FES A;  3S29 A;  4LDQ A;  5AGF A;  2CGE A;  1Q0F A;  2WZF A;  3DXJ F;  5CI8 A;  3SZR A;  1TWH A;  4JZA A;  3W4Y A;  1GGQ A;  2EPL X;  3DM5 A;  3HLZ A;  3X2Q C;  4CDA A;  4EIY A;  5B3I A;  4ANJ A;  1CPQ A;  1T9K A;  3B9Q A;  3W8I A;  5AC5 A;  1CGN A;  4JRZ A;  3KPH A;  3WAQ A;  1PV3 A;  2Y3D A;  1VB5 A;  3S9O A;  2ZXP A;  3H65 A;  4MW3 A;  5TJ5 E;  2P61 A;  2HSQ A;  3GM1 A;  3M4B A;  1B68 A;  1KU2 A;  3TJ5 A;  4HEA J;  2HV7 A;  2HZ8 A;  3X1O A;  1V54 C;  2Q9B A;  1SR2 A;  4U9E A;  5A6J A;  4P9T A;  4YL0 A;  2UUI A;  2VH3 A;  1YVI A;  3O6X A;  2GA0 A;  5L3Q A;  1RMV A;  4U9D A;  3B71 A;  3DE8 A;  3TQO A;  2HUJ A;  4YT4 A;  3BEH A;  1ZZP A;  4WGY A;  1ZU5 A;  5L0D A;  4OIR F;  4BG0 A;  2MWQ A;  3HTK C;  2WVQ A;  2BE5 F;  1AUE A;  2YVK A;  2XRH A;  1ZHT A;  3VRC A;  4Q5S F;  4CIH A;  1JPJ A;  1RKC A;  2M64 A;  2GFH A;  1OW6 A;  2LD6 A;  3AG2 C;  4PJM A;  4A4A A;  3ITF A;  2R9R B;  4YK5 A;  3U8P A;  4C7O B;  4JTC B;  4MTG A;  3VF0 A;  1WAS A;  5JVE A;  3RFY A;  3DM9 B;  1TKN A;  3NG1 A;  4MVO A;  2UUH A;  4YL3 A;  2XSE A;  4O6M A;  4K7B A;  5BUO A;  2E87 A;  1MMD A;  3GOR A;  1VTM P;  5COG A;  4HE8 D;  1UFB A;  4DOZ A;  2YEV A;  3POV A;  2QLA A;  1JMW A;  4Z9H A;  2J0W A;  3RF3 A;  1PCX A;  5KYW B;  2KNH A;  2YKZ A;  3QW0 A;  1I5N A;  1HMO A;  4MVQ A;  4CS7 A;  2I15 A;  2Q7R A;  1D0Z A;  2YRF A;  3SNH A;  3LEO A;  2IXP A;  3EGX B;  3CSK A;  4DVZ A;  3SXM A;  4HFK B;  5A6K A;  1MMN A;  2IM8 A;  5FCL A;  4IWB A;  4KC9 A;  1NZE A;  4MVM A;  4JC7 A;  3ZDL A;  1LIH A;  3RKO F;  3U3F A;  5A69 A;  2KK1 A;  2W4B A;  2EIM C;  2A6H F;  2A6E F;  1Y6D A;  2PBE A;  4PK4 A;  1E84 A;  3CZ6 A;  1YAU O;  2M4E A;  2B0H A;  3IPM O;  3GM2 A;  3EPV A;  4R32 A;  3U2M A;  1IW7 F;  2ZXW C;  2Y3B A;  3G4Z A;  4NTA A;  3PDM P;  3S84 A;  3AQB A;  1M2O A;  3ABM C;  3U3B A;  4G78 A;  2EPK X;  1G4W R;  2HS5 A;  3AJM A;  2A69 F;  4XLN F;  3RQF A;  4XTK A;  4AK9 A;  5L0H A;  2EIJ C;  2BC5 A;  1PD0 A;  3JTL O;  3L8J A;  1K04 A;  3M79 A;  4C3B A;  4I1M A;  4P6I C;  4XEF A;  4XPX A;  5KYX A;  4PFO A;  1C02 A;  4U5C E;  1A7V A;  4I3M A;  2DYR C;  3T4R A;  1XZQ A;  5T3W A;  2YLI A;  2HMZ A;  1LVK A;  4MND A;  3W8H A;  1O3U A;  2J9B A;  5L0I A;  1O87 A;  4JCZ A;  4PFP A;  1JPN A;  1LM3 B;  1KNY A;  3ZQY A;  1APC A;  4JTD B;  4GEH A;  2J9V A;  3WOD F;  3T6B A;  2J46 A;  3QTH A;  4ULW A;  1ORY A;  3U8V A;  2L6H A;  3U9M A;  4C3E A;  4D4X A;  5JSL A;  2ZD9 A;  3SYN A;  3M15 A;  4E0I A;  5JUA A;  3IQ6 A;  3VM6 A;  3HNK A;  1YDI A;  2Q4F A;  1GS9 A;  3NKD A;  4CJO A;  3RYL A;  1Y4C A;  1RXQ A;  3F47 A;  2VB6 A;  4Z9J A;  1WTY A;  1VLS A;  4I44 A;  4I1O B;  2EPM X;  3GWL A;  1HE1 A;  3RQE A;  4BJ1 A;  4XLP F;  1LKX A;  4CBE A;  1V4A A;  5KYN A;  3L8I A;  4W8K A;  1LS4 A;  1QVX A;  3EG9 A;  4E7S A;  4OIP F;  1EQ1 A;  3GEI A;  5E33 A;  3K1I C;  1SMY F;  4FWV A;  1J8Y F;  4PJN A;  3DKA A;  4AE4 B;  3ZG1 A;  3RW0 A;  1CGM E;  1OW8 A;  3EZI A;  3FXH A;  5B1B C;  2ZXO A;  2OJQ A;  4N6H A;  1O5H A;  2EIK C;  1Z7Q c;  1LPE A;  4C3D A;  2KJG A;  3HNI A;  2FFH A;  4LAC B;  4MVS A;  5JS5 A;  4MW8 A;  4U5F E;  5DLJ A;  5KYX B;  3A11 A;  1H9G A;  1Z3I X;  3NDB B;  4NCQ A;  4YT5 A;  3DMD A;  3S90 A;  1Z23 A;  2R7Q A;  2VC9 A;  5E3C A;  4JKV A;  3KYJ A;  5L0G A;  1ST6 A;  4HFF B;  3EFO B;  3A9C A;  2PNO A;  4F4B A;  3N2Z B;  4A2N B;  4JVS A;  2J9U A;  4WAB A;  1LS1 A;  3TD7 A;  1QZX A;  2FGY A;  1G4U S;  2KGO A;  2CW0 F;  2HFI A;  4CDV A;  2PP4 A;  2OOC A;  4JEA A;  3ZVR A;  4BEJ A;  4YL1 A;  1PD1 A;  4IAQ A;  5BQG A;  1T5O A;  3ZIB A;  3ZTZ A;  4CJG A;  1E83 A;  4NY3 A;  1WAT A;  1OCR C;  2XLD A;  4NQF A;  3VAY A;  3WHN A;  5KYU B;  5DQZ A;  2Q9A A;  1VYK A;  3NMK A;  2YL0 A;  1J8M F;  4XWJ A;  3O55 A;  4ZLD A;  3J06 A;  5DQT A;  4EUK B;  1JOG A;  1D0X A;  2LCH A;  3ECS A;  3FVY A;  5HSW A;  1T01 A;  1M6T A;  1WN0 A;  3TOM A;  3DE9 A;  1EKY A;  2XS1 A;  3ABK C;  3EH2 A;  4G7Z F;  3S27 A;  4GQH A;  2R7T A;  1FFT C;  5K0I A;  3RVY A;  4BJ5 C;  1I4Z A;  5DVW A;  5E3A A;  4G0H A;  1R4T A;  1EA8 A;  3FAJ A;  2KSF A;  3IQT A;  3V5X A;  1OXK A;  5B3S C;  5D92 A;  3W2W A;  3S28 A;  3R2P A;  2HKV A;  4RD9 A;  4YN0 B;  4G7H F;  4LDR A;  2Y3G A;  3U0C A;  4CX9 A;  2KW3 C;  2Y69 C;  1A7D A;  3NRH A;  3WG7 C;  1NBB A;  1AVO B;  4YT2 A;  3EZH A;  3F46 A;  4EKW A;  3B0U X;  2F22 A;  1LE2 A;  4J7T A;  1BR1 A;  2QUP A;  2W4M A;  2NG1 A;  4IGG A;  1JRA A;  4J30 B;  4RDA A;  3NYM A;  4ZLC A;  3JYH A;  1OKK A;  1M2V A;  2WVN A;  3H2V A;  3LLI A;  5DS5 A;  4OIO F;  2QE9 A;  3H2U A;  3OEO A;  4OIQ F;  4AL1 A;  3EGD A;  3MFN A;  5JP7 A;  3RIP A;  4MVU A;  4FAP B;  3IQC A;  4BJ6 A;  1TFO B;  3AG3 C;  2OEX A;  2WL8 A;  2ICW G;  5HV9 A;  1H7I A;  3NKE A;  1G5Z A;  5KYY A;  3DAF A;  2AU5 A;  3LNM B;  2DB4 A;  4DVY P;  1MNE A;  4YWQ A;  1V55 C;  3NYJ A;  3RVZ A;  5BQH A;  1FNT c;  1HW2 A;  1TWA A;  2XLV A;  4O6N A;  3T6G B;  4ULV A;  4CSA A;  1OCZ C;  2VCA A;  4PAC A;  2XS8 A;  2NSG A;  1ZW2 A;  1VYI A;  2IBF A;  2JX0 A;  4O7G A;  3LES A;  1YAR O;  2NPU A;  3ATP A;  1BR4 A;  2P6V A;  3MYI A;  1BR2 A;  1ZHZ A;  2B0J A;  4AL0 A;  1Q0G A;  4QI2 A;  4X0R A;  1R5I D;  3C8G A;  1T6Q A;  4BJT A;  1Z5Z A;  5A6B A;  2OG2 A;  3BRJ A;  1ZHY A;  2J7P D;  5KYU A;  4IRU A;  4DXW A;  3KYI A;  3SXZ A;  3ZC4 A;  2R7R A;  2Z15 A;  2IXM A;  4CSA C;  2OQM A;  3VYW A;  1TWC A;  3DJN B;  1D1B A;  3Q6M A;  2XL4 A;  1TR2 A;  4C7O A;  3EHM A;  5JRA A;  4PJJ A;  3RH3 A;  1L7C A;  1K05 A;  1QQ3 A;  3ABL C;  3RQG A;  3M4C A;  1QLE C;  1NFN A;  1UG7 A;  3LEV A;  5COM A;  4JEB A;  3PMR A;  2BL2 A;  2HJM A;  4NTB A;  3TK0 A;  1S05 A;  2ETS A;  3PCV A;  3Q7G A;  1OW7 A;  5KYW A;  2CYD A;  3DZA A;  4NC3 A;  4OIN F;  1V74 B;  1U6H A;  2YLD A;  3M1C B;  5F5H A;  5L3V A;  4CS9 C;  5DS4 A;  1T6I A;  2R7X A;  2R7O A;  2XLE A;  1MND A;  3C8Z A;  2XLH A;  1JAF A;  4MVZ A;  3JZ0 A;  4DRI B;  4E17 A;  3US6 A;  5JLI A;  2TMV P;  1IZM A;  2V3C C;  3B29 A;  4JUR I;  1C17 M;  1M2V B;  1GQA A;  3QVZ A;  2D5R B;  2J45 A;  3L34 A;  1HE9 A;  3N0T A;  1LI5 A;  5JT4 A;  2RSE B;  3QZC A;  4DJ9 A;  3UMH A;  3EG9 B;  4B6I A;  3EHN A;  1A41 A;  1Q0M A;  1D0Y A;  5T1D B;  3IHU A;  3SEO A;  2YL7 A;  2YL1 A;  2G3K A;  4DRJ B;  4PR9 A;  2XLM A;  4MVR A;  3QVY A;  1QKR A;  5D91 A;  4IAR A;  2L7A A;  2ZXR A;  4W8P A;  2JPU A;  2R7V A;  2Y3H A;  4BJ5 A;  4LLC A;  1ZVZ A;  1FFH A;  1HW1 A;  2OKU A;  4XQ1 A;  2P7V A;  5L0J A;  4U5H A;  3C7J A;  3T9O A;  4AX2 A;  2QY9 A;  4KNW A;  3QW1 A;  2J9W A;  3LS0 A;  3ZTM A;  2J0X A;  4Z9I A;  4JJG A;  3I4U A;  4WJ0 A;  4AE4 A;  1RCP A;  1YYX A;  1OR3 A;  1NFO A;  2XL6 A;  1NU7 D;  4NTF A;  1U89 A;  2WVO A;  3AQC A;  1FMW A;  4EHP A;  4JW1 A;  1WGW A;  3OWT A;  2L81 A;  1NSG B;  4XPY A;  3NMJ A;  4ONS A;  4E18 A;  2C04 A;  3U9J A;  3UGO A;  1ZU4 A;  256B A;  2NUT B;  1DOW A;  1OCO C;  4IB4 A;  3FMS A;  3EH1 A;  1D1C A;  5CIV A;  1RKE B;  4LLE A;  3PHF 2;  2L9J A;  1QSP A;  2DI3 A;  2Q00 A;  3B0V C;  2A0B A;  3TOL A;  4DRH B;  2XM0 A;  4Q7C A;  2R7U A;  3K6B A;  4ER9 A;  3AGU A;  2PX3 A;  1VOM A;  4FX5 A;  3Q6N A;  1MQV A;  2XL8 A;  1NLX A;  2W45 A;  3K1H A;  3O39 A;  3ASO C;  1F1M A;  2MYS A;  1XZP A;  1SF8 A;  4P9F A;  5B1A C;  2OU6 A;  4EBB A;  4DBQ A;  1FR0 A;  2XM4 A;  4U5G A;  2LIG A;  2A68 F;  3O10 A;  3MYF A;  3GAN A;  4IJJ A;  1BDJ B;  4N06 A;  3ZQV A;  3C8G B;  4KNV A;  2OEV A;  1SZI A;  2LSE A;  2Y39 A;  1TFK B;  2ASR A;  3OA1 A;  3K1I A;  1MMA A;  1VK5 A;  1ZHW A;  2HSB A;  2WB7 A;  1U0B B;  2KC3 A;  4H54 A;  3SXY A;  1H9T A;  1QPU A;  3EGX A;  2H7O A;  1WWP A;  2AP3 A;  1LI7 A;  2QTV A;  4N4W A;  3W2V A;  2PFD A;  3K7D A;  5EK0 A;  2R05 A;  4CS8 A;  5F5F A;  2H8A A;  2XLO A;  5EHH A;  2IOQ A;  2ZPA A;  3S0X A;  3FHD A;  4WGZ A;  1GM5 A;  3JRM O;  1YZA A;  2R02 A;  1TWG A;  2YL3 A;  2R7W A;  3JSE O;  5FZT A;  1HY5 A;  2GAQ A;  1OCC C;  4JIO A;  1E86 A;  2PX0 A;  2G3V A;  3LAY A;  2O9X A;  1RKE A;  1ZYR F;  1MMG A;  1RJ9 B;  2AWC A;  2C03 A;  1ZHX A;  3TUL A;  3V5Z A;  2YQY A;  4O79 A;  3GM3 A;  1Z63 A;  2R7S A;  3UR3 C;  1HMD A;  4IAO A;  5A6B D;  2DGJ A;  5F28 E;  3U2L A;  3MLG A;  1BZ4 A;  3JRT A;  1T6U A;  2CDQ A;  2IXN A;  4YJW A;  1SYQ A;  1E2X A;  2XXA A;  3I5Q A;  5A6A A;  2NUP A;  3HNL A;  3KH2 A;  2D4U A;  2HMQ A;  3C18 A;  5COF A;  2VAS A;  1YA9 A;  4BJ6 C;  4E0H A;  2NUT A;  4QDL A;  2J7P A;  2P1A A;  3LS1 A;  3T6J A;  3TJ6 A;  3GWN A;  3QMK A;  2AVK A;  2DYS C;  3FOP A;  1Z6A A;  1I4Y A;  3KMI A;  3C8G D;  3CEX A;  3N24 A;  1N1C A;  4JCH A;  2CNW D;  1OXB A;  3GEH A;  3V5Y A;  3AG1 C;  1A7E A;  3HNJ A;  4JJF A;  1JR8 A;  3SP1 A;  4KBL A;  4EWC A;  4CIP A;  1M56 C;  1M57 C;  4XPW A; 
#chains in the Genus database with same CATH homology
 3E9V A;  4CS9 A;  4U5B E;  1NG1 A;  2EIL C;  2V26 A;  3JT1 A;  3DD7 A;  2YHS A;  4RBN A;  4M63 A;  5E2Q A;  3EJN A;  2HV6 A;  4H4K C;  4DBR A;  3MX3 A;  3HJC A;  2H7V C;  4YT8 A;  1D1A A;  1RJ9 A;  2PF4 E;  3FDQ A;  2Q3T A;  4J32 B;  2H7B A;  2A1D D;  2Q9C A;  3UMK A;  3DAG A;  3EQL F;  3UMI A;  2WZL A;  1S7Z A;  3E70 C;  3L0I A;  1FMV A;  1OKK D;  3AG4 C;  2NUP B;  3EFO A;  5CI9 A;  5IY5 C;  3V7O A;  2CNW A;  4U5D E;  3ASN C;  3UNG C;  5EGY A;  1NU9 C;  4K0D A;  1VMA A;  4CS8 C;  2G62 A;  4PJL A;  3IEE A;  4O6Y A;  4QI0 A;  3CQZ A;  3NYL A;  3I5P A;  2W9Y A;  3LJB A;  3DJU B;  3GOD A;  2XXA B;  3KKB A;  1W2W A;  3LLK A;  1FTS A;  3JCU Q;  2WZG A;  4U5E E;  3ZSU A;  4GYT A;  4MQ9 F;  3UGP A;  3KL4 A;  5T3T A;  4E7Z A;  5KYY B;  4G7O F;  2I8B A;  2OCC C;  2IXO A;  4OD5 A;  3EGD B;  3Q7L A;  1G8X A;  2EIN C;  3LNR A;  2KQ9 A;  2X51 A;  5DS6 A;  3JSZ A;  2JD3 A;  4OD4 A;  3K33 A;  4KI2 A;  2IYL D;  4LER A;  3B0P A;  2YZS A;  3K66 A;  4FES A;  3S29 A;  2CGE A;  2WZF A;  3DXJ F;  5CI8 A;  3SZR A;  1TWH A;  4JZA A;  3DM5 A;  3HLZ A;  3X2Q C;  4ANJ A;  3W8I A;  3B9Q A;  2Y3D A;  2ZXP A;  3H65 A;  1KU2 A;  4HEA J;  2HV7 A;  3X1O A;  1V54 C;  2Q9B A;  3O6X A;  2VH3 A;  5L3Q A;  4YT4 A;  1ZU5 A;  4OIR F;  4BG0 A;  2MWQ A;  3HTK C;  2WVQ A;  2BE5 F;  2XRH A;  1ZHT A;  4Q5S F;  4CIH A;  1JPJ A;  3AG2 C;  2GFH A;  4PJM A;  4C7O B;  3ITF A;  3RFY A;  3DM9 B;  1TKN A;  3NG1 A;  2XSE A;  4O6M A;  4K7B A;  5BUO A;  2E87 A;  1MMD A;  4HE8 D;  4DOZ A;  2YEV A;  3POV A;  2J0W A;  1PCX A;  5KYW B;  2KNH A;  4CS7 A;  1D0Z A;  3SNH A;  2IXP A;  3EGX B;  3CSK A;  4DVZ A;  4HFK B;  1MMN A;  5FCL A;  4IWB A;  4KC9 A;  1NZE A;  3RKO F;  2W4B A;  2EIM C;  2A6H F;  2A6E F;  4PK4 A;  3CZ6 A;  2M4E A;  3EPV A;  1IW7 F;  2ZXW C;  2Y3B A;  3AQB A;  1M2O A;  3ABM C;  4Q4Z F;  4AK9 A;  2A69 F;  4XLN F;  4XTK A;  2EIJ C;  1PD0 A;  4C3B A;  4I1M A;  4P6I C;  5KYX A;  4PFO A;  4U5C E;  4I3M A;  2DYR C;  3T4R A;  5T3W A;  3W8H A;  1LVK A;  4MND A;  1O87 A;  4PFP A;  1JPN A;  4GEH A;  2J9V A;  3WOD F;  3T6B A;  2J46 A;  4ULW A;  4C3E A;  3SYN A;  3NKD A;  3RYL A;  3F47 A;  2VB6 A;  4I44 A;  4I1O B;  4BJ1 A;  4XLP F;  1LKX A;  4CBE A;  5KYN A;  4W8K A;  3EG9 A;  4E7S A;  4OIP F;  5E33 A;  3K1I C;  1SMY F;  4FWV A;  1J8Y F;  4PJN A;  4AE4 B;  3ZG1 A;  3EZI A;  5B1B C;  2ZXO A;  1O5H A;  2EIK C;  4C3D A;  2KJG A;  2FFH A;  4LAC B;  5KYX B;  4U5F E;  5DLJ A;  1Z3I X;  3NDB B;  4YT5 A;  3DMD A;  1Z23 A;  2R7Q A;  5E3C A;  1ST6 A;  4HFF B;  3EFO B;  4F4B A;  3N2Z B;  4A2N B;  4JVS A;  2J9U A;  1LS1 A;  3TD7 A;  1QZX A;  2FGY A;  2KGO A;  2CW0 F;  2PP4 A;  3ZVR A;  4BEJ A;  1PD1 A;  4NY3 A;  3VAY A;  1OCR C;  5KYU B;  5DQZ A;  2Q9A A;  1VYK A;  1J8M F;  4XWJ A;  4ZLD A;  5DQT A;  1D0X A;  3ECS A;  3FVY A;  5HSW A;  3ABK C;  3EH2 A;  4G7Z F;  3S27 A;  2R7T A;  1FFT C;  4BJ5 C;  5DVW A;  5E3A A;  4G0H A;  3FAJ A;  5B3S C;  5D92 A;  3W2W A;  3S28 A;  4RD9 A;  4YN0 B;  4G7H F;  2Y3G A;  2KW3 C;  3NRH A;  2Y69 C;  3WG7 C;  4YT2 A;  3EZH A;  3F46 A;  3B0U X;  1BR1 A;  2W4M A;  2NG1 A;  4J30 B;  4RDA A;  3NYM A;  4ZLC A;  3JYH A;  1OKK A;  1M2V A;  2WVN A;  3LLI A;  5DS5 A;  4OIO F;  3OEO A;  4OIQ F;  3EGD A;  3RIP A;  4BJ6 A;  3AG3 C;  2WL8 A;  3NKE A;  5KYY A;  3DAF A;  4DVY P;  1MNE A;  4YWQ A;  1V55 C;  3NYJ A;  1TWA A;  4O6N A;  4CSA A;  1OCZ C;  1VYI A;  4O7G A;  3LES A;  1BR4 A;  2P6V A;  1BR2 A;  1ZHZ A;  2B0J A;  4QI2 A;  4X0R A;  4BJT A;  1Z5Z A;  2OG2 A;  1ZHY A;  2J7P D;  5KYU A;  4IRU A;  3ZC4 A;  2R7R A;  2Z15 A;  2IXM A;  4CSA C;  3VYW A;  1TWC A;  3DJN B;  1D1B A;  3Q6M A;  2XL4 A;  1TR2 A;  4C7O A;  3EHM A;  4PJJ A;  3RH3 A;  3ABL C;  1QLE C;  3LEV A;  3PHF 2;  3PMR A;  3Q7G A;  5KYW A;  3DZA A;  4OIN F;  3M1C B;  5F5H A;  5L3V A;  4CS9 C;  5DS4 A;  2R7X A;  2R7O A;  1MND A;  2V3C C;  1IZM A;  4JUR I;  1M2V B;  2D5R B;  2J45 A;  3L34 A;  3N0T A;  3QZC A;  3UMH A;  3EG9 B;  4B6I A;  3EHN A;  5T1D B;  1D0Y A;  3SEO A;  2G3K A;  5D91 A;  2R7V A;  2ZXR A;  2Y3H A;  4BJ5 A;  4LLC A;  1FFH A;  2P7V A;  4U5H A;  4AX2 A;  2QY9 A;  4KNW A;  2J9W A;  3LS0 A;  2J0X A;  4JJG A;  3I4U A;  4WJ0 A;  4AE4 A;  1NU7 D;  2WVO A;  3AQC A;  1FMW A;  4JW1 A;  1WGW A;  3OWT A;  2L81 A;  2C04 A;  3UGO A;  1ZU4 A;  2NUT B;  1OCO C;  3EH1 A;  1D1C A;  4LLE A;  2L9J A;  3B0V C;  4Q7C A;  2R7U A;  3K6B A;  2PX3 A;  1VOM A;  4FX5 A;  3Q6N A;  2W45 A;  3K1H A;  3O39 A;  3ASO C;  2MYS A;  4EBB A;  1SF8 A;  5B1A C;  4DBQ A;  4U5G A;  2A68 F;  3GAN A;  4IJJ A;  4N06 A;  4KNV A;  1SZI A;  2LSE A;  2Y39 A;  3OA1 A;  1MMA A;  1VK5 A;  1ZHW A;  2WB7 A;  3EGX A;  2H7O A;  2QTV A;  3W2V A;  4CS8 A;  2PFD A;  3K7D A;  5F5F A;  5EHH A;  2IOQ A;  2ZPA A;  3S0X A;  3FHD A;  1TWG A;  2R7W A;  1OCC C;  2PX0 A;  2G3V A;  3LAY A;  2O9X A;  1ZYR F;  1MMG A;  1RJ9 B;  2C03 A;  1ZHX A;  4O79 A;  1Z63 A;  2R7S A;  3UR3 C;  4IAO A;  2DGJ A;  3MLG A;  3JRT A;  2CDQ A;  2IXN A;  4YJW A;  2XXA A;  3I5Q A;  2NUP A;  3KH2 A;  2VAS A;  4BJ6 C;  2NUT A;  4QDL A;  2J7P A;  3LS1 A;  3T6J A;  3QMK A;  3ZIB A;  2DYS C;  1Z6A A;  3KMI A;  3N24 A;  4JCH A;  1N1C A;  2CNW D;  3AG1 C;  4JJF A;  3SP1 A;  4KBL A;  4EWC A;  1M56 C;  1M57 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...