4AL0A

Crystal structure of human ps-1
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
146
structure length
146
Chain Sequence
VMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Microsomal Prostaglandin E2 Synthase Provides Insight Into Diversity in the Mapeg Superfamily.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PROSTAGLANDIN E SYNTHASE
total genus 65
structure length 146
sequence length 146
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4al0A00
2PNOA 3LEOA 4YK5A 3HKKA 4AL0A 5BQIA 5K0IA 4YL0A 5BQGA 2H8AA 4WABA 3DWWA 4J7YA 2UUHA 4J7TA 4JRZA 4YL1A 5BQHA 2UUIA 4YL3A 4NTFA 5HV9A 4NTBA 4JC7A 4NTAA 2Q7RA 3PCVA 3B29A 4AL1A 4JCZA 4BPMA
chains in the Genus database with same CATH superfamily
3UMHA 2RD9A 2CCYA 3NMKA 4LLEA 1TFKB 1Q0FA 3LAYA 5A69A 4CS9A 2I8BA 4CX9A 1EI7A 1F1MA 2KJGA 2FGYA 3H65A 1A0BA 4MVRA 4U5CE 3RF3A 3RVYA 4ZLDA 3TJ5A 1YARO 4EKWA 2XL4A 1RCPA 1VYIA 5JVEA 4JZAA 1H9GA 3EFOB 1O3UA 1TWGA 1VOMA 1YZCA 4JRZA 1HY5A 4YL1A 3U5SA 1QSPA 5E2QA 2QUPA 1N1CA 4BJ1A 3K66A 1QVXA 4PJJA 5AC4A 3WG7C 3I5PA 3ABLC 1OCCC 2Q7RA 4P9TA 2B0HA 1Z6AA 1T01A 2Y3HA 2AU5A 3C62A 3PCVA 1K05A 2DYSC 4K1OA 4C3DA 5DS4A 1Z63A 2R25A 3HNJA 4MVOA 2FFHA 5AC5A 1QLEC 4U5DE 1T6QA 2DB4A 2KW3C 2YVKA 1RJ9B 2D4UA 1BR1A 2LK4A 1H9TA 3GWNA 3IHUA 4CS9C 1E83A 5DS5A 3JSZA 2Y3BA 4OIRF 4WGZA 4PJNA 4YJWA 5BQGA 1OW8A 4Z9HA 2DGJA 3EPVA 3HNLA 3NMJA 3SXMA 2R7QA 2UUHA 4CJGA 4LDKA 1D1AA 4PFPA 3V5XA 3FVYA 3QMKA 4JJGA 1VLTA 2HJ3A 3JYYA 1LE2A 4CDAA 2P0NA 5B3SC 3H2UA 3FHDA 1G5ZA 2R7RA 3EFOA 2IOQA 4WJ0A 3S27A 4EBKA 3V7OA 4EUKB 3M4CA 1ORSC 4HFKB 3MLGA 4O79A 1J8MF 4AL1A 4MTFA 4E7SA 1A41A 2L7AA 3U9MA 1BR4A 2OKUA 3EHNA 1XZQA 4PJLA 4BPMA 3B0VC 3DJNB 3ZG1A 1CPRA 3GM3A 3TJ6A 2OQMA 2EIMC 1Q0DA 2LCHA 3MYIA 4LDRA 1TWHA 4NQFA 3RIPA 1SF8A 2A68F 1LVKA 1TWCA 2XLMA 3U2MA 5IY5C 1D1CA 1AUEA 2A69F 3V5YA 5FCLA 4I1OB 3GODA 5L0GA 1OR2A 2J9VA 1E85A 4RBNA 4Q5SF 3DWWA 1WWPA 2MHRA 4JIOA 3M4BA 4QDLA 5COMA 4MS2A 4HE8D 3U2LA 5A6KA 5L3QA 4GEHA 4J7TA 4YT4A 1DOVA 2LFDA 2OJED 4U9EA 3RVZA 4YL3A 1PD1A 2V26A 1Q0GA 2EPKX 3NYMA 3S9OA 3ZTMA 1T5OA 4DXWA 4QI2A 4AX2A 1YVIA 2M4EA 4NTAA 1SZIA 4BEJA 1BDJB 1M56C 3OEOA 4UDVA 1APCA 1I4YA 3SXZA 3AGTA 1G4WR 1LKXA 3QW0A 2HV6A 5CI9A 4I1MA 1U0BB 3O55A 3MFNA 1QPUA 2PX3A 5E3AA 3ZDLA 1LM3B 5JLIA 3PMRA 4OIPF 3TK0A 2OG2A 2A0BA 2PBEA 4JVSA 5E33A 4IAQA 1MMAA 3N0TA 4CDVA 3UR3C 3WODF 4CIHA 3TOLA 4XPXA 3VAYA 2KQ9A 3ZVRA 1PV3A 3M1CB 4OIOF 4G78A 2H7BA 4G7OF 4PK4A 1SR2A 2L6GA 3IQ6A 3UGPA 4K7BA 3R7CA 2Q00A 1AVOB 3L8JA 4F4BA 2V3CC 1CGNA 4FWVA 2EPOA 3B0UX 2VCBA 2BE5F 3V5ZA 1M2VA 3O10A 1VYKA 3U0CA 1TR2A 2A6HF 2P7VA 3HJCA 4ONSA 1S05A 2YRFA 2YZSA 3KYIA 4GYTA 3EH1A 2NSGA 3C8GB 2NPUA 3X2QC 1LS1A 4Q7CA 4C3BA 5K0IA 3AG4C 5DVWA 2ZXRA 1YA9A 1FAPB 3Q6MA 2YHSA 5A6AA 1I4ZA 4CJOA 1GS9A 3SP1A 3RW0A 3CZ6A 2NSFA 2G3VA 4O6NA 4XEFA 2NG1A 1JAFA 1Z23A 2CW0F 2IXNA 1H6GA 2UUIA 1L3PA 4DVZA 3ZC4A 2D5RB 2Q9CA 3ECSA 1RKEB 2Z15A 3POVA 4IGGA 4PR9A 3US6A 1MQVA 3EGDA 4E0IA 2NUTB 1M6TA 3ZSUA 1ORJA 5EK0A 1O5HA 1OCZC 2GDCA 5EHHA 3DE9A 5L0JA 1JOGA 2Y69C 5B3IA 1SYQA 4Z9IA 1EQ1A 2A1DD 5HSWA 4N06A 1M2VB 2XL8A 2HMZA 2AVKA 3KPHA 4YN0B 1JRAA 4AL0A 1HMOA 1CGOA 3NDBB 2XM4A 2LIGA 3IQCA 2YL3A 3DXJF 4KC9A 2ZXPA 4U5FE 4H4KC 2YL7A 2R7WA 1C02A 2J7PA 5T1DB 5JP7A 1T6UA 2CYDA 3F47A 3G4XA 3W8IA 1H7IA 3HTKC 2FAPB 3KH2A 3LNMB 4PJMA 1YYJA 2EINC 2F22A 1JPJA 1OQCA 5L0FA 3T4RA 3HNIA 3K33A 4RDAA 5COGA 5L0DA 2LQGA 2W4MA 2JX0A 3TOMA 2P1AA 2QLAA 2KSFA 2DI3A 2Q4FA 4XQ1A 5JRAA 1Z3IX 4G7ZF 2WL8A 2J9BA 3ASNC 1G4US 3HKKA 1LS4A 3M79A 4IWBA 1C03A 1Q0MA 3EGXB 3HNKA 1YJGA 1NSGB 4AK9A 4MQ9F 5DS6A 5JUAA 2BC5A 5A6BD 5L0IA 1OXBA 3GM2A 1NZEA 3FMSA 1E2XA 1ZHZA 3QVZA 3ASOC 5KYUA 1HE1A 1IW7F 1VMAA 4JEBA 4E17A 2XSEA 3KL4A 4XPYA 3CSKA 3H2VA 2Q9BA 1YLMA 3DJUB 2WVNA 3AQCA 2EILC 3N2ZB 3LUTB 4ANJA 2IYLD 2AWCA 3NYJA 2W4BA 3HLZA 2C03A 1A7VA 1YZAA 4JEAA 4M63A 3W2WA 4A4AA 1K40A 2HS5A 2O9XA 2YWAA 5T3WA 3EJNA 1W2WA 3W2VA 3U8PA 4CS7A 4PFOA 3AG3C 2B0JA 1RKEA 2J46A 2HUJA 2XL6A 4LERA 1U89A 3GWLA 4RD9A 1K04A 3B0PA 4KNVA 1FTSA 4JTAB 4MVQA 4OIQF 1ZU4A 3O6XA 1NFOA 1V54C 3JYHA 4OD5A 4EBJA 4Q4ZF 1OCOC 2P61A 2HSBA 3ATPA 2VASA 2J0XA 2OU6A 2YLGA 1D0XA 3B9QA 4G0HA 3Q7GA 4ULVA 3KYJA 3UMKA 4MNDA 3PHF2 2CGEA 1NU9C 1UFBA 4K0DA 2KC3A 2L6FA 4JTCB 1KTMA 2PFDA 4FX5A 4JCZA 3VRCA 5KYYB 3ITFA 1YAUO 5KYYA 3ZQYA 2IM8A 1AEPA 5F28E 2L81A 5F5FA 1SMYF 2XLDA 3JZ0A 4D4XA 3JRTA 3S84A 2EPMX 1FFTC 2KK1A 5DLJA 1V4AA 3Q7LA 1I5NA 1M2OA 2HFIA 1WTYA 2H8AA 1D0ZA 3I5QA 3L1MA 1M57C 4KBLA 2XRHA 2A0UA 5JT4A 3R2PA 4BEMJ 1E84A 1QQ3A 2WZLA 3EGDB 3WAQA 4BJ5C 3LLKA 1Z7Qc 1YDIA 2XLVA 3FXHA 1E86A 1KU2A 4PACA 2XS1A 4JC7A 1FR0A 3NG1A 4X0RA 3ZWIA 4YT2A 3F46A 3T6GB 5A6JA 3BEHA 1OW6A 1ZHWA 2E87A 2G62A 1FFHA 2MWQA 3JTLO 4L6RA 3OA1A 2KYHA 2J9WA 2W45A 2R7UA 2HSQA 1ZW3A 3U8VA 4N6HA 1S7ZA 2VCCA 3AJMA 4A2NB 1NFNA 1R4TA 4BJ6C 3N24A 2Y3DA 3EG9A 2YLDA 2LP4A 3KMIA 1QKRA 4LACB 2YL0A 4DRHB 3T6BA 4DVYP 1TQGA 2XLWA 1CPQA 2KNHA 4JTDB 4JURI 4C3EA 3PDMP 3JCUQ 2OJQA 3RFYA 2RSEB 2GFHA 3LJBA 3LS1A 4XPWA 1OR3A 4XLPF 2IXPA 5T3TA 2AP3A 3RQGA 3AQBA 1VLSA 3LEVA 2WB7A 1PCXA 3CAXA 4EWCA 5EGYA 1U6HA 3KKBA 1ZVZA 4HEAJ 3TULA 1A7EA 1MNEA 2X0CA 3LNRA 3GANA 1VB5A 4CSAA 1ORYA 3QW1A 5L0HA 2XS8A 1NLXA 2IXOA 3E9VA 3MBGA 5TJ5E 3FDQA 1XZPA 4B6IA 1HE9A 2OCCC 3VF0A 2PF4E 3JSEO 3J06A 2R03A 3FAPB 4YL0A 5AGFA 3S0XA 4EHPA 5KYNA 3QVYA 2MYSA 5D91A 3GEIA 3UNGC 4EIYA 4CBEA 2R02A 2ICWG 3FAJA 3DD7A 3EQLF 5F5HA 3DKAA 4KI2A 1OKKA 1LIHA 2LFFA 2VB6A 4IB4A 4E18A 2AWYA 3RKOF 1QZXA 4XLNF 3DMDA 3L8IA 1HW1A 2TMVP 1OXKA 1ZU5A 4IARA 4O6MA 5E3CA 4BJ5A 5CI8A 2R05A 4YT5A 2X51A 2J8WA 1B68A 1KNYA 1NU7D 1XWJA 3GEHA 5B1AC 4MTGA 2EIJC 3GM1A 3C63A 4U5BE 3W4YA 1UG7A 2PNOA 1T6IA 2CNWD 3AOUA 2VH3A 2A6EF 4FESA 2EPLX 4IJJA 1YA7O 1EA8A 1IZMA 3DAFA 4NC3A 3T6JA 3CEXA 5BQIA 1FMWA 2WZGA 2W9YA 3SYNA 3DM9B 1ST6A 2IXMA 4WABA 3TQOA 3ZIBA 4J7YA 4MVMA 4N6CA 1WOLA 4EBBA 4BJ6A 4W8KA 5B1BC 4NY3A 2VCAA 2YLIA 4AE4B 2M64A 4BJTA 4AE4A 4XEKA 1ZZPA 3E70C 3EG9B 4IAOA 3QTHA 2GA0A 4OD4A 3RQFA 2YL1A 4Z9JA 5CIVA 3K1IA 3G50A 3Q6NA 5A6BA 1BR2A 1D0YA 4XWJA 3DM5A 4I3MA 4BG0A 1T9KA 1OCRC 3SXYA 2ZPAA 3EZIA 2WVOA 4D4NA 1V74B 4DBRA 1FNTc 4U5EE 1MMNA 3L0IA 4MVSA 4C7OA 256BA 3C18A 4DRIB 3S90A 3NYLA 4U5HA 4CDYA 1RJ9A 1D1BA 2J9UA 2R7XA 4CIPA 3GEEA 3VYWA 2L6HA 5FZTA 1WN0A 3MYFA 2IBFA 4XTKA 1O87A 1WGWA 2DYRC 4JW1A 3IQTA 3T9OA 5D92A 3EGXA 4QI0A 4IRUA 3A9CA 3M15A 2GWWA 5COFA 5DQZA 2XXAB 3NKEA 2YQYA 3C8ZA 1OW7A 5KYWA 2XLHA 1CGME 5JSLA 2JPUA 4O6YA 4NTFA 1A7DA 4NCQA 3TD7A 2J45A 3IEEA 3C8GA 2ZXOA 2Q3TA 1VK5A 2R9RB 2WVQA 2XM0A 3FOOA 3K1HA 4U5GA 4FAPB 1JPNA 1J8YF 2XLEA 1Z5ZA 3EH2A 1Y6DA 1ZYRF 2HV7A 4J32B 2J0WA 2C04A 2L9JA 2R7OA 1DOWA 4KNWA 4H54A 3U9JA 4MTOA 3U3BA 2QE9A 4DBQA 3IQ5A 3WHNA 4YK5A 4C7OB 2Y39A 1EKYA 4U9DA 1JR8A 1Q0KA 5JS5A 1MNDA 4W8PA 3DZAA 2HZ8A 3FOPA 5KYXA 1ZHXA 5L3VA 1JMWA 1LPEA 4E0HA 2BL2A 1R5ID 3A11A 3ZTZA 2I15A 1GGQA 2HKVA 2LSEA 2VC9A 2ZD9A 4P6IC 1HW2A 2EPNA 3SNHA 1WASA 3RYLA 3MX3A 2J7PD 1FMVA 2Q9AA 1Y4CA 3NMIA 3B29A 3X1OA 3DAGA 4GQHA 4DRJB 4ZLCA 4MW8A 4CSAC 1C17M 4CS8A 3LESA 3C7JA 2OEXA 2CNWA 5KYUB 1MMDA 3LLIA 3K6BA 3EZHA 4YWQA 4I44A 1NBBA 2Y3GA 4XEVA 2NUPA 2YEVA 4O7GA 3DI5A 2H7VC 3LS0A 4DJ9A 2ETSA 3UGOA 1G8XA 1V55C 3U3FA 1GM5A 1WATA 3K1IC 5BUOA 1LI7A 1MMGA 2YKZA 3O39A 4E7ZA 2R7SA 4P9FA 3ABMC 4YT8A 3B71A 4WGYA 3ZQVA 5GPGB 3CQZA 3L34A 4JJFA 5DQTA 1PD0A 2R7VA 2CDQA 3S29A 3DE8A 3IPMO 4MW3A 2P6VA 2QY9A 1LE4A 3AG2C 3JRMO 3K7DA 3GORA 3QZCA 5KYXB 2NUTA 1OKKD 1L7CA 4ER9A 2ASRA 4MVUA 3JT1A 3UMIA 4CS8C 1HMDA 2XXAA 4JKVA 3W8HA 2WZFA 4MVZA 4OINF 4G7HF 1LI5A 3BRJA 5KYWB 2OEVA 2XLOA 2HJMA 3G4ZA 2QTVA 3LEOA 4R32A 4DOZA 1TWAA 1ZHTA 3VM6A 3AG1C 5L0CA 1ZHYA 3AGUA 3SEOA 4JE9A 1VTMP 2EIKC 3OWTA 1RMVA 2GAQA 3S28A 2KGOA 1TKNA 1NG1A 2G3KA 2NUPB 3SXKA 1YYXA 2PP4A 3ABKC 4LDQA 1BZ4A 5BQHA 2LD6A 2ZXWC 3C8GD 2HMQA 2OOCA 3SZRA 5HV9A 4J30B 4N4WA 1GQAA 4NTBA 2JD3A 3EHMA 1BBHA 1TFOB 2QNLA 3RQEA 3NKDA 4HFFB 1RXQA 1RKCA 4LLCA 3NRHA 3RH3A 2PX0A 2R7TA 4JCHA 3I4UA 1ZW2A 4ULWA 2H7OA
chains in the Genus database with same CATH topology
2PNOA 3LEOA 4YK5A 3HKKA 4AL0A 5BQIA 5K0IA 4YL0A 5BQGA 2H8AA 4WABA 3DWWA 4J7YA 2UUHA 4J7TA 4JRZA 4YL1A 5BQHA 2UUIA 4YL3A 4NTFA 5HV9A 4NTBA 4JC7A 4NTAA 2Q7RA 3PCVA 3B29A 4AL1A 4JCZA 4BPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNO A;  3LEO A;  4YK5 A;  3HKK A;  4AL0 A;  5BQI A;  5K0I A;  4YL0 A;  5BQG A;  2H8A A;  4WAB A;  3DWW A;  4J7Y A;  2UUH A;  4J7T A;  4JRZ A;  4YL1 A;  5BQH A;  2UUI A;  4YL3 A;  4NTF A;  5HV9 A;  4NTB A;  4JC7 A;  4NTA A;  2Q7R A;  3PCV A;  3B29 A;  4AL1 A;  4JCZ A;  4BPM A; 
#chains in the Genus database with same CATH topology
 3UMH A;  2RD9 A;  2CCY A;  3NMK A;  4LLE A;  1TFK B;  1Q0F A;  3LAY A;  5A69 A;  4CS9 A;  2I8B A;  4CX9 A;  1EI7 A;  1F1M A;  2KJG A;  2FGY A;  3H65 A;  1A0B A;  4MVR A;  4U5C E;  3RF3 A;  3RVY A;  4ZLD A;  3TJ5 A;  1YAR O;  4EKW A;  2XL4 A;  1RCP A;  1VYI A;  5JVE A;  4JZA A;  1H9G A;  3EFO B;  1O3U A;  1TWG A;  1VOM A;  1YZC A;  4JRZ A;  1HY5 A;  4YL1 A;  3U5S A;  1QSP A;  5E2Q A;  2QUP A;  1N1C A;  4BJ1 A;  3K66 A;  1QVX A;  4PJJ A;  5AC4 A;  3WG7 C;  3I5P A;  3ABL C;  1OCC C;  2Q7R A;  4P9T A;  2B0H A;  1Z6A A;  1T01 A;  2Y3H A;  2AU5 A;  3C62 A;  3PCV A;  1K05 A;  2DYS C;  4K1O A;  4C3D A;  5DS4 A;  1Z63 A;  2R25 A;  3HNJ A;  4MVO A;  2FFH A;  5AC5 A;  1QLE C;  4U5D E;  1T6Q A;  2DB4 A;  2KW3 C;  2YVK A;  1RJ9 B;  2D4U A;  1BR1 A;  2LK4 A;  1H9T A;  3GWN A;  3IHU A;  4CS9 C;  1E83 A;  5DS5 A;  3JSZ A;  2Y3B A;  4OIR F;  4WGZ A;  4PJN A;  4YJW A;  5BQG A;  1OW8 A;  4Z9H A;  2DGJ A;  3EPV A;  3HNL A;  3NMJ A;  3SXM A;  2R7Q A;  2UUH A;  4CJG A;  4LDK A;  1D1A A;  4PFP A;  3V5X A;  3FVY A;  3QMK A;  4JJG A;  1VLT A;  2HJ3 A;  3JYY A;  1LE2 A;  4CDA A;  2P0N A;  5B3S C;  3H2U A;  3FHD A;  1G5Z A;  2R7R A;  3EFO A;  2IOQ A;  4WJ0 A;  3S27 A;  4EBK A;  3V7O A;  4EUK B;  3M4C A;  1ORS C;  4HFK B;  3MLG A;  4O79 A;  1J8M F;  4AL1 A;  4MTF A;  4E7S A;  1A41 A;  2L7A A;  3U9M A;  1BR4 A;  2OKU A;  3EHN A;  1XZQ A;  4PJL A;  4BPM A;  3B0V C;  3DJN B;  3ZG1 A;  1CPR A;  3GM3 A;  3TJ6 A;  2OQM A;  2EIM C;  1Q0D A;  2LCH A;  3MYI A;  4LDR A;  1TWH A;  4NQF A;  3RIP A;  1SF8 A;  2A68 F;  1LVK A;  1TWC A;  2XLM A;  3U2M A;  5IY5 C;  1D1C A;  1AUE A;  2A69 F;  3V5Y A;  5FCL A;  4I1O B;  3GOD A;  5L0G A;  1OR2 A;  2J9V A;  1E85 A;  4RBN A;  4Q5S F;  3DWW A;  1WWP A;  2MHR A;  4JIO A;  3M4B A;  4QDL A;  5COM A;  4MS2 A;  4HE8 D;  3U2L A;  5A6K A;  5L3Q A;  4GEH A;  4J7T A;  4YT4 A;  1DOV A;  2LFD A;  2OJE D;  4U9E A;  3RVZ A;  4YL3 A;  1PD1 A;  2V26 A;  1Q0G A;  2EPK X;  3NYM A;  3S9O A;  3ZTM A;  1T5O A;  4DXW A;  4QI2 A;  4AX2 A;  1YVI A;  2M4E A;  4NTA A;  1SZI A;  4BEJ A;  1BDJ B;  1M56 C;  3OEO A;  4UDV A;  1APC A;  1I4Y A;  3SXZ A;  3AGT A;  1G4W R;  1LKX A;  3QW0 A;  2HV6 A;  5CI9 A;  4I1M A;  1U0B B;  3O55 A;  3MFN A;  1QPU A;  2PX3 A;  5E3A A;  3ZDL A;  1LM3 B;  5JLI A;  3PMR A;  4OIP F;  3TK0 A;  2OG2 A;  2A0B A;  2PBE A;  4JVS A;  5E33 A;  4IAQ A;  1MMA A;  3N0T A;  4CDV A;  3UR3 C;  3WOD F;  4CIH A;  3TOL A;  4XPX A;  3VAY A;  2KQ9 A;  3ZVR A;  1PV3 A;  3M1C B;  4OIO F;  4G78 A;  2H7B A;  4G7O F;  4PK4 A;  1SR2 A;  2L6G A;  3IQ6 A;  3UGP A;  4K7B A;  3R7C A;  2Q00 A;  1AVO B;  3L8J A;  4F4B A;  2V3C C;  1CGN A;  4FWV A;  2EPO A;  3B0U X;  2VCB A;  2BE5 F;  3V5Z A;  1M2V A;  3O10 A;  1VYK A;  3U0C A;  1TR2 A;  2A6H F;  2P7V A;  3HJC A;  4ONS A;  1S05 A;  2YRF A;  2YZS A;  3KYI A;  4GYT A;  3EH1 A;  2NSG A;  3C8G B;  2NPU A;  3X2Q C;  1LS1 A;  4Q7C A;  4C3B A;  5K0I A;  3AG4 C;  5DVW A;  2ZXR A;  1YA9 A;  1FAP B;  3Q6M A;  2YHS A;  5A6A A;  1I4Z A;  4CJO A;  1GS9 A;  3SP1 A;  3RW0 A;  3CZ6 A;  2NSF A;  2G3V A;  4O6N A;  4XEF A;  2NG1 A;  1JAF A;  1Z23 A;  2CW0 F;  2IXN A;  1H6G A;  2UUI A;  1L3P A;  4DVZ A;  3ZC4 A;  2D5R B;  2Q9C A;  3ECS A;  1RKE B;  2Z15 A;  3POV A;  4IGG A;  4PR9 A;  3US6 A;  1MQV A;  3EGD A;  4E0I A;  2NUT B;  1M6T A;  3ZSU A;  1ORJ A;  5EK0 A;  1O5H A;  1OCZ C;  2GDC A;  5EHH A;  3DE9 A;  5L0J A;  1JOG A;  2Y69 C;  5B3I A;  1SYQ A;  4Z9I A;  1EQ1 A;  2A1D D;  5HSW A;  4N06 A;  1M2V B;  2XL8 A;  2HMZ A;  2AVK A;  3KPH A;  4YN0 B;  1JRA A;  4AL0 A;  1HMO A;  1CGO A;  3NDB B;  2XM4 A;  2LIG A;  3IQC A;  2YL3 A;  3DXJ F;  4KC9 A;  2ZXP A;  4U5F E;  4H4K C;  2YL7 A;  2R7W A;  1C02 A;  2J7P A;  5T1D B;  5JP7 A;  1T6U A;  2CYD A;  3F47 A;  3G4X A;  3W8I A;  1H7I A;  3HTK C;  2FAP B;  3KH2 A;  3LNM B;  4PJM A;  1YYJ A;  2EIN C;  2F22 A;  1JPJ A;  1OQC A;  5L0F A;  3T4R A;  3HNI A;  3K33 A;  4RDA A;  5COG A;  5L0D A;  2LQG A;  2W4M A;  2JX0 A;  3TOM A;  2P1A A;  2QLA A;  2KSF A;  2DI3 A;  2Q4F A;  4XQ1 A;  5JRA A;  1Z3I X;  4G7Z F;  2WL8 A;  2J9B A;  3ASN C;  1G4U S;  3HKK A;  1LS4 A;  3M79 A;  4IWB A;  1C03 A;  1Q0M A;  3EGX B;  3HNK A;  1YJG A;  1NSG B;  4AK9 A;  4MQ9 F;  5DS6 A;  5JUA A;  2BC5 A;  5A6B D;  5L0I A;  1OXB A;  3GM2 A;  1NZE A;  3FMS A;  1E2X A;  1ZHZ A;  3QVZ A;  3ASO C;  5KYU A;  1HE1 A;  1IW7 F;  1VMA A;  4JEB A;  4E17 A;  2XSE A;  3KL4 A;  4XPY A;  3CSK A;  3H2V A;  2Q9B A;  1YLM A;  3DJU B;  2WVN A;  3AQC A;  2EIL C;  3N2Z B;  3LUT B;  4ANJ A;  2IYL D;  2AWC A;  3NYJ A;  2W4B A;  3HLZ A;  2C03 A;  1A7V A;  1YZA A;  4JEA A;  4M63 A;  3W2W A;  4A4A A;  1K40 A;  2HS5 A;  2O9X A;  2YWA A;  5T3W A;  3EJN A;  1W2W A;  3W2V A;  3U8P A;  4CS7 A;  4PFO A;  3AG3 C;  2B0J A;  1RKE A;  2J46 A;  2HUJ A;  2XL6 A;  4LER A;  1U89 A;  3GWL A;  4RD9 A;  1K04 A;  3B0P A;  4KNV A;  1FTS A;  4JTA B;  4MVQ A;  4OIQ F;  1ZU4 A;  3O6X A;  1NFO A;  1V54 C;  3JYH A;  4OD5 A;  4EBJ A;  4Q4Z F;  1OCO C;  2P61 A;  2HSB A;  3ATP A;  2VAS A;  2J0X A;  2OU6 A;  2YLG A;  1D0X A;  3B9Q A;  4G0H A;  3Q7G A;  4ULV A;  3KYJ A;  3UMK A;  4MND A;  3PHF 2;  2CGE A;  1NU9 C;  1UFB A;  4K0D A;  2KC3 A;  2L6F A;  4JTC B;  1KTM A;  2PFD A;  4FX5 A;  4JCZ A;  3VRC A;  5KYY B;  3ITF A;  1YAU O;  5KYY A;  3ZQY A;  2IM8 A;  1AEP A;  5F28 E;  2L81 A;  5F5F A;  1SMY F;  2XLD A;  3JZ0 A;  4D4X A;  3JRT A;  3S84 A;  2EPM X;  1FFT C;  2KK1 A;  5DLJ A;  1V4A A;  3Q7L A;  1I5N A;  1M2O A;  2HFI A;  1WTY A;  2H8A A;  1D0Z A;  3I5Q A;  3L1M A;  1M57 C;  4KBL A;  2XRH A;  2A0U A;  5JT4 A;  3R2P A;  4BEM J;  1E84 A;  1QQ3 A;  2WZL A;  3EGD B;  3WAQ A;  4BJ5 C;  3LLK A;  1Z7Q c;  1YDI A;  2XLV A;  3FXH A;  1E86 A;  1KU2 A;  4PAC A;  2XS1 A;  4JC7 A;  1FR0 A;  3NG1 A;  4X0R A;  3ZWI A;  4YT2 A;  3F46 A;  3T6G B;  5A6J A;  3BEH A;  1OW6 A;  1ZHW A;  2E87 A;  2G62 A;  1FFH A;  2MWQ A;  3JTL O;  4L6R A;  3OA1 A;  2KYH A;  2J9W A;  2W45 A;  2R7U A;  2HSQ A;  1ZW3 A;  3U8V A;  4N6H A;  1S7Z A;  2VCC A;  3AJM A;  4A2N B;  1NFN A;  1R4T A;  4BJ6 C;  3N24 A;  2Y3D A;  3EG9 A;  2YLD A;  2LP4 A;  3KMI A;  1QKR A;  4LAC B;  2YL0 A;  4DRH B;  3T6B A;  4DVY P;  1TQG A;  2XLW A;  1CPQ A;  2KNH A;  4JTD B;  4JUR I;  4C3E A;  3PDM P;  3JCU Q;  2OJQ A;  3RFY A;  2RSE B;  2GFH A;  3LJB A;  3LS1 A;  4XPW A;  1OR3 A;  4XLP F;  2IXP A;  5T3T A;  2AP3 A;  3RQG A;  3AQB A;  1VLS A;  3LEV A;  2WB7 A;  1PCX A;  3CAX A;  4EWC A;  5EGY A;  1U6H A;  3KKB A;  1ZVZ A;  4HEA J;  3TUL A;  1A7E A;  1MNE A;  2X0C A;  3LNR A;  3GAN A;  1VB5 A;  4CSA A;  1ORY A;  3QW1 A;  5L0H A;  2XS8 A;  1NLX A;  2IXO A;  3E9V A;  3MBG A;  5TJ5 E;  3FDQ A;  1XZP A;  4B6I A;  1HE9 A;  2OCC C;  3VF0 A;  2PF4 E;  3JSE O;  3J06 A;  2R03 A;  3FAP B;  4YL0 A;  5AGF A;  3S0X A;  4EHP A;  5KYN A;  3QVY A;  2MYS A;  5D91 A;  3GEI A;  3UNG C;  4EIY A;  4CBE A;  2R02 A;  2ICW G;  3FAJ A;  3DD7 A;  3EQL F;  5F5H A;  3DKA A;  4KI2 A;  1OKK A;  1LIH A;  2LFF A;  2VB6 A;  4IB4 A;  4E18 A;  2AWY A;  3RKO F;  1QZX A;  4XLN F;  3DMD A;  3L8I A;  1HW1 A;  2TMV P;  1OXK A;  1ZU5 A;  4IAR A;  4O6M A;  5E3C A;  4BJ5 A;  5CI8 A;  2R05 A;  4YT5 A;  2X51 A;  2J8W A;  1B68 A;  1KNY A;  1NU7 D;  1XWJ A;  3GEH A;  5B1A C;  4MTG A;  2EIJ C;  3GM1 A;  3C63 A;  4U5B E;  3W4Y A;  1UG7 A;  2PNO A;  1T6I A;  2CNW D;  3AOU A;  2VH3 A;  2A6E F;  4FES A;  2EPL X;  4IJJ A;  1YA7 O;  1EA8 A;  1IZM A;  3DAF A;  4NC3 A;  3T6J A;  3CEX A;  5BQI A;  1FMW A;  2WZG A;  2W9Y A;  3SYN A;  3DM9 B;  1ST6 A;  2IXM A;  4WAB A;  3TQO A;  3ZIB A;  4J7Y A;  4MVM A;  4N6C A;  1WOL A;  4EBB A;  4BJ6 A;  4W8K A;  5B1B C;  4NY3 A;  2VCA A;  2YLI A;  4AE4 B;  2M64 A;  4BJT A;  4AE4 A;  4XEK A;  1ZZP A;  3E70 C;  3EG9 B;  4IAO A;  3QTH A;  2GA0 A;  4OD4 A;  3RQF A;  2YL1 A;  4Z9J A;  5CIV A;  3K1I A;  3G50 A;  3Q6N A;  5A6B A;  1BR2 A;  1D0Y A;  4XWJ A;  3DM5 A;  4I3M A;  4BG0 A;  1T9K A;  1OCR C;  3SXY A;  2ZPA A;  3EZI A;  2WVO A;  4D4N A;  1V74 B;  4DBR A;  1FNT c;  4U5E E;  1MMN A;  3L0I A;  4MVS A;  4C7O A;  256B A;  3C18 A;  4DRI B;  3S90 A;  3NYL A;  4U5H A;  4CDY A;  1RJ9 A;  1D1B A;  2J9U A;  2R7X A;  4CIP A;  3GEE A;  3VYW A;  2L6H A;  5FZT A;  1WN0 A;  3MYF A;  2IBF A;  4XTK A;  1O87 A;  1WGW A;  2DYR C;  4JW1 A;  3IQT A;  3T9O A;  5D92 A;  3EGX A;  4QI0 A;  4IRU A;  3A9C A;  3M15 A;  2GWW A;  5COF A;  5DQZ A;  2XXA B;  3NKE A;  2YQY A;  3C8Z A;  1OW7 A;  5KYW A;  2XLH A;  1CGM E;  5JSL A;  2JPU A;  4O6Y A;  4NTF A;  1A7D A;  4NCQ A;  3TD7 A;  2J45 A;  3IEE A;  3C8G A;  2ZXO A;  2Q3T A;  1VK5 A;  2R9R B;  2WVQ A;  2XM0 A;  3FOO A;  3K1H A;  4U5G A;  4FAP B;  1JPN A;  1J8Y F;  2XLE A;  1Z5Z A;  3EH2 A;  1Y6D A;  1ZYR F;  2HV7 A;  4J32 B;  2J0W A;  2C04 A;  2L9J A;  2R7O A;  1DOW A;  4KNW A;  4H54 A;  3U9J A;  4MTO A;  3U3B A;  2QE9 A;  4DBQ A;  3IQ5 A;  3WHN A;  4YK5 A;  4C7O B;  2Y39 A;  1EKY A;  4U9D A;  1JR8 A;  1Q0K A;  5JS5 A;  1MND A;  4W8P A;  3DZA A;  2HZ8 A;  3FOP A;  5KYX A;  1ZHX A;  5L3V A;  1JMW A;  1LPE A;  4E0H A;  2BL2 A;  1R5I D;  3A11 A;  3ZTZ A;  2I15 A;  1GGQ A;  2HKV A;  2LSE A;  2VC9 A;  2ZD9 A;  4P6I C;  1HW2 A;  2EPN A;  3SNH A;  1WAS A;  3RYL A;  3MX3 A;  2J7P D;  1FMV A;  2Q9A A;  1Y4C A;  3NMI A;  3B29 A;  3X1O A;  3DAG A;  4GQH A;  4DRJ B;  4ZLC A;  4MW8 A;  4CSA C;  1C17 M;  4CS8 A;  3LES A;  3C7J A;  2OEX A;  2CNW A;  5KYU B;  1MMD A;  3LLI A;  3K6B A;  3EZH A;  4YWQ A;  4I44 A;  1NBB A;  2Y3G A;  4XEV A;  2NUP A;  2YEV A;  4O7G A;  3DI5 A;  2H7V C;  3LS0 A;  4DJ9 A;  2ETS A;  3UGO A;  1G8X A;  1V55 C;  3U3F A;  1GM5 A;  1WAT A;  3K1I C;  5BUO A;  1LI7 A;  1MMG A;  2YKZ A;  3O39 A;  4E7Z A;  2R7S A;  4P9F A;  3ABM C;  4YT8 A;  3B71 A;  4WGY A;  3ZQV A;  5GPG B;  3CQZ A;  3L34 A;  4JJF A;  5DQT A;  1PD0 A;  2R7V A;  2CDQ A;  3S29 A;  3DE8 A;  3IPM O;  4MW3 A;  2P6V A;  2QY9 A;  1LE4 A;  3AG2 C;  3JRM O;  3K7D A;  3GOR A;  3QZC A;  5KYX B;  2NUT A;  1OKK D;  1L7C A;  4ER9 A;  2ASR A;  4MVU A;  3JT1 A;  3UMI A;  4CS8 C;  1HMD A;  2XXA A;  4JKV A;  3W8H A;  2WZF A;  4MVZ A;  4OIN F;  4G7H F;  1LI5 A;  3BRJ A;  5KYW B;  2OEV A;  2XLO A;  2HJM A;  3G4Z A;  2QTV A;  3LEO A;  4R32 A;  4DOZ A;  1TWA A;  1ZHT A;  3VM6 A;  3AG1 C;  5L0C A;  1ZHY A;  3AGU A;  3SEO A;  4JE9 A;  1VTM P;  2EIK C;  3OWT A;  1RMV A;  2GAQ A;  3S28 A;  2KGO A;  1TKN A;  1NG1 A;  2G3K A;  2NUP B;  3SXK A;  1YYX A;  2PP4 A;  3ABK C;  4LDQ A;  1BZ4 A;  5BQH A;  2LD6 A;  2ZXW C;  3C8G D;  2HMQ A;  2OOC A;  3SZR A;  5HV9 A;  4J30 B;  4N4W A;  1GQA A;  4NTB A;  2JD3 A;  3EHM A;  1BBH A;  1TFO B;  2QNL A;  3RQE A;  3NKD A;  4HFF B;  1RXQ A;  1RKC A;  4LLC A;  3NRH A;  3RH3 A;  2PX0 A;  2R7T A;  4JCH A;  3I4U A;  1ZW2 A;  4ULW A;  2H7O A; 
#chains in the Genus database with same CATH homology
 2PNO A;  3LEO A;  4YK5 A;  3HKK A;  4AL0 A;  5BQI A;  5K0I A;  4YL0 A;  5BQG A;  2H8A A;  4WAB A;  3DWW A;  4J7Y A;  2UUH A;  4J7T A;  4JRZ A;  4YL1 A;  5BQH A;  2UUI A;  4YL3 A;  4NTF A;  5HV9 A;  4NTB A;  4JC7 A;  4NTA A;  2Q7R A;  3PCV A;  3B29 A;  4AL1 A;  4JCZ A;  4BPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...