3K1IC

Crystal strcture of flis-hp1076 complex in h. pylori
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
119
structure length
119
Chain Sequence
QQIAKFSRDMKNINESVGALQVLQIACKKLFNKSMGLEDKDALQASIIKQELREIVENCQFLASPLFDTQLNIAINDEIFSMIVVNPLDLLENVGEFQAYLEEKLNEIKELLGYLSESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar protein
publication title Molecular interaction of flagellar export chaperone FliS and cochaperone HP1076 in Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Chaperone
total genus 40
structure length 119
sequence length 119
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16522 FliS_cochap Flagellar FLiS export co-chaperone, HP1076
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1890 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3k1iC00
3K1IC 3K1HA
chains in the Genus database with same CATH superfamily
2HSBA 1A7DA 4JTDB 3VF0A 4H54A 4NCQA 1CPQA 2OEXA 2R03A 3K1IC 4XPWA 4Q5SF 1EA8A 2Q9CA 3HLZA 3M15A 4N4WA 2JD3A 4XTKA 1AVOB 5DVWA 2M64A 3SXMA 1SMYF 1VYIA 2IXMA 2NPUA 1D0ZA 3G4ZA 1M2OA 3TJ5A 1U0BB 4YT4A 2E87A 5A6JA 2Q9AA 1TFOB 2ZXWC 4XPXA 1Z7Qc 3S28A 1L3PA 2PX3A 2MHRA 3RW0A 1FAPB 4BJ5C 3GM3A 3GEEA 1TWCA 3RQGA 2NSFA 1LM3B 5A6KA 4YT5A 3F46A 4DXWA 4G7ZF 1D0XA 3I5PA 3FXHA 2EIMC 3B71A 4JJFA 4ONSA 3DAFA 1EQ1A 1QQ3A 5L0FA 3KYIA 2HFIA 3PHF2 3EG9B 1Z6AA 3WG7C 3QMKA 4JRZA 1D0YA 2D5RB 1VMAA 2XLHA 2RD9A 5COFA 4MQ9F 4BJ5A 5F5HA 1HE1A 1QZXA 3DD7A 4JJGA 4JVSA 4CJOA 4DVYP 3M79A 1QPUA 1XZQA 3JYYA 5COMA 1MMDA 2JX0A 3LLKA 3T4RA 4DRIB 4QI2A 1LIHA 3O39A 5A69A 3ABMC 4CIPA 3EZIA 2ZD9A 4WGYA 1GM5A 1A41A 3NMJA 3Q6MA 4LDKA 3PMRA 2XLWA 1E83A 3U2LA 1SF8A 1TFKB 1ORSC 1E84A 3S0XA 3IQCA 4YN0B 4PJJA 3RVZA 2IYLD 1Z23A 3N2ZB 3FVYA 3GM1A 2OCCC 3KPHA 3EGXB 2HSQA 1OW8A 2QNLA 2J9BA 4W8KA 2OJQA 4LDRA 3C18A 1T9KA 4BJ1A 3GM2A 4HFFB 4EIYA 2XLMA 3C8GB 3L1MA 3UR3C 2LIGA 5KYYA 2PF4E 4Z9JA 1JOGA 3B9QA 3S9OA 2I15A 1O87A 1QKRA 3J06A 2WVOA 1F1MA 1LS4A 5IY5C 3LLIA 1H7IA 2WVNA 5KYUB 3U0CA 3EH1A 4K7BA 4MNDA 3WODF 3JZ0A 3GORA 3K7DA 1R5ID 3EGDB 1TWHA 3DWWA 2NUPB 2WB7A 4FWVA 3SYNA 3O55A 2NG1A 4C3DA 5L3QA 4CS9C 2YL3A 2HZ8A 3K6BA 2MYSA 3V7OA 5BQIA 5DS4A 2R7SA 3ZQVA 3IEEA 4MVRA 2L7AA 3LUTB 4K1OA 1MQVA 1YDIA 1VB5A 1ZHWA 1TKNA 5L3VA 3R7CA 1OXKA 3S29A 1WASA 3EZHA 4XEVA 1ZHTA 4PK4A 4FX5A 4J32B 2XL4A 1LI7A 4I44A 4U5BE 4MVZA 4G7HF 3I5QA 4D4NA 1V4AA 1M2VB 4I1OB 1CGME 3EQLF 1NFOA 1IZMA 4Q7CA 3RFYA 1OXBA 2YHSA 3U8PA 2A0BA 4XEKA 2IOQA 1ZW2A 5T3TA 3U3BA 3L0IA 1O5HA 4KNVA 1RJ9B 4YJWA 4MVSA 2J46A 3JSEO 1A0BA 4JEAA 2GDCA 1VYKA 4OINF 2P6VA 4E0HA 3LEVA 1HY5A 2CYDA 5L0IA 4N6HA 5GPGB 4HEAJ 2O9XA 3DKAA 1WN0A 3MX3A 2HV7A 3X1OA 4OIQF 3AG4C 4EWCA 3M4CA 3GANA 2LQGA 1AEPA 3RH3A 4CDAA 2YZSA 2UUHA 5JP7A 3U5SA 1T5OA 2W4BA 3RVYA 4CS7A 2IXNA 2ASRA 3AGTA 4HE8D 5B1BC 1KNYA 5KYWA 4XWJA 4P9FA 4YWQA 3N24A 3AJMA 3DZAA 3GEIA 3GEHA 2Y39A 2J45A 4JCHA 1E85A 3ASOC 3FDQA 2G62A 3C8GD 3FOOA 1PCXA 3MLGA 2ICWG 3EG9A 1C17M 2LFFA 1HW1A 2Y3BA 3HTKC 5L0GA 2VH3A 5JUAA 1BDJB 2EPOA 2P7VA 1D1AA 2ETSA 2R05A 3KH2A 4G0HA 1JAFA 2KYHA 4CS8A 4XPYA 1ZW3A 1MMNA 5F5FA 2YL1A 2IBFA 4MW8A 4ULVA 3RKOF 2M4EA 4E7ZA 1VTMP 2RSEB 2YLGA 3LNRA 3QTHA 1ZU5A 3MBGA 4IAQA 1T6IA 4EKWA 3ZG1A 2EPKX 2J9WA 4C3BA 4OIRF 4FESA 4DBRA 1LS1A 5E33A 2A6HF 1YARO 2R02A 4RD9A 3V5ZA 3NKEA 1WTYA 1N1CA 2YL0A 2J0WA 1H9GA 3A11A 4I3MA 1M56C 2NUTB 4NTFA 3SXYA 2YWAA 3CSKA 2EILC 1MNEA 4X0RA 3SP1A 3AG2C 2EPMX 3W2WA 2XLEA 2QE9A 2QTVA 2XSEA 1YA9A 3EGXA 3HNJA 4KC9A 3S27A 3H2VA 1CGNA 5AGFA 4E17A 2YKZA 4PJLA 1XZPA 1YZCA 1MMGA 3C8GA 1LE2A 2KK1A 5DLJA 1QSPA 2XM0A 1PD0A 5CI9A 4YL3A 2AWYA 3FAJA 5JSLA 1A7VA 3K1IA 4MTGA 3KL4A 1C02A 1G8XA 2KSFA 3AQCA 4IARA 5JT4A 5KYWB 2DB4A 2HJ3A 5KYUA 2IXPA 3RF3A 4W8PA 5JRAA 2YVKA 3PDMP 2KW3C 2LSEA 1UFBA 2DI3A 1SYQA 2P0NA 1R4TA 1IW7F 2YLDA 3EGDA 4BJ6C 4YT2A 2NUPA 2XXAB 2HKVA 2OU6A 3EHNA 4PJNA 2CGEA 3VM6A 3JT1A 4CJGA 2W9YA 4BEMJ 3A9CA 4IRUA 2XRHA 1LVKA 3FMSA 3JCUQ 4U5HA 4U5CE 5FZTA 4GQHA 2HMQA 2WZFA 4U5DE 2VCBA 2YRFA 2G3KA 3C63A 4U9DA 5E3AA 4YL0A 4AL0A 1NU9C 4BJTA 1YZAA 1J8YF 2XL8A 3UMIA 1QLEC 4J30B 4ZLCA 1HW2A 1V55C 1KU2A 3LAYA 5BQGA 4KBLA 1M2VA 3K33A 3ECSA 1EKYA 4GYTA 4PR9A 2GAQA 3BRJA 1TWGA 3ATPA 3K66A 3O6XA 1NLXA 1RJ9A 3NKDA 2AVKA 4UDVA 1VOMA 1RKCA 2Q4FA 4LLCA 1RMVA 4G78A 4NTBA 3SZRA 1V74B 3U9JA 3LESA 4N06A 2LK4A 2HUJA 3OWTA 5B1AC 3N0TA 4U9EA 3ZSUA 4N6CA 2J0XA 1MMAA 2BC5A 4MVOA 2MWQA 4WJ0A 4AE4B 4ANJA 3TJ6A 1JPJA 3AG3C 4EUKB 4O6MA 3PCVA 3ZTMA 1E86A 3JTLO 4U5GA 4BPMA 2A1DD 2CDQA 2D4UA 5COGA 5EHHA 1QVXA 1NZEA 1Q0DA 3M4BA 5HV9A 4DOZA 2DGJA 4ER9A 2TMVP 1TR2A 4E0IA 3T6BA 4XQ1A 2KJGA 4PJMA 3DM5A 1H6GA 4QDLA 4LACB 4CSAC 1GGQA 2ZXRA 1ZHZA 2DYSC 4MW3A 2FFHA 3AOUA 3NYJA 4XLPF 1FR0A 1GQAA 3TOMA 3DXJF 4JZAA 3UNGC 5E2QA 4AK9A 3GWLA 2WZLA 1RXQA 4CS9A 2P1AA 2Q3TA 3ZTZA 2IM8A 2VCAA 3L8JA 3GWNA 5HSWA 1O3UA 3AG1C 2V26A 4LERA 3NDBB 1VLSA 2UUIA 2W45A 4DVZA 3HKKA 3JRTA 4XLNF 2YLIA 3HNLA 4PACA 3SXZA 3W8IA 3ZWIA 2NUTA 3LNMB 4RDAA 3ZIBA 3LS1A 1CPRA 1Y4CA 3HJCA 3UGOA 1YLMA 1DOWA 4J7YA 3X2QC 2R7XA 5D92A 2KC3A 3CAXA 3BEHA 4BEJA 5B3SC 1FNTc 3C8ZA 3LS0A 1H9TA 1ORJA 3H2UA 2A68F 3KMIA 2X0CA 1BBHA 1Z63A 1FFTC 3G4XA 3R2PA 1NSGB 2LFDA 3NYMA 4QI0A 3RIPA 3IQ6A 5CI8A 3K1HA 5L0HA 1T01A 2G3VA 1ZU4A 2LP4A 2R7UA 4MVQA 1I4ZA 1PV3A 2Q00A 3O10A 1Z3IX 5DQZA 4O6YA 2J9UA 2XXAA 3T9OA 3E9VA 2HS5A 2WL8A 2GFHA 1I4YA 2R25A 1XWJA 3L8IA 4L6RA 2HMZA 2L6HA 3ASNC 4IAOA 4PFPA 2H8AA 2ZPAA 1M6TA 5KYNA 1K04A 3MYFA 3TOLA 1J8MF 3VYWA 4DJ9A 4MS2A 4MVUA 2OG2A 4NC3A 2GA0A 5L0DA 4E7SA 4C7OB 3DJUB 3U9MA 3NMKA 2R7WA 4IWBA 3LEOA 3DE9A 3QW0A 4YT8A 2ZXPA 2JPUA 2XM4A 3EPVA 5K0IA 3MYIA 5BUOA 1A7EA 1OW6A 3T6GB 1E2XA 2WZGA 4MTOA 2NSGA 1BR4A 3KYJA 1WATA 4U5FE 3ZQYA 4JC7A 2Q9BA 3T6JA 1NU7D 4M63A 3EFOB 4LDQA 4U5EE 4CDYA 1Q0FA 2R7VA 2VCCA 3L34A 4PFOA 3TK0A 5AC4A 4OD5A 3ABLC 4YL1A 3TD7A 1Q0GA 4AE4A 4H4KC 2QLAA 1D1BA 2XLDA 3WHNA 4B6IA 1Z5ZA 3FAPB 5JLIA 2OQMA 2KNHA 1RKEB 2Y3GA 3NYLA 4JTCB 5A6AA 3F47A 2CCYA 4IGGA 1OQCA 1TWAA 4JCZA 4NY3A 5DQTA 3DAGA 2FGYA 2H7VC 4F4BA 2VC9A 3OEOA 4NQFA 2OOCA 1OCCC 2EPLX 3QVZA 2L6GA 2EIJC 4NTAA 3W2VA 3POVA 1FFHA 3ABKC 2EIKC 4AL1A 3TULA 4MVMA 3W8HA 3U2MA 4O79A 3DI5A 4AX2A 4BJ6A 2W4MA 3KKBA 3Q7GA 1MNDA 1FMWA 1YA7O 2AU5A 4IB4A 2YQYA 5F28E 5L0JA 2H7BA 1HMDA 1YYXA 4CX9A 3C62A 2VASA 2WVQA 1YJGA 5T3WA 1LPEA 1L7CA 1CGOA 4WGZA 4RBNA 2R9RB 3CQZA 5TJ5E 3E70C 2CNWD 1U6HA 4EHPA 3I4UA 3FHDA 1WOLA 3TQOA 2AWCA 2Z15A 3IHUA 3V5XA 1W2WA 3B0PA 2R7TA 2X51A 1ST6A 3FOPA 2FAPB 3DE8A 3SNHA 3M1CB 1Y6DA 2J7PD 2B0HA 4GEHA 1G4WR 1APCA 2PBEA 4O7GA 2CW0F 1ZZPA 3SEOA 5BQHA 256BA 5CIVA 1G5ZA 2OEVA 3DMDA 1EI7A 2KGOA 3H65A 2I8BA 2PNOA 3B0UX 1OW7A 3US6A 2Y3HA 3EHMA 5EK0A 3JSZA 2BE5F 3U3FA 1C03A 1BR1A 2AP3A 2DYRC 2ZXOA 4DRJB 2EINC 2LCHA 3OA1A 3RQFA 3HNKA 3RYLA 2XS1A 1VLTA 2HV6A 1FMVA 3IQTA 4A2NB 2H7OA 4XEFA 4JIOA 4OD4A 3ITFA 3UMKA 2YEVA 3RQEA 3Q7LA 5EGYA 2V3CC 3S90A 4WABA 3VRCA 5KYXA 1OKKD 1BZ4A 2C03A 2CNWA 4A4AA 4OIPF 4C3EA 3B29A 1OR2A 1K40A 5B3IA 1OR3A 3WAQA 1YAUO 4J7TA 2B0JA 3NG1A 4KI2A 2PX0A 4OIOF 3CEXA 4CBEA 1S7ZA 2J7PA 2OJED 1YYJA 2IXOA 3S84A 4C7OA 1LKXA 3JYHA 1ZVZA 3EJNA 2P61A 1JR8A 1NG1A 3G50A 4CSAA 3QW1A 1BR2A 5A6BD 4YK5A 4Q4ZF 3CZ6A 1TQGA 2J9VA 4K0DA 5E3CA 1M57C 1B68A 2EPNA 1DOVA 3VAYA 4DBQA 2C04A 1Q0KA 3UMHA 3B0VC 4P6IC 4IJJA 4HFKB 1Q0MA 3DJNB 3C7JA 3QVYA 2PP4A 3QZCA 3EFOA 2A69F 3SXKA 2XS8A 1YVIA 4BG0A 5L0CA 4EBBA 3IQ5A 1NFNA 1HE9A 1OKKA 1WWPA 1RCPA 2XLVA 3EH2A 1V54C 1ZHYA 2HJMA 2L6FA 1LE4A 3AQBA 4P9TA 5D91A 4EBKA 5AC5A 2BL2A 1G4US 2A6EF 4I1MA 5KYYB 1S05A 2L9JA 5JVEA 5JS5A 1RKEA 2J8WA 3ZDLA 1LI5A 5FCLA 1ZYRF 4JW1A 3NRHA 4Z9IA 1HMOA 1OCZC 1ORYA 1VK5A 1ZHXA 2QUPA 1AUEA 2YL7A 4E18A 5KYXB 3NMIA 4JTAB 3AGUA 2PFDA 4JKVA 1UG7A 2GWWA 1FTSA 4FAPB 5A6BA 2F22A 4R32A 4CS8C 2A0UA 3IPMO 1K05A 2Q7RA 1SZIA 5DS5A 1SR2A 3Q6NA 4CIHA 2R7OA 4JURI 4G7OF 2L81A 1U89A 3DM9B 1NBBA 3JRMO 2Y69C 1JPNA 2KQ9A 2XLOA 2OKUA 2VB6A 3ZC4A 5DS6A 1D1CA 1I5NA 4DRHB 2XL6A 2R7RA 1KTMA 4JEBA 3MFNA 1JRAA 1T6QA 3LJBA 1PD1A 4CDVA 3UGPA 2Y3DA 1OCRC 3GODA 2R7QA 3HNIA 4MTFA 1GS9A 5T1DB 4Z9HA 3U8VA 4JE9A 3W4YA 1T6UA 4D4XA 1OCOC 4LLEA 1WGWA 2QY9A 1JMWA 4ZLDA 3ZVRA 3V5YA 4ULWA 4O6NA 4EBJA 2LD6A 4KNWA
chains in the Genus database with same CATH topology
4Q5SF 3K1IC 2Q9CA 3HLZA 2JD3A 4XTKA 5DVWA 1SMYF 1VYIA 2IXMA 1D0ZA 1M2OA 4YT4A 2E87A 2Q9AA 2ZXWC 3S28A 2PX3A 4BJ5C 1TWCA 4YT5A 3F46A 4G7ZF 1D0XA 3I5PA 2EIMC 4JJFA 3DAFA 3PHF2 3EG9B 1Z6AA 3WG7C 3QMKA 1D0YA 2D5RB 1VMAA 4MQ9F 4BJ5A 5F5HA 1QZXA 3DD7A 4JJGA 4JVSA 4DVYP 1MMDA 3LLKA 3T4RA 4QI2A 3O39A 3ABMC 3EZIA 3Q6MA 3PMRA 3S0XA 1SF8A 4YN0B 4PJJA 2IYLD 1Z23A 3N2ZB 3FVYA 2OCCC 3EGXB 4W8KA 4BJ1A 4HFFB 3UR3C 5KYYA 2PF4E 3B9QA 1O87A 2WVOA 5IY5C 3LLIA 2WVNA 5KYUB 3EH1A 4K7BA 4MNDA 3WODF 3K7DA 3EGDB 1TWHA 2NUPB 2WB7A 4FWVA 3SYNA 4C3DA 2NG1A 5L3QA 4CS9C 3K6BA 2MYSA 3V7OA 5DS4A 2R7SA 3IEEA 1ZHWA 1TKNA 5L3VA 3S29A 3EZHA 1ZHTA 4PK4A 4FX5A 4J32B 2XL4A 4I44A 4U5BE 4G7HF 3I5QA 1M2VB 4I1OB 3EQLF 1IZMA 4Q7CA 3RFYA 2YHSA 2IOQA 3L0IA 1O5HA 4KNVA 1RJ9B 4YJWA 2J46A 1VYKA 4OINF 2P6VA 3LEVA 4HEAJ 2O9XA 4OIQF 3MX3A 2HV7A 3X1OA 3AG4C 4EWCA 3GANA 3RH3A 2YZSA 2W4BA 4CS7A 2IXNA 5B1BC 4HE8D 5KYWA 4XWJA 4YWQA 3N24A 3DZAA 4JCHA 2Y39A 2J45A 3FDQA 3ASOC 2G62A 3MLGA 1PCXA 3EG9A 2Y3BA 3HTKC 2VH3A 2P7VA 1D1AA 4G0HA 3KH2A 4CS8A 1MMNA 5F5FA 3RKOF 2M4EA 4E7ZA 3LNRA 1ZU5A 3ZG1A 2J9WA 4C3BA 4OIRF 4FESA 4DBRA 1LS1A 5E33A 2A6HF 4RD9A 3NKEA 1N1CA 2J0WA 4I3MA 1M56C 2NUTB 3CSKA 2EILC 1MNEA 4X0RA 3SP1A 3AG2C 3W2WA 2XSEA 2QTVA 3EGXA 4KC9A 3S27A 4PJLA 1MMGA 5DLJA 5CI9A 1PD0A 3FAJA 3KL4A 3AQCA 1G8XA 5KYWB 5KYUA 2IXPA 2KW3C 2LSEA 1IW7F 3EGDA 4BJ6C 4YT2A 2NUPA 2XXAB 3EHNA 4PJNA 2CGEA 3JT1A 2W9YA 4IRUA 2XRHA 1LVKA 3JCUQ 4U5CE 4U5HA 2WZFA 4U5DE 2G3KA 5E3AA 1NU9C 4BJTA 1J8YF 3UMIA 1QLEC 4J30B 4ZLCA 1V55C 1KU2A 3LAYA 4KBLA 1M2VA 3K33A 3ECSA 4GYTA 1TWGA 3K66A 3O6XA 1RJ9A 3NKDA 1VOMA 4LLCA 3SZRA 3UMHA 3LESA 4N06A 5B1AC 3OWTA 3ZSUA 3N0TA 2J0XA 1MMAA 4WJ0A 2MWQA 4AE4B 4ANJA 1JPJA 3AG3C 4O6MA 4U5GA 2A1DD 2CDQA 5EHHA 1NZEA 4DOZA 2DGJA 1TR2A 3T6BA 2KJGA 4PJMA 3DM5A 4QDLA 4LACB 4CSAC 2ZXRA 1ZHZA 2DYSC 4XLPF 2FFHA 3NYJA 3DXJF 4JZAA 3UNGC 5E2QA 4AK9A 2WZLA 4CS9A 2Q3TA 5HSWA 3AG1C 2V26A 4LERA 3NDBB 4DVZA 2W45A 3B0UX 3JRTA 4XLNF 3W8IA 2NUTA 3ZIBA 4RDAA 3LS1A 3HJCA 3UGOA 3X2QC 2R7XA 5D92A 4BEJA 5B3SC 3LS0A 2A68F 3KMIA 1Z63A 1FFTC 3NYMA 4QI0A 3RIPA 5CI8A 3K1HA 2G3VA 1ZU4A 2R7UA 1Z3IX 5DQZA 4O6YA 2J9UA 2XXAA 3E9VA 2WL8A 2GFHA 3ASNC 4IAOA 4PFPA 2ZPAA 5KYNA 1J8MF 3VYWA 2OG2A 4E7SA 4C7OB 3DJUB 2R7WA 4IWBA 4YT8A 2ZXPA 3EPVA 5BUOA 2WZGA 1BR4A 4U5FE 3T6JA 2Q9BA 1NU7D 3EFOB 2R7VA 4U5EE 3L34A 4PFOA 4OD5A 3ABLC 3TD7A 4AE4A 4H4KC 1D1BA 4B6IA 1Z5ZA 2KNHA 2Y3GA 3NYLA 3F47A 1TWAA 4NY3A 5DQTA 3DAGA 2FGYA 2H7VC 4F4BA 3OEOA 1OCCC 2EIJC 3W2VA 3POVA 1FFHA 3ABKC 2EIKC 3W8HA 4BJ6A 4O79A 4AX2A 2W4MA 3KKBA 3Q7GA 1MNDA 1FMWA 5T3TA 2H7BA 2VASA 2WVQA 5T3WA 4RBNA 3CQZA 3E70C 2CNWD 3I4UA 3FHDA 2Z15A 1W2WA 3B0PA 2R7TA 2X51A 1ST6A 3SNHA 3M1CB 2J7PD 4GEHA 4O7GA 2CW0F 3SEOA 3DMDA 2KGOA 3H65A 2I8BA 2Y3HA 3EHMA 3JSZA 2BE5F 1BR1A 2DYRC 2ZXOA 2EINC 3OA1A 3RYLA 2HV6A 1FMVA 4A2NB 2H7OA 4OD4A 3ITFA 3UMKA 2YEVA 3Q7LA 5EGYA 2V3CC 5KYXA 1OKKD 2C03A 2CNWA 4OIPF 4C3EA 4KI2A 2B0JA 3NG1A 2PX0A 4OIOF 4CBEA 1S7ZA 2J7PA 2IXOA 4C7OA 1LKXA 3JYHA 3EJNA 1NG1A 4CSAA 1BR2A 4Q4ZF 4G7OF 3CZ6A 4K0DA 2J9VA 5E3CA 3VAYA 1M57C 4DBQA 2C04A 3B0VC 4P6IC 4IJJA 4HFKB 3DJNB 2PP4A 3QZCA 3EFOA 2A69F 4BG0A 4EBBA 1OKKA 3EH2A 1V54C 1ZHYA 3AQBA 5D91A 2A6EF 4I1MA 5KYYB 2L9JA 5FCLA 1ZYRF 4JW1A 3NRHA 1OCZC 1VK5A 1ZHXA 5KYXB 2PFDA 1FTSA 4CS8C 1SZIA 5DS5A 3Q6NA 4CIHA 2R7OA 4JURI 2L81A 4M63A 3DM9B 2Y69C 1JPNA 2KQ9A 5DS6A 2VB6A 3ZC4A 1D1CA 2R7RA 3LJBA 1PD1A 3UGPA 2Y3DA 1OCRC 3GODA 2R7QA 5T1DB 1OCOC 4LLEA 1WGWA 2QY9A 4ZLDA 3ZVRA 4ULWA 4O6NA 4KNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1I C;  3K1H A; 
#chains in the Genus database with same CATH topology
 2HSB A;  1A7D A;  4JTD B;  3VF0 A;  4H54 A;  4NCQ A;  1CPQ A;  2OEX A;  2R03 A;  3K1I C;  4XPW A;  4Q5S F;  1EA8 A;  2Q9C A;  3HLZ A;  3M15 A;  4N4W A;  2JD3 A;  4XTK A;  1AVO B;  5DVW A;  2M64 A;  3SXM A;  1SMY F;  1VYI A;  2IXM A;  2NPU A;  1D0Z A;  3G4Z A;  1M2O A;  3TJ5 A;  1U0B B;  4YT4 A;  2E87 A;  5A6J A;  2Q9A A;  1TFO B;  2ZXW C;  4XPX A;  1Z7Q c;  3S28 A;  1L3P A;  2PX3 A;  2MHR A;  3RW0 A;  1FAP B;  4BJ5 C;  3GM3 A;  3GEE A;  1TWC A;  3RQG A;  2NSF A;  1LM3 B;  5A6K A;  4YT5 A;  3F46 A;  4DXW A;  4G7Z F;  1D0X A;  3I5P A;  3FXH A;  2EIM C;  3B71 A;  4JJF A;  4ONS A;  3DAF A;  1EQ1 A;  1QQ3 A;  5L0F A;  3KYI A;  2HFI A;  3PHF 2;  3EG9 B;  1Z6A A;  3WG7 C;  3QMK A;  4JRZ A;  1D0Y A;  2D5R B;  1VMA A;  2XLH A;  2RD9 A;  5COF A;  4MQ9 F;  4BJ5 A;  5F5H A;  1HE1 A;  1QZX A;  3DD7 A;  4JJG A;  4JVS A;  4CJO A;  4DVY P;  3M79 A;  1QPU A;  1XZQ A;  3JYY A;  5COM A;  1MMD A;  2JX0 A;  3LLK A;  3T4R A;  4DRI B;  4QI2 A;  1LIH A;  3O39 A;  5A69 A;  3ABM C;  4CIP A;  3EZI A;  2ZD9 A;  4WGY A;  1GM5 A;  1A41 A;  3NMJ A;  3Q6M A;  4LDK A;  3PMR A;  2XLW A;  1E83 A;  3U2L A;  1SF8 A;  1TFK B;  1ORS C;  1E84 A;  3S0X A;  3IQC A;  4YN0 B;  4PJJ A;  3RVZ A;  2IYL D;  1Z23 A;  3N2Z B;  3FVY A;  3GM1 A;  2OCC C;  3KPH A;  3EGX B;  2HSQ A;  1OW8 A;  2QNL A;  2J9B A;  4W8K A;  2OJQ A;  4LDR A;  3C18 A;  1T9K A;  4BJ1 A;  3GM2 A;  4HFF B;  4EIY A;  2XLM A;  3C8G B;  3L1M A;  3UR3 C;  2LIG A;  5KYY A;  2PF4 E;  4Z9J A;  1JOG A;  3B9Q A;  3S9O A;  2I15 A;  1O87 A;  1QKR A;  3J06 A;  2WVO A;  1F1M A;  1LS4 A;  5IY5 C;  3LLI A;  1H7I A;  2WVN A;  5KYU B;  3U0C A;  3EH1 A;  4K7B A;  4MND A;  3WOD F;  3JZ0 A;  3GOR A;  3K7D A;  1R5I D;  3EGD B;  1TWH A;  3DWW A;  2NUP B;  2WB7 A;  4FWV A;  3SYN A;  3O55 A;  2NG1 A;  4C3D A;  5L3Q A;  4CS9 C;  2YL3 A;  2HZ8 A;  3K6B A;  2MYS A;  3V7O A;  5BQI A;  5DS4 A;  2R7S A;  3ZQV A;  3IEE A;  4MVR A;  2L7A A;  3LUT B;  4K1O A;  1MQV A;  1YDI A;  1VB5 A;  1ZHW A;  1TKN A;  5L3V A;  3R7C A;  1OXK A;  3S29 A;  1WAS A;  3EZH A;  4XEV A;  1ZHT A;  4PK4 A;  4FX5 A;  4J32 B;  2XL4 A;  1LI7 A;  4I44 A;  4U5B E;  4MVZ A;  4G7H F;  3I5Q A;  4D4N A;  1V4A A;  1M2V B;  4I1O B;  1CGM E;  3EQL F;  1NFO A;  1IZM A;  4Q7C A;  3RFY A;  1OXB A;  2YHS A;  3U8P A;  2A0B A;  4XEK A;  2IOQ A;  1ZW2 A;  5T3T A;  3U3B A;  3L0I A;  1O5H A;  4KNV A;  1RJ9 B;  4YJW A;  4MVS A;  2J46 A;  3JSE O;  1A0B A;  4JEA A;  2GDC A;  1VYK A;  4OIN F;  2P6V A;  4E0H A;  3LEV A;  1HY5 A;  2CYD A;  5L0I A;  4N6H A;  5GPG B;  4HEA J;  2O9X A;  3DKA A;  1WN0 A;  3MX3 A;  2HV7 A;  3X1O A;  4OIQ F;  3AG4 C;  4EWC A;  3M4C A;  3GAN A;  2LQG A;  1AEP A;  3RH3 A;  4CDA A;  2YZS A;  2UUH A;  5JP7 A;  3U5S A;  1T5O A;  2W4B A;  3RVY A;  4CS7 A;  2IXN A;  2ASR A;  3AGT A;  4HE8 D;  5B1B C;  1KNY A;  5KYW A;  4XWJ A;  4P9F A;  4YWQ A;  3N24 A;  3AJM A;  3DZA A;  3GEI A;  3GEH A;  2Y39 A;  2J45 A;  4JCH A;  1E85 A;  3ASO C;  3FDQ A;  2G62 A;  3C8G D;  3FOO A;  1PCX A;  3MLG A;  2ICW G;  3EG9 A;  1C17 M;  2LFF A;  1HW1 A;  2Y3B A;  3HTK C;  5L0G A;  2VH3 A;  5JUA A;  1BDJ B;  2EPO A;  2P7V A;  1D1A A;  2ETS A;  2R05 A;  3KH2 A;  4G0H A;  1JAF A;  2KYH A;  4CS8 A;  4XPY A;  1ZW3 A;  1MMN A;  5F5F A;  2YL1 A;  2IBF A;  4MW8 A;  4ULV A;  3RKO F;  2M4E A;  4E7Z A;  1VTM P;  2RSE B;  2YLG A;  3LNR A;  3QTH A;  1ZU5 A;  3MBG A;  4IAQ A;  1T6I A;  4EKW A;  3ZG1 A;  2EPK X;  2J9W A;  4C3B A;  4OIR F;  4FES A;  4DBR A;  1LS1 A;  5E33 A;  2A6H F;  1YAR O;  2R02 A;  4RD9 A;  3V5Z A;  3NKE A;  1WTY A;  1N1C A;  2YL0 A;  2J0W A;  1H9G A;  3A11 A;  4I3M A;  1M56 C;  2NUT B;  4NTF A;  3SXY A;  2YWA A;  3CSK A;  2EIL C;  1MNE A;  4X0R A;  3SP1 A;  3AG2 C;  2EPM X;  3W2W A;  2XLE A;  2QE9 A;  2QTV A;  2XSE A;  1YA9 A;  3EGX A;  3HNJ A;  4KC9 A;  3S27 A;  3H2V A;  1CGN A;  5AGF A;  4E17 A;  2YKZ A;  4PJL A;  1XZP A;  1YZC A;  1MMG A;  3C8G A;  1LE2 A;  2KK1 A;  5DLJ A;  1QSP A;  2XM0 A;  1PD0 A;  5CI9 A;  4YL3 A;  2AWY A;  3FAJ A;  5JSL A;  1A7V A;  3K1I A;  4MTG A;  3KL4 A;  1C02 A;  1G8X A;  2KSF A;  3AQC A;  4IAR A;  5JT4 A;  5KYW B;  2DB4 A;  2HJ3 A;  5KYU A;  2IXP A;  3RF3 A;  4W8P A;  5JRA A;  2YVK A;  3PDM P;  2KW3 C;  2LSE A;  1UFB A;  2DI3 A;  1SYQ A;  2P0N A;  1R4T A;  1IW7 F;  2YLD A;  3EGD A;  4BJ6 C;  4YT2 A;  2NUP A;  2XXA B;  2HKV A;  2OU6 A;  3EHN A;  4PJN A;  2CGE A;  3VM6 A;  3JT1 A;  4CJG A;  2W9Y A;  4BEM J;  3A9C A;  4IRU A;  2XRH A;  1LVK A;  3FMS A;  3JCU Q;  4U5H A;  4U5C E;  5FZT A;  4GQH A;  2HMQ A;  2WZF A;  4U5D E;  2VCB A;  2YRF A;  2G3K A;  3C63 A;  4U9D A;  5E3A A;  4YL0 A;  4AL0 A;  1NU9 C;  4BJT A;  1YZA A;  1J8Y F;  2XL8 A;  3UMI A;  1QLE C;  4J30 B;  4ZLC A;  1HW2 A;  1V55 C;  1KU2 A;  3LAY A;  5BQG A;  4KBL A;  1M2V A;  3K33 A;  3ECS A;  1EKY A;  4GYT A;  4PR9 A;  2GAQ A;  3BRJ A;  1TWG A;  3ATP A;  3K66 A;  3O6X A;  1NLX A;  1RJ9 A;  3NKD A;  2AVK A;  4UDV A;  1VOM A;  1RKC A;  2Q4F A;  4LLC A;  1RMV A;  4G78 A;  4NTB A;  3SZR A;  1V74 B;  3U9J A;  3LES A;  4N06 A;  2LK4 A;  2HUJ A;  3OWT A;  5B1A C;  3N0T A;  4U9E A;  3ZSU A;  4N6C A;  2J0X A;  1MMA A;  2BC5 A;  4MVO A;  2MWQ A;  4WJ0 A;  4AE4 B;  4ANJ A;  3TJ6 A;  1JPJ A;  3AG3 C;  4EUK B;  4O6M A;  3PCV A;  3ZTM A;  1E86 A;  3JTL O;  4U5G A;  4BPM A;  2A1D D;  2CDQ A;  2D4U A;  5COG A;  5EHH A;  1QVX A;  1NZE A;  1Q0D A;  3M4B A;  5HV9 A;  4DOZ A;  2DGJ A;  4ER9 A;  2TMV P;  1TR2 A;  4E0I A;  3T6B A;  4XQ1 A;  2KJG A;  4PJM A;  3DM5 A;  1H6G A;  4QDL A;  4LAC B;  4CSA C;  1GGQ A;  2ZXR A;  1ZHZ A;  2DYS C;  4MW3 A;  2FFH A;  3AOU A;  3NYJ A;  4XLP F;  1FR0 A;  1GQA A;  3TOM A;  3DXJ F;  4JZA A;  3UNG C;  5E2Q A;  4AK9 A;  3GWL A;  2WZL A;  1RXQ A;  4CS9 A;  2P1A A;  2Q3T A;  3ZTZ A;  2IM8 A;  2VCA A;  3L8J A;  3GWN A;  5HSW A;  1O3U A;  3AG1 C;  2V26 A;  4LER A;  3NDB B;  1VLS A;  2UUI A;  2W45 A;  4DVZ A;  3HKK A;  3JRT A;  4XLN F;  2YLI A;  3HNL A;  4PAC A;  3SXZ A;  3W8I A;  3ZWI A;  2NUT A;  3LNM B;  4RDA A;  3ZIB A;  3LS1 A;  1CPR A;  1Y4C A;  3HJC A;  3UGO A;  1YLM A;  1DOW A;  4J7Y A;  3X2Q C;  2R7X A;  5D92 A;  2KC3 A;  3CAX A;  3BEH A;  4BEJ A;  5B3S C;  1FNT c;  3C8Z A;  3LS0 A;  1H9T A;  1ORJ A;  3H2U A;  2A68 F;  3KMI A;  2X0C A;  1BBH A;  1Z63 A;  1FFT C;  3G4X A;  3R2P A;  1NSG B;  2LFD A;  3NYM A;  4QI0 A;  3RIP A;  3IQ6 A;  5CI8 A;  3K1H A;  5L0H A;  1T01 A;  2G3V A;  1ZU4 A;  2LP4 A;  2R7U A;  4MVQ A;  1I4Z A;  1PV3 A;  2Q00 A;  3O10 A;  1Z3I X;  5DQZ A;  4O6Y A;  2J9U A;  2XXA A;  3T9O A;  3E9V A;  2HS5 A;  2WL8 A;  2GFH A;  1I4Y A;  2R25 A;  1XWJ A;  3L8I A;  4L6R A;  2HMZ A;  2L6H A;  3ASN C;  4IAO A;  4PFP A;  2H8A A;  2ZPA A;  1M6T A;  5KYN A;  1K04 A;  3MYF A;  3TOL A;  1J8M F;  3VYW A;  4DJ9 A;  4MS2 A;  4MVU A;  2OG2 A;  4NC3 A;  2GA0 A;  5L0D A;  4E7S A;  4C7O B;  3DJU B;  3U9M A;  3NMK A;  2R7W A;  4IWB A;  3LEO A;  3DE9 A;  3QW0 A;  4YT8 A;  2ZXP A;  2JPU A;  2XM4 A;  3EPV A;  5K0I A;  3MYI A;  5BUO A;  1A7E A;  1OW6 A;  3T6G B;  1E2X A;  2WZG A;  4MTO A;  2NSG A;  1BR4 A;  3KYJ A;  1WAT A;  4U5F E;  3ZQY A;  4JC7 A;  2Q9B A;  3T6J A;  1NU7 D;  4M63 A;  3EFO B;  4LDQ A;  4U5E E;  4CDY A;  1Q0F A;  2R7V A;  2VCC A;  3L34 A;  4PFO A;  3TK0 A;  5AC4 A;  4OD5 A;  3ABL C;  4YL1 A;  3TD7 A;  1Q0G A;  4AE4 A;  4H4K C;  2QLA A;  1D1B A;  2XLD A;  3WHN A;  4B6I A;  1Z5Z A;  3FAP B;  5JLI A;  2OQM A;  2KNH A;  1RKE B;  2Y3G A;  3NYL A;  4JTC B;  5A6A A;  3F47 A;  2CCY A;  4IGG A;  1OQC A;  1TWA A;  4JCZ A;  4NY3 A;  5DQT A;  3DAG A;  2FGY A;  2H7V C;  4F4B A;  2VC9 A;  3OEO A;  4NQF A;  2OOC A;  1OCC C;  2EPL X;  3QVZ A;  2L6G A;  2EIJ C;  4NTA A;  3W2V A;  3POV A;  1FFH A;  3ABK C;  2EIK C;  4AL1 A;  3TUL A;  4MVM A;  3W8H A;  3U2M A;  4O79 A;  3DI5 A;  4AX2 A;  4BJ6 A;  2W4M A;  3KKB A;  3Q7G A;  1MND A;  1FMW A;  1YA7 O;  2AU5 A;  4IB4 A;  2YQY A;  5F28 E;  5L0J A;  2H7B A;  1HMD A;  1YYX A;  4CX9 A;  3C62 A;  2VAS A;  2WVQ A;  1YJG A;  5T3W A;  1LPE A;  1L7C A;  1CGO A;  4WGZ A;  4RBN A;  2R9R B;  3CQZ A;  5TJ5 E;  3E70 C;  2CNW D;  1U6H A;  4EHP A;  3I4U A;  3FHD A;  1WOL A;  3TQO A;  2AWC A;  2Z15 A;  3IHU A;  3V5X A;  1W2W A;  3B0P A;  2R7T A;  2X51 A;  1ST6 A;  3FOP A;  2FAP B;  3DE8 A;  3SNH A;  3M1C B;  1Y6D A;  2J7P D;  2B0H A;  4GEH A;  1G4W R;  1APC A;  2PBE A;  4O7G A;  2CW0 F;  1ZZP A;  3SEO A;  5BQH A;  256B A;  5CIV A;  1G5Z A;  2OEV A;  3DMD A;  1EI7 A;  2KGO A;  3H65 A;  2I8B A;  2PNO A;  3B0U X;  1OW7 A;  3US6 A;  2Y3H A;  3EHM A;  5EK0 A;  3JSZ A;  2BE5 F;  3U3F A;  1C03 A;  1BR1 A;  2AP3 A;  2DYR C;  2ZXO A;  4DRJ B;  2EIN C;  2LCH A;  3OA1 A;  3RQF A;  3HNK A;  3RYL A;  2XS1 A;  1VLT A;  2HV6 A;  1FMV A;  3IQT A;  4A2N B;  2H7O A;  4XEF A;  4JIO A;  4OD4 A;  3ITF A;  3UMK A;  2YEV A;  3RQE A;  3Q7L A;  5EGY A;  2V3C C;  3S90 A;  4WAB A;  3VRC A;  5KYX A;  1OKK D;  1BZ4 A;  2C03 A;  2CNW A;  4A4A A;  4OIP F;  4C3E A;  3B29 A;  1OR2 A;  1K40 A;  5B3I A;  1OR3 A;  3WAQ A;  1YAU O;  4J7T A;  2B0J A;  3NG1 A;  4KI2 A;  2PX0 A;  4OIO F;  3CEX A;  4CBE A;  1S7Z A;  2J7P A;  2OJE D;  1YYJ A;  2IXO A;  3S84 A;  4C7O A;  1LKX A;  3JYH A;  1ZVZ A;  3EJN A;  2P61 A;  1JR8 A;  1NG1 A;  3G50 A;  4CSA A;  3QW1 A;  1BR2 A;  5A6B D;  4YK5 A;  4Q4Z F;  3CZ6 A;  1TQG A;  2J9V A;  4K0D A;  5E3C A;  1M57 C;  1B68 A;  2EPN A;  1DOV A;  3VAY A;  4DBQ A;  2C04 A;  1Q0K A;  3UMH A;  3B0V C;  4P6I C;  4IJJ A;  4HFK B;  1Q0M A;  3DJN B;  3C7J A;  3QVY A;  2PP4 A;  3QZC A;  3EFO A;  2A69 F;  3SXK A;  2XS8 A;  1YVI A;  4BG0 A;  5L0C A;  4EBB A;  3IQ5 A;  1NFN A;  1HE9 A;  1OKK A;  1WWP A;  1RCP A;  2XLV A;  3EH2 A;  1V54 C;  1ZHY A;  2HJM A;  2L6F A;  1LE4 A;  3AQB A;  4P9T A;  5D91 A;  4EBK A;  5AC5 A;  2BL2 A;  1G4U S;  2A6E F;  4I1M A;  5KYY B;  1S05 A;  2L9J A;  5JVE A;  5JS5 A;  1RKE A;  2J8W A;  3ZDL A;  1LI5 A;  5FCL A;  1ZYR F;  4JW1 A;  3NRH A;  4Z9I A;  1HMO A;  1OCZ C;  1ORY A;  1VK5 A;  1ZHX A;  2QUP A;  1AUE A;  2YL7 A;  4E18 A;  5KYX B;  3NMI A;  4JTA B;  3AGU A;  2PFD A;  4JKV A;  1UG7 A;  2GWW A;  1FTS A;  4FAP B;  5A6B A;  2F22 A;  4R32 A;  4CS8 C;  2A0U A;  3IPM O;  1K05 A;  2Q7R A;  1SZI A;  5DS5 A;  1SR2 A;  3Q6N A;  4CIH A;  2R7O A;  4JUR I;  4G7O F;  2L81 A;  1U89 A;  3DM9 B;  1NBB A;  3JRM O;  2Y69 C;  1JPN A;  2KQ9 A;  2XLO A;  2OKU A;  2VB6 A;  3ZC4 A;  5DS6 A;  1D1C A;  1I5N A;  4DRH B;  2XL6 A;  2R7R A;  1KTM A;  4JEB A;  3MFN A;  1JRA A;  1T6Q A;  3LJB A;  1PD1 A;  4CDV A;  3UGP A;  2Y3D A;  1OCR C;  3GOD A;  2R7Q A;  3HNI A;  4MTF A;  1GS9 A;  5T1D B;  4Z9H A;  3U8V A;  4JE9 A;  3W4Y A;  1T6U A;  4D4X A;  1OCO C;  4LLE A;  1WGW A;  2QY9 A;  1JMW A;  4ZLD A;  3ZVR A;  3V5Y A;  4ULW A;  4O6N A;  4EBJ A;  2LD6 A;  4KNW A; 
#chains in the Genus database with same CATH homology
 4Q5S F;  3K1I C;  2Q9C A;  3HLZ A;  2JD3 A;  4XTK A;  5DVW A;  1SMY F;  1VYI A;  2IXM A;  1D0Z A;  1M2O A;  4YT4 A;  2E87 A;  2Q9A A;  2ZXW C;  3S28 A;  2PX3 A;  4BJ5 C;  1TWC A;  4YT5 A;  3F46 A;  4G7Z F;  1D0X A;  3I5P A;  2EIM C;  4JJF A;  3DAF A;  3PHF 2;  3EG9 B;  1Z6A A;  3WG7 C;  3QMK A;  1D0Y A;  2D5R B;  1VMA A;  4MQ9 F;  4BJ5 A;  5F5H A;  1QZX A;  3DD7 A;  4JJG A;  4JVS A;  4DVY P;  1MMD A;  3LLK A;  3T4R A;  4QI2 A;  3O39 A;  3ABM C;  3EZI A;  3Q6M A;  3PMR A;  3S0X A;  1SF8 A;  4YN0 B;  4PJJ A;  2IYL D;  1Z23 A;  3N2Z B;  3FVY A;  2OCC C;  3EGX B;  4W8K A;  4BJ1 A;  4HFF B;  3UR3 C;  5KYY A;  2PF4 E;  3B9Q A;  1O87 A;  2WVO A;  5IY5 C;  3LLI A;  2WVN A;  5KYU B;  3EH1 A;  4K7B A;  4MND A;  3WOD F;  3K7D A;  3EGD B;  1TWH A;  2NUP B;  2WB7 A;  4FWV A;  3SYN A;  4C3D A;  2NG1 A;  5L3Q A;  4CS9 C;  3K6B A;  2MYS A;  3V7O A;  5DS4 A;  2R7S A;  3IEE A;  1ZHW A;  1TKN A;  5L3V A;  3S29 A;  3EZH A;  1ZHT A;  4PK4 A;  4FX5 A;  4J32 B;  2XL4 A;  4I44 A;  4U5B E;  4G7H F;  3I5Q A;  1M2V B;  4I1O B;  3EQL F;  1IZM A;  4Q7C A;  3RFY A;  2YHS A;  2IOQ A;  3L0I A;  1O5H A;  4KNV A;  1RJ9 B;  4YJW A;  2J46 A;  1VYK A;  4OIN F;  2P6V A;  3LEV A;  4HEA J;  2O9X A;  4OIQ F;  3MX3 A;  2HV7 A;  3X1O A;  3AG4 C;  4EWC A;  3GAN A;  3RH3 A;  2YZS A;  2W4B A;  4CS7 A;  2IXN A;  5B1B C;  4HE8 D;  5KYW A;  4XWJ A;  4YWQ A;  3N24 A;  3DZA A;  4JCH A;  2Y39 A;  2J45 A;  3FDQ A;  3ASO C;  2G62 A;  3MLG A;  1PCX A;  3EG9 A;  2Y3B A;  3HTK C;  2VH3 A;  2P7V A;  1D1A A;  4G0H A;  3KH2 A;  4CS8 A;  1MMN A;  5F5F A;  3RKO F;  2M4E A;  4E7Z A;  3LNR A;  1ZU5 A;  3ZG1 A;  2J9W A;  4C3B A;  4OIR F;  4FES A;  4DBR A;  1LS1 A;  5E33 A;  2A6H F;  4RD9 A;  3NKE A;  1N1C A;  2J0W A;  4I3M A;  1M56 C;  2NUT B;  3CSK A;  2EIL C;  1MNE A;  4X0R A;  3SP1 A;  3AG2 C;  3W2W A;  2XSE A;  2QTV A;  3EGX A;  4KC9 A;  3S27 A;  4PJL A;  1MMG A;  5DLJ A;  5CI9 A;  1PD0 A;  3FAJ A;  3KL4 A;  3AQC A;  1G8X A;  5KYW B;  5KYU A;  2IXP A;  2KW3 C;  2LSE A;  1IW7 F;  3EGD A;  4BJ6 C;  4YT2 A;  2NUP A;  2XXA B;  3EHN A;  4PJN A;  2CGE A;  3JT1 A;  2W9Y A;  4IRU A;  2XRH A;  1LVK A;  3JCU Q;  4U5C E;  4U5H A;  2WZF A;  4U5D E;  2G3K A;  5E3A A;  1NU9 C;  4BJT A;  1J8Y F;  3UMI A;  1QLE C;  4J30 B;  4ZLC A;  1V55 C;  1KU2 A;  3LAY A;  4KBL A;  1M2V A;  3K33 A;  3ECS A;  4GYT A;  1TWG A;  3K66 A;  3O6X A;  1RJ9 A;  3NKD A;  1VOM A;  4LLC A;  3SZR A;  3UMH A;  3LES A;  4N06 A;  5B1A C;  3OWT A;  3ZSU A;  3N0T A;  2J0X A;  1MMA A;  4WJ0 A;  2MWQ A;  4AE4 B;  4ANJ A;  1JPJ A;  3AG3 C;  4O6M A;  4U5G A;  2A1D D;  2CDQ A;  5EHH A;  1NZE A;  4DOZ A;  2DGJ A;  1TR2 A;  3T6B A;  2KJG A;  4PJM A;  3DM5 A;  4QDL A;  4LAC B;  4CSA C;  2ZXR A;  1ZHZ A;  2DYS C;  4XLP F;  2FFH A;  3NYJ A;  3DXJ F;  4JZA A;  3UNG C;  5E2Q A;  4AK9 A;  2WZL A;  4CS9 A;  2Q3T A;  5HSW A;  3AG1 C;  2V26 A;  4LER A;  3NDB B;  4DVZ A;  2W45 A;  3B0U X;  3JRT A;  4XLN F;  3W8I A;  2NUT A;  3ZIB A;  4RDA A;  3LS1 A;  3HJC A;  3UGO A;  3X2Q C;  2R7X A;  5D92 A;  4BEJ A;  5B3S C;  3LS0 A;  2A68 F;  3KMI A;  1Z63 A;  1FFT C;  3NYM A;  4QI0 A;  3RIP A;  5CI8 A;  3K1H A;  2G3V A;  1ZU4 A;  2R7U A;  1Z3I X;  5DQZ A;  4O6Y A;  2J9U A;  2XXA A;  3E9V A;  2WL8 A;  2GFH A;  3ASN C;  4IAO A;  4PFP A;  2ZPA A;  5KYN A;  1J8M F;  3VYW A;  2OG2 A;  4E7S A;  4C7O B;  3DJU B;  2R7W A;  4IWB A;  4YT8 A;  2ZXP A;  3EPV A;  5BUO A;  2WZG A;  1BR4 A;  4U5F E;  3T6J A;  2Q9B A;  1NU7 D;  3EFO B;  2R7V A;  4U5E E;  3L34 A;  4PFO A;  4OD5 A;  3ABL C;  3TD7 A;  4AE4 A;  4H4K C;  1D1B A;  4B6I A;  1Z5Z A;  2KNH A;  2Y3G A;  3NYL A;  3F47 A;  1TWA A;  4NY3 A;  5DQT A;  3DAG A;  2FGY A;  2H7V C;  4F4B A;  3OEO A;  1OCC C;  2EIJ C;  3W2V A;  3POV A;  1FFH A;  3ABK C;  2EIK C;  3W8H A;  4BJ6 A;  4O79 A;  4AX2 A;  2W4M A;  3KKB A;  3Q7G A;  1MND A;  1FMW A;  5T3T A;  2H7B A;  2VAS A;  2WVQ A;  5T3W A;  4RBN A;  3CQZ A;  3E70 C;  2CNW D;  3I4U A;  3FHD A;  2Z15 A;  1W2W A;  3B0P A;  2R7T A;  2X51 A;  1ST6 A;  3SNH A;  3M1C B;  2J7P D;  4GEH A;  4O7G A;  2CW0 F;  3SEO A;  3DMD A;  2KGO A;  3H65 A;  2I8B A;  2Y3H A;  3EHM A;  3JSZ A;  2BE5 F;  1BR1 A;  2DYR C;  2ZXO A;  2EIN C;  3OA1 A;  3RYL A;  2HV6 A;  1FMV A;  4A2N B;  2H7O A;  4OD4 A;  3ITF A;  3UMK A;  2YEV A;  3Q7L A;  5EGY A;  2V3C C;  5KYX A;  1OKK D;  2C03 A;  2CNW A;  4OIP F;  4C3E A;  4KI2 A;  2B0J A;  3NG1 A;  2PX0 A;  4OIO F;  4CBE A;  1S7Z A;  2J7P A;  2IXO A;  4C7O A;  1LKX A;  3JYH A;  3EJN A;  1NG1 A;  4CSA A;  1BR2 A;  4Q4Z F;  4G7O F;  3CZ6 A;  4K0D A;  2J9V A;  5E3C A;  3VAY A;  1M57 C;  4DBQ A;  2C04 A;  3B0V C;  4P6I C;  4IJJ A;  4HFK B;  3DJN B;  2PP4 A;  3QZC A;  3EFO A;  2A69 F;  4BG0 A;  4EBB A;  1OKK A;  3EH2 A;  1V54 C;  1ZHY A;  3AQB A;  5D91 A;  2A6E F;  4I1M A;  5KYY B;  2L9J A;  5FCL A;  1ZYR F;  4JW1 A;  3NRH A;  1OCZ C;  1VK5 A;  1ZHX A;  5KYX B;  2PFD A;  1FTS A;  4CS8 C;  1SZI A;  5DS5 A;  3Q6N A;  4CIH A;  2R7O A;  4JUR I;  2L81 A;  4M63 A;  3DM9 B;  2Y69 C;  1JPN A;  2KQ9 A;  5DS6 A;  2VB6 A;  3ZC4 A;  1D1C A;  2R7R A;  3LJB A;  1PD1 A;  3UGP A;  2Y3D A;  1OCR C;  3GOD A;  2R7Q A;  5T1D B;  1OCO C;  4LLE A;  1WGW A;  2QY9 A;  4ZLD A;  3ZVR A;  4ULW A;  4O6N A;  4KNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...