4AL0A

Crystal structure of human ps-1
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
146
structure length
146
Chain Sequence
VMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Microsomal Prostaglandin E2 Synthase Provides Insight Into Diversity in the Mapeg Superfamily.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PROSTAGLANDIN E SYNTHASE
total genus 65
structure length 146
sequence length 146
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4al0A00
2UUIA 4YL1A 4NTBA 4YL0A 3B29A 4J7YA 3HKKA 4NTAA 5BQGA 4AL0A 3PCVA 2H8AA 4J7TA 5HV9A 4YL3A 2Q7RA 4JCZA 4YK5A 4AL1A 3DWWA 2PNOA 3LEOA 4JC7A 4WABA 4BPMA 4JRZA 4NTFA 2UUHA 5BQIA 5BQHA 5K0IA
chains in the Genus database with same CATH superfamily
3H65A 3KMIA 1HE1A 2OG2A 1BZ4A 2NUTB 2KK1A 3EHMA 4C3BA 3L0IA 4J7YA 3ZDLA 1K04A 2ZXOA 3I5PA 3SNHA 1MMGA 3PCVA 1Y4CA 2H8AA 4XEVA 2Y3GA 3K6BA 3ZIBA 2R9RB 3WG7C 4XPWA 4Z9IA 4NQFA 4P6IC 4G7HF 4YT8A 3K7DA 3CEXA 1U0BB 3RIPA 3K1IA 4IAOA 3HNJA 2HKVA 1XZQA 2LFFA 4PJNA 1Z63A 2ZXRA 4PR9A 3N0TA 2AWCA 2HSQA 3C8GA 3U5SA 5E33A 4BJ5A 4DRIB 1FR0A 2A0UA 3V7OA 2Q00A 4E17A 2EPLX 5D91A 1EQ1A 4AX2A 2LP4A 4QDLA 1H9GA 5JLIA 2OEVA 3U3BA 3JCUQ 5COMA 4BEJA 2NSGA 3RVZA 4YN0B 3K33A 3O55A 4HFKB 2YKZA 1JRAA 3RQGA 3S9OA 1ORSC 2AP3A 1J8MF 2YVKA 3OA1A 4M63A 2R02A 4P9FA 5B1AC 1YJGA 3AG2C 3UNGC 4MTFA 3CAXA 2YLDA 3FDQA 2IXMA 4U5FE 3ABLC 1SR2A 3PHF2 2HS5A 2A6HF 3A11A 3SZRA 3WHNA 4N06A 1G8XA 1S05A 4YWQA 2XL6A 4E18A 5L0JA 4C3DA 4CIPA 1ORYA 3O39A 3T4RA 5BUOA 1S7ZA 1LI5A 3M1CB 2GWWA 3DM9B 4CS9C 3OEOA 4O6NA 4OD5A 3EGXA 5BQHA 2P61A 2PP4A 1UFBA 5K0IA 3ASOC 3I5QA 3ZQYA 4IAQA 3HLZA 1C03A 1H7IA 2YRFA 3LNMB 2WL8A 3DM5A 2KSFA 3JYYA 3WAQA 4C3EA 3SXYA 1A0BA 4BJ5C 2VCBA 4C7OA 4G7ZF 3T6BA 3W2WA 4YT4A 3V5YA 4D4NA 1FFHA 3V5ZA 2J9WA 4JJFA 1CPRA 3MFNA 2WZFA 2M4EA 1J8YF 2OKUA 2H7VC 3IQ6A 5B1BC 4GEHA 4KBLA 4E0HA 1DOWA 2XLOA 4ULVA 4I1OB 3RQFA 2CNWA 2LFDA 3EQLF 4N4WA 3NMIA 3TJ6A 4MS2A 4BPMA 5KYXB 1AVOB 5A69A 1V4AA 1ZZPA 3JRMO 2JX0A 4K7BA 2R7OA 5T3WA 1PD0A 2IYLD 2FAPB 2J7PA 3PMRA 1JOGA 1PV3A 3NG1A 2HMQA 2I15A 4ER9A 3IQTA 3AQBA 3B0PA 1V55C 1VLTA 2DGJA 3FHDA 3GWLA 3DAFA 4CDVA 1G4US 3EGXB 1IZMA 1D0YA 3ASNC 3F46A 2KC3A 3GM3A 4DRHB 4DRJB 4MTGA 2BL2A 2P1AA 2XLMA 4XWJA 4CJGA 4EUKB 2GFHA 2LD6A 2LSEA 5A6BA 2R03A 3EJNA 5JVEA 3DKAA 2P6VA 4W8KA 1FAPB 3ATPA 2PNOA 3W8IA 1MMDA 4XPYA 2EIJC 2KQ9A 1HMDA 1W2WA 2KYHA 2QNLA 3AG1C 4MQ9F 1U89A 4MVOA 3CZ6A 4ZLCA 3GEEA 3JSEO 2CGEA 2Q4FA 3B9QA 4NCQA 2J8WA 2AVKA 4DBQA 5CI9A 5E3CA 1YDIA 3QVZA 1LE2A 3AOUA 2L9JA 2IXOA 5KYUB 1IW7F 1HE9A 3EG9A 2EINC 4IARA 1RCPA 3EGDA 2LK4A 1EI7A 3MYIA 1E83A 2HUJA 4OD4A 5EK0A 1E84A 4JCZA 4DJ9A 2RSEB 1R4TA 4ULWA 1GM5A 3IQ5A 3KPHA 3N24A 1RMVA 1G4WR 3LESA 4OIQF 3LEOA 3GM2A 4UDVA 2IXNA 2YLGA 4O79A 4BJ6A 3TJ5A 2FGYA 4E0IA 1NZEA 5AC4A 4JTAB 3U8VA 2J9BA 3E70C 2YL0A 1NLXA 4U5GA 3VM6A 2VH3A 5EHHA 2E87A 1NFOA 2X0CA 1A41A 2W4MA 4DVZA 3JSZA 3NYMA 3DAGA 4CJOA 4CS9A 1Z23A 5DQTA 3C8GD 1QKRA 1YA7O 2KNHA 4RD9A 1C17M 3S29A 1WASA 3B0UX 1CGOA 5CIVA 1ZHXA 1FMVA 4Q7CA 4CS8C 5L0FA 1DOVA 4IJJA 4JVSA 1SYQA 2EPKX 4K0DA 2D4UA 3GORA 1M6TA 1V54C 1TWCA 2ZXPA 4CIHA 3W4YA 1WTYA 3JZ0A 1ST6A 3U8PA 1ZYRF 2Y69C 1T6QA 2ETSA 1C02A 1CGNA 2B0HA 4PFPA 3WODF 3LS0A 3U3FA 1ORJA 2R7SA 1LE4A 1N1CA 5FCLA 1B68A 1OKKA 3NMKA 3X2QC 3S84A 1NU7D 3HNKA 3HTKC 3LNRA 2J9VA 1O87A 4JZAA 1OW8A 2R7XA 2J7PD 1JMWA 3FMSA 4CSAC 1LS4A 3UMHA 1A7EA 4KNWA 2H7OA 2GDCA 4LDKA 2MWQA 2EPNA 4IGGA 1D1AA 2YL1A 1K05A 3R7CA 1YZCA 4JTDB 2A0BA 2DB4A 2EIMC 3B71A 3M4BA 4U9EA 4MVMA 3MYFA 2EILC 2Q7RA 3U9JA 2LQGA 2CDQA 3BRJA 3KYIA 4IRUA 5KYXA 4EBBA 1RKEB 2VCCA 2CCYA 1ZHTA 1BBHA 4JKVA 4EBJA 4RBNA 5DS5A 1NFNA 3G4XA 1AUEA 1L7CA 3AG3C 5D92A 5HSWA 3HNIA 1O3UA 1OXKA 1T01A 2EPMX 3ZTZA 4XLNF 2IBFA 4HE8D 2O9XA 4XEKA 3UGOA 3C18A 5JS5A 4CX9A 2XL4A 1KU2A 4MW8A 2H7BA 3TK0A 4MVZA 3M4CA 3T9OA 3MX3A 3LEVA 4JTCB 1NU9C 2L7AA 4YL0A 3U9MA 1VYIA 3US6A 1GQAA 1H6GA 3JT1A 2R25A 4KC9A 4BJ6C 4BJ1A 4DBRA 2Y3HA 2HV6A 2OCCC 2VASA 4J7TA 3S0XA 4LLEA 1FFTC 3AG4C 4YL3A 4EHPA 5HV9A 2D5RB 1VTMP 2CW0F 4JE9A 4AL1A 3DE8A 1YARO 3GEHA 1H9TA 3VAYA 3Q7GA 4CDAA 1YVIA 4MNDA 1ZHZA 3K1HA 1Q0KA 2PX3A 2XM0A 3TQOA 4JEBA 4LERA 4JC7A 4U9DA 4Q4ZF 3HNLA 1VOMA 1OQCA 3IEEA 2J0WA 1EA8A 4OIRF 3SXKA 1NBBA 3DZAA 3BEHA 2IXPA 1SMYF 1I4YA 2W45A 3KL4A 2J46A 4HFFB 1MQVA 4I3MA 4NY3A 3ZSUA 1QSPA 3PDMP 3U2MA 2EPOA 3Q6MA 2CNWD 4I1MA 3L34A 2YEVA 3RFYA 1SZIA 4N6CA 1A7VA 2ASRA 3R2PA 4XQ1A 3X1OA 5COFA 2OQMA 2J9UA 3CQZA 4L6RA 3IHUA 3ZTMA 4PJLA 3G50A 1YYXA 5L0DA 1FTSA 3LLIA 4P9TA 1TWGA 2C03A 3MBGA 2I8BA 4ONSA 1VYKA 2A1DD 2Y3BA 3FOPA 4WGZA 5E2QA 4Q5SF 1QZXA 1VB5A 3H2VA 2G3KA 2L6HA 2M64A 4K1OA 4D4XA 3UGPA 2OJED 3QVYA 2QE9A 3NKDA 5KYWB 5IY5C 3EH1A 4WABA 1JPNA 2GAQA 3E9VA 4FX5A 1L3PA 1RKEA 4JW1A 3S28A 4PACA 5DS6A 1WOLA 2Z15A 5EGYA 5T3TA 1OW6A 4BEMJ 4DVYP 4EIYA 4PJJA 1OCRC 2HFIA 1VLSA 1T5OA 256BA 2R7QA 4IB4A 4YL1A 3FOOA 1OCOC 2NSFA 4R32A 3KYJA 2OU6A 3HJCA 3RVYA 4H54A 5T1DB 5KYNA 3U0CA 1NSGB 1RJ9A 2P0NA 4AE4A 5KYYB 2R05A 3LLKA 4EKWA 2YWAA 3TOMA 3H2UA 4AK9A 4BG0A 3DD7A 2XS8A 1T6UA 4O7GA 4MVUA 5DVWA 4A4AA 2EIKC 3L1MA 4Z9HA 1HY5A 2L6GA 1EKYA 4H4KC 1I4ZA 3M15A 4X0RA 5DS4A 3KH2A 4YT2A 5COGA 2UUHA 5BQIA 2PFDA 2YHSA 3LS1A 2HZ8A 2VB6A 1Q0MA 3ITFA 2V26A 3K1IC 3ZG1A 3ECSA 3NYJA 3CSKA 2CYDA 2XL8A 2XRHA 4LLCA 1QLEC 4Z9JA 1TFKB 4XTKA 1D0ZA 1LVKA 1TKNA 2XLHA 4NTAA 2A68F 1T6IA 2Q9AA 2YQYA 2W9YA 3JRTA 1HW1A 3ABKC 5DLJA 5A6BD 2J0XA 1YYJA 2NPUA 1ZU5A 1VMAA 1TFOB 2L6FA 2B0JA 2P7VA 4G0HA 4LACB 3GWNA 1SF8A 3POVA 4W8PA 4YJWA 4F4BA 2L81A 2WVOA 3EG9B 4LDQA 4PJMA 2PF4E 2XXAB 2GA0A 2MHRA 4B6IA 5L3VA 3RYLA 4KI2A 1RJ9B 3I4UA 4NC3A 4O6YA 2LIGA 2NUPA 4G7OF 4N6HA 3ZWIA 3LUTB 2ZPAA 1U6HA 4PFOA 4XLPF 1V74B 1JAFA 2AU5A 3AGUA 4QI0A 2Q9BA 3T6JA 3ZQVA 3S90A 3N2ZB 1OW7A 2W4BA 3M79A 1OXBA 3QW1A 1OKKD 4MTOA 2Y3DA 3NDBB 1QVXA 3EFOB 3SXZA 1RKCA 2AWYA 3AGTA 3T6GB 1MMAA 5L3QA 3B0VC 5AC5A 1KTMA 3HKKA 4G78A 4E7SA 5GPGB 1YLMA 1Z6AA 1R5ID 2X51A 3F47A 2XM4A 3TULA 5F5FA 1T9KA 4J30B 2NUTA 4YK5A 1TQGA 2NG1A 3EZIA 3DJUB 3SP1A 5L0CA 2VC9A 1D1CA 3DWWA 4U5DE 1GGQA 1CPQA 2PBEA 3DJNB 1D1BA 2A69F 3KKBA 3FXHA 4EWCA 2HMZA 2RD9A 5FZTA 1TWAA 3C62A 3LJBA 2JD3A 3NYLA 5JP7A 3VRCA 4XPXA 5B3SC 2DYSC 2XXAA 3V5XA 3RF3A 2WB7A 5JRAA 1UG7A 1QQ3A 3ABMC 3EHNA 4JJGA 3AQCA 1JR8A 2ICWG 3FVYA 5L0GA 2TMVP 2R7TA 2Q3TA 3W2VA 2HJ3A 1Y6DA 3EH2A 1FNTc 1NG1A 3GEIA 1GS9A 1Q0DA 1WWPA 5JT4A 4KNVA 3GODA 2YZSA 1LI7A 4U5BE 3SXMA 3QW0A 1MMNA 1O5HA 3S27A 4CS7A 3NKEA 4CSAA 4YT5A 2YL7A 3Q7LA 3JTLO 4CDYA 4EBKA 1ZW2A 2XLEA 2ZD9A 5F5HA 1E86A 4RDAA 1AEPA 1M2OA 1PD1A 3DMDA 4GYTA 4MW3A 1ZHWA 1M57C 2WVQA 4U5CE 4WGYA 3EGDB 2WVNA 3MLGA 1BDJB 4LDRA 4WJ0A 5L0IA 3C8GB 2HV7A 1LM3B 1F1MA 3DI5A 4NTBA 5JSLA 5KYYA 1ZHYA 3ZC4A 3JYHA 3RW0A 2ZXWC 2FFHA 2C04A 4FESA 2YL3A 4OIPF 2R7UA 1K40A 1TWHA 3DXJF 1CGME 3LAYA 1E85A 1FMWA 4BJTA 3C7JA 1Z7Qc 3QMKA 2R7WA 1I5NA 1TR2A 1XZPA 2MYSA 1KNYA 4U5EE 1ZU4A 4A2NB 4E7ZA 1BR4A 3G4ZA 3J06A 1VK5A 2BE5F 5B3IA 1M56C 2YLIA 2WZGA 4ZLDA 3C63A 4NTFA 3L8IA 3FAJA 1Q0FA 2HJMA 2JPUA 4C7OB 5KYWA 1G5ZA 1BR1A 2J45A 3GM1A 4OIOF 2UUIA 4DOZA 4IWBA 2XLVA 4MVSA 2IOQA 4AE4B 4CS8A 3VF0A 3L8JA 3B29A 1M2VA 1OCZC 1Z3IX 2KW3C 3QTHA 2R7RA 4AL0A 4PK4A 1JPJA 1QPUA 2QTVA 3NRHA 3TD7A 4HEAJ 1OR2A 1Q0GA 5AGFA 4J32B 4XEFA 4MVQA 3SEOA 3RKOF 2QLAA 2G62A 4JIOA 4JURI 1XWJA 5KYUA 5A6KA 3O10A 1YAUO 4JCHA 4OINF 5CI8A 3Q6NA 2Q9CA 4JEAA 5DQZA 2VCAA 2IM8A 2Y39A 5F28E 1ZW3A 1WGWA 3RQEA 2KJGA 1YZAA 2BC5A 2F22A 1YA9A 2HSBA 3EFOA 5E3AA 5TJ5E 2XLDA 3TOLA 1LIHA 5L0HA 4MVRA 3C8ZA 3DE9A 4ANJA 1OR3A 2QY9A 4U5HA 3EPVA 2OEXA 1WN0A 4FAPB 1ZVZA 3IQCA 5A6AA 2NUPB 3UMKA 3OWTA 3A9CA 1PCXA 3UR3C 4CBEA 1BR2A 1D0XA 1HMOA 1LKXA 2WZLA 2XLWA 5BQGA 2OJQA 3ZVRA 3GANA 4DXWA 1MNEA 3NMJA 4GQHA 3IPMO 3EZHA 2KGOA 1E2XA 2DI3A 1OCCC 3U2LA 3K66A 4I44A 4QI2A 3SYNA 1MNDA 1WATA 5JUAA 1M2VB 1RXQA 2A6EF 1HW2A 3QZCA 3VYWA 3UMIA 2PX0A 5A6JA 2OOCA 3W8HA 4FWVA 1Z5ZA 1A7DA 1LS1A 2LCHA 4O6MA 1APCA 4JRZA 2DYRC 2G3VA 2XS1A 2XSEA 3O6XA 1LPEA 3FAPB 3RH3A 2QUPA 3AJMA 2V3CC 2R7VA
chains in the Genus database with same CATH topology
2UUIA 4YL1A 4NTBA 4YL0A 3B29A 4J7YA 3HKKA 4NTAA 5BQGA 4AL0A 3PCVA 2H8AA 4J7TA 5HV9A 4YL3A 2Q7RA 4JCZA 4YK5A 4AL1A 3DWWA 2PNOA 3LEOA 4JC7A 4WABA 4BPMA 4JRZA 4NTFA 2UUHA 5BQIA 5BQHA 5K0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUI A;  4YL1 A;  4NTB A;  4YL0 A;  3B29 A;  4J7Y A;  3HKK A;  4NTA A;  5BQG A;  4AL0 A;  3PCV A;  2H8A A;  4J7T A;  5HV9 A;  4YL3 A;  2Q7R A;  4JCZ A;  4YK5 A;  4AL1 A;  3DWW A;  2PNO A;  3LEO A;  4JC7 A;  4WAB A;  4BPM A;  4JRZ A;  4NTF A;  2UUH A;  5BQI A;  5BQH A;  5K0I A; 
#chains in the Genus database with same CATH topology
 3H65 A;  3KMI A;  1HE1 A;  2OG2 A;  1BZ4 A;  2NUT B;  2KK1 A;  3EHM A;  4C3B A;  3L0I A;  4J7Y A;  3ZDL A;  1K04 A;  2ZXO A;  3I5P A;  3SNH A;  1MMG A;  3PCV A;  1Y4C A;  2H8A A;  4XEV A;  2Y3G A;  3K6B A;  3ZIB A;  2R9R B;  3WG7 C;  4XPW A;  4Z9I A;  4NQF A;  4P6I C;  4G7H F;  4YT8 A;  3K7D A;  3CEX A;  1U0B B;  3RIP A;  3K1I A;  4IAO A;  3HNJ A;  2HKV A;  1XZQ A;  2LFF A;  4PJN A;  1Z63 A;  2ZXR A;  4PR9 A;  3N0T A;  2AWC A;  2HSQ A;  3C8G A;  3U5S A;  5E33 A;  4BJ5 A;  4DRI B;  1FR0 A;  2A0U A;  3V7O A;  2Q00 A;  4E17 A;  2EPL X;  5D91 A;  1EQ1 A;  4AX2 A;  2LP4 A;  4QDL A;  1H9G A;  5JLI A;  2OEV A;  3U3B A;  3JCU Q;  5COM A;  4BEJ A;  2NSG A;  3RVZ A;  4YN0 B;  3K33 A;  3O55 A;  4HFK B;  2YKZ A;  1JRA A;  3RQG A;  3S9O A;  1ORS C;  2AP3 A;  1J8M F;  2YVK A;  3OA1 A;  4M63 A;  2R02 A;  4P9F A;  5B1A C;  1YJG A;  3AG2 C;  3UNG C;  4MTF A;  3CAX A;  2YLD A;  3FDQ A;  2IXM A;  4U5F E;  3ABL C;  1SR2 A;  3PHF 2;  2HS5 A;  2A6H F;  3A11 A;  3SZR A;  3WHN A;  4N06 A;  1G8X A;  1S05 A;  4YWQ A;  2XL6 A;  4E18 A;  5L0J A;  4C3D A;  4CIP A;  1ORY A;  3O39 A;  3T4R A;  5BUO A;  1S7Z A;  1LI5 A;  3M1C B;  2GWW A;  3DM9 B;  4CS9 C;  3OEO A;  4O6N A;  4OD5 A;  3EGX A;  5BQH A;  2P61 A;  2PP4 A;  1UFB A;  5K0I A;  3ASO C;  3I5Q A;  3ZQY A;  4IAQ A;  3HLZ A;  1C03 A;  1H7I A;  2YRF A;  3LNM B;  2WL8 A;  3DM5 A;  2KSF A;  3JYY A;  3WAQ A;  4C3E A;  3SXY A;  1A0B A;  4BJ5 C;  2VCB A;  4C7O A;  4G7Z F;  3T6B A;  3W2W A;  4YT4 A;  3V5Y A;  4D4N A;  1FFH A;  3V5Z A;  2J9W A;  4JJF A;  1CPR A;  3MFN A;  2WZF A;  2M4E A;  1J8Y F;  2OKU A;  2H7V C;  3IQ6 A;  5B1B C;  4GEH A;  4KBL A;  4E0H A;  1DOW A;  2XLO A;  4ULV A;  4I1O B;  3RQF A;  2CNW A;  2LFD A;  3EQL F;  4N4W A;  3NMI A;  3TJ6 A;  4MS2 A;  4BPM A;  5KYX B;  1AVO B;  5A69 A;  1V4A A;  1ZZP A;  3JRM O;  2JX0 A;  4K7B A;  2R7O A;  5T3W A;  1PD0 A;  2IYL D;  2FAP B;  2J7P A;  3PMR A;  1JOG A;  1PV3 A;  3NG1 A;  2HMQ A;  2I15 A;  4ER9 A;  3IQT A;  3AQB A;  3B0P A;  1V55 C;  1VLT A;  2DGJ A;  3FHD A;  3GWL A;  3DAF A;  4CDV A;  1G4U S;  3EGX B;  1IZM A;  1D0Y A;  3ASN C;  3F46 A;  2KC3 A;  3GM3 A;  4DRH B;  4DRJ B;  4MTG A;  2BL2 A;  2P1A A;  2XLM A;  4XWJ A;  4CJG A;  4EUK B;  2GFH A;  2LD6 A;  2LSE A;  5A6B A;  2R03 A;  3EJN A;  5JVE A;  3DKA A;  2P6V A;  4W8K A;  1FAP B;  3ATP A;  2PNO A;  3W8I A;  1MMD A;  4XPY A;  2EIJ C;  2KQ9 A;  1HMD A;  1W2W A;  2KYH A;  2QNL A;  3AG1 C;  4MQ9 F;  1U89 A;  4MVO A;  3CZ6 A;  4ZLC A;  3GEE A;  3JSE O;  2CGE A;  2Q4F A;  3B9Q A;  4NCQ A;  2J8W A;  2AVK A;  4DBQ A;  5CI9 A;  5E3C A;  1YDI A;  3QVZ A;  1LE2 A;  3AOU A;  2L9J A;  2IXO A;  5KYU B;  1IW7 F;  1HE9 A;  3EG9 A;  2EIN C;  4IAR A;  1RCP A;  3EGD A;  2LK4 A;  1EI7 A;  3MYI A;  1E83 A;  2HUJ A;  4OD4 A;  5EK0 A;  1E84 A;  4JCZ A;  4DJ9 A;  2RSE B;  1R4T A;  4ULW A;  1GM5 A;  3IQ5 A;  3KPH A;  3N24 A;  1RMV A;  1G4W R;  3LES A;  4OIQ F;  3LEO A;  3GM2 A;  4UDV A;  2IXN A;  2YLG A;  4O79 A;  4BJ6 A;  3TJ5 A;  2FGY A;  4E0I A;  1NZE A;  5AC4 A;  4JTA B;  3U8V A;  2J9B A;  3E70 C;  2YL0 A;  1NLX A;  4U5G A;  3VM6 A;  2VH3 A;  5EHH A;  2E87 A;  1NFO A;  2X0C A;  1A41 A;  2W4M A;  4DVZ A;  3JSZ A;  3NYM A;  3DAG A;  4CJO A;  4CS9 A;  1Z23 A;  5DQT A;  3C8G D;  1QKR A;  1YA7 O;  2KNH A;  4RD9 A;  1C17 M;  3S29 A;  1WAS A;  3B0U X;  1CGO A;  5CIV A;  1ZHX A;  1FMV A;  4Q7C A;  4CS8 C;  5L0F A;  1DOV A;  4IJJ A;  4JVS A;  1SYQ A;  2EPK X;  4K0D A;  2D4U A;  3GOR A;  1M6T A;  1V54 C;  1TWC A;  2ZXP A;  4CIH A;  3W4Y A;  1WTY A;  3JZ0 A;  1ST6 A;  3U8P A;  1ZYR F;  2Y69 C;  1T6Q A;  2ETS A;  1C02 A;  1CGN A;  2B0H A;  4PFP A;  3WOD F;  3LS0 A;  3U3F A;  1ORJ A;  2R7S A;  1LE4 A;  1N1C A;  5FCL A;  1B68 A;  1OKK A;  3NMK A;  3X2Q C;  3S84 A;  1NU7 D;  3HNK A;  3HTK C;  3LNR A;  2J9V A;  1O87 A;  4JZA A;  1OW8 A;  2R7X A;  2J7P D;  1JMW A;  3FMS A;  4CSA C;  1LS4 A;  3UMH A;  1A7E A;  4KNW A;  2H7O A;  2GDC A;  4LDK A;  2MWQ A;  2EPN A;  4IGG A;  1D1A A;  2YL1 A;  1K05 A;  3R7C A;  1YZC A;  4JTD B;  2A0B A;  2DB4 A;  2EIM C;  3B71 A;  3M4B A;  4U9E A;  4MVM A;  3MYF A;  2EIL C;  2Q7R A;  3U9J A;  2LQG A;  2CDQ A;  3BRJ A;  3KYI A;  4IRU A;  5KYX A;  4EBB A;  1RKE B;  2VCC A;  2CCY A;  1ZHT A;  1BBH A;  4JKV A;  4EBJ A;  4RBN A;  5DS5 A;  1NFN A;  3G4X A;  1AUE A;  1L7C A;  3AG3 C;  5D92 A;  5HSW A;  3HNI A;  1O3U A;  1OXK A;  1T01 A;  2EPM X;  3ZTZ A;  4XLN F;  2IBF A;  4HE8 D;  2O9X A;  4XEK A;  3UGO A;  3C18 A;  5JS5 A;  4CX9 A;  2XL4 A;  1KU2 A;  4MW8 A;  2H7B A;  3TK0 A;  4MVZ A;  3M4C A;  3T9O A;  3MX3 A;  3LEV A;  4JTC B;  1NU9 C;  2L7A A;  4YL0 A;  3U9M A;  1VYI A;  3US6 A;  1GQA A;  1H6G A;  3JT1 A;  2R25 A;  4KC9 A;  4BJ6 C;  4BJ1 A;  4DBR A;  2Y3H A;  2HV6 A;  2OCC C;  2VAS A;  4J7T A;  3S0X A;  4LLE A;  1FFT C;  3AG4 C;  4YL3 A;  4EHP A;  5HV9 A;  2D5R B;  1VTM P;  2CW0 F;  4JE9 A;  4AL1 A;  3DE8 A;  1YAR O;  3GEH A;  1H9T A;  3VAY A;  3Q7G A;  4CDA A;  1YVI A;  4MND A;  1ZHZ A;  3K1H A;  1Q0K A;  2PX3 A;  2XM0 A;  3TQO A;  4JEB A;  4LER A;  4JC7 A;  4U9D A;  4Q4Z F;  3HNL A;  1VOM A;  1OQC A;  3IEE A;  2J0W A;  1EA8 A;  4OIR F;  3SXK A;  1NBB A;  3DZA A;  3BEH A;  2IXP A;  1SMY F;  1I4Y A;  2W45 A;  3KL4 A;  2J46 A;  4HFF B;  1MQV A;  4I3M A;  4NY3 A;  3ZSU A;  1QSP A;  3PDM P;  3U2M A;  2EPO A;  3Q6M A;  2CNW D;  4I1M A;  3L34 A;  2YEV A;  3RFY A;  1SZI A;  4N6C A;  1A7V A;  2ASR A;  3R2P A;  4XQ1 A;  3X1O A;  5COF A;  2OQM A;  2J9U A;  3CQZ A;  4L6R A;  3IHU A;  3ZTM A;  4PJL A;  3G50 A;  1YYX A;  5L0D A;  1FTS A;  3LLI A;  4P9T A;  1TWG A;  2C03 A;  3MBG A;  2I8B A;  4ONS A;  1VYK A;  2A1D D;  2Y3B A;  3FOP A;  4WGZ A;  5E2Q A;  4Q5S F;  1QZX A;  1VB5 A;  3H2V A;  2G3K A;  2L6H A;  2M64 A;  4K1O A;  4D4X A;  3UGP A;  2OJE D;  3QVY A;  2QE9 A;  3NKD A;  5KYW B;  5IY5 C;  3EH1 A;  4WAB A;  1JPN A;  2GAQ A;  3E9V A;  4FX5 A;  1L3P A;  1RKE A;  4JW1 A;  3S28 A;  4PAC A;  5DS6 A;  1WOL A;  2Z15 A;  5EGY A;  5T3T A;  1OW6 A;  4BEM J;  4DVY P;  4EIY A;  4PJJ A;  1OCR C;  2HFI A;  1VLS A;  1T5O A;  256B A;  2R7Q A;  4IB4 A;  4YL1 A;  3FOO A;  1OCO C;  2NSF A;  4R32 A;  3KYJ A;  2OU6 A;  3HJC A;  3RVY A;  4H54 A;  5T1D B;  5KYN A;  3U0C A;  1NSG B;  1RJ9 A;  2P0N A;  4AE4 A;  5KYY B;  2R05 A;  3LLK A;  4EKW A;  2YWA A;  3TOM A;  3H2U A;  4AK9 A;  4BG0 A;  3DD7 A;  2XS8 A;  1T6U A;  4O7G A;  4MVU A;  5DVW A;  4A4A A;  2EIK C;  3L1M A;  4Z9H A;  1HY5 A;  2L6G A;  1EKY A;  4H4K C;  1I4Z A;  3M15 A;  4X0R A;  5DS4 A;  3KH2 A;  4YT2 A;  5COG A;  2UUH A;  5BQI A;  2PFD A;  2YHS A;  3LS1 A;  2HZ8 A;  2VB6 A;  1Q0M A;  3ITF A;  2V26 A;  3K1I C;  3ZG1 A;  3ECS A;  3NYJ A;  3CSK A;  2CYD A;  2XL8 A;  2XRH A;  4LLC A;  1QLE C;  4Z9J A;  1TFK B;  4XTK A;  1D0Z A;  1LVK A;  1TKN A;  2XLH A;  4NTA A;  2A68 F;  1T6I A;  2Q9A A;  2YQY A;  2W9Y A;  3JRT A;  1HW1 A;  3ABK C;  5DLJ A;  5A6B D;  2J0X A;  1YYJ A;  2NPU A;  1ZU5 A;  1VMA A;  1TFO B;  2L6F A;  2B0J A;  2P7V A;  4G0H A;  4LAC B;  3GWN A;  1SF8 A;  3POV A;  4W8P A;  4YJW A;  4F4B A;  2L81 A;  2WVO A;  3EG9 B;  4LDQ A;  4PJM A;  2PF4 E;  2XXA B;  2GA0 A;  2MHR A;  4B6I A;  5L3V A;  3RYL A;  4KI2 A;  1RJ9 B;  3I4U A;  4NC3 A;  4O6Y A;  2LIG A;  2NUP A;  4G7O F;  4N6H A;  3ZWI A;  3LUT B;  2ZPA A;  1U6H A;  4PFO A;  4XLP F;  1V74 B;  1JAF A;  2AU5 A;  3AGU A;  4QI0 A;  2Q9B A;  3T6J A;  3ZQV A;  3S90 A;  3N2Z B;  1OW7 A;  2W4B A;  3M79 A;  1OXB A;  3QW1 A;  1OKK D;  4MTO A;  2Y3D A;  3NDB B;  1QVX A;  3EFO B;  3SXZ A;  1RKC A;  2AWY A;  3AGT A;  3T6G B;  1MMA A;  5L3Q A;  3B0V C;  5AC5 A;  1KTM A;  3HKK A;  4G78 A;  4E7S A;  5GPG B;  1YLM A;  1Z6A A;  1R5I D;  2X51 A;  3F47 A;  2XM4 A;  3TUL A;  5F5F A;  1T9K A;  4J30 B;  2NUT A;  4YK5 A;  1TQG A;  2NG1 A;  3EZI A;  3DJU B;  3SP1 A;  5L0C A;  2VC9 A;  1D1C A;  3DWW A;  4U5D E;  1GGQ A;  1CPQ A;  2PBE A;  3DJN B;  1D1B A;  2A69 F;  3KKB A;  3FXH A;  4EWC A;  2HMZ A;  2RD9 A;  5FZT A;  1TWA A;  3C62 A;  3LJB A;  2JD3 A;  3NYL A;  5JP7 A;  3VRC A;  4XPX A;  5B3S C;  2DYS C;  2XXA A;  3V5X A;  3RF3 A;  2WB7 A;  5JRA A;  1UG7 A;  1QQ3 A;  3ABM C;  3EHN A;  4JJG A;  3AQC A;  1JR8 A;  2ICW G;  3FVY A;  5L0G A;  2TMV P;  2R7T A;  2Q3T A;  3W2V A;  2HJ3 A;  1Y6D A;  3EH2 A;  1FNT c;  1NG1 A;  3GEI A;  1GS9 A;  1Q0D A;  1WWP A;  5JT4 A;  4KNV A;  3GOD A;  2YZS A;  1LI7 A;  4U5B E;  3SXM A;  3QW0 A;  1MMN A;  1O5H A;  3S27 A;  4CS7 A;  3NKE A;  4CSA A;  4YT5 A;  2YL7 A;  3Q7L A;  3JTL O;  4CDY A;  4EBK A;  1ZW2 A;  2XLE A;  2ZD9 A;  5F5H A;  1E86 A;  4RDA A;  1AEP A;  1M2O A;  1PD1 A;  3DMD A;  4GYT A;  4MW3 A;  1ZHW A;  1M57 C;  2WVQ A;  4U5C E;  4WGY A;  3EGD B;  2WVN A;  3MLG A;  1BDJ B;  4LDR A;  4WJ0 A;  5L0I A;  3C8G B;  2HV7 A;  1LM3 B;  1F1M A;  3DI5 A;  4NTB A;  5JSL A;  5KYY A;  1ZHY A;  3ZC4 A;  3JYH A;  3RW0 A;  2ZXW C;  2FFH A;  2C04 A;  4FES A;  2YL3 A;  4OIP F;  2R7U A;  1K40 A;  1TWH A;  3DXJ F;  1CGM E;  3LAY A;  1E85 A;  1FMW A;  4BJT A;  3C7J A;  1Z7Q c;  3QMK A;  2R7W A;  1I5N A;  1TR2 A;  1XZP A;  2MYS A;  1KNY A;  4U5E E;  1ZU4 A;  4A2N B;  4E7Z A;  1BR4 A;  3G4Z A;  3J06 A;  1VK5 A;  2BE5 F;  5B3I A;  1M56 C;  2YLI A;  2WZG A;  4ZLD A;  3C63 A;  4NTF A;  3L8I A;  3FAJ A;  1Q0F A;  2HJM A;  2JPU A;  4C7O B;  5KYW A;  1G5Z A;  1BR1 A;  2J45 A;  3GM1 A;  4OIO F;  2UUI A;  4DOZ A;  4IWB A;  2XLV A;  4MVS A;  2IOQ A;  4AE4 B;  4CS8 A;  3VF0 A;  3L8J A;  3B29 A;  1M2V A;  1OCZ C;  1Z3I X;  2KW3 C;  3QTH A;  2R7R A;  4AL0 A;  4PK4 A;  1JPJ A;  1QPU A;  2QTV A;  3NRH A;  3TD7 A;  4HEA J;  1OR2 A;  1Q0G A;  5AGF A;  4J32 B;  4XEF A;  4MVQ A;  3SEO A;  3RKO F;  2QLA A;  2G62 A;  4JIO A;  4JUR I;  1XWJ A;  5KYU A;  5A6K A;  3O10 A;  1YAU O;  4JCH A;  4OIN F;  5CI8 A;  3Q6N A;  2Q9C A;  4JEA A;  5DQZ A;  2VCA A;  2IM8 A;  2Y39 A;  5F28 E;  1ZW3 A;  1WGW A;  3RQE A;  2KJG A;  1YZA A;  2BC5 A;  2F22 A;  1YA9 A;  2HSB A;  3EFO A;  5E3A A;  5TJ5 E;  2XLD A;  3TOL A;  1LIH A;  5L0H A;  4MVR A;  3C8Z A;  3DE9 A;  4ANJ A;  1OR3 A;  2QY9 A;  4U5H A;  3EPV A;  2OEX A;  1WN0 A;  4FAP B;  1ZVZ A;  3IQC A;  5A6A A;  2NUP B;  3UMK A;  3OWT A;  3A9C A;  1PCX A;  3UR3 C;  4CBE A;  1BR2 A;  1D0X A;  1HMO A;  1LKX A;  2WZL A;  2XLW A;  5BQG A;  2OJQ A;  3ZVR A;  3GAN A;  4DXW A;  1MNE A;  3NMJ A;  4GQH A;  3IPM O;  3EZH A;  2KGO A;  1E2X A;  2DI3 A;  1OCC C;  3U2L A;  3K66 A;  4I44 A;  4QI2 A;  3SYN A;  1MND A;  1WAT A;  5JUA A;  1M2V B;  1RXQ A;  2A6E F;  1HW2 A;  3QZC A;  3VYW A;  3UMI A;  2PX0 A;  5A6J A;  2OOC A;  3W8H A;  4FWV A;  1Z5Z A;  1A7D A;  1LS1 A;  2LCH A;  4O6M A;  1APC A;  4JRZ A;  2DYR C;  2G3V A;  2XS1 A;  2XSE A;  3O6X A;  1LPE A;  3FAP B;  3RH3 A;  2QUP A;  3AJM A;  2V3C C;  2R7V A; 
#chains in the Genus database with same CATH homology
 2UUI A;  4YL1 A;  4NTB A;  4YL0 A;  3B29 A;  4J7Y A;  3HKK A;  4NTA A;  5BQG A;  4AL0 A;  3PCV A;  2H8A A;  4J7T A;  5HV9 A;  4YL3 A;  2Q7R A;  4JCZ A;  4YK5 A;  4AL1 A;  3DWW A;  2PNO A;  3LEO A;  4JC7 A;  4WAB A;  4BPM A;  4JRZ A;  4NTF A;  2UUH A;  5BQI A;  5BQH A;  5K0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...