4AL0A

Crystal structure of human ps-1
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
146
structure length
146
Chain Sequence
VMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROSTAGLANDIN E SYNTHASE
publication title Crystal Structure of Microsomal Prostaglandin E2 Synthase Provides Insight Into Diversity in the Mapeg Superfamily.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 65
structure length 146
sequence length 146
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4al0A00
5BQIA 3LEOA 3B29A 4J7YA 5BQGA 2UUHA 5BQHA 2PNOA 4JRZA 4BPMA 4J7TA 4YK5A 4YL0A 5K0IA 4JCZA 4YL3A 4YL1A 4WABA 4AL0A 4AL1A 4NTAA 2UUIA 4NTFA 4JC7A 2H8AA 2Q7RA 5HV9A 3DWWA 3HKKA 4NTBA 3PCVA
chains in the Genus database with same CATH superfamily
1Z5ZA 3O39A 4LDQA 1NU9C 3UMIA 2P6VA 1KNYA 2YL0A 3N24A 2YLGA 1BR1A 3ECSA 2UUHA 3QVYA 4YT4A 1OW6A 1T6QA 1FMWA 1W2WA 2PNOA 4GEHA 3U9MA 3S27A 3K33A 5K0IA 3ASOC 4DXWA 2HJMA 3CZ6A 1Z63A 5FZTA 2WL8A 5L0JA 4JTDB 2H7OA 3UGPA 2M4EA 1EQ1A 1L3PA 2ZD9A 4I1OB 4CS8C 3B0UX 2L6FA 3QW0A 1APCA 1GQAA 1Y6DA 2P0NA 3DZAA 3ITFA 3EGXB 2YLIA 2NG1A 4XEKA 3ABKC 3X2QC 5KYYB 1RKEA 2H8AA 1RJ9B 3O55A 2YWAA 3B0PA 4BEMJ 2EIJC 3L34A 1ZHXA 2IXPA 2KGOA 3G50A 4WJ0A 1E2XA 1M6TA 1NBBA 1JMWA 1S7ZA 2R05A 4NTBA 4PJLA 3ZC4A 3ZVRA 3RQGA 5KYXB 3LEOA 3EH1A 4OIQF 4OIPF 1RMVA 3B29A 4O6NA 3FAJA 1HE9A 2HZ8A 4CJGA 5DS5A 1BDJB 1A41A 2C03A 1VLSA 2J9UA 2KQ9A 3LNMB 3M4BA 2P7VA 4U9EA 4G7OF 2KC3A 2L81A 3RVYA 3EQLF 1LI7A 2YL7A 2J0WA 2QLAA 2W9YA 3IHUA 4FX5A 4U9DA 3N2ZB 3V7OA 4F4BA 5A6BD 2BC5A 3T4RA 5JLIA 1F1MA 3T9OA 3UNGC 4XLNF 2VCBA 3FHDA 4DJ9A 5T1DB 2HKVA 2VB6A 4BJTA 2Q3TA 3EHNA 2Y3GA 3I4UA 3MYIA 3T6GB 4BEJA 4JE9A 5E33A 3H2VA 2LP4A 1OKKA 1M2VA 3DE9A 3L8JA 5A6BA 2HS5A 3K1IA 2J8WA 3HNKA 3KPHA 4Q4ZF 4EWCA 4Q5SF 4MVRA 2XRHA 1YVIA 1PD0A 3NRHA 2A6EF 2HMZA 3JTLO 3LS1A 3S90A 4MW8A 5JRAA 2XLWA 3A11A 4J7TA 4YK5A 1YYXA 4GQHA 2XXAB 4RDAA 3NYLA 4GYTA 1ZZPA 2OJED 3DAGA 4CX9A 1A7VA 2V26A 3S29A 4X0RA 3GM1A 2HFIA 2EINC 2A6HF 2I15A 3WG7C 1Z6AA 4CBEA 4IAQA 5BUOA 2HMQA 3K1HA 4YJWA 4AK9A 1VYIA 2YVKA 3AG4C 3C8GB 3E9VA 3ZIBA 3T6JA 4C3EA 2LIGA 2IXMA 2XLDA 4YT5A 4K1OA 5EK0A 2OEVA 2NUPA 4FAPB 2YL3A 3W8IA 2MYSA 1H7IA 1FR0A 1ZHYA 3W2VA 1J8YF 5COGA 3GM3A 3RVZA 3U9JA 3FMSA 5BQHA 4IB4A 1ZYRF 4LLCA 5FCLA 4C7OB 3U2LA 1FNTc 3QMKA 3DJUB 3BEHA 4PK4A 5D92A 2G3KA 5COFA 2HV6A 4YL3A 4Z9JA 1ST6A 3AG2C 3V5ZA 3JYHA 4AL0A 3LEVA 3TD7A 4PACA 2OQMA 1OXKA 2IOQA 3Q7GA 1LS4A 1JPJA 4N6CA 1ZHZA 2LK4A 1YZAA 3GM2A 3U0CA 4NCQA 4JIOA 4YN0B 5COMA 5E3AA 3JCUQ 3B71A 1VK5A 1K05A 4FWVA 4NY3A 3DI5A 4MTGA 1AUEA 1A7EA 4CS9C 3OWTA 4EKWA 3RQEA 2R7WA 2R7VA 1IW7F 5BQIA 3EFOB 5CI9A 1Z23A 2GDCA 3K6BA 3VAYA 3SNHA 256BA 1H9TA 2AP3A 1TWCA 1U6HA 4KNVA 3US6A 2OOCA 1OW8A 3HNIA 1XWJA 3V5XA 3EGDB 4PJNA 3G4ZA 1Z7Qc 2BL2A 2A1DD 3K1IC 4K0DA 5JP7A 4DRIB 4H54A 4U5BE 5KYWB 2QY9A 2OU6A 4BJ5A 3ZG1A 1MMGA 1G5ZA 3M15A 2NUTA 1HW1A 2IXNA 1GGQA 5JSLA 3WODF 4RBNA 2HUJA 1YYJA 3B0VC 4CS7A 2R7UA 4O79A 2IYLD 1V54C 2DI3A 2XS8A 3BRJA 1VB5A 1WGWA 4AE4A 2R7XA 4P9TA 2W4MA 1IZMA 3SP1A 1BR4A 3KL4A 2VCAA 3JYYA 4Q7CA 3U5SA 1MMAA 1YARO 1YA9A 2KSFA 3EG9A 4HFKB 2GFHA 1YLMA 1Q0GA 3FXHA 4U5CE 3FOPA 5HSWA 2AU5A 4IGGA 3NKDA 3MBGA 4JZAA 2O9XA 3LUTB 4J30B 4JCZA 4XLPF 3U8VA 4CSAA 3M4CA 1Q0MA 1LS1A 2LQGA 3Q6NA 4O6YA 2AWYA 4U5EE 3SXZA 3TOMA 4CDYA 2B0JA 3EZHA 1OQCA 1OR2A 2PBEA 2LFDA 4LACB 3MX3A 2JX0A 4AL1A 2VCCA 4C3BA 4EIYA 2Z15A 5KYUB 1VTMP 4YWQA 2LFFA 1C17M 4DRHB 2RD9A 3GWLA 2XLHA 1XZQA 4A4AA 3OEOA 4R32A 1H6GA 3SXMA 3CAXA 1BR2A 1TWGA 3FAPB 2GAQA 5DQTA 3EGXA 1RKCA 1CGOA 5KYYA 3AG3C 1G4US 1ZW3A 1RJ9A 1HY5A 3F46A 1CGNA 5DS4A 1M57C 3EH2A 3CQZA 2R7OA 5L0HA 3POVA 5E3CA 4JRZA 2D4UA 3FDQA 4MVSA 5KYXA 4JTCB 2FFHA 1VMAA 2NSGA 1MMNA 3RW0A 1ZW2A 1RCPA 3AQBA 4U5DE 3U2MA 3LLKA 4LERA 3GEHA 4OINF 3RFYA 3AGUA 3K7DA 1OKKD 4CS9A 3Q6MA 1D1AA 4YT8A 2CCYA 4ZLCA 5A6AA 4OIOF 2UUIA 3S28A 4BG0A 1LE4A 4JEAA 3VRCA 1U0BB 3CSKA 2WVOA 3DD7A 1C03A 2MWQA 3QVZA 2HJ3A 2J7PA 2YLDA 2Q7RA 3L8IA 3U3BA 4E17A 3RYLA 2XSEA 3HKKA 1Q0KA 3AGTA 4BJ5C 2EPKX 1QSPA 3L0IA 2IM8A 3IEEA 3LS0A 4MTFA 5AC4A 3GANA 4XWJA 1HMDA 3RH3A 2F22A 2JD3A 1T6IA 2XLVA 2Y3HA 2QUPA 2GA0A 1PD1A 4MQ9F 4YL1A 4KBLA 1JRAA 2LSEA 3IQTA 4PFPA 1NG1A 4U5HA 4JVSA 4EBJA 1ORJA 1TFKB 3AG1C 3ZSUA 1LM3B 1MNEA 3W8HA 1NFOA 4NTAA 2KJGA 3AJMA 2DYRC 3C8GD 2CNWA 4CIPA 2EPMX 2XXAA 4NTFA 5CI8A 5B3SC 3ZQVA 4NC3A 4DVYP 4H4KC 1OCOC 3MLGA 4CSAC 2R7SA 1K04A 1RXQA 1WN0A 3DXJF 2YHSA 2VH3A 4OD5A 3DWWA 1PV3A 1JOGA 3IQCA 4P6IC 3NYJA 3S84A 1V55C 3GWNA 4JJGA 3UGOA 3SYNA 3C8GA 4IARA 4N6HA 4MTOA 4C3DA 1EKYA 3ZQYA 5JVEA 3TQOA 2FGYA 3G4XA 1TWAA 1T6UA 2QTVA 2D5RB 2XL6A 1MNDA 4YL0A 3NYMA 2PX0A 1D0ZA 1JR8A 1SF8A 5AC5A 4QI2A 4JKVA 4C7OA 2WZGA 2FAPB 1ZHWA 4MVQA 2A69F 1M56C 3NDBB 4JC7A 3O10A 1AEPA 4I1MA 3NG1A 2XL8A 2HSBA 2XLOA 3K66A 4IWBA 1SZIA 1YZCA 2Q9BA 4MVOA 1GM5A 2GWWA 1QVXA 1KU2A 3DJNB 1QKRA 2A0BA 5JS5A 3C62A 1A7DA 1UFBA 2KW3C 1HW2A 1ZHTA 4A2NB 3U3FA 1LI5A 1WTYA 1HMOA 1FTSA 1T9KA 3HLZA 3UMHA 2ETSA 3KMIA 4O7GA 4FESA 3V5YA 3ZWIA 3MFNA 4D4XA 1ZU5A 3CEXA 3EFOA 5DQZA 4E0IA 1J8MF 4KI2A 3S9OA 4DOZA 4XPYA 2VC9A 3TULA 2XM4A 4ER9A 4IJJA 3JT1A 4Z9HA 1SR2A 2A68F 2CDQA 3DAFA 5DS6A 5L3VA 1SMYF 3EGDA 2EPLX 4I3MA 3IQ6A 4MW3A 3JRMO 4CIHA 4WGYA 1D1BA 4U5FE 3X1OA 1O5HA 2XLMA 3QTHA 5L0CA 4LDKA 1E86A 5HV9A 1B68A 2PFDA 5KYWA 5A69A 3GODA 1OCZC 2YZSA 1D1CA 4ULWA 5GPGB 4DBRA 1E84A 1V4AA 2Y3DA 5TJ5E 4MNDA 1CPRA 3SXYA 1R4TA 4DRJB 2EPOA 3NKEA 3DKAA 3NMKA 3VM6A 4PJMA 3PDMP 1TKNA 4LDRA 1YAUO 4XTKA 3ATPA 1R5ID 3JSEO 5DVWA 5T3TA 5B1BC 1ORYA 3LJBA 4WABA 4E7SA 2I8BA 4QI0A 2IXOA 1O87A 3C18A 2R02A 2X51A 4JEBA 1EA8A 2NPUA 2OCCC 2XM0A 3M1CB 4I44A 4PR9A 2Y39A 2YRFA 4CJOA 2AVKA 3O6XA 1WOLA 3C7JA 3HNLA 2WB7A 4W8PA 4PFOA 5B3IA 1TFOB 3PHF2 5KYUA 2MHRA 3ABLC 3Q7LA 4YT2A 4JW1A 3IQ5A 5B1AC 3DE8A 4JCHA 4AX2A 4ANJA 1O3UA 2G3VA 4J7YA 5BQGA 5E2QA 3QZCA 2Q4FA 3S0XA 2ICWG 1FAPB 2R9RB 3FVYA 3A9CA 3VF0A 4CDAA 2RSEB 2NSFA 3AOUA 3TOLA 4BPMA 2J7PD 3GORA 1NSGB 2X0CA 1SYQA 2B0HA 1BZ4A 1YDIA 2LD6A 1RKEB 3F47A 2PP4A 2VASA 2ZXPA 1T5OA 1K40A 2QE9A 3ASNC 2JPUA 4D4NA 5L0DA 2OKUA 5L0IA 4BJ6A 2Q00A 5AGFA 1L7CA 1ZU4A 1M2OA 1FFHA 1AVOB 1Z3IX 2EIKC 1OR3A 3N0TA 4JJFA 4U5GA 3LNRA 1C02A 2QNLA 1NZEA 2P61A 5JUAA 2E87A 1HE1A 4MVZA 3WHNA 3W4YA 3LLIA 2HV7A 4L6RA 5DLJA 2R7RA 3ZTZA 1XZPA 5JT4A 2KNHA 4IRUA 3I5PA 4N4WA 1QQ3A 1VOMA 3KYJA 4E0HA 1N1CA 3KKBA 4G0HA 1YA7O 2DGJA 4QDLA 3OA1A 2CNWD 2WZFA 5D91A 5A6KA 4JTAB 2YKZA 4Z9IA 3FOOA 4G78A 2J0XA 1FFTC 4OD4A 5L0GA 3GEEA 3DM5A 3HTKC 5CIVA 2R7QA 1OCCC 2L6GA 1MMDA 2XL4A 3NMJA 2L6HA 2IBFA 1OCRC 1G4WR 5EHHA 1NLXA 1OW7A 1M2VB 2OG2A 3E70C 3U8PA 3UR3C 2J9BA 3TK0A 1YJGA 3NMIA 3R2PA 1DOVA 1NU7D 3H2UA 1QZXA 3EHMA 3PMRA 1OXBA 2V3CC 1G8XA 4K7BA 1LE2A 3WAQA 1QLEC 4M63A 3M79A 3RKOF 2J45A 2M64A 3H65A 5A6JA 1A0BA 1S05A 3JSZA 2AWCA 2BE5F 2W4BA 2R03A 2DYSC 2ZPAA 4E18A 2Y3BA 3MYFA 4XPXA 4P9FA 3QW1A 4XQ1A 2XLEA 2ZXOA 3EPVA 1TR2A 2HSQA 2J46A 1U89A 3LESA 4HFFB 1LKXA 1WATA 4ULVA 4NQFA 4EBKA 4XEFA 3I5QA 1JAFA 2H7VC 4G7HF 3HNJA 1V74B 3GEIA 2CYDA 2OJQA 1QPUA 2R25A 4XEVA 2KYHA 4O6MA 2YQYA 2YEVA 2Q9AA 3C8ZA 3RIPA 2NUPB 4RD9A 4KNWA 1T01A 1MQVA 5L3QA 1GS9A 2KK1A 4MS2A 1CGME 1I5NA 1LPEA 3TJ6A 2CW0F 4HEAJ 1I4YA 4BJ6C 1WASA 2Q9CA 3PCVA 2A0UA 3SEOA 1PCXA 2ZXRA 3SZRA 1EI7A 4PJJA 4CS8A 2Y69C 1TWHA 3ZTMA 4KC9A 3RF3A 1WWPA 2WZLA 3IPMO 4JURI 5T3WA 1D0YA 3C63A 3ZDLA 1Q0DA 4N06A 4E7ZA 3DMDA 3HJCA 4BJ1A 4IAOA 1LIHA 1FMVA 3VYWA 1NFNA 1CPQA 4J32B 5F5FA 2WVNA 1JPNA 3R7CA 1Y4CA 1UG7A 4WGZA 1E83A 2EIMC 3EJNA 1VYKA 3AQCA 3JZ0A 4B6IA 1TQGA 3RQFA 2W45A 2ASRA 5F28E 4EHPA 4MVMA 2YL1A 5IY5C 5L0FA 1KTMA 3T6BA 2L7AA 3EZIA 1LVKA 2EPNA 1D0XA 2OEXA 4ONSA 3TJ5A 2C04A 2CGEA 1H9GA 2XS1A 5F5HA 2LCHA 4LLEA 4HE8D 3J06A 3DM9B 5EGYA 1ZVZA 2J9VA 3B9QA 4MVUA 4DBQA 2J9WA 3LAYA 5KYNA 3KH2A 3L1MA 3SXKA 2NUTB 1VLTA 3ABMC 1E85A 2G62A 2DB4A 3KYIA 4G7ZF 4W8KA 1DOWA 2ZXWC 2PF4E 2L9JA 3JRTA 2TMVP 4ZLDA 4AE4B 4CDVA 4XPWA 2P1AA 2R7TA 1ORSC 2PX3A 1I4ZA 4EBBA 2EILC 2WVQA 4OIRF 2H7BA 4UDVA 3W2WA 1Q0FA 3EG9B 1BBHA 4DVZA 3UMKA 4EUKB
chains in the Genus database with same CATH topology
5BQIA 3LEOA 3B29A 4J7YA 5BQGA 2UUHA 5BQHA 2PNOA 4JRZA 4BPMA 4J7TA 4YK5A 4YL0A 5K0IA 4JCZA 4YL3A 4YL1A 4WABA 4AL0A 4AL1A 4NTAA 2UUIA 4NTFA 4JC7A 2H8AA 2Q7RA 5HV9A 3DWWA 3HKKA 4NTBA 3PCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BQI A;  3LEO A;  3B29 A;  4J7Y A;  5BQG A;  2UUH A;  5BQH A;  2PNO A;  4JRZ A;  4BPM A;  4J7T A;  4YK5 A;  4YL0 A;  5K0I A;  4JCZ A;  4YL3 A;  4YL1 A;  4WAB A;  4AL0 A;  4AL1 A;  4NTA A;  2UUI A;  4NTF A;  4JC7 A;  2H8A A;  2Q7R A;  5HV9 A;  3DWW A;  3HKK A;  4NTB A;  3PCV A; 
#chains in the Genus database with same CATH topology
 1Z5Z A;  3O39 A;  4LDQ A;  1NU9 C;  3UMI A;  2P6V A;  1KNY A;  2YL0 A;  3N24 A;  2YLG A;  1BR1 A;  3ECS A;  2UUH A;  3QVY A;  4YT4 A;  1OW6 A;  1T6Q A;  1FMW A;  1W2W A;  2PNO A;  4GEH A;  3U9M A;  3S27 A;  3K33 A;  5K0I A;  3ASO C;  4DXW A;  2HJM A;  3CZ6 A;  1Z63 A;  5FZT A;  2WL8 A;  5L0J A;  4JTD B;  2H7O A;  3UGP A;  2M4E A;  1EQ1 A;  1L3P A;  2ZD9 A;  4I1O B;  4CS8 C;  3B0U X;  2L6F A;  3QW0 A;  1APC A;  1GQA A;  1Y6D A;  2P0N A;  3DZA A;  3ITF A;  3EGX B;  2YLI A;  2NG1 A;  4XEK A;  3ABK C;  3X2Q C;  5KYY B;  1RKE A;  2H8A A;  1RJ9 B;  3O55 A;  2YWA A;  3B0P A;  4BEM J;  2EIJ C;  3L34 A;  1ZHX A;  2IXP A;  2KGO A;  3G50 A;  4WJ0 A;  1E2X A;  1M6T A;  1NBB A;  1JMW A;  1S7Z A;  2R05 A;  4NTB A;  4PJL A;  3ZC4 A;  3ZVR A;  3RQG A;  5KYX B;  3LEO A;  3EH1 A;  4OIQ F;  4OIP F;  1RMV A;  3B29 A;  4O6N A;  3FAJ A;  1HE9 A;  2HZ8 A;  4CJG A;  5DS5 A;  1BDJ B;  1A41 A;  2C03 A;  1VLS A;  2J9U A;  2KQ9 A;  3LNM B;  3M4B A;  2P7V A;  4U9E A;  4G7O F;  2KC3 A;  2L81 A;  3RVY A;  3EQL F;  1LI7 A;  2YL7 A;  2J0W A;  2QLA A;  2W9Y A;  3IHU A;  4FX5 A;  4U9D A;  3N2Z B;  3V7O A;  4F4B A;  5A6B D;  2BC5 A;  3T4R A;  5JLI A;  1F1M A;  3T9O A;  3UNG C;  4XLN F;  2VCB A;  3FHD A;  4DJ9 A;  5T1D B;  2HKV A;  2VB6 A;  4BJT A;  2Q3T A;  3EHN A;  2Y3G A;  3I4U A;  3MYI A;  3T6G B;  4BEJ A;  4JE9 A;  5E33 A;  3H2V A;  2LP4 A;  1OKK A;  1M2V A;  3DE9 A;  3L8J A;  5A6B A;  2HS5 A;  3K1I A;  2J8W A;  3HNK A;  3KPH A;  4Q4Z F;  4EWC A;  4Q5S F;  4MVR A;  2XRH A;  1YVI A;  1PD0 A;  3NRH A;  2A6E F;  2HMZ A;  3JTL O;  3LS1 A;  3S90 A;  4MW8 A;  5JRA A;  2XLW A;  3A11 A;  4J7T A;  4YK5 A;  1YYX A;  4GQH A;  2XXA B;  4RDA A;  3NYL A;  4GYT A;  1ZZP A;  2OJE D;  3DAG A;  4CX9 A;  1A7V A;  2V26 A;  3S29 A;  4X0R A;  3GM1 A;  2HFI A;  2EIN C;  2A6H F;  2I15 A;  3WG7 C;  1Z6A A;  4CBE A;  4IAQ A;  5BUO A;  2HMQ A;  3K1H A;  4YJW A;  4AK9 A;  1VYI A;  2YVK A;  3AG4 C;  3C8G B;  3E9V A;  3ZIB A;  3T6J A;  4C3E A;  2LIG A;  2IXM A;  2XLD A;  4YT5 A;  4K1O A;  5EK0 A;  2OEV A;  2NUP A;  4FAP B;  2YL3 A;  3W8I A;  2MYS A;  1H7I A;  1FR0 A;  1ZHY A;  3W2V A;  1J8Y F;  5COG A;  3GM3 A;  3RVZ A;  3U9J A;  3FMS A;  5BQH A;  4IB4 A;  1ZYR F;  4LLC A;  5FCL A;  4C7O B;  3U2L A;  1FNT c;  3QMK A;  3DJU B;  3BEH A;  4PK4 A;  5D92 A;  2G3K A;  5COF A;  2HV6 A;  4YL3 A;  4Z9J A;  1ST6 A;  3AG2 C;  3V5Z A;  3JYH A;  4AL0 A;  3LEV A;  3TD7 A;  4PAC A;  2OQM A;  1OXK A;  2IOQ A;  3Q7G A;  1LS4 A;  1JPJ A;  4N6C A;  1ZHZ A;  2LK4 A;  1YZA A;  3GM2 A;  3U0C A;  4NCQ A;  4JIO A;  4YN0 B;  5COM A;  5E3A A;  3JCU Q;  3B71 A;  1VK5 A;  1K05 A;  4FWV A;  4NY3 A;  3DI5 A;  4MTG A;  1AUE A;  1A7E A;  4CS9 C;  3OWT A;  4EKW A;  3RQE A;  2R7W A;  2R7V A;  1IW7 F;  5BQI A;  3EFO B;  5CI9 A;  1Z23 A;  2GDC A;  3K6B A;  3VAY A;  3SNH A;  256B A;  1H9T A;  2AP3 A;  1TWC A;  1U6H A;  4KNV A;  3US6 A;  2OOC A;  1OW8 A;  3HNI A;  1XWJ A;  3V5X A;  3EGD B;  4PJN A;  3G4Z A;  1Z7Q c;  2BL2 A;  2A1D D;  3K1I C;  4K0D A;  5JP7 A;  4DRI B;  4H54 A;  4U5B E;  5KYW B;  2QY9 A;  2OU6 A;  4BJ5 A;  3ZG1 A;  1MMG A;  1G5Z A;  3M15 A;  2NUT A;  1HW1 A;  2IXN A;  1GGQ A;  5JSL A;  3WOD F;  4RBN A;  2HUJ A;  1YYJ A;  3B0V C;  4CS7 A;  2R7U A;  4O79 A;  2IYL D;  1V54 C;  2DI3 A;  2XS8 A;  3BRJ A;  1VB5 A;  1WGW A;  4AE4 A;  2R7X A;  4P9T A;  2W4M A;  1IZM A;  3SP1 A;  1BR4 A;  3KL4 A;  2VCA A;  3JYY A;  4Q7C A;  3U5S A;  1MMA A;  1YAR O;  1YA9 A;  2KSF A;  3EG9 A;  4HFK B;  2GFH A;  1YLM A;  1Q0G A;  3FXH A;  4U5C E;  3FOP A;  5HSW A;  2AU5 A;  4IGG A;  3NKD A;  3MBG A;  4JZA A;  2O9X A;  3LUT B;  4J30 B;  4JCZ A;  4XLP F;  3U8V A;  4CSA A;  3M4C A;  1Q0M A;  1LS1 A;  2LQG A;  3Q6N A;  4O6Y A;  2AWY A;  4U5E E;  3SXZ A;  3TOM A;  4CDY A;  2B0J A;  3EZH A;  1OQC A;  1OR2 A;  2PBE A;  2LFD A;  4LAC B;  3MX3 A;  2JX0 A;  4AL1 A;  2VCC A;  4C3B A;  4EIY A;  2Z15 A;  5KYU B;  1VTM P;  4YWQ A;  2LFF A;  1C17 M;  4DRH B;  2RD9 A;  3GWL A;  2XLH A;  1XZQ A;  4A4A A;  3OEO A;  4R32 A;  1H6G A;  3SXM A;  3CAX A;  1BR2 A;  1TWG A;  3FAP B;  2GAQ A;  5DQT A;  3EGX A;  1RKC A;  1CGO A;  5KYY A;  3AG3 C;  1G4U S;  1ZW3 A;  1RJ9 A;  1HY5 A;  3F46 A;  1CGN A;  5DS4 A;  1M57 C;  3EH2 A;  3CQZ A;  2R7O A;  5L0H A;  3POV A;  5E3C A;  4JRZ A;  2D4U A;  3FDQ A;  4MVS A;  5KYX A;  4JTC B;  2FFH A;  1VMA A;  2NSG A;  1MMN A;  3RW0 A;  1ZW2 A;  1RCP A;  3AQB A;  4U5D E;  3U2M A;  3LLK A;  4LER A;  3GEH A;  4OIN F;  3RFY A;  3AGU A;  3K7D A;  1OKK D;  4CS9 A;  3Q6M A;  1D1A A;  4YT8 A;  2CCY A;  4ZLC A;  5A6A A;  4OIO F;  2UUI A;  3S28 A;  4BG0 A;  1LE4 A;  4JEA A;  3VRC A;  1U0B B;  3CSK A;  2WVO A;  3DD7 A;  1C03 A;  2MWQ A;  3QVZ A;  2HJ3 A;  2J7P A;  2YLD A;  2Q7R A;  3L8I A;  3U3B A;  4E17 A;  3RYL A;  2XSE A;  3HKK A;  1Q0K A;  3AGT A;  4BJ5 C;  2EPK X;  1QSP A;  3L0I A;  2IM8 A;  3IEE A;  3LS0 A;  4MTF A;  5AC4 A;  3GAN A;  4XWJ A;  1HMD A;  3RH3 A;  2F22 A;  2JD3 A;  1T6I A;  2XLV A;  2Y3H A;  2QUP A;  2GA0 A;  1PD1 A;  4MQ9 F;  4YL1 A;  4KBL A;  1JRA A;  2LSE A;  3IQT A;  4PFP A;  1NG1 A;  4U5H A;  4JVS A;  4EBJ A;  1ORJ A;  1TFK B;  3AG1 C;  3ZSU A;  1LM3 B;  1MNE A;  3W8H A;  1NFO A;  4NTA A;  2KJG A;  3AJM A;  2DYR C;  3C8G D;  2CNW A;  4CIP A;  2EPM X;  2XXA A;  4NTF A;  5CI8 A;  5B3S C;  3ZQV A;  4NC3 A;  4DVY P;  4H4K C;  1OCO C;  3MLG A;  4CSA C;  2R7S A;  1K04 A;  1RXQ A;  1WN0 A;  3DXJ F;  2YHS A;  2VH3 A;  4OD5 A;  3DWW A;  1PV3 A;  1JOG A;  3IQC A;  4P6I C;  3NYJ A;  3S84 A;  1V55 C;  3GWN A;  4JJG A;  3UGO A;  3SYN A;  3C8G A;  4IAR A;  4N6H A;  4MTO A;  4C3D A;  1EKY A;  3ZQY A;  5JVE A;  3TQO A;  2FGY A;  3G4X A;  1TWA A;  1T6U A;  2QTV A;  2D5R B;  2XL6 A;  1MND A;  4YL0 A;  3NYM A;  2PX0 A;  1D0Z A;  1JR8 A;  1SF8 A;  5AC5 A;  4QI2 A;  4JKV A;  4C7O A;  2WZG A;  2FAP B;  1ZHW A;  4MVQ A;  2A69 F;  1M56 C;  3NDB B;  4JC7 A;  3O10 A;  1AEP A;  4I1M A;  3NG1 A;  2XL8 A;  2HSB A;  2XLO A;  3K66 A;  4IWB A;  1SZI A;  1YZC A;  2Q9B A;  4MVO A;  1GM5 A;  2GWW A;  1QVX A;  1KU2 A;  3DJN B;  1QKR A;  2A0B A;  5JS5 A;  3C62 A;  1A7D A;  1UFB A;  2KW3 C;  1HW2 A;  1ZHT A;  4A2N B;  3U3F A;  1LI5 A;  1WTY A;  1HMO A;  1FTS A;  1T9K A;  3HLZ A;  3UMH A;  2ETS A;  3KMI A;  4O7G A;  4FES A;  3V5Y A;  3ZWI A;  3MFN A;  4D4X A;  1ZU5 A;  3CEX A;  3EFO A;  5DQZ A;  4E0I A;  1J8M F;  4KI2 A;  3S9O A;  4DOZ A;  4XPY A;  2VC9 A;  3TUL A;  2XM4 A;  4ER9 A;  4IJJ A;  3JT1 A;  4Z9H A;  1SR2 A;  2A68 F;  2CDQ A;  3DAF A;  5DS6 A;  5L3V A;  1SMY F;  3EGD A;  2EPL X;  4I3M A;  3IQ6 A;  4MW3 A;  3JRM O;  4CIH A;  4WGY A;  1D1B A;  4U5F E;  3X1O A;  1O5H A;  2XLM A;  3QTH A;  5L0C A;  4LDK A;  1E86 A;  5HV9 A;  1B68 A;  2PFD A;  5KYW A;  5A69 A;  3GOD A;  1OCZ C;  2YZS A;  1D1C A;  4ULW A;  5GPG B;  4DBR A;  1E84 A;  1V4A A;  2Y3D A;  5TJ5 E;  4MND A;  1CPR A;  3SXY A;  1R4T A;  4DRJ B;  2EPO A;  3NKE A;  3DKA A;  3NMK A;  3VM6 A;  4PJM A;  3PDM P;  1TKN A;  4LDR A;  1YAU O;  4XTK A;  3ATP A;  1R5I D;  3JSE O;  5DVW A;  5T3T A;  5B1B C;  1ORY A;  3LJB A;  4WAB A;  4E7S A;  2I8B A;  4QI0 A;  2IXO A;  1O87 A;  3C18 A;  2R02 A;  2X51 A;  4JEB A;  1EA8 A;  2NPU A;  2OCC C;  2XM0 A;  3M1C B;  4I44 A;  4PR9 A;  2Y39 A;  2YRF A;  4CJO A;  2AVK A;  3O6X A;  1WOL A;  3C7J A;  3HNL A;  2WB7 A;  4W8P A;  4PFO A;  5B3I A;  1TFO B;  3PHF 2;  5KYU A;  2MHR A;  3ABL C;  3Q7L A;  4YT2 A;  4JW1 A;  3IQ5 A;  5B1A C;  3DE8 A;  4JCH A;  4AX2 A;  4ANJ A;  1O3U A;  2G3V A;  4J7Y A;  5BQG A;  5E2Q A;  3QZC A;  2Q4F A;  3S0X A;  2ICW G;  1FAP B;  2R9R B;  3FVY A;  3A9C A;  3VF0 A;  4CDA A;  2RSE B;  2NSF A;  3AOU A;  3TOL A;  4BPM A;  2J7P D;  3GOR A;  1NSG B;  2X0C A;  1SYQ A;  2B0H A;  1BZ4 A;  1YDI A;  2LD6 A;  1RKE B;  3F47 A;  2PP4 A;  2VAS A;  2ZXP A;  1T5O A;  1K40 A;  2QE9 A;  3ASN C;  2JPU A;  4D4N A;  5L0D A;  2OKU A;  5L0I A;  4BJ6 A;  2Q00 A;  5AGF A;  1L7C A;  1ZU4 A;  1M2O A;  1FFH A;  1AVO B;  1Z3I X;  2EIK C;  1OR3 A;  3N0T A;  4JJF A;  4U5G A;  3LNR A;  1C02 A;  2QNL A;  1NZE A;  2P61 A;  5JUA A;  2E87 A;  1HE1 A;  4MVZ A;  3WHN A;  3W4Y A;  3LLI A;  2HV7 A;  4L6R A;  5DLJ A;  2R7R A;  3ZTZ A;  1XZP A;  5JT4 A;  2KNH A;  4IRU A;  3I5P A;  4N4W A;  1QQ3 A;  1VOM A;  3KYJ A;  4E0H A;  1N1C A;  3KKB A;  4G0H A;  1YA7 O;  2DGJ A;  4QDL A;  3OA1 A;  2CNW D;  2WZF A;  5D91 A;  5A6K A;  4JTA B;  2YKZ A;  4Z9I A;  3FOO A;  4G78 A;  2J0X A;  1FFT C;  4OD4 A;  5L0G A;  3GEE A;  3DM5 A;  3HTK C;  5CIV A;  2R7Q A;  1OCC C;  2L6G A;  1MMD A;  2XL4 A;  3NMJ A;  2L6H A;  2IBF A;  1OCR C;  1G4W R;  5EHH A;  1NLX A;  1OW7 A;  1M2V B;  2OG2 A;  3E70 C;  3U8P A;  3UR3 C;  2J9B A;  3TK0 A;  1YJG A;  3NMI A;  3R2P A;  1DOV A;  1NU7 D;  3H2U A;  1QZX A;  3EHM A;  3PMR A;  1OXB A;  2V3C C;  1G8X A;  4K7B A;  1LE2 A;  3WAQ A;  1QLE C;  4M63 A;  3M79 A;  3RKO F;  2J45 A;  2M64 A;  3H65 A;  5A6J A;  1A0B A;  1S05 A;  3JSZ A;  2AWC A;  2BE5 F;  2W4B A;  2R03 A;  2DYS C;  2ZPA A;  4E18 A;  2Y3B A;  3MYF A;  4XPX A;  4P9F A;  3QW1 A;  4XQ1 A;  2XLE A;  2ZXO A;  3EPV A;  1TR2 A;  2HSQ A;  2J46 A;  1U89 A;  3LES A;  4HFF B;  1LKX A;  1WAT A;  4ULV A;  4NQF A;  4EBK A;  4XEF A;  3I5Q A;  1JAF A;  2H7V C;  4G7H F;  3HNJ A;  1V74 B;  3GEI A;  2CYD A;  2OJQ A;  1QPU A;  2R25 A;  4XEV A;  2KYH A;  4O6M A;  2YQY A;  2YEV A;  2Q9A A;  3C8Z A;  3RIP A;  2NUP B;  4RD9 A;  4KNW A;  1T01 A;  1MQV A;  5L3Q A;  1GS9 A;  2KK1 A;  4MS2 A;  1CGM E;  1I5N A;  1LPE A;  3TJ6 A;  2CW0 F;  4HEA J;  1I4Y A;  4BJ6 C;  1WAS A;  2Q9C A;  3PCV A;  2A0U A;  3SEO A;  1PCX A;  2ZXR A;  3SZR A;  1EI7 A;  4PJJ A;  4CS8 A;  2Y69 C;  1TWH A;  3ZTM A;  4KC9 A;  3RF3 A;  1WWP A;  2WZL A;  3IPM O;  4JUR I;  5T3W A;  1D0Y A;  3C63 A;  3ZDL A;  1Q0D A;  4N06 A;  4E7Z A;  3DMD A;  3HJC A;  4BJ1 A;  4IAO A;  1LIH A;  1FMV A;  3VYW A;  1NFN A;  1CPQ A;  4J32 B;  5F5F A;  2WVN A;  1JPN A;  3R7C A;  1Y4C A;  1UG7 A;  4WGZ A;  1E83 A;  2EIM C;  3EJN A;  1VYK A;  3AQC A;  3JZ0 A;  4B6I A;  1TQG A;  3RQF A;  2W45 A;  2ASR A;  5F28 E;  4EHP A;  4MVM A;  2YL1 A;  5IY5 C;  5L0F A;  1KTM A;  3T6B A;  2L7A A;  3EZI A;  1LVK A;  2EPN A;  1D0X A;  2OEX A;  4ONS A;  3TJ5 A;  2C04 A;  2CGE A;  1H9G A;  2XS1 A;  5F5H A;  2LCH A;  4LLE A;  4HE8 D;  3J06 A;  3DM9 B;  5EGY A;  1ZVZ A;  2J9V A;  3B9Q A;  4MVU A;  4DBQ A;  2J9W A;  3LAY A;  5KYN A;  3KH2 A;  3L1M A;  3SXK A;  2NUT B;  1VLT A;  3ABM C;  1E85 A;  2G62 A;  2DB4 A;  3KYI A;  4G7Z F;  4W8K A;  1DOW A;  2ZXW C;  2PF4 E;  2L9J A;  3JRT A;  2TMV P;  4ZLD A;  4AE4 B;  4CDV A;  4XPW A;  2P1A A;  2R7T A;  1ORS C;  2PX3 A;  1I4Z A;  4EBB A;  2EIL C;  2WVQ A;  4OIR F;  2H7B A;  4UDV A;  3W2W A;  1Q0F A;  3EG9 B;  1BBH A;  4DVZ A;  3UMK A;  4EUK B; 
#chains in the Genus database with same CATH homology
 5BQI A;  3LEO A;  3B29 A;  4J7Y A;  5BQG A;  2UUH A;  5BQH A;  2PNO A;  4JRZ A;  4BPM A;  4J7T A;  4YK5 A;  4YL0 A;  5K0I A;  4JCZ A;  4YL3 A;  4YL1 A;  4WAB A;  4AL0 A;  4AL1 A;  4NTA A;  2UUI A;  4NTF A;  4JC7 A;  2H8A A;  2Q7R A;  5HV9 A;  3DWW A;  3HKK A;  4NTB A;  3PCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...