3K1IC

Crystal strcture of flis-hp1076 complex in h. pylori
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
119
structure length
119
Chain Sequence
QQIAKFSRDMKNINESVGALQVLQIACKKLFNKSMGLEDKDALQASIIKQELREIVENCQFLASPLFDTQLNIAINDEIFSMIVVNPLDLLENVGEFQAYLEEKLNEIKELLGYLSESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular interaction of flagellar export chaperone FliS and cochaperone HP1076 in Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Chaperone
molecule keywords Flagellar protein
total genus 40
structure length 119
sequence length 119
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16522 FliS_cochap Flagellar FLiS export co-chaperone, HP1076
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1890 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3k1iC00
3K1HA 3K1IC
chains in the Genus database with same CATH superfamily
5B1AC 4JIOA 1JMWA 2YEVA 4Q7CA 3H2VA 4AE4B 5AGFA 4OIPF 2KC3A 4IWBA 2CNWA 4Z9JA 3GEHA 3AGTA 3DE8A 3MFNA 2NUTB 2V26A 3U9JA 5DS5A 2AP3A 4AL0A 5KYWB 4BJTA 1XZPA 2WB7A 5L0HA 3C8GA 4CX9A 1CPRA 1T5OA 4XLNF 3KMIA 4HEAJ 4P6IC 5A6JA 1Q0DA 1QLEC 1YA7O 2L6HA 3CAXA 4U5GA 3O39A 4BJ5C 4Z9IA 5L0JA 1FTSA 3ITFA 3S90A 3B0VC 3VF0A 1E85A 4LDQA 2IM8A 3UGPA 1RKCA 1OCCC 4N6CA 1T6UA 4QI2A 2YKZA 3LESA 4CS8C 3NYLA 3ATPA 2OU6A 2HZ8A 4A4AA 2HV6A 2L7AA 3TK0A 3V5XA 2Q7RA 5L3VA 2NSFA 1D1CA 3ZDLA 4NTFA 1NBBA 3J06A 2RSEB 1G4WR 1A7EA 1BBHA 5D91A 5E3CA 5JUAA 4YT2A 1FAPB 4K7BA 3K6BA 1UFBA 4GEHA 4GYTA 5TJ5E 3WODF 4KNVA 3DE9A 4M63A 4CBEA 1OW8A 2Y39A 4CJGA 2IYLD 2VC9A 4HE8D 1R5ID 3H2UA 3OA1A 2L6GA 3EZHA 3TOLA 3IEEA 4B6IA 3AG3C 5T1DB 2I8BA 2IOQA 1WATA 1YVIA 2XS8A 3IQ5A 3QVYA 1YDIA 2FFHA 4MQ9F 4N06A 2XLMA 3UMHA 2LCHA 3JRMO 3AG2C 1WTYA 2HSQA 2VCCA 4O79A 1D1AA 3W8IA 3HLZA 1BR4A 1H7IA 2A6EF 1JPNA 2XL4A 4BJ1A 1OCZC 4YT8A 1C17M 1KU2A 2QE9A 2R7WA 2V3CC 2PX0A 3GODA 3OEOA 3HKKA 256BA 2A68F 2OEXA 3QTHA 1A0BA 5F5HA 3H65A 1HW1A 4IGGA 1GGQA 2EPOA 5L0DA 3TOMA 5A6AA 2FGYA 1W2WA 2XS1A 4QDLA 3RFYA 3FHDA 3HNLA 4E7SA 2OJED 2Y3DA 2LP4A 3BEHA 5KYUB 4EIYA 1JPJA 2L6FA 1MMAA 2OOCA 2PF4E 4JKVA 3KPHA 1TQGA 2J9UA 3QMKA 2XLWA 1FMVA 1ZVZA 2AWCA 2Q00A 3EH1A 2LD6A 3LEOA 1AVOB 3TD7A 2IXMA 3ZSUA 2H7BA 1SR2A 4DJ9A 2FAPB 2DGJA 2KJGA 2P61A 3NMJA 4O6MA 4BEJA 3N2ZB 2XM0A 3JCUQ 4JE9A 4JW1A 4DBQA 1C03A 2EIJC 4FAPB 4H54A 4LDKA 2R25A 1GM5A 2LFDA 4G7HF 3S0XA 4DVYP 3Q6NA 1FR0A 2OG2A 1LKXA 2HKVA 1DOVA 1ZHYA 3W4YA 4CS8A 3ZTMA 3MX3A 3ASNC 1H6GA 1QVXA 1MMGA 2ETSA 3FMSA 1Q0FA 4U5CE 3SXKA 5KYUA 2IBFA 4KI2A 1K40A 4FWVA 2VCAA 3QVZA 2UUIA 3O6XA 4X0RA 4CIHA 3FOOA 4UDVA 2B0HA 2CNWD 4OINF 5A6KA 2MWQA 2OCCC 4AL1A 1SZIA 3LS1A 3EG9B 1VLSA 1FFTC 2BC5A 2OJQA 3B29A 3AG4C 3C8GB 5COMA 2J7PD 5F28E 1G8XA 3U0CA 5T3WA 1LI7A 3B71A 4Z9HA 3KYJA 3Q7LA 4J7YA 2HMQA 1MNEA 4RDAA 3L1MA 1Z6AA 1Q0GA 2IXNA 4YL3A 3ZIBA 5B3IA 5IY5C 1TWGA 3R2PA 2PNOA 3DJUB 1OKKD 2GWWA 3NYJA 5JP7A 1T9KA 1BR1A 1M6TA 2JPUA 1OXBA 1U6HA 1WASA 2AU5A 4JRZA 5L3QA 3SP1A 1T01A 1N1CA 3F46A 3C18A 4NCQA 3U3FA 3L34A 1M56C 1T6QA 3CQZA 3HJCA 4EHPA 5KYXB 1M57C 1HE9A 3DKAA 3UMIA 4ZLDA 5L0FA 3FAJA 4U5EE 4OD5A 5BQGA 4KC9A 2W9YA 3V5ZA 4YJWA 3U2LA 2R7TA 3T9OA 3IQ6A 3US6A 5EK0A 2Y69C 3M4CA 5DQTA 1E83A 1ZU5A 2PP4A 3N24A 4A2NB 1J8MF 1Q0MA 2M64A 3AOUA 1APCA 3OWTA 1OQCA 4U5HA 3WG7C 2KK1A 1NU9C 2WL8A 2KW3C 3DD7A 4DOZA 2XL8A 3NKDA 1PD1A 4DRJB 1S05A 1OKKA 3PMRA 1A41A 1LIHA 1D0XA 1Z23A 4YT4A 2R05A 1O87A 1RKEB 1JAFA 4I1MA 4LLCA 3VAYA 2EIMC 1SF8A 3EGXA 4JEAA 3U8PA 1HW2A 3I4UA 1JOGA 1VK5A 2EPLX 2G3KA 2YL0A 3NKEA 2E87A 2A6HF 2XL6A 2XLOA 4LERA 5D92A 3RQGA 2ICWG 1FNTc 4RBNA 5KYNA 3FDQA 4XPXA 4JTAB 2YZSA 3IQCA 5COFA 5JVEA 1GS9A 1L3PA 2M4EA 1ORYA 3C8ZA 2D4UA 4H4KC 2VCBA 5E33A 4PJNA 1M2VB 5KYYB 2TMVP 2Y3BA 1AUEA 3RKOF 2I15A 1ZU4A 1T6IA 2YL3A 5FZTA 1C02A 3WHNA 2EILC 4MNDA 4JJFA 2HJMA 3U8VA 3KKBA 2EINC 2R02A 3TQOA 4E0HA 3K1HA 2DYSC 3RH3A 3RVYA 4BG0A 1ORJA 1EI7A 1WGWA 2LQGA 2A1DD 3S84A 4CDAA 2Q9AA 3NG1A 4N6HA 2JD3A 3T4RA 3MYIA 3W2WA 4ONSA 4WJ0A 2XLHA 3K7DA 2EIKC 4OD4A 5AC5A 2YWAA 2L81A 4JEBA 1NSGB 3TJ5A 2GA0A 2QNLA 3DM5A 4FESA 4AK9A 3TULA 4OIOF 3CSKA 4PJJA 3ABLC 3PCVA 3L8JA 3U2MA 3C63A 4PR9A 3EHMA 4O6YA 3KL4A 3TJ6A 3GM3A 4DRIB 4NY3A 2YL7A 2MYSA 4NC3A 1MQVA 4PK4A 3LLKA 4EWCA 4BJ6C 4NQFA 2W4BA 3C8GD 2YVKA 3JT1A 3Q7GA 1PCXA 4JCZA 5E2QA 1Q0KA 4LACB 2YRFA 2NSGA 3FAPB 3R7CA 3B0PA 4MTFA 2GDCA 2NPUA 2KGOA 2PX3A 1HMDA 1ZHWA 1IZMA 1V74B 1JRAA 2R7UA 1QQ3A 2H8AA 1ZYRF 1YJGA 1BDJB 3NDBB 2EPNA 1O5HA 1NZEA 4WGYA 3B0UX 5F5FA 2Q3TA 4EUKB 1NU7D 4J30B 2ZD9A 3FXHA 3HNIA 3K33A 2XLDA 2R7XA 2CDQA 1Z5ZA 3ZVRA 1K04A 5B1BC 3DZAA 1CGOA 2HV7A 4ER9A 2Y3GA 3E70C 2Q9BA 3ABMC 3K66A 3NYMA 5DS4A 1H9GA 1HY5A 2WVOA 5BQIA 2JX0A 4K1OA 3QW0A 3U3BA 2J7PA 2J9VA 4MVMA 3SXZA 2CW0F 1BR2A 3CEXA 3SNHA 3ASOC 4CDYA 3IPMO 4XWJA 4D4XA 2OKUA 2KQ9A 3ZQYA 1VTMP 2GFHA 1OW6A 4R32A 3POVA 4YL0A 3AQBA 3PHF2 1NFNA 5DQZA 2J0WA 2ZXRA 4BPMA 1ZW2A 2VH3A 3ZWIA 2OQMA 5DVWA 3W2VA 5BUOA 2J46A 4BJ5A 4OIQF 5HSWA 2WVNA 3GM1A 3C62A 3JZ0A 4CDVA 1D1BA 3EFOB 4XEVA 2YLGA 1O3UA 4EKWA 4HFKB 1B68A 1Y4CA 2NUPA 2R03A 2X51A 3M15A 3LS0A 4IARA 1J8YF 3O55A 1L7CA 2A0UA 3DI5A 4PACA 4CS9C 3FVYA 3LJBA 3RQFA 4U5FE 4XTKA 3NRHA 3EGXB 4XPWA 3AG1C 3DM9B 2ASRA 2XXAB 2HJ3A 3EH2A 1VLTA 3KH2A 3RIPA 5GPGB 1E2XA 2DYRC 2J9BA 1QPUA 5COGA 1CGME 2YLDA 1YZCA 1TWAA 4XEFA 1RMVA 1A7DA 2C04A 4MS2A 3DWWA 3EPVA 3LNRA 1OW7A 4KNWA 2A69F 3EZIA 5L0IA 1PV3A 4MVQA 4MVZA 1M2OA 4P9FA 2P6VA 2XXAA 1MMDA 4GQHA 1R4TA 2P0NA 3E9VA 4PJLA 4U5BE 4XLPF 1UG7A 3SXYA 2EPMX 1OCRC 3KYIA 3DXJF 3ZG1A 2R7OA 3WAQA 1FMWA 3MYFA 4CSAA 2D5RB 4C3DA 2AWYA 2WZGA 3G50A 1YYJA 4I1OB 3U5SA 1IW7F 1U0BB 1MNDA 1QZXA 3EGDB 2C03A 1K05A 3EFOA 3K1IC 4DXWA 4G7OF 5KYWA 1V54C 3ZC4A 3N0TA 5L0GA 1CPQA 4IJJA 3RVZA 4JCHA 4BJ6A 5CI9A 1V4AA 2IXOA 3K1IA 4MW3A 2F22A 5HV9A 2J0XA 2OEVA 1LS4A 2DB4A 3HNKA 2BL2A 4AX2A 2L9JA 4J32B 4JZAA 3VYWA 2BE5F 3O10A 3HTKC 2CYDA 4MW8A 4CIPA 3X1OA 4Q5SF 1WOLA 3JTLO 3JYYA 3RYLA 1VMAA 1ZHXA 2AVKA 5DS6A 3AJMA 4NTBA 2J8WA 3MBGA 3V5YA 4CJOA 3LLIA 1Y6DA 3QW1A 2X0CA 4O6NA 1TKNA 1LPEA 1TR2A 1TWCA 3CZ6A 1ZZPA 4JVSA 3ABKC 3JSZA 2WVQA 3Q6MA 3RF3A 2QTVA 2O9XA 3ZTZA 1YLMA 4U5DE 4RD9A 4C3EA 1PD0A 2XRHA 3GM2A 4JURI 4MVRA 4CS9A 1Z7Qc 2G62A 4E17A 2UUHA 4XQ1A 4E18A 4EBBA 4KBLA 4F4BA 3UNGC 1YYXA 4G7ZF 1I4ZA 1YA9A 3M4BA 3ZQVA 5CI8A 3G4ZA 2H7OA 1EA8A 4YL1A 3UMKA 3EHNA 3T6BA 3HNJA 4QI0A 5DLJA 4ANJA 3AQCA 3GWNA 2KSFA 3BRJA 1BZ4A 1D0YA 2PBEA 2RD9A 3M79A 2YL1A 4NTAA 2P1AA 1FFHA 1WN0A 1ZHZA 4PFPA 4W8KA 4YN0B 4YWQA 2A0BA 3UR3C 3S9OA 1WWPA 4MTGA 1LI5A 1ZHTA 1NG1A 3SXMA 3VM6A 4W8PA 5JS5A 4ULVA 1RXQA 2NG1A 4JJGA 1CGNA 1OCOC 2YHSA 4MTOA 4PFOA 3RW0A 2H7VC 2PFDA 1DOWA 2QUPA 2VB6A 2R7VA 4C7OB 1VYIA 3LEVA 1SYQA 2XSEA 2GAQA 1HMOA 1JR8A 4JC7A 3L8IA 4FX5A 3SEOA 2HSBA 4Q4ZF 4OIRF 2P7VA 3EJNA 2Z15A 1E86A 2R7SA 4E7ZA 3PDMP 2LK4A 3IHUA 1KTMA 3MLGA 2XM4A 3EG9A 4C3BA 4MVOA 3NMIA 4U9DA 3S29A 2DI3A 4XEKA 2XLEA 3V7OA 5CIVA 1QSPA 2W45A 1XZQA 3JSEO 1SMYF 4IAQA 3EGDA 4XPYA 1VOMA 2LIGA 4CS7A 2YLIA 1OR2A 4U9EA 1RKEA 2HFIA 3JRTA 4IRUA 5E3AA 5FCLA 1ST6A 5JRAA 1S7ZA 3LNMB 4PJMA 4O7GA 2J9WA 5BQHA 4DRHB 2R7QA 3LAYA 1U89A 3C7JA 3EQLF 1I5NA 3IQTA 3A11A 4DVZA 1F1MA 2B0JA 4BEMJ 2CCYA 2HUJA 3FOPA 2R7RA 5A6BA 5JSLA 2NUTA 2R9RB 2J45A 4ULWA 4IB4A 5EGYA 3X2QC 1I4YA 4YK5A 4ZLCA 1RCPA 2VASA 1LE2A 3G4XA 3T6GB 3W8HA 4YT5A 1EKYA 2Q9CA 5EHHA 1TFOB 1YAUO 1YZAA 5L0CA 3S27A 4HFFB 3GORA 3GANA 4AE4A 1ORSC 2KNHA 4P9TA 3GEEA 1Z63A 3JYHA 3SYNA 1OXKA 4G78A 3QZCA 2CGEA 2LFFA 5A6BD 5KYXA 3LUTB 5A69A 3GEIA 2ZPAA 1AEPA 1M2VA 4K0DA 5KYYA 3T6JA 4I3MA 3ECSA 2WZLA 4WGZA 3B9QA 3AGUA 2KYHA 3GWLA 3VRCA 2NUPB 1YARO 1D0ZA 4EBJA 1G4US 2MHRA 1OR3A 1LS1A 1RJ9A 2QLAA 2W4MA 1LM3B 2Y3HA 3DAGA 1A7VA 2XLVA 2IXPA 3DJNB 4I44A 4L6RA 2HS5A 4G0HA 5K0IA 1EQ1A 3NMKA 1KNYA 2WZFA 1Z3IX 3I5QA 2HMZA 1GQAA 3U9MA 1NLXA 2ZXPA 5B3SC 4E0IA 2YQYA 3L0IA 4EBKA 4CSAC 3SZRA 4D4NA 1G5ZA 4JTDB 1H9TA 1QKRA 1V55C 3DMDA 4LDRA 1HE1A 2ZXOA 3F47A 4IAOA 4DBRA 1RJ9B 1TWHA 2QY9A 3I5PA 1LE4A 3A9CA 4J7TA 2EPKX 3UGOA 4LLEA 3M1CB 2Q4FA 4MVUA 5T3TA 1E84A 2LSEA 3DAFA 5JLIA 1MMNA 1XWJA 5AC4A 2ZXWC 4WABA 4C7OA 1NFOA 2G3VA 4N4WA 1VYKA 3RQEA 3S28A 1VB5A 1ZW3A 1LVKA 4MVSA 4JTCB 1TFKB 5JT4A
chains in the Genus database with same CATH topology
5B1AC 2YEVA 4Q7CA 4AE4B 4OIPF 4IWBA 2CNWA 5DS5A 2NUTB 2V26A 5KYWB 4BJTA 2WB7A 4XLNF 3KMIA 4HEAJ 4P6IC 1QLEC 4U5GA 3O39A 4BJ5C 1FTSA 3ITFA 3B0VC 3UGPA 1OCCC 4QI2A 3LESA 4CS8C 3NYLA 2HV6A 5L3VA 1D1CA 5D91A 5E3CA 4YT2A 4K7BA 3K6BA 4GEHA 3WODF 4GYTA 4CBEA 4KNVA 4M63A 2Y39A 2IYLD 4HE8D 3OA1A 3EZHA 3IEEA 4B6IA 3AG3C 5T1DB 2I8BA 2IOQA 2FFHA 4MQ9F 4N06A 3UMHA 3AG2C 4O79A 1D1AA 3W8IA 3HLZA 1BR4A 4BJ1A 2A6EF 1JPNA 2XL4A 4YT8A 1OCZC 2R7WA 1KU2A 2V3CC 2PX0A 3GODA 3OEOA 4AE4A 2A68F 5F5HA 3H65A 2FGYA 1W2WA 4QDLA 3RFYA 3FHDA 4E7SA 2Y3DA 5KYUB 1JPJA 1MMAA 2PF4E 3QMKA 2J9UA 3EH1A 1FMVA 3TD7A 3ZSUA 2IXMA 2H7BA 2DGJA 2KJGA 4O6MA 4BEJA 5IY5C 3N2ZB 3JCUQ 4JW1A 4DBQA 2EIJC 4G7HF 3S0XA 4DVYP 3Q6NA 2OG2A 1LKXA 1ZHYA 4CS8A 3MX3A 3ASNC 1MMGA 4U5CE 5KYUA 4KI2A 4FWVA 3O6XA 4X0RA 4CIHA 2CNWD 4OINF 2MWQA 2OCCC 1SZIA 3LS1A 3EG9B 1FFTC 3AG4C 2J7PD 1G8XA 5T3WA 3Q7LA 1MNEA 4RDAA 1Z6AA 2IXNA 3ZIBA 1TWGA 3DJUB 1OKKD 3NYJA 1BR1A 5L3QA 3SP1A 1N1CA 3F46A 3L34A 1M56C 3HJCA 3CQZA 5KYXB 1M57C 3UMIA 4ZLDA 3FAJA 4U5EE 4OD5A 4KC9A 2W9YA 4YJWA 2R7TA 2Y69C 5DQTA 1ZU5A 2PP4A 3N24A 4A2NB 1J8MF 3WG7C 3OWTA 4U5HA 2WL8A 1NU9C 3DD7A 2KW3C 4DOZA 3NKDA 1PD1A 1OKKA 3PMRA 1Z23A 1D0XA 4YT4A 1O87A 4I1MA 4LLCA 3VAYA 2EIMC 1SF8A 3EGXA 3I4UA 1VK5A 2G3KA 3NKEA 2E87A 2A6HF 5D92A 4LERA 4RBNA 5KYNA 3FDQA 2YZSA 2M4EA 4H4KC 5E33A 4PJNA 1M2VB 5KYYB 2Y3BA 3RKOF 1ZU4A 2EILC 4MNDA 4JJFA 3KKBA 2EINC 3K1HA 2DYSC 3RH3A 4BG0A 1WGWA 2A1DD 2Q9AA 3NG1A 2JD3A 3T4RA 3W2WA 4WJ0A 3K7DA 2EIKC 4OD4A 2L81A 4OIOF 3DM5A 4FESA 4AK9A 3CSKA 4PJJA 3ABLC 3V7OA 3EHMA 4O6YA 3KL4A 4NY3A 2MYSA 4PK4A 3LLKA 4EWCA 4BJ6C 2W4BA 3JT1A 3Q7GA 1PCXA 5E2QA 4LACB 3B0PA 2PX3A 2KGOA 1ZHWA 1IZMA 2R7UA 3NDBB 1ZYRF 1O5HA 1NZEA 3B0UX 5F5FA 2Q3TA 1NU7D 4J30B 2R7XA 3K33A 2CDQA 1Z5ZA 3ZVRA 5B1BC 3DZAA 2HV7A 2Y3GA 3E70C 2Q9BA 3ABMC 3K66A 3NYMA 5DS4A 2WVOA 2J7PA 2J9VA 2CW0F 1BR2A 3SNHA 3ASOC 4XWJA 2KQ9A 2GFHA 3POVA 3AQBA 3PHF2 5DQZA 2J0WA 2ZXRA 2VH3A 5DVWA 3W2VA 5BUOA 2J46A 4BJ5A 4OIQF 5HSWA 2WVNA 1D1BA 3EFOB 4HFKB 2NUPA 2X51A 3LS0A 1J8YF 4CS9C 3FVYA 3LJBA 4U5FE 4XTKA 3NRHA 3EGXB 3AG1C 3DM9B 2XXAB 3EH2A 3KH2A 3RIPA 2DYRC 1TWAA 2C04A 3EPVA 3LNRA 4KNWA 2A69F 3EZIA 1M2OA 2P6VA 2XXAA 1MMDA 4PJLA 4U5BE 3E9VA 4XLPF 1OCRC 3DXJF 3ZG1A 2R7OA 1FMWA 4CSAA 2D5RB 4C3DA 2WZGA 4I1OB 1IW7F 1MNDA 1QZXA 3EGDB 2C03A 3EFOA 3K1IC 4G7OF 5KYWA 1V54C 3ZC4A 3N0TA 4IJJA 4BJ6A 4JCHA 5CI9A 2IXOA 2J0XA 4AX2A 4J32B 2L9JA 4JZAA 3VYWA 2BE5F 3HTKC 3X1OA 4Q5SF 3RYLA 1VMAA 1ZHXA 5DS6A 3LLIA 4O6NA 1TR2A 1TKNA 1TWCA 3CZ6A 4JVSA 3ABKC 3JSZA 2WVQA 3Q6MA 2QTVA 2O9XA 4C3EA 4U5DE 4RD9A 4CS9A 1PD0A 2XRHA 4JURI 2G62A 4G7ZF 4F4BA 4EBBA 4KBLA 5CI8A 2H7OA 3UMKA 3EHNA 3T6BA 4QI0A 4ANJA 5DLJA 3AQCA 1D0YA 1FFHA 1ZHZA 4PFPA 4W8KA 4YN0B 4YWQA 3UR3C 1ZHTA 1NG1A 2NG1A 4JJGA 2YHSA 1OCOC 4PFOA 2H7VC 2PFDA 2VB6A 2R7VA 4C7OB 1VYIA 3LEVA 2XSEA 4FX5A 3SEOA 4Q4ZF 4OIRF 2P7VA 3EJNA 2Z15A 2R7SA 4E7ZA 3MLGA 3EG9A 4C3BA 3S29A 2W45A 1SMYF 3EGDA 1VOMA 4CS7A 3JRTA 4IRUA 5E3AA 5FCLA 1ST6A 1S7ZA 4PJMA 4O7GA 2J9WA 2R7QA 3LAYA 3EQLF 4DVZA 2B0JA 2R7RA 2NUTA 5EGYA 2J45A 4ULWA 3X2QC 4ZLCA 2VASA 3W8HA 4YT5A 2Q9CA 5EHHA 3S27A 4HFFB 3GANA 2KNHA 1Z63A 3JYHA 3SYNA 3QZCA 2CGEA 5KYXA 2ZPAA 1M2VA 4K0DA 5KYYA 3T6JA 4I3MA 3ECSA 2WZLA 3B9QA 2NUPB 1D0ZA 2W4MA 1LS1A 1RJ9A 2Y3HA 3DJNB 4I44A 3DAGA 2IXPA 4G0HA 2WZFA 1Z3IX 3I5QA 2ZXPA 5B3SC 3L0IA 4CSAC 3SZRA 1V55C 3DMDA 2ZXOA 3F47A 4IAOA 4DBRA 1RJ9B 1TWHA 2QY9A 3I5PA 3UGOA 4LLEA 3M1CB 5T3TA 2LSEA 3DAFA 1MMNA 2ZXWC 4C7OA 2G3VA 1VYKA 3S28A 1LVKA 3UNGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1H A;  3K1I C; 
#chains in the Genus database with same CATH topology
 5B1A C;  4JIO A;  1JMW A;  2YEV A;  4Q7C A;  3H2V A;  4AE4 B;  5AGF A;  4OIP F;  2KC3 A;  4IWB A;  2CNW A;  4Z9J A;  3GEH A;  3AGT A;  3DE8 A;  3MFN A;  2NUT B;  2V26 A;  3U9J A;  5DS5 A;  2AP3 A;  4AL0 A;  5KYW B;  4BJT A;  1XZP A;  2WB7 A;  5L0H A;  3C8G A;  4CX9 A;  1CPR A;  1T5O A;  4XLN F;  3KMI A;  4HEA J;  4P6I C;  5A6J A;  1Q0D A;  1QLE C;  1YA7 O;  2L6H A;  3CAX A;  4U5G A;  3O39 A;  4BJ5 C;  4Z9I A;  5L0J A;  1FTS A;  3ITF A;  3S90 A;  3B0V C;  3VF0 A;  1E85 A;  4LDQ A;  2IM8 A;  3UGP A;  1RKC A;  1OCC C;  4N6C A;  1T6U A;  4QI2 A;  2YKZ A;  3LES A;  4CS8 C;  3NYL A;  3ATP A;  2OU6 A;  2HZ8 A;  4A4A A;  2HV6 A;  2L7A A;  3TK0 A;  3V5X A;  2Q7R A;  5L3V A;  2NSF A;  1D1C A;  3ZDL A;  4NTF A;  1NBB A;  3J06 A;  2RSE B;  1G4W R;  1A7E A;  1BBH A;  5D91 A;  5E3C A;  5JUA A;  4YT2 A;  1FAP B;  4K7B A;  3K6B A;  1UFB A;  4GEH A;  4GYT A;  5TJ5 E;  3WOD F;  4KNV A;  3DE9 A;  4M63 A;  4CBE A;  1OW8 A;  2Y39 A;  4CJG A;  2IYL D;  2VC9 A;  4HE8 D;  1R5I D;  3H2U A;  3OA1 A;  2L6G A;  3EZH A;  3TOL A;  3IEE A;  4B6I A;  3AG3 C;  5T1D B;  2I8B A;  2IOQ A;  1WAT A;  1YVI A;  2XS8 A;  3IQ5 A;  3QVY A;  1YDI A;  2FFH A;  4MQ9 F;  4N06 A;  2XLM A;  3UMH A;  2LCH A;  3JRM O;  3AG2 C;  1WTY A;  2HSQ A;  2VCC A;  4O79 A;  1D1A A;  3W8I A;  3HLZ A;  1BR4 A;  1H7I A;  2A6E F;  1JPN A;  2XL4 A;  4BJ1 A;  1OCZ C;  4YT8 A;  1C17 M;  1KU2 A;  2QE9 A;  2R7W A;  2V3C C;  2PX0 A;  3GOD A;  3OEO A;  3HKK A;  256B A;  2A68 F;  2OEX A;  3QTH A;  1A0B A;  5F5H A;  3H65 A;  1HW1 A;  4IGG A;  1GGQ A;  2EPO A;  5L0D A;  3TOM A;  5A6A A;  2FGY A;  1W2W A;  2XS1 A;  4QDL A;  3RFY A;  3FHD A;  3HNL A;  4E7S A;  2OJE D;  2Y3D A;  2LP4 A;  3BEH A;  5KYU B;  4EIY A;  1JPJ A;  2L6F A;  1MMA A;  2OOC A;  2PF4 E;  4JKV A;  3KPH A;  1TQG A;  2J9U A;  3QMK A;  2XLW A;  1FMV A;  1ZVZ A;  2AWC A;  2Q00 A;  3EH1 A;  2LD6 A;  3LEO A;  1AVO B;  3TD7 A;  2IXM A;  3ZSU A;  2H7B A;  1SR2 A;  4DJ9 A;  2FAP B;  2DGJ A;  2KJG A;  2P61 A;  3NMJ A;  4O6M A;  4BEJ A;  3N2Z B;  2XM0 A;  3JCU Q;  4JE9 A;  4JW1 A;  4DBQ A;  1C03 A;  2EIJ C;  4FAP B;  4H54 A;  4LDK A;  2R25 A;  1GM5 A;  2LFD A;  4G7H F;  3S0X A;  4DVY P;  3Q6N A;  1FR0 A;  2OG2 A;  1LKX A;  2HKV A;  1DOV A;  1ZHY A;  3W4Y A;  4CS8 A;  3ZTM A;  3MX3 A;  3ASN C;  1H6G A;  1QVX A;  1MMG A;  2ETS A;  3FMS A;  1Q0F A;  4U5C E;  3SXK A;  5KYU A;  2IBF A;  4KI2 A;  1K40 A;  4FWV A;  2VCA A;  3QVZ A;  2UUI A;  3O6X A;  4X0R A;  4CIH A;  3FOO A;  4UDV A;  2B0H A;  2CNW D;  4OIN F;  5A6K A;  2MWQ A;  2OCC C;  4AL1 A;  1SZI A;  3LS1 A;  3EG9 B;  1VLS A;  1FFT C;  2BC5 A;  2OJQ A;  3B29 A;  3AG4 C;  3C8G B;  5COM A;  2J7P D;  5F28 E;  1G8X A;  3U0C A;  5T3W A;  1LI7 A;  3B71 A;  4Z9H A;  3KYJ A;  3Q7L A;  4J7Y A;  2HMQ A;  1MNE A;  4RDA A;  3L1M A;  1Z6A A;  1Q0G A;  2IXN A;  4YL3 A;  3ZIB A;  5B3I A;  5IY5 C;  1TWG A;  3R2P A;  2PNO A;  3DJU B;  1OKK D;  2GWW A;  3NYJ A;  5JP7 A;  1T9K A;  1BR1 A;  1M6T A;  2JPU A;  1OXB A;  1U6H A;  1WAS A;  2AU5 A;  4JRZ A;  5L3Q A;  3SP1 A;  1T01 A;  1N1C A;  3F46 A;  3C18 A;  4NCQ A;  3U3F A;  3L34 A;  1M56 C;  1T6Q A;  3CQZ A;  3HJC A;  4EHP A;  5KYX B;  1M57 C;  1HE9 A;  3DKA A;  3UMI A;  4ZLD A;  5L0F A;  3FAJ A;  4U5E E;  4OD5 A;  5BQG A;  4KC9 A;  2W9Y A;  3V5Z A;  4YJW A;  3U2L A;  2R7T A;  3T9O A;  3IQ6 A;  3US6 A;  5EK0 A;  2Y69 C;  3M4C A;  5DQT A;  1E83 A;  1ZU5 A;  2PP4 A;  3N24 A;  4A2N B;  1J8M F;  1Q0M A;  2M64 A;  3AOU A;  1APC A;  3OWT A;  1OQC A;  4U5H A;  3WG7 C;  2KK1 A;  1NU9 C;  2WL8 A;  2KW3 C;  3DD7 A;  4DOZ A;  2XL8 A;  3NKD A;  1PD1 A;  4DRJ B;  1S05 A;  1OKK A;  3PMR A;  1A41 A;  1LIH A;  1D0X A;  1Z23 A;  4YT4 A;  2R05 A;  1O87 A;  1RKE B;  1JAF A;  4I1M A;  4LLC A;  3VAY A;  2EIM C;  1SF8 A;  3EGX A;  4JEA A;  3U8P A;  1HW2 A;  3I4U A;  1JOG A;  1VK5 A;  2EPL X;  2G3K A;  2YL0 A;  3NKE A;  2E87 A;  2A6H F;  2XL6 A;  2XLO A;  4LER A;  5D92 A;  3RQG A;  2ICW G;  1FNT c;  4RBN A;  5KYN A;  3FDQ A;  4XPX A;  4JTA B;  2YZS A;  3IQC A;  5COF A;  5JVE A;  1GS9 A;  1L3P A;  2M4E A;  1ORY A;  3C8Z A;  2D4U A;  4H4K C;  2VCB A;  5E33 A;  4PJN A;  1M2V B;  5KYY B;  2TMV P;  2Y3B A;  1AUE A;  3RKO F;  2I15 A;  1ZU4 A;  1T6I A;  2YL3 A;  5FZT A;  1C02 A;  3WHN A;  2EIL C;  4MND A;  4JJF A;  2HJM A;  3U8V A;  3KKB A;  2EIN C;  2R02 A;  3TQO A;  4E0H A;  3K1H A;  2DYS C;  3RH3 A;  3RVY A;  4BG0 A;  1ORJ A;  1EI7 A;  1WGW A;  2LQG A;  2A1D D;  3S84 A;  4CDA A;  2Q9A A;  3NG1 A;  4N6H A;  2JD3 A;  3T4R A;  3MYI A;  3W2W A;  4ONS A;  4WJ0 A;  2XLH A;  3K7D A;  2EIK C;  4OD4 A;  5AC5 A;  2YWA A;  2L81 A;  4JEB A;  1NSG B;  3TJ5 A;  2GA0 A;  2QNL A;  3DM5 A;  4FES A;  4AK9 A;  3TUL A;  4OIO F;  3CSK A;  4PJJ A;  3ABL C;  3PCV A;  3L8J A;  3U2M A;  3C63 A;  4PR9 A;  3EHM A;  4O6Y A;  3KL4 A;  3TJ6 A;  3GM3 A;  4DRI B;  4NY3 A;  2YL7 A;  2MYS A;  4NC3 A;  1MQV A;  4PK4 A;  3LLK A;  4EWC A;  4BJ6 C;  4NQF A;  2W4B A;  3C8G D;  2YVK A;  3JT1 A;  3Q7G A;  1PCX A;  4JCZ A;  5E2Q A;  1Q0K A;  4LAC B;  2YRF A;  2NSG A;  3FAP B;  3R7C A;  3B0P A;  4MTF A;  2GDC A;  2NPU A;  2KGO A;  2PX3 A;  1HMD A;  1ZHW A;  1IZM A;  1V74 B;  1JRA A;  2R7U A;  1QQ3 A;  2H8A A;  1ZYR F;  1YJG A;  1BDJ B;  3NDB B;  2EPN A;  1O5H A;  1NZE A;  4WGY A;  3B0U X;  5F5F A;  2Q3T A;  4EUK B;  1NU7 D;  4J30 B;  2ZD9 A;  3FXH A;  3HNI A;  3K33 A;  2XLD A;  2R7X A;  2CDQ A;  1Z5Z A;  3ZVR A;  1K04 A;  5B1B C;  3DZA A;  1CGO A;  2HV7 A;  4ER9 A;  2Y3G A;  3E70 C;  2Q9B A;  3ABM C;  3K66 A;  3NYM A;  5DS4 A;  1H9G A;  1HY5 A;  2WVO A;  5BQI A;  2JX0 A;  4K1O A;  3QW0 A;  3U3B A;  2J7P A;  2J9V A;  4MVM A;  3SXZ A;  2CW0 F;  1BR2 A;  3CEX A;  3SNH A;  3ASO C;  4CDY A;  3IPM O;  4XWJ A;  4D4X A;  2OKU A;  2KQ9 A;  3ZQY A;  1VTM P;  2GFH A;  1OW6 A;  4R32 A;  3POV A;  4YL0 A;  3AQB A;  3PHF 2;  1NFN A;  5DQZ A;  2J0W A;  2ZXR A;  4BPM A;  1ZW2 A;  2VH3 A;  3ZWI A;  2OQM A;  5DVW A;  3W2V A;  5BUO A;  2J46 A;  4BJ5 A;  4OIQ F;  5HSW A;  2WVN A;  3GM1 A;  3C62 A;  3JZ0 A;  4CDV A;  1D1B A;  3EFO B;  4XEV A;  2YLG A;  1O3U A;  4EKW A;  4HFK B;  1B68 A;  1Y4C A;  2NUP A;  2R03 A;  2X51 A;  3M15 A;  3LS0 A;  4IAR A;  1J8Y F;  3O55 A;  1L7C A;  2A0U A;  3DI5 A;  4PAC A;  4CS9 C;  3FVY A;  3LJB A;  3RQF A;  4U5F E;  4XTK A;  3NRH A;  3EGX B;  4XPW A;  3AG1 C;  3DM9 B;  2ASR A;  2XXA B;  2HJ3 A;  3EH2 A;  1VLT A;  3KH2 A;  3RIP A;  5GPG B;  1E2X A;  2DYR C;  2J9B A;  1QPU A;  5COG A;  1CGM E;  2YLD A;  1YZC A;  1TWA A;  4XEF A;  1RMV A;  1A7D A;  2C04 A;  4MS2 A;  3DWW A;  3EPV A;  3LNR A;  1OW7 A;  4KNW A;  2A69 F;  3EZI A;  5L0I A;  1PV3 A;  4MVQ A;  4MVZ A;  1M2O A;  4P9F A;  2P6V A;  2XXA A;  1MMD A;  4GQH A;  1R4T A;  2P0N A;  3E9V A;  4PJL A;  4U5B E;  4XLP F;  1UG7 A;  3SXY A;  2EPM X;  1OCR C;  3KYI A;  3DXJ F;  3ZG1 A;  2R7O A;  3WAQ A;  1FMW A;  3MYF A;  4CSA A;  2D5R B;  4C3D A;  2AWY A;  2WZG A;  3G50 A;  1YYJ A;  4I1O B;  3U5S A;  1IW7 F;  1U0B B;  1MND A;  1QZX A;  3EGD B;  2C03 A;  1K05 A;  3EFO A;  3K1I C;  4DXW A;  4G7O F;  5KYW A;  1V54 C;  3ZC4 A;  3N0T A;  5L0G A;  1CPQ A;  4IJJ A;  3RVZ A;  4JCH A;  4BJ6 A;  5CI9 A;  1V4A A;  2IXO A;  3K1I A;  4MW3 A;  2F22 A;  5HV9 A;  2J0X A;  2OEV A;  1LS4 A;  2DB4 A;  3HNK A;  2BL2 A;  4AX2 A;  2L9J A;  4J32 B;  4JZA A;  3VYW A;  2BE5 F;  3O10 A;  3HTK C;  2CYD A;  4MW8 A;  4CIP A;  3X1O A;  4Q5S F;  1WOL A;  3JTL O;  3JYY A;  3RYL A;  1VMA A;  1ZHX A;  2AVK A;  5DS6 A;  3AJM A;  4NTB A;  2J8W A;  3MBG A;  3V5Y A;  4CJO A;  3LLI A;  1Y6D A;  3QW1 A;  2X0C A;  4O6N A;  1TKN A;  1LPE A;  1TR2 A;  1TWC A;  3CZ6 A;  1ZZP A;  4JVS A;  3ABK C;  3JSZ A;  2WVQ A;  3Q6M A;  3RF3 A;  2QTV A;  2O9X A;  3ZTZ A;  1YLM A;  4U5D E;  4RD9 A;  4C3E A;  1PD0 A;  2XRH A;  3GM2 A;  4JUR I;  4MVR A;  4CS9 A;  1Z7Q c;  2G62 A;  4E17 A;  2UUH A;  4XQ1 A;  4E18 A;  4EBB A;  4KBL A;  4F4B A;  3UNG C;  1YYX A;  4G7Z F;  1I4Z A;  1YA9 A;  3M4B A;  3ZQV A;  5CI8 A;  3G4Z A;  2H7O A;  1EA8 A;  4YL1 A;  3UMK A;  3EHN A;  3T6B A;  3HNJ A;  4QI0 A;  5DLJ A;  4ANJ A;  3AQC A;  3GWN A;  2KSF A;  3BRJ A;  1BZ4 A;  1D0Y A;  2PBE A;  2RD9 A;  3M79 A;  2YL1 A;  4NTA A;  2P1A A;  1FFH A;  1WN0 A;  1ZHZ A;  4PFP A;  4W8K A;  4YN0 B;  4YWQ A;  2A0B A;  3UR3 C;  3S9O A;  1WWP A;  4MTG A;  1LI5 A;  1ZHT A;  1NG1 A;  3SXM A;  3VM6 A;  4W8P A;  5JS5 A;  4ULV A;  1RXQ A;  2NG1 A;  4JJG A;  1CGN A;  1OCO C;  2YHS A;  4MTO A;  4PFO A;  3RW0 A;  2H7V C;  2PFD A;  1DOW A;  2QUP A;  2VB6 A;  2R7V A;  4C7O B;  1VYI A;  3LEV A;  1SYQ A;  2XSE A;  2GAQ A;  1HMO A;  1JR8 A;  4JC7 A;  3L8I A;  4FX5 A;  3SEO A;  2HSB A;  4Q4Z F;  4OIR F;  2P7V A;  3EJN A;  2Z15 A;  1E86 A;  2R7S A;  4E7Z A;  3PDM P;  2LK4 A;  3IHU A;  1KTM A;  3MLG A;  2XM4 A;  3EG9 A;  4C3B A;  4MVO A;  3NMI A;  4U9D A;  3S29 A;  2DI3 A;  4XEK A;  2XLE A;  3V7O A;  5CIV A;  1QSP A;  2W45 A;  1XZQ A;  3JSE O;  1SMY F;  4IAQ A;  3EGD A;  4XPY A;  1VOM A;  2LIG A;  4CS7 A;  2YLI A;  1OR2 A;  4U9E A;  1RKE A;  2HFI A;  3JRT A;  4IRU A;  5E3A A;  5FCL A;  1ST6 A;  5JRA A;  1S7Z A;  3LNM B;  4PJM A;  4O7G A;  2J9W A;  5BQH A;  4DRH B;  2R7Q A;  3LAY A;  1U89 A;  3C7J A;  3EQL F;  1I5N A;  3IQT A;  3A11 A;  4DVZ A;  1F1M A;  2B0J A;  4BEM J;  2CCY A;  2HUJ A;  3FOP A;  2R7R A;  5A6B A;  5JSL A;  2NUT A;  2R9R B;  2J45 A;  4ULW A;  4IB4 A;  5EGY A;  3X2Q C;  1I4Y A;  4YK5 A;  4ZLC A;  1RCP A;  2VAS A;  1LE2 A;  3G4X A;  3T6G B;  3W8H A;  4YT5 A;  1EKY A;  2Q9C A;  5EHH A;  1TFO B;  1YAU O;  1YZA A;  5L0C A;  3S27 A;  4HFF B;  3GOR A;  3GAN A;  4AE4 A;  1ORS C;  2KNH A;  4P9T A;  3GEE A;  1Z63 A;  3JYH A;  3SYN A;  1OXK A;  4G78 A;  3QZC A;  2CGE A;  2LFF A;  5A6B D;  5KYX A;  3LUT B;  5A69 A;  3GEI A;  2ZPA A;  1AEP A;  1M2V A;  4K0D A;  5KYY A;  3T6J A;  4I3M A;  3ECS A;  2WZL A;  4WGZ A;  3B9Q A;  3AGU A;  2KYH A;  3GWL A;  3VRC A;  2NUP B;  1YAR O;  1D0Z A;  4EBJ A;  1G4U S;  2MHR A;  1OR3 A;  1LS1 A;  1RJ9 A;  2QLA A;  2W4M A;  1LM3 B;  2Y3H A;  3DAG A;  1A7V A;  2XLV A;  2IXP A;  3DJN B;  4I44 A;  4L6R A;  2HS5 A;  4G0H A;  5K0I A;  1EQ1 A;  3NMK A;  1KNY A;  2WZF A;  1Z3I X;  3I5Q A;  2HMZ A;  1GQA A;  3U9M A;  1NLX A;  2ZXP A;  5B3S C;  4E0I A;  2YQY A;  3L0I A;  4EBK A;  4CSA C;  3SZR A;  4D4N A;  1G5Z A;  4JTD B;  1H9T A;  1QKR A;  1V55 C;  3DMD A;  4LDR A;  1HE1 A;  2ZXO A;  3F47 A;  4IAO A;  4DBR A;  1RJ9 B;  1TWH A;  2QY9 A;  3I5P A;  1LE4 A;  3A9C A;  4J7T A;  2EPK X;  3UGO A;  4LLE A;  3M1C B;  2Q4F A;  4MVU A;  5T3T A;  1E84 A;  2LSE A;  3DAF A;  5JLI A;  1MMN A;  1XWJ A;  5AC4 A;  2ZXW C;  4WAB A;  4C7O A;  1NFO A;  2G3V A;  4N4W A;  1VYK A;  3RQE A;  3S28 A;  1VB5 A;  1ZW3 A;  1LVK A;  4MVS A;  4JTC B;  1TFK B;  5JT4 A; 
#chains in the Genus database with same CATH homology
 5B1A C;  2YEV A;  4Q7C A;  4AE4 B;  4OIP F;  4IWB A;  2CNW A;  5DS5 A;  2NUT B;  2V26 A;  5KYW B;  4BJT A;  2WB7 A;  4XLN F;  3KMI A;  4HEA J;  4P6I C;  1QLE C;  4U5G A;  3O39 A;  4BJ5 C;  1FTS A;  3ITF A;  3B0V C;  3UGP A;  1OCC C;  4QI2 A;  3LES A;  4CS8 C;  3NYL A;  2HV6 A;  5L3V A;  1D1C A;  5D91 A;  5E3C A;  4YT2 A;  4K7B A;  3K6B A;  4GEH A;  3WOD F;  4GYT A;  4CBE A;  4KNV A;  4M63 A;  2Y39 A;  2IYL D;  4HE8 D;  3OA1 A;  3EZH A;  3IEE A;  4B6I A;  3AG3 C;  5T1D B;  2I8B A;  2IOQ A;  2FFH A;  4MQ9 F;  4N06 A;  3UMH A;  3AG2 C;  4O79 A;  1D1A A;  3W8I A;  3HLZ A;  1BR4 A;  4BJ1 A;  2A6E F;  1JPN A;  2XL4 A;  4YT8 A;  1OCZ C;  2R7W A;  1KU2 A;  2V3C C;  2PX0 A;  3GOD A;  3OEO A;  4AE4 A;  2A68 F;  5F5H A;  3H65 A;  2FGY A;  1W2W A;  4QDL A;  3RFY A;  3FHD A;  4E7S A;  2Y3D A;  5KYU B;  1JPJ A;  1MMA A;  2PF4 E;  3QMK A;  2J9U A;  3EH1 A;  1FMV A;  3TD7 A;  3ZSU A;  2IXM A;  2H7B A;  2DGJ A;  2KJG A;  4O6M A;  4BEJ A;  5IY5 C;  3N2Z B;  3JCU Q;  4JW1 A;  4DBQ A;  2EIJ C;  4G7H F;  3S0X A;  4DVY P;  3Q6N A;  2OG2 A;  1LKX A;  1ZHY A;  4CS8 A;  3MX3 A;  3ASN C;  1MMG A;  4U5C E;  5KYU A;  4KI2 A;  4FWV A;  3O6X A;  4X0R A;  4CIH A;  2CNW D;  4OIN F;  2MWQ A;  2OCC C;  1SZI A;  3LS1 A;  3EG9 B;  1FFT C;  3AG4 C;  2J7P D;  1G8X A;  5T3W A;  3Q7L A;  1MNE A;  4RDA A;  1Z6A A;  2IXN A;  3ZIB A;  1TWG A;  3DJU B;  1OKK D;  3NYJ A;  1BR1 A;  5L3Q A;  3SP1 A;  1N1C A;  3F46 A;  3L34 A;  1M56 C;  3HJC A;  3CQZ A;  5KYX B;  1M57 C;  3UMI A;  4ZLD A;  3FAJ A;  4U5E E;  4OD5 A;  4KC9 A;  2W9Y A;  4YJW A;  2R7T A;  2Y69 C;  5DQT A;  1ZU5 A;  2PP4 A;  3N24 A;  4A2N B;  1J8M F;  3WG7 C;  3OWT A;  4U5H A;  2WL8 A;  1NU9 C;  3DD7 A;  2KW3 C;  4DOZ A;  3NKD A;  1PD1 A;  1OKK A;  3PMR A;  1Z23 A;  1D0X A;  4YT4 A;  1O87 A;  4I1M A;  4LLC A;  3VAY A;  2EIM C;  1SF8 A;  3EGX A;  3I4U A;  1VK5 A;  2G3K A;  3NKE A;  2E87 A;  2A6H F;  5D92 A;  4LER A;  4RBN A;  5KYN A;  3FDQ A;  2YZS A;  2M4E A;  4H4K C;  5E33 A;  4PJN A;  1M2V B;  5KYY B;  2Y3B A;  3RKO F;  1ZU4 A;  2EIL C;  4MND A;  4JJF A;  3KKB A;  2EIN C;  3K1H A;  2DYS C;  3RH3 A;  4BG0 A;  1WGW A;  2A1D D;  2Q9A A;  3NG1 A;  2JD3 A;  3T4R A;  3W2W A;  4WJ0 A;  3K7D A;  2EIK C;  4OD4 A;  2L81 A;  4OIO F;  3DM5 A;  4FES A;  4AK9 A;  3CSK A;  4PJJ A;  3ABL C;  3V7O A;  3EHM A;  4O6Y A;  3KL4 A;  4NY3 A;  2MYS A;  4PK4 A;  3LLK A;  4EWC A;  4BJ6 C;  2W4B A;  3JT1 A;  3Q7G A;  1PCX A;  5E2Q A;  4LAC B;  3B0P A;  2PX3 A;  2KGO A;  1ZHW A;  1IZM A;  2R7U A;  3NDB B;  1ZYR F;  1O5H A;  1NZE A;  3B0U X;  5F5F A;  2Q3T A;  1NU7 D;  4J30 B;  2R7X A;  3K33 A;  2CDQ A;  1Z5Z A;  3ZVR A;  5B1B C;  3DZA A;  2HV7 A;  2Y3G A;  3E70 C;  2Q9B A;  3ABM C;  3K66 A;  3NYM A;  5DS4 A;  2WVO A;  2J7P A;  2J9V A;  2CW0 F;  1BR2 A;  3SNH A;  3ASO C;  4XWJ A;  2KQ9 A;  2GFH A;  3POV A;  3AQB A;  3PHF 2;  5DQZ A;  2J0W A;  2ZXR A;  2VH3 A;  5DVW A;  3W2V A;  5BUO A;  2J46 A;  4BJ5 A;  4OIQ F;  5HSW A;  2WVN A;  1D1B A;  3EFO B;  4HFK B;  2NUP A;  2X51 A;  3LS0 A;  1J8Y F;  4CS9 C;  3FVY A;  3LJB A;  4U5F E;  4XTK A;  3NRH A;  3EGX B;  3AG1 C;  3DM9 B;  2XXA B;  3EH2 A;  3KH2 A;  3RIP A;  2DYR C;  1TWA A;  2C04 A;  3EPV A;  3LNR A;  4KNW A;  2A69 F;  3EZI A;  1M2O A;  2P6V A;  2XXA A;  1MMD A;  4PJL A;  4U5B E;  3E9V A;  4XLP F;  1OCR C;  3DXJ F;  3ZG1 A;  2R7O A;  1FMW A;  4CSA A;  2D5R B;  4C3D A;  2WZG A;  4I1O B;  1IW7 F;  1MND A;  1QZX A;  3EGD B;  2C03 A;  3EFO A;  3K1I C;  4G7O F;  5KYW A;  1V54 C;  3ZC4 A;  3N0T A;  4IJJ A;  4BJ6 A;  4JCH A;  5CI9 A;  2IXO A;  2J0X A;  4AX2 A;  4J32 B;  2L9J A;  4JZA A;  3VYW A;  2BE5 F;  3HTK C;  3X1O A;  4Q5S F;  3RYL A;  1VMA A;  1ZHX A;  5DS6 A;  3LLI A;  4O6N A;  1TR2 A;  1TKN A;  1TWC A;  3CZ6 A;  4JVS A;  3ABK C;  3JSZ A;  2WVQ A;  3Q6M A;  2QTV A;  2O9X A;  4C3E A;  4U5D E;  4RD9 A;  4CS9 A;  1PD0 A;  2XRH A;  4JUR I;  2G62 A;  4G7Z F;  4F4B A;  4EBB A;  4KBL A;  5CI8 A;  2H7O A;  3UMK A;  3EHN A;  3T6B A;  4QI0 A;  4ANJ A;  5DLJ A;  3AQC A;  1D0Y A;  1FFH A;  1ZHZ A;  4PFP A;  4W8K A;  4YN0 B;  4YWQ A;  3UR3 C;  1ZHT A;  1NG1 A;  2NG1 A;  4JJG A;  2YHS A;  1OCO C;  4PFO A;  2H7V C;  2PFD A;  2VB6 A;  2R7V A;  4C7O B;  1VYI A;  3LEV A;  2XSE A;  4FX5 A;  3SEO A;  4Q4Z F;  4OIR F;  2P7V A;  3EJN A;  2Z15 A;  2R7S A;  4E7Z A;  3MLG A;  3EG9 A;  4C3B A;  3S29 A;  2W45 A;  1SMY F;  3EGD A;  1VOM A;  4CS7 A;  3JRT A;  4IRU A;  5E3A A;  5FCL A;  1ST6 A;  1S7Z A;  4PJM A;  4O7G A;  2J9W A;  2R7Q A;  3LAY A;  3EQL F;  4DVZ A;  2B0J A;  2R7R A;  2NUT A;  5EGY A;  2J45 A;  4ULW A;  3X2Q C;  4ZLC A;  2VAS A;  3W8H A;  4YT5 A;  2Q9C A;  5EHH A;  3S27 A;  4HFF B;  3GAN A;  2KNH A;  1Z63 A;  3JYH A;  3SYN A;  3QZC A;  2CGE A;  5KYX A;  2ZPA A;  1M2V A;  4K0D A;  5KYY A;  3T6J A;  4I3M A;  3ECS A;  2WZL A;  3B9Q A;  2NUP B;  1D0Z A;  2W4M A;  1LS1 A;  1RJ9 A;  2Y3H A;  3DJN B;  4I44 A;  3DAG A;  2IXP A;  4G0H A;  2WZF A;  1Z3I X;  3I5Q A;  2ZXP A;  5B3S C;  3L0I A;  4CSA C;  3SZR A;  1V55 C;  3DMD A;  2ZXO A;  3F47 A;  4IAO A;  4DBR A;  1RJ9 B;  1TWH A;  2QY9 A;  3I5P A;  3UGO A;  4LLE A;  3M1C B;  5T3T A;  2LSE A;  3DAF A;  1MMN A;  2ZXW C;  4C7O A;  2G3V A;  1VYK A;  3S28 A;  1LVK A;  3UNG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...