4AL0A

Crystal structure of human ps-1
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
146
structure length
146
Chain Sequence
VMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROSTAGLANDIN E SYNTHASE
publication title Crystal Structure of Microsomal Prostaglandin E2 Synthase Provides Insight Into Diversity in the Mapeg Superfamily.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 65
structure length 146
sequence length 146
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4al0A00
2PNOA 2UUIA 4NTAA 4YL1A 4J7TA 3HKKA 4AL0A 4NTFA 4YL3A 4J7YA 5K0IA 4YK5A 3B29A 2UUHA 2Q7RA 2H8AA 4JC7A 5BQGA 3LEOA 3PCVA 4NTBA 5HV9A 4JRZA 4YL0A 3DWWA 5BQHA 5BQIA 4BPMA 4AL1A 4WABA 4JCZA
chains in the Genus database with same CATH superfamily
1ORJA 4JIOA 1EKYA 4MNDA 1J8YF 2Y3DA 4JTCB 4ULVA 2RD9A 3GEEA 3G50A 3FAJA 2EPMX 2YL3A 1TFOB 1AVOB 2XLMA 3MLGA 2XRHA 1A7DA 2VCBA 2A0UA 3MYFA 2CNWD 1FNTc 3B29A 4EKWA 2ZXRA 3K1HA 3TJ6A 1ORSC 3DE8A 2LQGA 1WGWA 1H9TA 3I4UA 4C7OB 3K66A 3K7DA 3U3FA 1T6IA 2EINC 2GDCA 4H54A 4GYTA 1QZXA 4K0DA 4N4WA 5KYYA 3O10A 2HS5A 2P6VA 4I1OB 4YL0A 3UGOA 3B0VC 1OQCA 1SR2A 3LLKA 4HFKB 4KNWA 1A7EA 3Q7LA 3VAYA 1OXBA 4N6HA 1FTSA 4G7OF 2YLGA 1LE2A 2R05A 3MFNA 3U2LA 2XLOA 3LNRA 4IGGA 1OR2A 3GANA 4PR9A 3RQEA 3ZDLA 3SXKA 1GGQA 4YJWA 2OEVA 3FHDA 4MVOA 3W2VA 3DJNB 1ZHTA 1RCPA 2FGYA 1VMAA 4BEMJ 2R7XA 2I8BA 1MQVA 3F47A 3M4CA 4NTFA 4KI2A 2EILC 2O9XA 4EWCA 3EZHA 4JJFA 2QTVA 2ZXOA 1YA9A 1MNEA 4Q7CA 1FR0A 2P7VA 1V54C 4OD5A 2HMZA 4OD4A 4PFPA 3FOOA 4L6RA 2W4MA 4R32A 3M1CB 3PCVA 2A6EF 2YRFA 4IRUA 4A4AA 4HE8D 1JRAA 4IARA 4NQFA 1V74B 3DWWA 3EH1A 3TQOA 2IOQA 1OCRC 4IB4A 2HSQA 2J9WA 3I5QA 4QI0A 4DRHB 1QVXA 4WABA 3U8PA 5D91A 1KNYA 4G0HA 3QVYA 3X1OA 4CSAA 1E2XA 3NYMA 4JTAB 2R03A 2YZSA 4O6MA 3S0XA 1XZQA 1U89A 1VYKA 1JMWA 3JYYA 4J7TA 2KYHA 4OIRF 4CIHA 1Q0GA 2HUJA 4IAQA 1QQ3A 3FDQA 1JOGA 3SXYA 4AX2A 3LAYA 4OIQF 2E87A 5CI8A 5EK0A 3IEEA 1Z6AA 5DLJA 2A0BA 2YEVA 5AGFA 3S28A 4N06A 4U5CE 2UUHA 2H8AA 4BJ6C 5L0DA 4GEHA 2OQMA 2OU6A 1ZVZA 4C3EA 2CCYA 1T6UA 2R7QA 1DOVA 4RBNA 2XLVA 3N0TA 2L6HA 1MMNA 3HTKC 1MNDA 2BE5F 2D4UA 3C8GB 3ZWIA 4CJOA 2VCCA 3O6XA 4LLCA 3KKBA 3C8GA 3AG2C 2J7PD 3POVA 3SNHA 4Z9HA 1LM3B 2J7PA 1VLTA 2M4EA 3NDBB 3T6GB 1LKXA 1Q0FA 3H2UA 5EGYA 1YA7O 3U0CA 3V5ZA 1NFOA 3EGXB 4JEBA 1TWCA 1ZHZA 3HKKA 2R25A 5DVWA 3W8HA 3CAXA 3M15A 4DVYP 5A6AA 3PDMP 1ZU5A 2QUPA 3DKAA 2EPKX 2WVNA 2NSGA 3EGXA 3GWNA 3IQTA 2KJGA 3JSEO 4ONSA 1PD1A 4OIPF 2LD6A 4NY3A 3RH3A 1QPUA 1D0YA 3HNIA 2Y3HA 3SP1A 4YT2A 2J0WA 4U5HA 5JT4A 3R2PA 4PJLA 1G4US 4B6IA 3CZ6A 2TMVP 5JP7A 2AWCA 1NSGB 1ZZPA 4MTOA 3N24A 3EFOB 4D4NA 3LJBA 2HV6A 2XS8A 1YDIA 2XS1A 3EFOA 1ZU4A 4IJJA 4C3DA 4OIOF 2G62A 5A6KA 3UGPA 1LVKA 2AWYA 1LIHA 2FFHA 3SYNA 3DMDA 3IQCA 1L3PA 3RW0A 1CGOA 4U5BE 3ZC4A 3A11A 2G3VA 1T9KA 1U6HA 3IQ6A 4Q4ZF 3JSZA 4E17A 2EPOA 4BJ5A 3IHUA 4MVQA 3S84A 3T6BA 5A6BD 2EIMC 1Z3IX 1M57C 3LEOA 4U5DE 3ZQYA 1FAPB 5B1BC 1VB5A 4K1OA 4PACA 5FZTA 1G4WR 1OCZC 4MS2A 1Z5ZA 2H7OA 5L0CA 1VLSA 2B0HA 2XLWA 1ZW3A 2WZFA 4AL1A 2V3CC 5KYYB 3EHMA 1E86A 1G5ZA 4FX5A 1K04A 3NG1A 4MVUA 2F22A 4JEAA 3U9MA 2B0JA 2X0CA 4Z9IA 1H9GA 1U0BB 2EIKC 4I3MA 3N2ZB 2AVKA 3OWTA 2LFFA 5F5HA 1OKKD 3JTLO 3LEVA 2P61A 3L1MA 2QE9A 1BDJB 1WTYA 4XEVA 4DRIB 2EPLX 1YAUO 3ECSA 2CNWA 4FAPB 3ABMC 1YARO 3M79A 1CGME 4J30B 3UMIA 3W8IA 1SF8A 2GWWA 1YZCA 1E84A 1Q0MA 1FFTC 4P9TA 2DYRC 2VCAA 4PFOA 3RKOF 4AK9A 3FMSA 3QW1A 2Q00A 2XM0A 4YN0B 3S9OA 5B3IA 1TWGA 3LNMB 1E83A 1VK5A 3JT1A 5EHHA 5CIVA 2IYLD 1Z63A 1OW6A 2HV7A 1Y6DA 4U9DA 4EBBA 2G3KA 2IXPA 2LFDA 4AL0A 3R7CA 3SXZA 3H2VA 5T1DB 4EUKB 3PMRA 2R7SA 1NU9C 2KQ9A 1S05A 4AE4A 2WZLA 2CW0F 3SZRA 2Y39A 3GM2A 3M4BA 4WGZA 3GM1A 2R02A 2W9YA 3S27A 1WN0A 5L3VA 3QVZA 5DS5A 2JPUA 1LI7A 3L8JA 3WAQA 3EHNA 3ZSUA 4C7OA 1C02A 2IXOA 2KK1A 1A7VA 3EH2A 4YT5A 3UNGC 3LS0A 1HW2A 3NKEA 3GORA 4JKVA 5L0HA 3EG9A 3TK0A 4YWQA 2XL8A 5B3SC 5L3QA 3G4ZA 4JCZA 4CIPA 3W4YA 3J06A 4HFFB 1Z7Qc 3V5XA 4BJ6A 4LDKA 4BG0A 2LK4A 2Y3BA 4W8KA 4XEFA 2NPUA 2C03A 2YWAA 1Y4CA 2BL2A 3K33A 4IWBA 3JZ0A 1M6TA 3JCUQ 3ATPA 2Y3GA 2LSEA 1YJGA 2NUPB 3FAPB 4MVRA 1ZHXA 2L6GA 3ZTZA 4YK5A 3AOUA 3RQFA 4BJTA 2BC5A 5DQZA 4DJ9A 4DXWA 2NUPA 4LLEA 4HEAJ 3FVYA 2Q7RA 1EQ1A 4JC7A 4U5GA 3HNJA 1WASA 2NUTA 4CS8C 1VYIA 2WL8A 1I4YA 2OCCC 3A9CA 1G8XA 3KH2A 5HV9A 2FAPB 3RVYA 3WG7C 5HSWA 1RMVA 3K6BA 3V5YA 1V4AA 2VC9A 4JW1A 4XQ1A 1MMGA 3MX3A 1O5HA 5A6JA 4J32B 3L8IA 3TJ5A 3QTHA 1D0ZA 3MYIA 3AGTA 3U2MA 1C17M 2LCHA 1RJ9B 4NCQA 2R9RB 5DQTA 1CPRA 3DE9A 4QI2A 4MTGA 1RJ9A 5A69A 4NC3A 3BRJA 3GWLA 3ASNC 3FXHA 1TFKB 4XPYA 1M2OA 1WWPA 3ZG1A 3ZQVA 2ZXWC 1D0XA 4MVSA 3B0UX 1FMVA 2HKVA 2KC3A 5IY5C 4WGYA 3TOMA 2J0XA 2R7OA 1O3UA 1SYQA 4Z9JA 2X51A 1UFBA 1OCCC 5E2QA 1BR4A 4K7BA 4G78A 1OCOC 1HMDA 1VOMA 1S7ZA 2KNHA 4P9FA 4P6IC 5KYUA 5KYWB 4KBLA 2J46A 4I1MA 2M64A 2ZPAA 1VTMP 5KYWA 3SEOA 4BPMA 1IW7F 2KSFA 3Q6MA 2HSBA 1HE1A 3AQCA 2LP4A 4H4KC 2DGJA 4O6YA 4U5FE 2CGEA 3UMHA 2EPNA 4XLNF 3VYWA 3KYIA 4GQHA 3AG4C 1T6QA 3QZCA 3TD7A 3ABLC 1BBHA 4E7SA 1K40A 2J9BA 4YL3A 3GEHA 4CDVA 4RD9A 3TOLA 4I44A 5E3CA 1T01A 3G4XA 1T5OA 3OEOA 1FMWA 1CPQA 2JD3A 1LPEA 3DZAA 3DJUB 3E9VA 5BQGA 1IZMA 4MVMA 2WZGA 2W4BA 2ZD9A 5L0FA 5A6BA 2A68F 2VB6A 3OA1A 3B0PA 2C04A 1ZHYA 2A69F 2DYSC 3GM3A 4A2NB 1K05A 3DM5A 3HNLA 4DOZA 2MYSA 256BA 3K1IC 5FCLA 2XLHA 2PBEA 1OW8A 3LUTB 1MMDA 5BUOA 1EA8A 1LI5A 2OJQA 2L7AA 3B71A 4YL1A 2OG2A 4XTKA 1M2VB 3O55A 1HMOA 1ST6A 5CI9A 2A1DD 3VM6A 1M2VA 4X0RA 3BEHA 5F28E 5K0IA 1FFHA 4O79A 3NYLA 4PJMA 3WODF 1D1CA 1OKKA 1QSPA 1YVIA 1ZW2A 2WVQA 2XSEA 2OOCA 2PX3A 4W8PA 1UG7A 3LLIA 1AUEA 4EBKA 1RXQA 3QW0A 1WATA 3DAFA 3JRMO 3JRTA 1H6GA 3Q7GA 4QDLA 2YLDA 3B9QA 4JJGA 1JR8A 4MQ9F 5D92A 3DM9B 2HJ3A 5TJ5E 5COFA 3GODA 3RF3A 3U9JA 1YYXA 1APCA 3EZIA 2NG1A 4CDYA 3ABKC 2A6HF 5BQHA 5L0JA 4JVSA 1I4ZA 1N1CA 2XL6A 5L0GA 3RYLA 1R4TA 2H7VC 4DVZA 2V26A 4PJJA 5DS4A 3EPVA 1C03A 1RKCA 1EI7A 2L6FA 1TR2A 2PF4E 3DXJF 4LDQA 5AC5A 4G7HF 2UUIA 2CYDA 1BR2A 3JYHA 4CBEA 3W2WA 4Q5SF 1PD0A 1TWHA 2L81A 2H7BA 3KYJA 4LACB 4AE4B 4CS9C 4ZLDA 2MHRA 4DRJB 3KPHA 4PK4A 4CJGA 5B1AC 3T9OA 4M63A 2WB7A 3VF0A 4EIYA 2Q4FA 4IAOA 1O87A 2AU5A 3ITFA 3UR3C 1NLXA 1JAFA 1XWJA 3PHF2 3DAGA 2D5RB 3CEXA 3EG9B 2OJED 2GA0A 4EBJA 1B68A 1GS9A 2GFHA 4ER9A 1NZEA 4MVZA 4MW8A 1TKNA 3E70C 2HFIA 3O39A 3AG3C 2Q9BA 4FESA 3FOPA 4CS8A 1XZPA 1KU2A 1QLEC 1SMYF 4E0IA 5E3AA 1OW7A 1TQGA 2XLEA 4ULWA 4BJ1A 4UDVA 2IBFA 5T3WA 3GEIA 1R5ID 3CQZA 4J7YA 4XPWA 3ZIBA 3TULA 3S90A 4KNVA 5COGA 1DOWA 1A41A 2CDQA 1WOLA 1SZIA 4D4XA 4DBQA 2NUTB 3ASOC 2R7RA 4N6CA 2Q9CA 1PV3A 3S29A 2YQYA 3ZTMA 1NG1A 1F1MA 3C63A 3NMJA 1GQAA 4NTBA 5JLIA 2VASA 3NYJA 2LIGA 4OINF 2R7WA 2W45A 3T6JA 3U8VA 4MTFA 3NKDA 2ASRA 3X2QC 3H65A 4DBRA 3WHNA 4JZAA 3Q6NA 4O6NA 2J9VA 2PP4A 3KMIA 4MW3A 4NTAA 2HZ8A 4BEJA 2VH3A 4U5EE 1KTMA 2PX0A 1CGNA 2YL0A 1V55C 3LESA 2P1AA 3LS1A 1Q0DA 3C62A 3L34A 2OKUA 4E0HA 2OEXA 1PCXA 5COMA 4F4BA 4LERA 2ICWG 1NBBA 3C8ZA 4XPXA 3EGDB 3T4RA 4CSAC 3HJCA 1JPJA 5KYUB 2IXNA 1ZYRF 3UMKA 3NMKA 3EGDA 3U5SA 1Q0KA 5DS6A 1NU7D 4XLPF 3AQBA 4JTDB 1M56C 1D1AA 2AP3A 3C18A 2J8WA 3QMKA 2R7TA 3IQ5A 1LS1A 2YHSA 2XL4A 1YLMA 3C8GD 5L0IA 3DD7A 4JURI 5JRAA 5JS5A 5JVEA 5KYXB 1D1BA 4CX9A 2YLIA 1HE9A 4ZLCA 1LS4A 4C3BA 5KYXA 3RFYA 4YT8A 1ORYA 1MMAA 2HJMA 1OXKA 2J9UA 2DI3A 2IXMA 2YL7A 3NMIA 3RQGA 5F5FA 1OR3A 5JUAA 2ZXPA 3HNKA 4RDAA 3RVZA 4JE9A 3AGUA 4ANJA 2P0NA 4O7GA 4LDRA 2NSFA 3L0IA 3K1IA 3MBGA 4FWVA 1J8MF 2YVKA 3KL4A 1RKEB 2YL1A 1W2WA 3EQLF 4E7ZA 4G7ZF 5E33A 3VRCA 2JX0A 1RKEA 2RSEB 4U9EA 5AC4A 1LE4A 2I15A 2Y69C 4JCHA 4JRZA 2QNLA 4YT4A 2XM4A 3EJNA 3SXMA 4CS7A 2YKZA 2Q9AA 2J45A 1L7CA 2XLDA 3AJMA 1A0BA 1HW1A 1BZ4A 2GAQA 3AG1C 5JSLA 1BR1A 3US6A 5T3TA 1NFNA 2MWQA 2QLAA 2Q3TA 2DB4A 2PNOA 4WJ0A 3HLZA 3V7OA 3C7JA 1YYJA 2XXAB 2HMQA 3IPMO 1ZHWA 2R7UA 3CSKA 2XXAA 3F46A 1I5NA 3I5PA 2QY9A 2Z15A 4EHPA 1QKRA 2EIJC 4PJNA 4XEKA 3NRHA 2R7VA 3DI5A 1AEPA 3U3BA 1YZAA 4E18A 4XWJA 2WVOA 1JPNA 4KC9A 1HY5A 5GPGB 1Z23A 2KGOA 3RIPA 2PFDA 2IM8A 1H7IA 2KW3C 1E85A 5BQIA 5KYNA 4CS9A 1GM5A 1TWAA 2ETSA 3ZVRA 2L9JA 4CDAA 4BJ5C
chains in the Genus database with same CATH topology
2PNOA 2UUIA 4NTAA 4YL1A 4J7TA 3HKKA 4AL0A 4NTFA 4YL3A 4J7YA 5K0IA 4YK5A 3B29A 2UUHA 2Q7RA 2H8AA 4JC7A 5BQGA 3LEOA 3PCVA 4NTBA 5HV9A 4JRZA 4YL0A 3DWWA 5BQHA 5BQIA 4BPMA 4AL1A 4WABA 4JCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNO A;  2UUI A;  4NTA A;  4YL1 A;  4J7T A;  3HKK A;  4AL0 A;  4NTF A;  4YL3 A;  4J7Y A;  5K0I A;  4YK5 A;  3B29 A;  2UUH A;  2Q7R A;  2H8A A;  4JC7 A;  5BQG A;  3LEO A;  3PCV A;  4NTB A;  5HV9 A;  4JRZ A;  4YL0 A;  3DWW A;  5BQH A;  5BQI A;  4BPM A;  4AL1 A;  4WAB A;  4JCZ A; 
#chains in the Genus database with same CATH topology
 1ORJ A;  4JIO A;  1EKY A;  4MND A;  1J8Y F;  2Y3D A;  4JTC B;  4ULV A;  2RD9 A;  3GEE A;  3G50 A;  3FAJ A;  2EPM X;  2YL3 A;  1TFO B;  1AVO B;  2XLM A;  3MLG A;  2XRH A;  1A7D A;  2VCB A;  2A0U A;  3MYF A;  2CNW D;  1FNT c;  3B29 A;  4EKW A;  2ZXR A;  3K1H A;  3TJ6 A;  1ORS C;  3DE8 A;  2LQG A;  1WGW A;  1H9T A;  3I4U A;  4C7O B;  3K66 A;  3K7D A;  3U3F A;  1T6I A;  2EIN C;  2GDC A;  4H54 A;  4GYT A;  1QZX A;  4K0D A;  4N4W A;  5KYY A;  3O10 A;  2HS5 A;  2P6V A;  4I1O B;  4YL0 A;  3UGO A;  3B0V C;  1OQC A;  1SR2 A;  3LLK A;  4HFK B;  4KNW A;  1A7E A;  3Q7L A;  3VAY A;  1OXB A;  4N6H A;  1FTS A;  4G7O F;  2YLG A;  1LE2 A;  2R05 A;  3MFN A;  3U2L A;  2XLO A;  3LNR A;  4IGG A;  1OR2 A;  3GAN A;  4PR9 A;  3RQE A;  3ZDL A;  3SXK A;  1GGQ A;  4YJW A;  2OEV A;  3FHD A;  4MVO A;  3W2V A;  3DJN B;  1ZHT A;  1RCP A;  2FGY A;  1VMA A;  4BEM J;  2R7X A;  2I8B A;  1MQV A;  3F47 A;  3M4C A;  4NTF A;  4KI2 A;  2EIL C;  2O9X A;  4EWC A;  3EZH A;  4JJF A;  2QTV A;  2ZXO A;  1YA9 A;  1MNE A;  4Q7C A;  1FR0 A;  2P7V A;  1V54 C;  4OD5 A;  2HMZ A;  4OD4 A;  4PFP A;  3FOO A;  4L6R A;  2W4M A;  4R32 A;  3M1C B;  3PCV A;  2A6E F;  2YRF A;  4IRU A;  4A4A A;  4HE8 D;  1JRA A;  4IAR A;  4NQF A;  1V74 B;  3DWW A;  3EH1 A;  3TQO A;  2IOQ A;  1OCR C;  4IB4 A;  2HSQ A;  2J9W A;  3I5Q A;  4QI0 A;  4DRH B;  1QVX A;  4WAB A;  3U8P A;  5D91 A;  1KNY A;  4G0H A;  3QVY A;  3X1O A;  4CSA A;  1E2X A;  3NYM A;  4JTA B;  2R03 A;  2YZS A;  4O6M A;  3S0X A;  1XZQ A;  1U89 A;  1VYK A;  1JMW A;  3JYY A;  4J7T A;  2KYH A;  4OIR F;  4CIH A;  1Q0G A;  2HUJ A;  4IAQ A;  1QQ3 A;  3FDQ A;  1JOG A;  3SXY A;  4AX2 A;  3LAY A;  4OIQ F;  2E87 A;  5CI8 A;  5EK0 A;  3IEE A;  1Z6A A;  5DLJ A;  2A0B A;  2YEV A;  5AGF A;  3S28 A;  4N06 A;  4U5C E;  2UUH A;  2H8A A;  4BJ6 C;  5L0D A;  4GEH A;  2OQM A;  2OU6 A;  1ZVZ A;  4C3E A;  2CCY A;  1T6U A;  2R7Q A;  1DOV A;  4RBN A;  2XLV A;  3N0T A;  2L6H A;  1MMN A;  3HTK C;  1MND A;  2BE5 F;  2D4U A;  3C8G B;  3ZWI A;  4CJO A;  2VCC A;  3O6X A;  4LLC A;  3KKB A;  3C8G A;  3AG2 C;  2J7P D;  3POV A;  3SNH A;  4Z9H A;  1LM3 B;  2J7P A;  1VLT A;  2M4E A;  3NDB B;  3T6G B;  1LKX A;  1Q0F A;  3H2U A;  5EGY A;  1YA7 O;  3U0C A;  3V5Z A;  1NFO A;  3EGX B;  4JEB A;  1TWC A;  1ZHZ A;  3HKK A;  2R25 A;  5DVW A;  3W8H A;  3CAX A;  3M15 A;  4DVY P;  5A6A A;  3PDM P;  1ZU5 A;  2QUP A;  3DKA A;  2EPK X;  2WVN A;  2NSG A;  3EGX A;  3GWN A;  3IQT A;  2KJG A;  3JSE O;  4ONS A;  1PD1 A;  4OIP F;  2LD6 A;  4NY3 A;  3RH3 A;  1QPU A;  1D0Y A;  3HNI A;  2Y3H A;  3SP1 A;  4YT2 A;  2J0W A;  4U5H A;  5JT4 A;  3R2P A;  4PJL A;  1G4U S;  4B6I A;  3CZ6 A;  2TMV P;  5JP7 A;  2AWC A;  1NSG B;  1ZZP A;  4MTO A;  3N24 A;  3EFO B;  4D4N A;  3LJB A;  2HV6 A;  2XS8 A;  1YDI A;  2XS1 A;  3EFO A;  1ZU4 A;  4IJJ A;  4C3D A;  4OIO F;  2G62 A;  5A6K A;  3UGP A;  1LVK A;  2AWY A;  1LIH A;  2FFH A;  3SYN A;  3DMD A;  3IQC A;  1L3P A;  3RW0 A;  1CGO A;  4U5B E;  3ZC4 A;  3A11 A;  2G3V A;  1T9K A;  1U6H A;  3IQ6 A;  4Q4Z F;  3JSZ A;  4E17 A;  2EPO A;  4BJ5 A;  3IHU A;  4MVQ A;  3S84 A;  3T6B A;  5A6B D;  2EIM C;  1Z3I X;  1M57 C;  3LEO A;  4U5D E;  3ZQY A;  1FAP B;  5B1B C;  1VB5 A;  4K1O A;  4PAC A;  5FZT A;  1G4W R;  1OCZ C;  4MS2 A;  1Z5Z A;  2H7O A;  5L0C A;  1VLS A;  2B0H A;  2XLW A;  1ZW3 A;  2WZF A;  4AL1 A;  2V3C C;  5KYY B;  3EHM A;  1E86 A;  1G5Z A;  4FX5 A;  1K04 A;  3NG1 A;  4MVU A;  2F22 A;  4JEA A;  3U9M A;  2B0J A;  2X0C A;  4Z9I A;  1H9G A;  1U0B B;  2EIK C;  4I3M A;  3N2Z B;  2AVK A;  3OWT A;  2LFF A;  5F5H A;  1OKK D;  3JTL O;  3LEV A;  2P61 A;  3L1M A;  2QE9 A;  1BDJ B;  1WTY A;  4XEV A;  4DRI B;  2EPL X;  1YAU O;  3ECS A;  2CNW A;  4FAP B;  3ABM C;  1YAR O;  3M79 A;  1CGM E;  4J30 B;  3UMI A;  3W8I A;  1SF8 A;  2GWW A;  1YZC A;  1E84 A;  1Q0M A;  1FFT C;  4P9T A;  2DYR C;  2VCA A;  4PFO A;  3RKO F;  4AK9 A;  3FMS A;  3QW1 A;  2Q00 A;  2XM0 A;  4YN0 B;  3S9O A;  5B3I A;  1TWG A;  3LNM B;  1E83 A;  1VK5 A;  3JT1 A;  5EHH A;  5CIV A;  2IYL D;  1Z63 A;  1OW6 A;  2HV7 A;  1Y6D A;  4U9D A;  4EBB A;  2G3K A;  2IXP A;  2LFD A;  4AL0 A;  3R7C A;  3SXZ A;  3H2V A;  5T1D B;  4EUK B;  3PMR A;  2R7S A;  1NU9 C;  2KQ9 A;  1S05 A;  4AE4 A;  2WZL A;  2CW0 F;  3SZR A;  2Y39 A;  3GM2 A;  3M4B A;  4WGZ A;  3GM1 A;  2R02 A;  2W9Y A;  3S27 A;  1WN0 A;  5L3V A;  3QVZ A;  5DS5 A;  2JPU A;  1LI7 A;  3L8J A;  3WAQ A;  3EHN A;  3ZSU A;  4C7O A;  1C02 A;  2IXO A;  2KK1 A;  1A7V A;  3EH2 A;  4YT5 A;  3UNG C;  3LS0 A;  1HW2 A;  3NKE A;  3GOR A;  4JKV A;  5L0H A;  3EG9 A;  3TK0 A;  4YWQ A;  2XL8 A;  5B3S C;  5L3Q A;  3G4Z A;  4JCZ A;  4CIP A;  3W4Y A;  3J06 A;  4HFF B;  1Z7Q c;  3V5X A;  4BJ6 A;  4LDK A;  4BG0 A;  2LK4 A;  2Y3B A;  4W8K A;  4XEF A;  2NPU A;  2C03 A;  2YWA A;  1Y4C A;  2BL2 A;  3K33 A;  4IWB A;  3JZ0 A;  1M6T A;  3JCU Q;  3ATP A;  2Y3G A;  2LSE A;  1YJG A;  2NUP B;  3FAP B;  4MVR A;  1ZHX A;  2L6G A;  3ZTZ A;  4YK5 A;  3AOU A;  3RQF A;  4BJT A;  2BC5 A;  5DQZ A;  4DJ9 A;  4DXW A;  2NUP A;  4LLE A;  4HEA J;  3FVY A;  2Q7R A;  1EQ1 A;  4JC7 A;  4U5G A;  3HNJ A;  1WAS A;  2NUT A;  4CS8 C;  1VYI A;  2WL8 A;  1I4Y A;  2OCC C;  3A9C A;  1G8X A;  3KH2 A;  5HV9 A;  2FAP B;  3RVY A;  3WG7 C;  5HSW A;  1RMV A;  3K6B A;  3V5Y A;  1V4A A;  2VC9 A;  4JW1 A;  4XQ1 A;  1MMG A;  3MX3 A;  1O5H A;  5A6J A;  4J32 B;  3L8I A;  3TJ5 A;  3QTH A;  1D0Z A;  3MYI A;  3AGT A;  3U2M A;  1C17 M;  2LCH A;  1RJ9 B;  4NCQ A;  2R9R B;  5DQT A;  1CPR A;  3DE9 A;  4QI2 A;  4MTG A;  1RJ9 A;  5A69 A;  4NC3 A;  3BRJ A;  3GWL A;  3ASN C;  3FXH A;  1TFK B;  4XPY A;  1M2O A;  1WWP A;  3ZG1 A;  3ZQV A;  2ZXW C;  1D0X A;  4MVS A;  3B0U X;  1FMV A;  2HKV A;  2KC3 A;  5IY5 C;  4WGY A;  3TOM A;  2J0X A;  2R7O A;  1O3U A;  1SYQ A;  4Z9J A;  2X51 A;  1UFB A;  1OCC C;  5E2Q A;  1BR4 A;  4K7B A;  4G78 A;  1OCO C;  1HMD A;  1VOM A;  1S7Z A;  2KNH A;  4P9F A;  4P6I C;  5KYU A;  5KYW B;  4KBL A;  2J46 A;  4I1M A;  2M64 A;  2ZPA A;  1VTM P;  5KYW A;  3SEO A;  4BPM A;  1IW7 F;  2KSF A;  3Q6M A;  2HSB A;  1HE1 A;  3AQC A;  2LP4 A;  4H4K C;  2DGJ A;  4O6Y A;  4U5F E;  2CGE A;  3UMH A;  2EPN A;  4XLN F;  3VYW A;  3KYI A;  4GQH A;  3AG4 C;  1T6Q A;  3QZC A;  3TD7 A;  3ABL C;  1BBH A;  4E7S A;  1K40 A;  2J9B A;  4YL3 A;  3GEH A;  4CDV A;  4RD9 A;  3TOL A;  4I44 A;  5E3C A;  1T01 A;  3G4X A;  1T5O A;  3OEO A;  1FMW A;  1CPQ A;  2JD3 A;  1LPE A;  3DZA A;  3DJU B;  3E9V A;  5BQG A;  1IZM A;  4MVM A;  2WZG A;  2W4B A;  2ZD9 A;  5L0F A;  5A6B A;  2A68 F;  2VB6 A;  3OA1 A;  3B0P A;  2C04 A;  1ZHY A;  2A69 F;  2DYS C;  3GM3 A;  4A2N B;  1K05 A;  3DM5 A;  3HNL A;  4DOZ A;  2MYS A;  256B A;  3K1I C;  5FCL A;  2XLH A;  2PBE A;  1OW8 A;  3LUT B;  1MMD A;  5BUO A;  1EA8 A;  1LI5 A;  2OJQ A;  2L7A A;  3B71 A;  4YL1 A;  2OG2 A;  4XTK A;  1M2V B;  3O55 A;  1HMO A;  1ST6 A;  5CI9 A;  2A1D D;  3VM6 A;  1M2V A;  4X0R A;  3BEH A;  5F28 E;  5K0I A;  1FFH A;  4O79 A;  3NYL A;  4PJM A;  3WOD F;  1D1C A;  1OKK A;  1QSP A;  1YVI A;  1ZW2 A;  2WVQ A;  2XSE A;  2OOC A;  2PX3 A;  4W8P A;  1UG7 A;  3LLI A;  1AUE A;  4EBK A;  1RXQ A;  3QW0 A;  1WAT A;  3DAF A;  3JRM O;  3JRT A;  1H6G A;  3Q7G A;  4QDL A;  2YLD A;  3B9Q A;  4JJG A;  1JR8 A;  4MQ9 F;  5D92 A;  3DM9 B;  2HJ3 A;  5TJ5 E;  5COF A;  3GOD A;  3RF3 A;  3U9J A;  1YYX A;  1APC A;  3EZI A;  2NG1 A;  4CDY A;  3ABK C;  2A6H F;  5BQH A;  5L0J A;  4JVS A;  1I4Z A;  1N1C A;  2XL6 A;  5L0G A;  3RYL A;  1R4T A;  2H7V C;  4DVZ A;  2V26 A;  4PJJ A;  5DS4 A;  3EPV A;  1C03 A;  1RKC A;  1EI7 A;  2L6F A;  1TR2 A;  2PF4 E;  3DXJ F;  4LDQ A;  5AC5 A;  4G7H F;  2UUI A;  2CYD A;  1BR2 A;  3JYH A;  4CBE A;  3W2W A;  4Q5S F;  1PD0 A;  1TWH A;  2L81 A;  2H7B A;  3KYJ A;  4LAC B;  4AE4 B;  4CS9 C;  4ZLD A;  2MHR A;  4DRJ B;  3KPH A;  4PK4 A;  4CJG A;  5B1A C;  3T9O A;  4M63 A;  2WB7 A;  3VF0 A;  4EIY A;  2Q4F A;  4IAO A;  1O87 A;  2AU5 A;  3ITF A;  3UR3 C;  1NLX A;  1JAF A;  1XWJ A;  3PHF 2;  3DAG A;  2D5R B;  3CEX A;  3EG9 B;  2OJE D;  2GA0 A;  4EBJ A;  1B68 A;  1GS9 A;  2GFH A;  4ER9 A;  1NZE A;  4MVZ A;  4MW8 A;  1TKN A;  3E70 C;  2HFI A;  3O39 A;  3AG3 C;  2Q9B A;  4FES A;  3FOP A;  4CS8 A;  1XZP A;  1KU2 A;  1QLE C;  1SMY F;  4E0I A;  5E3A A;  1OW7 A;  1TQG A;  2XLE A;  4ULW A;  4BJ1 A;  4UDV A;  2IBF A;  5T3W A;  3GEI A;  1R5I D;  3CQZ A;  4J7Y A;  4XPW A;  3ZIB A;  3TUL A;  3S90 A;  4KNV A;  5COG A;  1DOW A;  1A41 A;  2CDQ A;  1WOL A;  1SZI A;  4D4X A;  4DBQ A;  2NUT B;  3ASO C;  2R7R A;  4N6C A;  2Q9C A;  1PV3 A;  3S29 A;  2YQY A;  3ZTM A;  1NG1 A;  1F1M A;  3C63 A;  3NMJ A;  1GQA A;  4NTB A;  5JLI A;  2VAS A;  3NYJ A;  2LIG A;  4OIN F;  2R7W A;  2W45 A;  3T6J A;  3U8V A;  4MTF A;  3NKD A;  2ASR A;  3X2Q C;  3H65 A;  4DBR A;  3WHN A;  4JZA A;  3Q6N A;  4O6N A;  2J9V A;  2PP4 A;  3KMI A;  4MW3 A;  4NTA A;  2HZ8 A;  4BEJ A;  2VH3 A;  4U5E E;  1KTM A;  2PX0 A;  1CGN A;  2YL0 A;  1V55 C;  3LES A;  2P1A A;  3LS1 A;  1Q0D A;  3C62 A;  3L34 A;  2OKU A;  4E0H A;  2OEX A;  1PCX A;  5COM A;  4F4B A;  4LER A;  2ICW G;  1NBB A;  3C8Z A;  4XPX A;  3EGD B;  3T4R A;  4CSA C;  3HJC A;  1JPJ A;  5KYU B;  2IXN A;  1ZYR F;  3UMK A;  3NMK A;  3EGD A;  3U5S A;  1Q0K A;  5DS6 A;  1NU7 D;  4XLP F;  3AQB A;  4JTD B;  1M56 C;  1D1A A;  2AP3 A;  3C18 A;  2J8W A;  3QMK A;  2R7T A;  3IQ5 A;  1LS1 A;  2YHS A;  2XL4 A;  1YLM A;  3C8G D;  5L0I A;  3DD7 A;  4JUR I;  5JRA A;  5JS5 A;  5JVE A;  5KYX B;  1D1B A;  4CX9 A;  2YLI A;  1HE9 A;  4ZLC A;  1LS4 A;  4C3B A;  5KYX A;  3RFY A;  4YT8 A;  1ORY A;  1MMA A;  2HJM A;  1OXK A;  2J9U A;  2DI3 A;  2IXM A;  2YL7 A;  3NMI A;  3RQG A;  5F5F A;  1OR3 A;  5JUA A;  2ZXP A;  3HNK A;  4RDA A;  3RVZ A;  4JE9 A;  3AGU A;  4ANJ A;  2P0N A;  4O7G A;  4LDR A;  2NSF A;  3L0I A;  3K1I A;  3MBG A;  4FWV A;  1J8M F;  2YVK A;  3KL4 A;  1RKE B;  2YL1 A;  1W2W A;  3EQL F;  4E7Z A;  4G7Z F;  5E33 A;  3VRC A;  2JX0 A;  1RKE A;  2RSE B;  4U9E A;  5AC4 A;  1LE4 A;  2I15 A;  2Y69 C;  4JCH A;  4JRZ A;  2QNL A;  4YT4 A;  2XM4 A;  3EJN A;  3SXM A;  4CS7 A;  2YKZ A;  2Q9A A;  2J45 A;  1L7C A;  2XLD A;  3AJM A;  1A0B A;  1HW1 A;  1BZ4 A;  2GAQ A;  3AG1 C;  5JSL A;  1BR1 A;  3US6 A;  5T3T A;  1NFN A;  2MWQ A;  2QLA A;  2Q3T A;  2DB4 A;  2PNO A;  4WJ0 A;  3HLZ A;  3V7O A;  3C7J A;  1YYJ A;  2XXA B;  2HMQ A;  3IPM O;  1ZHW A;  2R7U A;  3CSK A;  2XXA A;  3F46 A;  1I5N A;  3I5P A;  2QY9 A;  2Z15 A;  4EHP A;  1QKR A;  2EIJ C;  4PJN A;  4XEK A;  3NRH A;  2R7V A;  3DI5 A;  1AEP A;  3U3B A;  1YZA A;  4E18 A;  4XWJ A;  2WVO A;  1JPN A;  4KC9 A;  1HY5 A;  5GPG B;  1Z23 A;  2KGO A;  3RIP A;  2PFD A;  2IM8 A;  1H7I A;  2KW3 C;  1E85 A;  5BQI A;  5KYN A;  4CS9 A;  1GM5 A;  1TWA A;  2ETS A;  3ZVR A;  2L9J A;  4CDA A;  4BJ5 C; 
#chains in the Genus database with same CATH homology
 2PNO A;  2UUI A;  4NTA A;  4YL1 A;  4J7T A;  3HKK A;  4AL0 A;  4NTF A;  4YL3 A;  4J7Y A;  5K0I A;  4YK5 A;  3B29 A;  2UUH A;  2Q7R A;  2H8A A;  4JC7 A;  5BQG A;  3LEO A;  3PCV A;  4NTB A;  5HV9 A;  4JRZ A;  4YL0 A;  3DWW A;  5BQH A;  5BQI A;  4BPM A;  4AL1 A;  4WAB A;  4JCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...