3K1IC

Crystal strcture of flis-hp1076 complex in h. pylori
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
119
structure length
119
Chain Sequence
QQIAKFSRDMKNINESVGALQVLQIACKKLFNKSMGLEDKDALQASIIKQELREIVENCQFLASPLFDTQLNIAINDEIFSMIVVNPLDLLENVGEFQAYLEEKLNEIKELLGYLSESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Flagellar protein
publication title Molecular interaction of flagellar export chaperone FliS and cochaperone HP1076 in Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
total genus 40
structure length 119
sequence length 119
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16522 FliS_cochap Flagellar FLiS export co-chaperone, HP1076
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1890 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3k1iC00
3K1IC 3K1HA
chains in the Genus database with same CATH superfamily
2H8AA 1ST6A 3KMIA 2RD9A 2L81A 3L34A 4MW8A 4WGYA 4YN0B 5COMA 3ZTMA 2AWYA 2G62A 4DRJB 4E17A 5JS5A 3ZDLA 4B6IA 2WZLA 1MMNA 3NYJA 1OCCC 3SXZA 4CBEA 4D4NA 2J7PD 4DVYP 2Y3BA 4MTOA 1Q0GA 1YZCA 2H7VC 4IRUA 1U0BB 3LEOA 5JP7A 1YZAA 4ER9A 2GWWA 4G7HF 1M56C 2KSFA 4PFPA 4U9EA 5AGFA 4BJ5A 1UG7A 1C03A 4Q5SF 2P0NA 2LP4A 2J7PA 3K1IA 5EK0A 5L0CA 4KBLA 3DM5A 1H6GA 3G4XA 4JTAB 3DE8A 3Q7LA 2CW0F 4KNWA 4YL3A 4E0HA 3BEHA 2LD6A 3DAFA 1SYQA 1M57C 1LIHA 4BJ6C 1MMGA 1NG1A 5FCLA 1NSGB 4G7ZF 2XSEA 1LE2A 1MNDA 4NCQA 5E2QA 1VB5A 3UGOA 3OA1A 1HY5A 4U5EE 4K7BA 2IXPA 3O55A 2R7SA 5E3CA 3JYHA 2EPNA 3RQGA 1C17M 3WODF 3T9OA 2X0CA 1ZHWA 2J46A 2XLHA 2WZFA 4O79A 3NYLA 2LIGA 4EBBA 5D91A 4KI2A 1YJGA 4FWVA 2IM8A 1C02A 1V55C 3NKDA 4NTAA 4K1OA 4EBJA 3RIPA 5DS4A 1Y6DA 3U8VA 1G4US 4LLCA 4A4AA 1MMDA 1E2XA 3HNKA 5IY5C 2W45A 2W9YA 2TMVP 2P6VA 3GM2A 1D0XA 1I4YA 2Q7RA 4CDVA 4OIQF 1LI5A 3MYFA 3PCVA 2WVQA 3W2VA 5L0IA 3IQ6A 3B71A 3RFYA 2AU5A 1A7DA 1D1BA 4LLEA 3RYLA 2ZXWC 3QMKA 4MW3A 4CSAA 4JTCB 1VYIA 2L9JA 4EWCA 3S27A 3AG1C 2Y39A 4JJFA 2OQMA 2KC3A 3TOMA 4I1OB 4OIPF 3HJCA 1RXQA 2A69F 3H2VA 3DXJF 3LUTB 1J8MF 1M2VB 2A0BA 2MHRA 2NUPB 1U6HA 3H65A 2OU6A 3KL4A 3NMKA 3EGDB 3RQEA 3U8PA 1HW1A 5CIVA 1U89A 2WVOA 2YZSA 3KH2A 1T01A 3W8HA 1T9KA 2WL8A 3EHNA 4DRHB 2J0XA 4WABA 3NMIA 4BEJA 4P6IC 2VCCA 4U9DA 3S84A 2P61A 4AK9A 2OJQA 5CI8A 5B1BC 3W8IA 2V3CC 3SEOA 1FAPB 4MS2A 3VYWA 2W4BA 4KNVA 4NTBA 3TULA 4KC9A 4IARA 4AX2A 3CSKA 2NUPA 3QVYA 1OW8A 3EFOB 1VK5A 5T3TA 5AC5A 2M4EA 5KYWB 3S9OA 3DZAA 3QZCA 1H9GA 2GDCA 1JAFA 4RDAA 4DXWA 5L0DA 1Y4CA 2J0WA 3K1HA 5JVEA 2NG1A 2QY9A 1BR4A 1Z23A 1Z5ZA 3ZSUA 1Q0MA 3MLGA 3CZ6A 3EG9B 2VCAA 3I5PA 4BPMA 2NSGA 2PP4A 3IEEA 3NDBB 2WZGA 2EIKC 3AQBA 3KYIA 4MVUA 4OINF 3EFOA 2KW3C 1D1AA 1K05A 1NLXA 1MMAA 4N6CA 4O6NA 1TFOB 5FZTA 5BQIA 4OD5A 4F4BA 3AG3C 1YARO 5KYYB 3OEOA 1WOLA 1ORSC 3IPMO 2KJGA 5EHHA 2A0UA 4I44A 2ZXPA 3SXMA 2XXAB 3AG4C 1Q0KA 5GPGB 5K0IA 2PX3A 5F5HA 3U9MA 1EQ1A 2B0HA 3TJ5A 3IQ5A 2GFHA 3I5QA 2PF4E 3DMDA 1LVKA 2Q9AA 4P9FA 2HKVA 4JC7A 2YHSA 1AUEA 2Q9BA 2NUTA 2LQGA 3C7JA 1HW2A 3S28A 2XLOA 2Q9CA 1BZ4A 2OKUA 4E7SA 5KYNA 1R4TA 3S29A 2VB6A 3ZQVA 2XRHA 4XWJA 4QI2A 2C03A 3RVYA 1BR2A 4LDRA 3SP1A 1D0ZA 2BE5F 4W8KA 1ORYA 1SZIA 5TJ5E 3B29A 1D1CA 3C8GD 3N2ZB 1O87A 2QLAA 3EH2A 4NTFA 3SYNA 4IAQA 2X51A 4IB4A 4N4WA 4PFOA 2A68F 4XLPF 2KK1A 5DQZA 1S05A 2HZ8A 5T1DB 1JPJA 5DQTA 3VM6A 5KYXB 3US6A 1Z6AA 3C8GA 2J9WA 1V54C 3H2UA 1QZXA 2YRFA 3HNLA 2LCHA 5JSLA 1Z63A 2CDQA 2NPUA 2R02A 1H9TA 4JEBA 3POVA 2WB7A 3FVYA 3EPVA 4O6MA 4XPXA 3LEVA 2R9RB 2OOCA 5A6AA 1OKKD 4MQ9F 4MVQA 1D0YA 3FXHA 1M6TA 5AC4A 1OCZC 1Q0FA 5B1AC 3SZRA 3G4ZA 4W8PA 3FAJA 3U3FA 3PHF2 4NC3A 4FAPB 1N1CA 1SMYF 3JSZA 4FESA 1APCA 4YWQA 4G7OF 1OKKA 3EQLF 3SXKA 5KYXA 3B0VC 4I1MA 3JZ0A 2B0JA 2EPOA 4P9TA 2YL0A 1CPRA 2A1DD 2YQYA 3JRMO 2XLDA 4LERA 2A6EF 2A6HF 1VLTA 2Q3TA 3CEXA 4HEAJ 4PJLA 1EA8A 5E3AA 4D4XA 1A7EA 2Y69C 4U5BE 1V4AA 4C3EA 1HE1A 3LS1A 4WGZA 2VASA 4DBRA 1H7IA 1Z3IX 4DBQA 3CAXA 1GS9A 2HV7A 3NG1A 4QI0A 4CS8C 3GORA 3ABLC 4X0RA 2BL2A 4C3DA 3MFNA 3M4CA 4DVZA 2LFFA 2VCBA 2HSBA 1Z7Qc 3RKOF 3C8ZA 2G3VA 5DVWA 2HMZA 3JSEO 4XEFA 3HNIA 4JVSA 4CJGA 2FGYA 1OR2A 1T6IA 3KKBA 4LDKA 1ZU4A 2FFHA 3ABMC 4H4KC 4XEVA 4MTFA 4CS9A 1FMVA 4XPWA 2YLIA 3MX3A 4JCHA 1IW7F 2R7QA 2R7OA 2I15A 1CPQA 3C18A 3T6BA 4ZLDA 1RJ9A 2BC5A 1MNEA 4Q7CA 3WHNA 2P7VA 4HE8D 2AWCA 4U5DE 4E0IA 2R7XA 1ZW2A 3E9VA 3DI5A 4YJWA 3NYMA 4JW1A 3LLKA 3RF3A 4IGGA 1JMWA 2GA0A 4XPYA 1MQVA 3S0XA 2R7RA 4JIOA 1ZHXA 4PJJA 4G78A 4C3BA 1V74B 2HMQA 3JTLO 3K33A 4JJGA 1TQGA 2Y3DA 1CGME 3DKAA 1A41A 3G50A 1GGQA 3IQCA 4QDLA 5BUOA 4NY3A 3V7OA 1NZEA 1TKNA 3GWNA 5F28E 1QSPA 2XS8A 4LDQA 4N06A 4ONSA 1Q0DA 256BA 3ZQYA 1ZHTA 1ZHYA 1TWHA 3C63A 3HKKA 2YWAA 1F1MA 3W2WA 3VRCA 2LFDA 4MVZA 1GM5A 1WATA 3RW0A 3FOOA 2QE9A 2ASRA 3QW1A 1B68A 4G0HA 2HJMA 1TWAA 1OR3A 1TR2A 3X1OA 4BJ6A 3GANA 5A6BD 1NBBA 1ORJA 4ULWA 3UMKA 1A0BA 2DB4A 3MYIA 3QTHA 1RKEA 1FFTC 4Z9JA 1G5ZA 2PFDA 1PD1A 4BJ5C 3K6BA 1KNYA 3ECSA 5KYUB 3Q6MA 2JPUA 3K1IC 5B3SC 5A6BA 1YYXA 5CI9A 1ZVZA 3SXYA 2L6GA 2HV6A 3EGXB 3ZTZA 1XZPA 3RH3A 1NU7D 2F22A 4JURI 3EJNA 3U3BA 3ZVRA 2DYSC 1QLEC 1HMOA 2UUHA 3ZG1A 2YVKA 4BG0A 4C7OB 1E86A 1AVOB 2H7OA 1W2WA 2IYLD 5COGA 3T6GB 1NFNA 2PX0A 1WTYA 5JRAA 4K0DA 3K66A 4AL1A 2HFIA 4YT4A 2YLGA 5KYUA 4BJTA 3IHUA 3BRJA 1E84A 2R7UA 2L6FA 2WVNA 4HFKB 4ANJA 1RKCA 1FFHA 1YDIA 3EGXA 1CGNA 3LNRA 4CDYA 4PK4A 3C8GB 4LACB 1M2OA 1DOVA 1OW7A 3ATPA 1E83A 2R7WA 3FHDA 3R7CA 1SR2A 1TWGA 3W4YA 3ZWIA 4C7OA 3AGTA 1FTSA 1NFOA 3DM9B 4CX9A 3ABKC 2XL6A 3B9QA 3L1MA 2OEXA 4XQ1A 1LKXA 3M15A 1S7ZA 4M63A 3SNHA 5JUAA 4OIOF 4J30B 3GM3A 4CS9C 1HMDA 2PBEA 1OCRC 1T6UA 1FNTc 3EZIA 4DRIB 2XL8A 4CDAA 4CSAC 1QVXA 2FAPB 3EH1A 4U5HA 3R2PA 3U0CA 3NRHA 2XLVA 1YLMA 5L3QA 2EPMX 3B0PA 2Z15A 2HS5A 3LAYA 1JPNA 4ULVA 4DOZA 3ASOC 3O10A 2J9UA 1FMWA 4GEHA 1YA7O 4PACA 4CIHA 4BEMJ 2IXNA 2D5RB 2J45A 3F47A 2XLEA 4O7GA 4EUKB 2DI3A 1T5OA 1LI7A 1TFKB 5E33A 1OXBA 1LPEA 4JZAA 3WAQA 2MWQA 3E70C 3EZHA 2RSEB 1HE9A 2XL4A 3FOPA 1EI7A 2YL1A 2OJED 2H7BA 2DGJA 2W4MA 4AE4B 1I4ZA 4EKWA 1I5NA 4J32B 3FAPB 3N0TA 3F46A 2J9BA 1NU9C 3EHMA 4UDVA 2VC9A 3M79A 5DS6A 4IJJA 3UR3C 2HJ3A 1BDJB 3V5ZA 4WJ0A 1L7CA 2IXOA 4U5FE 3GM1A 1WGWA 3KPHA 5L0GA 4IAOA 2AVKA 4DJ9A 3GEIA 1RJ9B 2PNOA 3GEEA 1VTMP 5D92A 5BQHA 1WWPA 1LS1A 4Z9HA 4FX5A 4RBNA 4CIPA 2OCCC 3TK0A 5HV9A 4AE4A 3Q7GA 4N6HA 5A6KA 4HFFB 1QQ3A 4A2NB 1ZHZA 3O6XA 1TWCA 2CGEA 3CQZA 4I3MA 3RVZA 4EBKA 3M1CB 3M4BA 1ZW3A 1O5HA 3U2MA 2YKZA 2C04A 2EINC 1ZU5A 3ZC4A 4RD9A 3NMJA 2OEVA 3LLIA 1XZQA 1PV3A 3I4UA 3KYJA 3O39A 4JKVA 5COFA 4Z9IA 2CNWD 2M64A 4JTDB 5JT4A 2Q4FA 3AGUA 4J7YA 2DYRC 3ASNC 1QPUA 4E18A 3OWTA 4L6RA 1L3PA 4O6YA 1GQAA 1O3UA 3FMSA 2D4UA 2CNWA 3UNGC 4CJOA 3L8JA 2HUJA 3QVZA 2ICWG 5KYWA 1EKYA 3AOUA 1WN0A 4U5GA 4XLNF 5DS5A 1JR8A 2IBFA 3VF0A 3HTKC 1XWJA 1YYJA 4IWBA 4JRZA 1AEPA 1JRAA 2YLDA 4MVSA 2LK4A 4OD4A 5EGYA 4MVRA 2J9VA 2L6HA 4H54A 2CCYA 3B0UX 1OCOC 5B3IA 1OQCA 3TOLA 1BBHA 2EPLX 1PD0A 2R05A 5L0FA 1RKEB 4AL0A 2EIJC 3UMIA 2XLWA 3AJMA 2R7TA 1WASA 4ZLCA 3A9CA 5L0HA 1RCPA 1R5ID 3K7DA 4CS7A 2QTVA 3ZIBA 3PMRA 3JT1A 2G3KA 1JOGA 3PDMP 1J8YF 1LS4A 5F5FA 1UFBA 2MYSA 4GYTA 3DJNB 1K04A 3RQFA 1G8XA 1YVIA 5BQGA 2KNHA 2KYHA 3NKEA 2JX0A 1M2VA 2Y3HA 1IZMA 2P1AA 2XLMA 1KU2A 2NSFA 4JCZA 2OG2A 3EGDA 4YT5A 5L0JA 1RMVA 3C62A 5T3WA 1DOWA 1SF8A 3AG2C 4OIRF 5L3VA 3U5SA 3UGPA 4MVOA 3TJ6A 3TQOA 2XM0A 4MNDA 5DLJA 1ZZPA 2L7AA 4CS8A 1OXKA 3DAGA 1K40A 3GEHA 3JCUQ 4GQHA 1E85A 3V5YA 3AQCA 4YT8A 1FR0A 3A11A 3S90A 3WG7C 3JYYA 3L0IA 2YL3A 2V26A 2ETSA 2YEVA 3GWLA 1VOMA 2CYDA 4MTGA 2XXAA 1CGOA 1VMAA 5HSWA 2EIMC 3DWWA 2LSEA 3FDQA 4XEKA 3J06A 1YAUO 1LM3B 2AP3A 4MVMA 2XM4A 3ITFA 4EHPA 2R7VA 3DD7A 1KTMA 3HNJA 3TD7A 3VAYA 4E7ZA 3DE9A 4JE9A 3LJBA 3EG9A 5A69A 2JD3A 2O9XA 3IQTA 2IXMA 2J8WA 3Q6NA 2EILC 4PR9A 3U9JA 1YA9A 2VH3A 4BJ1A 1VYKA 4PJMA 1VLSA 5JLIA 2EPKX 3MBGA 4Q4ZF 3DJUB 4YL0A 3UMHA 4YL1A 2KGOA 2NUTB 2GAQA 2ZXOA 3T4RA 1OW6A 5KYYA 2ZXRA 2I8BA 3V5XA 4R32A 4YK5A 1QKRA 1T6QA 3LS0A 5A6JA 2E87A 2Y3GA 1BR1A 2IOQA 1PCXA 2QNLA 3N24A 4EIYA 2XS1A 3LNMB 3JRTA 2KQ9A 2HSQA 2UUIA 4JEAA 1G4WR 4PJNA 3X2QC 2QUPA 1LE4A 4J7TA 3T6JA 4NQFA 3QW0A 2ZPAA 3LESA 3U2LA 1A7VA 3HLZA 4U5CE 4XTKA 1ZYRF 2YL7A 2Q00A 2R25A 2ZD9A 2R03A 4YT2A 3L8IA 3GODA
chains in the Genus database with same CATH topology
1ST6A 3KMIA 2L81A 3L34A 4YN0B 2G62A 4B6IA 2WZLA 1MMNA 3NYJA 1OCCC 4CBEA 4DVYP 2J7PD 2Y3BA 4IRUA 2H7VC 4G7HF 1M56C 4PFPA 4BJ5A 4Q5SF 2J7PA 4KBLA 3DM5A 3Q7LA 2CW0F 4KNWA 3DAFA 1M57C 4BJ6C 1MMGA 1NG1A 5FCLA 4G7ZF 2XSEA 1MNDA 3UGOA 5E2QA 3OA1A 4U5EE 4K7BA 2IXPA 2R7SA 5E3CA 3JYHA 3WODF 1ZHWA 2J46A 2WZFA 4O79A 3NYLA 4EBBA 5D91A 4FWVA 1V55C 3RIPA 5DS4A 4LLCA 1MMDA 5IY5C 2W45A 2W9YA 2P6VA 1D0XA 4OIQF 2WVQA 3W2VA 3RFYA 1D1BA 4LLEA 3RYLA 2ZXWC 3QMKA 4CSAA 1VYIA 2L9JA 4EWCA 3S27A 3AG1C 2Y39A 4JJFA 4I1OB 4OIPF 3HJCA 2A69F 3DXJF 1J8MF 1M2VB 2NUPB 3H65A 3KL4A 3EGDB 3KH2A 2WVOA 2YZSA 3W8HA 3EHNA 2WL8A 2J0XA 4BEJA 4P6IC 4AK9A 3W8IA 5CI8A 5B1BC 3SEOA 3VYWA 2W4BA 4KNVA 4KC9A 4AX2A 3CSKA 2NUPA 5T3TA 3EFOB 1VK5A 2M4EA 3DZAA 3QZCA 4RDAA 2J0WA 3K1HA 2NG1A 2QY9A 1BR4A 1Z23A 1Z5ZA 3ZSUA 3MLGA 3CZ6A 3EG9B 3I5PA 2PP4A 3IEEA 3NDBB 2WZGA 2EIKC 3AQBA 4OINF 3EFOA 2KW3C 1D1AA 4O6NA 1MMAA 4OD5A 4F4BA 3AG3C 5KYYB 3OEOA 5EHHA 2KJGA 4I44A 2ZXPA 3AG4C 2PX3A 5F5HA 2GFHA 3I5QA 2PF4E 3DMDA 1LVKA 2Q9AA 2YHSA 2Q9BA 3S28A 2Q9CA 4E7SA 5KYNA 3S29A 2VB6A 2XRHA 4XWJA 4QI2A 2C03A 1BR2A 3SP1A 1D0ZA 2BE5F 4W8KA 1SZIA 1D1CA 3N2ZB 1O87A 3EH2A 3SYNA 2X51A 4PFOA 2A68F 4XLPF 5DQZA 5DQTA 5T1DB 1JPJA 5KYXB 1Z6AA 2J9WA 1V54C 1QZXA 1Z63A 2CDQA 3POVA 2WB7A 3FVYA 3EPVA 4O6MA 3LEVA 1OKKD 4MQ9F 1D0YA 1OCZC 5B1AC 3SZRA 3FAJA 3PHF2 1N1CA 1SMYF 3JSZA 4FESA 4YWQA 4G7OF 1OKKA 3EQLF 5KYXA 3B0VC 4I1MA 2B0JA 2A1DD 4LERA 2A6EF 2A6HF 2Q3TA 4HEAJ 4PJLA 5E3AA 2Y69C 4U5BE 4C3EA 3LS1A 2VASA 1Z3IX 4DBQA 2HV7A 4CS8C 3NG1A 4QI0A 3ABLC 4X0RA 4C3DA 4DVZA 3RKOF 2G3VA 5DVWA 4JVSA 2FGYA 3KKBA 1ZU4A 2FFHA 3ABMC 4H4KC 4CS9A 1FMVA 3MX3A 4JCHA 1IW7F 2R7QA 2R7OA 3T6BA 4ZLDA 1RJ9A 1MNEA 4Q7CA 2P7VA 4HE8D 4U5DE 2R7XA 3E9VA 4YJWA 3NYMA 4JW1A 3LLKA 3S0XA 2R7RA 1ZHXA 4PJJA 4C3BA 3K33A 4JJGA 2Y3DA 5BUOA 4QDLA 4NY3A 3V7OA 1NZEA 1TKNA 4N06A 1ZHTA 1ZHYA 1TWHA 3W2WA 4G0HA 1TWAA 1TR2A 3X1OA 4BJ6A 3GANA 4ULWA 3UMKA 1FFTC 2PFDA 1PD1A 4BJ5C 3K6BA 3ECSA 5KYUB 3Q6MA 3K1IC 5B3SC 5CI9A 2HV6A 3EGXB 3RH3A 1NU7D 4JURI 3ZVRA 3EJNA 2DYSC 1QLEC 3ZG1A 4C7OB 4BG0A 2H7OA 1W2WA 2IYLD 2PX0A 4K0DA 3K66A 4YT4A 4BJTA 5KYUA 2R7UA 2WVNA 4HFKB 4ANJA 1FFHA 3EGXA 3LNRA 4PK4A 4LACB 1M2OA 2R7WA 3FHDA 1TWGA 4C7OA 1FTSA 3DM9B 3ABKC 3B9QA 1LKXA 1S7ZA 4M63A 3SNHA 4OIOF 4J30B 4CS9C 1OCRC 3EZIA 4CSAC 4U5HA 3EH1A 3NRHA 5L3QA 3B0PA 2Z15A 3LAYA 1JPNA 4DOZA 3ASOC 4GEHA 2J9UA 1FMWA 4CIHA 2IXNA 2D5RB 2J45A 3F47A 4O7GA 5E33A 4JZAA 2MWQA 3E70C 3EZHA 2XL4A 2H7BA 2DGJA 2W4MA 4AE4B 4J32B 3N0TA 3F46A 1NU9C 3EHMA 5DS6A 4IJJA 3UR3C 4WJ0A 2IXOA 4U5FE 1WGWA 4IAOA 1RJ9B 5D92A 1LS1A 4FX5A 4RBNA 2OCCC 4AE4A 3Q7GA 4HFFB 4A2NB 1ZHZA 3O6XA 1TWCA 2CGEA 3CQZA 4I3MA 5KYWB 4KI2A 3M1CB 1O5HA 2C04A 2EINC 1ZU5A 3ZC4A 4RD9A 3LLIA 4E7ZA 3O39A 3I4UA 2CNWD 2DYRC 3ASNC 3OWTA 4O6YA 2CNWA 3UNGC 5KYWA 4U5GA 4XLNF 5DS5A 3HTKC 4IWBA 4OD4A 5EGYA 2J9VA 3B0UX 1OCOC 1PD0A 2EIJC 3UMIA 2R7TA 4ZLCA 3K7DA 4CS7A 2QTVA 3ZIBA 3PMRA 3JT1A 2G3KA 1J8YF 5F5FA 2MYSA 4GYTA 3DJNB 1G8XA 2KNHA 3NKEA 1M2VA 2Y3HA 1IZMA 1KU2A 2OG2A 3EGDA 4YT5A 2XXAB 5T3WA 1SF8A 3AG2C 4OIRF 5L3VA 3UGPA 4MNDA 5DLJA 4CS8A 3DAGA 3JCUQ 3AQCA 4YT8A 3WG7C 3GODA 3L0IA 2V26A 2YEVA 1VOMA 2XXAA 1VMAA 5HSWA 2EIMC 3FDQA 2LSEA 3ITFA 2R7VA 3DD7A 3TD7A 3VAYA 3LJBA 3EG9A 2JD3A 2O9XA 2IXMA 3Q6NA 2EILC 4BJ1A 4DBRA 2VH3A 1VYKA 4PJMA 4Q4ZF 3DJUB 3UMHA 2KGOA 2NUTB 3T4RA 2ZXOA 5KYYA 2ZXRA 2I8BA 3LS0A 2E87A 2Y3GA 1BR1A 2IOQA 1PCXA 3N24A 3JRTA 2KQ9A 4PJNA 3X2QC 3T6JA 2ZPAA 3LESA 4U5CE 3HLZA 4XTKA 1ZYRF 2V3CC 4YT2A 2NUTA 3NKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1I C;  3K1H A; 
#chains in the Genus database with same CATH topology
 2H8A A;  1ST6 A;  3KMI A;  2RD9 A;  2L81 A;  3L34 A;  4MW8 A;  4WGY A;  4YN0 B;  5COM A;  3ZTM A;  2AWY A;  2G62 A;  4DRJ B;  4E17 A;  5JS5 A;  3ZDL A;  4B6I A;  2WZL A;  1MMN A;  3NYJ A;  1OCC C;  3SXZ A;  4CBE A;  4D4N A;  2J7P D;  4DVY P;  2Y3B A;  4MTO A;  1Q0G A;  1YZC A;  2H7V C;  4IRU A;  1U0B B;  3LEO A;  5JP7 A;  1YZA A;  4ER9 A;  2GWW A;  4G7H F;  1M56 C;  2KSF A;  4PFP A;  4U9E A;  5AGF A;  4BJ5 A;  1UG7 A;  1C03 A;  4Q5S F;  2P0N A;  2LP4 A;  2J7P A;  3K1I A;  5EK0 A;  5L0C A;  4KBL A;  3DM5 A;  1H6G A;  3G4X A;  4JTA B;  3DE8 A;  3Q7L A;  2CW0 F;  4KNW A;  4YL3 A;  4E0H A;  3BEH A;  2LD6 A;  3DAF A;  1SYQ A;  1M57 C;  1LIH A;  4BJ6 C;  1MMG A;  1NG1 A;  5FCL A;  1NSG B;  4G7Z F;  2XSE A;  1LE2 A;  1MND A;  4NCQ A;  5E2Q A;  1VB5 A;  3UGO A;  3OA1 A;  1HY5 A;  4U5E E;  4K7B A;  2IXP A;  3O55 A;  2R7S A;  5E3C A;  3JYH A;  2EPN A;  3RQG A;  1C17 M;  3WOD F;  3T9O A;  2X0C A;  1ZHW A;  2J46 A;  2XLH A;  2WZF A;  4O79 A;  3NYL A;  2LIG A;  4EBB A;  5D91 A;  4KI2 A;  1YJG A;  4FWV A;  2IM8 A;  1C02 A;  1V55 C;  3NKD A;  4NTA A;  4K1O A;  4EBJ A;  3RIP A;  5DS4 A;  1Y6D A;  3U8V A;  1G4U S;  4LLC A;  4A4A A;  1MMD A;  1E2X A;  3HNK A;  5IY5 C;  2W45 A;  2W9Y A;  2TMV P;  2P6V A;  3GM2 A;  1D0X A;  1I4Y A;  2Q7R A;  4CDV A;  4OIQ F;  1LI5 A;  3MYF A;  3PCV A;  2WVQ A;  3W2V A;  5L0I A;  3IQ6 A;  3B71 A;  3RFY A;  2AU5 A;  1A7D A;  1D1B A;  4LLE A;  3RYL A;  2ZXW C;  3QMK A;  4MW3 A;  4CSA A;  4JTC B;  1VYI A;  2L9J A;  4EWC A;  3S27 A;  3AG1 C;  2Y39 A;  4JJF A;  2OQM A;  2KC3 A;  3TOM A;  4I1O B;  4OIP F;  3HJC A;  1RXQ A;  2A69 F;  3H2V A;  3DXJ F;  3LUT B;  1J8M F;  1M2V B;  2A0B A;  2MHR A;  2NUP B;  1U6H A;  3H65 A;  2OU6 A;  3KL4 A;  3NMK A;  3EGD B;  3RQE A;  3U8P A;  1HW1 A;  5CIV A;  1U89 A;  2WVO A;  2YZS A;  3KH2 A;  1T01 A;  3W8H A;  1T9K A;  2WL8 A;  3EHN A;  4DRH B;  2J0X A;  4WAB A;  3NMI A;  4BEJ A;  4P6I C;  2VCC A;  4U9D A;  3S84 A;  2P61 A;  4AK9 A;  2OJQ A;  5CI8 A;  5B1B C;  3W8I A;  2V3C C;  3SEO A;  1FAP B;  4MS2 A;  3VYW A;  2W4B A;  4KNV A;  4NTB A;  3TUL A;  4KC9 A;  4IAR A;  4AX2 A;  3CSK A;  2NUP A;  3QVY A;  1OW8 A;  3EFO B;  1VK5 A;  5T3T A;  5AC5 A;  2M4E A;  5KYW B;  3S9O A;  3DZA A;  3QZC A;  1H9G A;  2GDC A;  1JAF A;  4RDA A;  4DXW A;  5L0D A;  1Y4C A;  2J0W A;  3K1H A;  5JVE A;  2NG1 A;  2QY9 A;  1BR4 A;  1Z23 A;  1Z5Z A;  3ZSU A;  1Q0M A;  3MLG A;  3CZ6 A;  3EG9 B;  2VCA A;  3I5P A;  4BPM A;  2NSG A;  2PP4 A;  3IEE A;  3NDB B;  2WZG A;  2EIK C;  3AQB A;  3KYI A;  4MVU A;  4OIN F;  3EFO A;  2KW3 C;  1D1A A;  1K05 A;  1NLX A;  1MMA A;  4N6C A;  4O6N A;  1TFO B;  5FZT A;  5BQI A;  4OD5 A;  4F4B A;  3AG3 C;  1YAR O;  5KYY B;  3OEO A;  1WOL A;  1ORS C;  3IPM O;  2KJG A;  5EHH A;  2A0U A;  4I44 A;  2ZXP A;  3SXM A;  2XXA B;  3AG4 C;  1Q0K A;  5GPG B;  5K0I A;  2PX3 A;  5F5H A;  3U9M A;  1EQ1 A;  2B0H A;  3TJ5 A;  3IQ5 A;  2GFH A;  3I5Q A;  2PF4 E;  3DMD A;  1LVK A;  2Q9A A;  4P9F A;  2HKV A;  4JC7 A;  2YHS A;  1AUE A;  2Q9B A;  2NUT A;  2LQG A;  3C7J A;  1HW2 A;  3S28 A;  2XLO A;  2Q9C A;  1BZ4 A;  2OKU A;  4E7S A;  5KYN A;  1R4T A;  3S29 A;  2VB6 A;  3ZQV A;  2XRH A;  4XWJ A;  4QI2 A;  2C03 A;  3RVY A;  1BR2 A;  4LDR A;  3SP1 A;  1D0Z A;  2BE5 F;  4W8K A;  1ORY A;  1SZI A;  5TJ5 E;  3B29 A;  1D1C A;  3C8G D;  3N2Z B;  1O87 A;  2QLA A;  3EH2 A;  4NTF A;  3SYN A;  4IAQ A;  2X51 A;  4IB4 A;  4N4W A;  4PFO A;  2A68 F;  4XLP F;  2KK1 A;  5DQZ A;  1S05 A;  2HZ8 A;  5T1D B;  1JPJ A;  5DQT A;  3VM6 A;  5KYX B;  3US6 A;  1Z6A A;  3C8G A;  2J9W A;  1V54 C;  3H2U A;  1QZX A;  2YRF A;  3HNL A;  2LCH A;  5JSL A;  1Z63 A;  2CDQ A;  2NPU A;  2R02 A;  1H9T A;  4JEB A;  3POV A;  2WB7 A;  3FVY A;  3EPV A;  4O6M A;  4XPX A;  3LEV A;  2R9R B;  2OOC A;  5A6A A;  1OKK D;  4MQ9 F;  4MVQ A;  1D0Y A;  3FXH A;  1M6T A;  5AC4 A;  1OCZ C;  1Q0F A;  5B1A C;  3SZR A;  3G4Z A;  4W8P A;  3FAJ A;  3U3F A;  3PHF 2;  4NC3 A;  4FAP B;  1N1C A;  1SMY F;  3JSZ A;  4FES A;  1APC A;  4YWQ A;  4G7O F;  1OKK A;  3EQL F;  3SXK A;  5KYX A;  3B0V C;  4I1M A;  3JZ0 A;  2B0J A;  2EPO A;  4P9T A;  2YL0 A;  1CPR A;  2A1D D;  2YQY A;  3JRM O;  2XLD A;  4LER A;  2A6E F;  2A6H F;  1VLT A;  2Q3T A;  3CEX A;  4HEA J;  4PJL A;  1EA8 A;  5E3A A;  4D4X A;  1A7E A;  2Y69 C;  4U5B E;  1V4A A;  4C3E A;  1HE1 A;  3LS1 A;  4WGZ A;  2VAS A;  4DBR A;  1H7I A;  1Z3I X;  4DBQ A;  3CAX A;  1GS9 A;  2HV7 A;  3NG1 A;  4QI0 A;  4CS8 C;  3GOR A;  3ABL C;  4X0R A;  2BL2 A;  4C3D A;  3MFN A;  3M4C A;  4DVZ A;  2LFF A;  2VCB A;  2HSB A;  1Z7Q c;  3RKO F;  3C8Z A;  2G3V A;  5DVW A;  2HMZ A;  3JSE O;  4XEF A;  3HNI A;  4JVS A;  4CJG A;  2FGY A;  1OR2 A;  1T6I A;  3KKB A;  4LDK A;  1ZU4 A;  2FFH A;  3ABM C;  4H4K C;  4XEV A;  4MTF A;  4CS9 A;  1FMV A;  4XPW A;  2YLI A;  3MX3 A;  4JCH A;  1IW7 F;  2R7Q A;  2R7O A;  2I15 A;  1CPQ A;  3C18 A;  3T6B A;  4ZLD A;  1RJ9 A;  2BC5 A;  1MNE A;  4Q7C A;  3WHN A;  2P7V A;  4HE8 D;  2AWC A;  4U5D E;  4E0I A;  2R7X A;  1ZW2 A;  3E9V A;  3DI5 A;  4YJW A;  3NYM A;  4JW1 A;  3LLK A;  3RF3 A;  4IGG A;  1JMW A;  2GA0 A;  4XPY A;  1MQV A;  3S0X A;  2R7R A;  4JIO A;  1ZHX A;  4PJJ A;  4G78 A;  4C3B A;  1V74 B;  2HMQ A;  3JTL O;  3K33 A;  4JJG A;  1TQG A;  2Y3D A;  1CGM E;  3DKA A;  1A41 A;  3G50 A;  1GGQ A;  3IQC A;  4QDL A;  5BUO A;  4NY3 A;  3V7O A;  1NZE A;  1TKN A;  3GWN A;  5F28 E;  1QSP A;  2XS8 A;  4LDQ A;  4N06 A;  4ONS A;  1Q0D A;  256B A;  3ZQY A;  1ZHT A;  1ZHY A;  1TWH A;  3C63 A;  3HKK A;  2YWA A;  1F1M A;  3W2W A;  3VRC A;  2LFD A;  4MVZ A;  1GM5 A;  1WAT A;  3RW0 A;  3FOO A;  2QE9 A;  2ASR A;  3QW1 A;  1B68 A;  4G0H A;  2HJM A;  1TWA A;  1OR3 A;  1TR2 A;  3X1O A;  4BJ6 A;  3GAN A;  5A6B D;  1NBB A;  1ORJ A;  4ULW A;  3UMK A;  1A0B A;  2DB4 A;  3MYI A;  3QTH A;  1RKE A;  1FFT C;  4Z9J A;  1G5Z A;  2PFD A;  1PD1 A;  4BJ5 C;  3K6B A;  1KNY A;  3ECS A;  5KYU B;  3Q6M A;  2JPU A;  3K1I C;  5B3S C;  5A6B A;  1YYX A;  5CI9 A;  1ZVZ A;  3SXY A;  2L6G A;  2HV6 A;  3EGX B;  3ZTZ A;  1XZP A;  3RH3 A;  1NU7 D;  2F22 A;  4JUR I;  3EJN A;  3U3B A;  3ZVR A;  2DYS C;  1QLE C;  1HMO A;  2UUH A;  3ZG1 A;  2YVK A;  4BG0 A;  4C7O B;  1E86 A;  1AVO B;  2H7O A;  1W2W A;  2IYL D;  5COG A;  3T6G B;  1NFN A;  2PX0 A;  1WTY A;  5JRA A;  4K0D A;  3K66 A;  4AL1 A;  2HFI A;  4YT4 A;  2YLG A;  5KYU A;  4BJT A;  3IHU A;  3BRJ A;  1E84 A;  2R7U A;  2L6F A;  2WVN A;  4HFK B;  4ANJ A;  1RKC A;  1FFH A;  1YDI A;  3EGX A;  1CGN A;  3LNR A;  4CDY A;  4PK4 A;  3C8G B;  4LAC B;  1M2O A;  1DOV A;  1OW7 A;  3ATP A;  1E83 A;  2R7W A;  3FHD A;  3R7C A;  1SR2 A;  1TWG A;  3W4Y A;  3ZWI A;  4C7O A;  3AGT A;  1FTS A;  1NFO A;  3DM9 B;  4CX9 A;  3ABK C;  2XL6 A;  3B9Q A;  3L1M A;  2OEX A;  4XQ1 A;  1LKX A;  3M15 A;  1S7Z A;  4M63 A;  3SNH A;  5JUA A;  4OIO F;  4J30 B;  3GM3 A;  4CS9 C;  1HMD A;  2PBE A;  1OCR C;  1T6U A;  1FNT c;  3EZI A;  4DRI B;  2XL8 A;  4CDA A;  4CSA C;  1QVX A;  2FAP B;  3EH1 A;  4U5H A;  3R2P A;  3U0C A;  3NRH A;  2XLV A;  1YLM A;  5L3Q A;  2EPM X;  3B0P A;  2Z15 A;  2HS5 A;  3LAY A;  1JPN A;  4ULV A;  4DOZ A;  3ASO C;  3O10 A;  2J9U A;  1FMW A;  4GEH A;  1YA7 O;  4PAC A;  4CIH A;  4BEM J;  2IXN A;  2D5R B;  2J45 A;  3F47 A;  2XLE A;  4O7G A;  4EUK B;  2DI3 A;  1T5O A;  1LI7 A;  1TFK B;  5E33 A;  1OXB A;  1LPE A;  4JZA A;  3WAQ A;  2MWQ A;  3E70 C;  3EZH A;  2RSE B;  1HE9 A;  2XL4 A;  3FOP A;  1EI7 A;  2YL1 A;  2OJE D;  2H7B A;  2DGJ A;  2W4M A;  4AE4 B;  1I4Z A;  4EKW A;  1I5N A;  4J32 B;  3FAP B;  3N0T A;  3F46 A;  2J9B A;  1NU9 C;  3EHM A;  4UDV A;  2VC9 A;  3M79 A;  5DS6 A;  4IJJ A;  3UR3 C;  2HJ3 A;  1BDJ B;  3V5Z A;  4WJ0 A;  1L7C A;  2IXO A;  4U5F E;  3GM1 A;  1WGW A;  3KPH A;  5L0G A;  4IAO A;  2AVK A;  4DJ9 A;  3GEI A;  1RJ9 B;  2PNO A;  3GEE A;  1VTM P;  5D92 A;  5BQH A;  1WWP A;  1LS1 A;  4Z9H A;  4FX5 A;  4RBN A;  4CIP A;  2OCC C;  3TK0 A;  5HV9 A;  4AE4 A;  3Q7G A;  4N6H A;  5A6K A;  4HFF B;  1QQ3 A;  4A2N B;  1ZHZ A;  3O6X A;  1TWC A;  2CGE A;  3CQZ A;  4I3M A;  3RVZ A;  4EBK A;  3M1C B;  3M4B A;  1ZW3 A;  1O5H A;  3U2M A;  2YKZ A;  2C04 A;  2EIN C;  1ZU5 A;  3ZC4 A;  4RD9 A;  3NMJ A;  2OEV A;  3LLI A;  1XZQ A;  1PV3 A;  3I4U A;  3KYJ A;  3O39 A;  4JKV A;  5COF A;  4Z9I A;  2CNW D;  2M64 A;  4JTD B;  5JT4 A;  2Q4F A;  3AGU A;  4J7Y A;  2DYR C;  3ASN C;  1QPU A;  4E18 A;  3OWT A;  4L6R A;  1L3P A;  4O6Y A;  1GQA A;  1O3U A;  3FMS A;  2D4U A;  2CNW A;  3UNG C;  4CJO A;  3L8J A;  2HUJ A;  3QVZ A;  2ICW G;  5KYW A;  1EKY A;  3AOU A;  1WN0 A;  4U5G A;  4XLN F;  5DS5 A;  1JR8 A;  2IBF A;  3VF0 A;  3HTK C;  1XWJ A;  1YYJ A;  4IWB A;  4JRZ A;  1AEP A;  1JRA A;  2YLD A;  4MVS A;  2LK4 A;  4OD4 A;  5EGY A;  4MVR A;  2J9V A;  2L6H A;  4H54 A;  2CCY A;  3B0U X;  1OCO C;  5B3I A;  1OQC A;  3TOL A;  1BBH A;  2EPL X;  1PD0 A;  2R05 A;  5L0F A;  1RKE B;  4AL0 A;  2EIJ C;  3UMI A;  2XLW A;  3AJM A;  2R7T A;  1WAS A;  4ZLC A;  3A9C A;  5L0H A;  1RCP A;  1R5I D;  3K7D A;  4CS7 A;  2QTV A;  3ZIB A;  3PMR A;  3JT1 A;  2G3K A;  1JOG A;  3PDM P;  1J8Y F;  1LS4 A;  5F5F A;  1UFB A;  2MYS A;  4GYT A;  3DJN B;  1K04 A;  3RQF A;  1G8X A;  1YVI A;  5BQG A;  2KNH A;  2KYH A;  3NKE A;  2JX0 A;  1M2V A;  2Y3H A;  1IZM A;  2P1A A;  2XLM A;  1KU2 A;  2NSF A;  4JCZ A;  2OG2 A;  3EGD A;  4YT5 A;  5L0J A;  1RMV A;  3C62 A;  5T3W A;  1DOW A;  1SF8 A;  3AG2 C;  4OIR F;  5L3V A;  3U5S A;  3UGP A;  4MVO A;  3TJ6 A;  3TQO A;  2XM0 A;  4MND A;  5DLJ A;  1ZZP A;  2L7A A;  4CS8 A;  1OXK A;  3DAG A;  1K40 A;  3GEH A;  3JCU Q;  4GQH A;  1E85 A;  3V5Y A;  3AQC A;  4YT8 A;  1FR0 A;  3A11 A;  3S90 A;  3WG7 C;  3JYY A;  3L0I A;  2YL3 A;  2V26 A;  2ETS A;  2YEV A;  3GWL A;  1VOM A;  2CYD A;  4MTG A;  2XXA A;  1CGO A;  1VMA A;  5HSW A;  2EIM C;  3DWW A;  2LSE A;  3FDQ A;  4XEK A;  3J06 A;  1YAU O;  1LM3 B;  2AP3 A;  4MVM A;  2XM4 A;  3ITF A;  4EHP A;  2R7V A;  3DD7 A;  1KTM A;  3HNJ A;  3TD7 A;  3VAY A;  4E7Z A;  3DE9 A;  4JE9 A;  3LJB A;  3EG9 A;  5A69 A;  2JD3 A;  2O9X A;  3IQT A;  2IXM A;  2J8W A;  3Q6N A;  2EIL C;  4PR9 A;  3U9J A;  1YA9 A;  2VH3 A;  4BJ1 A;  1VYK A;  4PJM A;  1VLS A;  5JLI A;  2EPK X;  3MBG A;  4Q4Z F;  3DJU B;  4YL0 A;  3UMH A;  4YL1 A;  2KGO A;  2NUT B;  2GAQ A;  2ZXO A;  3T4R A;  1OW6 A;  5KYY A;  2ZXR A;  2I8B A;  3V5X A;  4R32 A;  4YK5 A;  1QKR A;  1T6Q A;  3LS0 A;  5A6J A;  2E87 A;  2Y3G A;  1BR1 A;  2IOQ A;  1PCX A;  2QNL A;  3N24 A;  4EIY A;  2XS1 A;  3LNM B;  3JRT A;  2KQ9 A;  2HSQ A;  2UUI A;  4JEA A;  1G4W R;  4PJN A;  3X2Q C;  2QUP A;  1LE4 A;  4J7T A;  3T6J A;  4NQF A;  3QW0 A;  2ZPA A;  3LES A;  3U2L A;  1A7V A;  3HLZ A;  4U5C E;  4XTK A;  1ZYR F;  2YL7 A;  2Q00 A;  2R25 A;  2ZD9 A;  2R03 A;  4YT2 A;  3L8I A;  3GOD A; 
#chains in the Genus database with same CATH homology
 1ST6 A;  3KMI A;  2L81 A;  3L34 A;  4YN0 B;  2G62 A;  4B6I A;  2WZL A;  1MMN A;  3NYJ A;  1OCC C;  4CBE A;  4DVY P;  2J7P D;  2Y3B A;  4IRU A;  2H7V C;  4G7H F;  1M56 C;  4PFP A;  4BJ5 A;  4Q5S F;  2J7P A;  4KBL A;  3DM5 A;  3Q7L A;  2CW0 F;  4KNW A;  3DAF A;  1M57 C;  4BJ6 C;  1MMG A;  1NG1 A;  5FCL A;  4G7Z F;  2XSE A;  1MND A;  3UGO A;  5E2Q A;  3OA1 A;  4U5E E;  4K7B A;  2IXP A;  2R7S A;  5E3C A;  3JYH A;  3WOD F;  1ZHW A;  2J46 A;  2WZF A;  4O79 A;  3NYL A;  4EBB A;  5D91 A;  4FWV A;  1V55 C;  3RIP A;  5DS4 A;  4LLC A;  1MMD A;  5IY5 C;  2W45 A;  2W9Y A;  2P6V A;  1D0X A;  4OIQ F;  2WVQ A;  3W2V A;  3RFY A;  1D1B A;  4LLE A;  3RYL A;  2ZXW C;  3QMK A;  4CSA A;  1VYI A;  2L9J A;  4EWC A;  3S27 A;  3AG1 C;  2Y39 A;  4JJF A;  4I1O B;  4OIP F;  3HJC A;  2A69 F;  3DXJ F;  1J8M F;  1M2V B;  2NUP B;  3H65 A;  3KL4 A;  3EGD B;  3KH2 A;  2WVO A;  2YZS A;  3W8H A;  3EHN A;  2WL8 A;  2J0X A;  4BEJ A;  4P6I C;  4AK9 A;  3W8I A;  5CI8 A;  5B1B C;  3SEO A;  3VYW A;  2W4B A;  4KNV A;  4KC9 A;  4AX2 A;  3CSK A;  2NUP A;  5T3T A;  3EFO B;  1VK5 A;  2M4E A;  3DZA A;  3QZC A;  4RDA A;  2J0W A;  3K1H A;  2NG1 A;  2QY9 A;  1BR4 A;  1Z23 A;  1Z5Z A;  3ZSU A;  3MLG A;  3CZ6 A;  3EG9 B;  3I5P A;  2PP4 A;  3IEE A;  3NDB B;  2WZG A;  2EIK C;  3AQB A;  4OIN F;  3EFO A;  2KW3 C;  1D1A A;  4O6N A;  1MMA A;  4OD5 A;  4F4B A;  3AG3 C;  5KYY B;  3OEO A;  5EHH A;  2KJG A;  4I44 A;  2ZXP A;  3AG4 C;  2PX3 A;  5F5H A;  2GFH A;  3I5Q A;  2PF4 E;  3DMD A;  1LVK A;  2Q9A A;  2YHS A;  2Q9B A;  3S28 A;  2Q9C A;  4E7S A;  5KYN A;  3S29 A;  2VB6 A;  2XRH A;  4XWJ A;  4QI2 A;  2C03 A;  1BR2 A;  3SP1 A;  1D0Z A;  2BE5 F;  4W8K A;  1SZI A;  1D1C A;  3N2Z B;  1O87 A;  3EH2 A;  3SYN A;  2X51 A;  4PFO A;  2A68 F;  4XLP F;  5DQZ A;  5DQT A;  5T1D B;  1JPJ A;  5KYX B;  1Z6A A;  2J9W A;  1V54 C;  1QZX A;  1Z63 A;  2CDQ A;  3POV A;  2WB7 A;  3FVY A;  3EPV A;  4O6M A;  3LEV A;  1OKK D;  4MQ9 F;  1D0Y A;  1OCZ C;  5B1A C;  3SZR A;  3FAJ A;  3PHF 2;  1N1C A;  1SMY F;  3JSZ A;  4FES A;  4YWQ A;  4G7O F;  1OKK A;  3EQL F;  5KYX A;  3B0V C;  4I1M A;  2B0J A;  2A1D D;  4LER A;  2A6E F;  2A6H F;  2Q3T A;  4HEA J;  4PJL A;  5E3A A;  2Y69 C;  4U5B E;  4C3E A;  3LS1 A;  2VAS A;  1Z3I X;  4DBQ A;  2HV7 A;  4CS8 C;  3NG1 A;  4QI0 A;  3ABL C;  4X0R A;  4C3D A;  4DVZ A;  3RKO F;  2G3V A;  5DVW A;  4JVS A;  2FGY A;  3KKB A;  1ZU4 A;  2FFH A;  3ABM C;  4H4K C;  4CS9 A;  1FMV A;  3MX3 A;  4JCH A;  1IW7 F;  2R7Q A;  2R7O A;  3T6B A;  4ZLD A;  1RJ9 A;  1MNE A;  4Q7C A;  2P7V A;  4HE8 D;  4U5D E;  2R7X A;  3E9V A;  4YJW A;  3NYM A;  4JW1 A;  3LLK A;  3S0X A;  2R7R A;  1ZHX A;  4PJJ A;  4C3B A;  3K33 A;  4JJG A;  2Y3D A;  5BUO A;  4QDL A;  4NY3 A;  3V7O A;  1NZE A;  1TKN A;  4N06 A;  1ZHT A;  1ZHY A;  1TWH A;  3W2W A;  4G0H A;  1TWA A;  1TR2 A;  3X1O A;  4BJ6 A;  3GAN A;  4ULW A;  3UMK A;  1FFT C;  2PFD A;  1PD1 A;  4BJ5 C;  3K6B A;  3ECS A;  5KYU B;  3Q6M A;  3K1I C;  5B3S C;  5CI9 A;  2HV6 A;  3EGX B;  3RH3 A;  1NU7 D;  4JUR I;  3ZVR A;  3EJN A;  2DYS C;  1QLE C;  3ZG1 A;  4C7O B;  4BG0 A;  2H7O A;  1W2W A;  2IYL D;  2PX0 A;  4K0D A;  3K66 A;  4YT4 A;  4BJT A;  5KYU A;  2R7U A;  2WVN A;  4HFK B;  4ANJ A;  1FFH A;  3EGX A;  3LNR A;  4PK4 A;  4LAC B;  1M2O A;  2R7W A;  3FHD A;  1TWG A;  4C7O A;  1FTS A;  3DM9 B;  3ABK C;  3B9Q A;  1LKX A;  1S7Z A;  4M63 A;  3SNH A;  4OIO F;  4J30 B;  4CS9 C;  1OCR C;  3EZI A;  4CSA C;  4U5H A;  3EH1 A;  3NRH A;  5L3Q A;  3B0P A;  2Z15 A;  3LAY A;  1JPN A;  4DOZ A;  3ASO C;  4GEH A;  2J9U A;  1FMW A;  4CIH A;  2IXN A;  2D5R B;  2J45 A;  3F47 A;  4O7G A;  5E33 A;  4JZA A;  2MWQ A;  3E70 C;  3EZH A;  2XL4 A;  2H7B A;  2DGJ A;  2W4M A;  4AE4 B;  4J32 B;  3N0T A;  3F46 A;  1NU9 C;  3EHM A;  5DS6 A;  4IJJ A;  3UR3 C;  4WJ0 A;  2IXO A;  4U5F E;  1WGW A;  4IAO A;  1RJ9 B;  5D92 A;  1LS1 A;  4FX5 A;  4RBN A;  2OCC C;  4AE4 A;  3Q7G A;  4HFF B;  4A2N B;  1ZHZ A;  3O6X A;  1TWC A;  2CGE A;  3CQZ A;  4I3M A;  5KYW B;  4KI2 A;  3M1C B;  1O5H A;  2C04 A;  2EIN C;  1ZU5 A;  3ZC4 A;  4RD9 A;  3LLI A;  4E7Z A;  3O39 A;  3I4U A;  2CNW D;  2DYR C;  3ASN C;  3OWT A;  4O6Y A;  2CNW A;  3UNG C;  5KYW A;  4U5G A;  4XLN F;  5DS5 A;  3HTK C;  4IWB A;  4OD4 A;  5EGY A;  2J9V A;  3B0U X;  1OCO C;  1PD0 A;  2EIJ C;  3UMI A;  2R7T A;  4ZLC A;  3K7D A;  4CS7 A;  2QTV A;  3ZIB A;  3PMR A;  3JT1 A;  2G3K A;  1J8Y F;  5F5F A;  2MYS A;  4GYT A;  3DJN B;  1G8X A;  2KNH A;  3NKE A;  1M2V A;  2Y3H A;  1IZM A;  1KU2 A;  2OG2 A;  3EGD A;  4YT5 A;  2XXA B;  5T3W A;  1SF8 A;  3AG2 C;  4OIR F;  5L3V A;  3UGP A;  4MND A;  5DLJ A;  4CS8 A;  3DAG A;  3JCU Q;  3AQC A;  4YT8 A;  3WG7 C;  3GOD A;  3L0I A;  2V26 A;  2YEV A;  1VOM A;  2XXA A;  1VMA A;  5HSW A;  2EIM C;  3FDQ A;  2LSE A;  3ITF A;  2R7V A;  3DD7 A;  3TD7 A;  3VAY A;  3LJB A;  3EG9 A;  2JD3 A;  2O9X A;  2IXM A;  3Q6N A;  2EIL C;  4BJ1 A;  4DBR A;  2VH3 A;  1VYK A;  4PJM A;  4Q4Z F;  3DJU B;  3UMH A;  2KGO A;  2NUT B;  3T4R A;  2ZXO A;  5KYY A;  2ZXR A;  2I8B A;  3LS0 A;  2E87 A;  2Y3G A;  1BR1 A;  2IOQ A;  1PCX A;  3N24 A;  3JRT A;  2KQ9 A;  4PJN A;  3X2Q C;  3T6J A;  2ZPA A;  3LES A;  4U5C E;  3HLZ A;  4XTK A;  1ZYR F;  2V3C C;  4YT2 A;  2NUT A;  3NKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...