1JMWA

Propagating conformational changes over long (and short) distances
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
MNQQGFVISNELRQQQSELTSTWDLMLQTRINLARSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords methyl-accepting chemotaxis protein II
publication title Propagating conformational changes over long (and short) distances in proteins.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 50
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2001-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1jmwA00
1VLTA 1WASA 4Z9IA 1JMWA 4Z9HA 2LIGA 1VLSA 4Z9JA 3T9OA 2ASRA 4H54A 3ATPA 1WATA 2D4UA 1LIHA
chains in the Genus database with same CATH superfamily
1QLEC 1JR8A 2IXMA 2OEVA 3FOPA 2Y3DA 3K1IA 3QTHA 4IGGA 4O7GA 3V7OA 4C3BA 4DVYP 1FFHA 5IY5C 3CZ6A 1U89A 3RF3A 4JTCB 3U9MA 4ZLDA 2YKZA 5JSLA 2G62A 3RQGA 4ZLCA 2AU5A 4CDAA 4IARA 3DI5A 4MVSA 5B1AC 2C04A 4YJWA 2XLOA 3FOOA 2CCYA 4I44A 3ZDLA 1HMDA 1PD1A 2DB4A 2R05A 1V54C 5E3CA 4PK4A 5COFA 3POVA 3AG2C 3I5PA 5JRAA 3VRCA 4LLCA 1KU2A 5F28E 1C02A 3BRJA 1B68A 4CBEA 4LACB 2D5RB 3OA1A 5EGYA 3EH2A 2XLMA 2ZXWC 2KW3C 2Q3TA 3HNIA 4E7ZA 1L3PA 2VCAA 3VF0A 3ZQYA 2H8AA 2YVKA 1JOGA 1KTMA 4NTBA 5CIVA 2VCCA 2HUJA 3SZRA 2CNWA 5AC5A 3GORA 3VAYA 1VYIA 3V5ZA 4HEAJ 1CGME 2PBEA 1NU7D 4XWJA 4U5BE 3IHUA 1Z7Qc 3RQFA 2OG2A 3ZWIA 3L1MA 4BJ6C 5KYXB 3M15A 2J8WA 4FESA 4JJFA 3S90A 2J7PA 2YWAA 4BG0A 4DRHB 2QLAA 4CS7A 4DJ9A 4U5EE 1VTMP 4WABA 2XL8A 4CIHA 1FMVA 1MQVA 2TMVP 3S28A 2ZXOA 3ZC4A 2XLVA 1YA9A 3G4ZA 1ORJA 1YARO 2KSFA 4NQFA 4O79A 1L7CA 4XPWA 2L6FA 2M64A 4RD9A 3FXHA 3FHDA 3RYLA 1M56C 2OJQA 2D4UA 1G4US 1UG7A 3NMJA 3PCVA 4KNWA 4N6HA 2KYHA 1I5NA 3H2VA 3HNJA 4LDKA 3B0VC 3N0TA 3RFYA 4G7OF 3EG9B 2WZGA 4AX2A 1D0ZA 3AG1C 3E70C 2NUTA 3WODF 5BUOA 3QMKA 1WN0A 4MVMA 4CSAC 1XZPA 4PACA 2DYRC 4OINF 3ATPA 3MYFA 2J0WA 4J32B 4MTFA 3PDMP 1GM5A 1EA8A 1JPJA 1ZVZA 1EKYA 1TR2A 1ZU4A 1OCOC 1SZIA 3OWTA 3IQ6A 2W45A 4GYTA 1XWJA 2YL0A 5B3SC 5KYWB 1M2VB 5L0FA 3K6BA 5HV9A 3T4RA 5KYWA 4JE9A 2I15A 1D1CA 3ABKC 4J7YA 3U9JA 1R5ID 4J30B 4H4KC 1ZYRF 3FMSA 2R7TA 2J9VA 1NFOA 2XLWA 5COMA 4CIPA 2HMQA 1HY5A 1MMGA 4YT8A 1A7EA 4YL3A 1WTYA 1HE9A 2P6VA 5L0CA 4LLEA 3W2VA 3RIPA 4E18A 1JRAA 1O87A 2Q7RA 4DXWA 5JT4A 2R7SA 5DQTA 3NYJA 4G0HA 1ZHTA 1E83A 4YT4A 1VK5A 1W2WA 1TWGA 4FWVA 1A7VA 2FFHA 1I4ZA 3ZVRA 2WZFA 2XLHA 4JEBA 5AGFA 2J9UA 3HTKC 5JS5A 3SP1A 2Y3GA 4C3DA 4NY3A 5B3IA 2I8BA 3U8VA 5DQZA 5HSWA 3C18A 3AG4C 3W8IA 3AQBA 2R7UA 1Z3IX 3N2ZB 3KH2A 3EZHA 1AUEA 2O9XA 1FTSA 2R7WA 2PX3A 2Q00A 4Q7CA 4NTAA 2NUPB 4I1OB 4KC9A 5BQHA 2G3VA 4LERA 1RMVA 1LM3B 2XSEA 1BZ4A 1A41A 3I5QA 1S7ZA 2HFIA 3NKDA 3DMDA 3DZAA 3MFNA 1ZHYA 4BEMJ 2R7OA 2AWYA 1CPQA 3KL4A 3LJBA 5A6JA 4NCQA 1S05A 2UUHA 3AG3C 4JIOA 2IYLD 2HV6A 3EH1A 3O10A 3ABMC 1ZHXA 4B6IA 3DE8A 5KYUA 1Y6DA 3GM3A 3NMIA 4BJ5C 2VB6A 4MQ9F 1TWAA 1OCRC 3A9CA 5KYNA 1M6TA 4JTAB 4NTFA 4BEJA 1D1BA 3M4BA 4JZAA 3LNRA 4PR9A 3LAYA 3DAFA 1OR3A 1Q0DA 3SXMA 3T6JA 3CAXA 4QDLA 4DBQA 2HV7A 4U9EA 4XQ1A 1IZMA 1LE4A 1RKEB 4DBRA 1MNDA 3L8IA 4BJ6A 2XRHA 4RDAA 2R7XA 1H6GA 3JRMO 2GA0A 2L7AA 3FAJA 4MVQA 4ULWA 3U0CA 2XL6A 3ASOC 2YRFA 3C8ZA 1LI5A 2IM8A 3HLZA 3EFOA 4P9TA 5DS4A 3LS1A 3AJMA 1T5OA 2QNLA 4A4AA 3IQCA 2YL3A 1Q0GA 4ULVA 2P61A 1LE2A 2LSEA 3EGDB 3QZCA 4K1OA 4G78A 4E0HA 3EGDA 4MVZA 3T6BA 1WWPA 4BPMA 4EWCA 2M4EA 2V3CC 3BEHA 1LVKA 3U3FA 1Q0FA 2IXNA 3DKAA 5L0GA 1Q0MA 2A68F 4AK9A 1JAFA 4FAPB 4KNVA 3B0PA 2YL7A 1QQ3A 5E33A 4IB4A 1HW1A 4YT2A 4CSAA 1K04A 4MNDA 3CQZA 4Z9HA 3S27A 1JPNA 1YYJA 1RCPA 2DYSC 2QY9A 2W4MA 3EGXA 2PFDA 1CGNA 4EBKA 4MVUA 3GEHA 4XEKA 4QI0A 4AL0A 1OW6A 5K0IA 2ETSA 2ZPAA 3LUTB 1BR4A 4PJNA 4Q4ZF 3K66A 4MW8A 1FNTc 3UR3C 4WGZA 1VMAA 2JPUA 3M1CB 3DD7A 2KK1A 2MWQA 2XM0A 3AGTA 2Y69C 1YVIA 2BE5F 3F47A 3O55A 4K0DA 4P9FA 1E85A 2CNWD 3DAGA 1C17M 1PD0A 3L0IA 3GWNA 3EHMA 3N24A 3RW0A 4CS8A 4XEVA 3NDBB 2EIKC 2KJGA 1TQGA 3I4UA 3W2WA 2XLDA 2W9YA 3GM1A 3K33A 3R7CA 2J7PD 4O6YA 2LIGA 2OQMA 2GWWA 3UNGC 3E9VA 2BC5A 1Y4CA 4OIOF 3C8GA 3JZ0A 2NUTB 1BDJB 3RVZA 1ZZPA 2XM4A 1LPEA 3QW1A 4IJJA 2YLDA 3K1IC 4ONSA 4OIRF 1GGQA 3IQTA 3RH3A 1I4YA 1ORYA 4DVZA 1TWHA 5L3VA 4MVRA 3U3BA 2A0UA 3TULA 4DOZA 1NSGB 2AP3A 2EPMX 1E2XA 2HJ3A 4EBBA 1R4TA 3WAQA 3B29A 1YLMA 1M57C 4AE4A 5DLJA 2HSQA 2E87A 5D92A 5KYYA 4O6NA 5TJ5E 3ECSA 1ZW2A 4J7TA 4LDQA 2DGJA 5BQGA 2HJMA 4RBNA 1YJGA 5B1BC 2P0NA 2J45A 3ABLC 2ZXRA 1A7DA 1LIHA 3EZIA 4KBLA 2B0JA 4XPYA 3T6GB 3PHF2 2A1DD 3RQEA 1OXBA 4MVOA 3TD7A 2WB7A 1LS4A 3GWLA 2V26A 3OEOA 4EIYA 2PF4E 4U5GA 3Q6MA 4X0RA 3TJ5A 3WG7C 2HSBA 2KQ9A 1EI7A 1VOMA 1TWCA 3SNHA 4PFOA 3LEOA 4G7HF 1DOWA 2DI3A 1T01A 2KC3A 4H54A 4CJOA 2ICWG 1AVOB 3LLIA 3FDQA 1E86A 2VCBA 2IXPA 2HZ8A 1Z6AA 4N06A 3B71A 1CPRA 3V5XA 3GEIA 2LFDA 3LEVA 3DJNB 3M79A 1NBBA 2A6HF 1G4WR 3NMKA 3QW0A 4YT5A 3QVZA 5FCLA 2ASRA 2YZSA 2XXAA 4JEAA 1DOVA 1O5HA 2L9JA 3ITFA 2IXOA 4N6CA 1J8YF 2GAQA 2J9WA 3H2UA 2EPOA 3F46A 4Z9IA 3VM6A 4YK5A 2OEXA 2KGOA 3DM9B 5KYUB 2A0BA 3DM5A 3US6A 3AGUA 3O39A 3EPVA 4R32A 1F1MA 2YLIA 2A6EF 3WHNA 3VYWA 2X51A 3JRTA 1ST6A 2H7OA 5A6BA 2R02A 5T3TA 2GDCA 5JUAA 4XLNF 3HJCA 1QVXA 1EQ1A 1QSPA 1JMWA 1D0YA 2R03A 3S0XA 2R7QA 1SYQA 4OD4A 4QI2A 3CEXA 2Q9AA 4N4WA 4OD5A 1LI7A 4CJGA 4D4XA 4JCHA 3X1OA 3JSZA 1O3UA 2FAPB 1PCXA 1QPUA 1GS9A 3EQLF 4MW3A 1Z63A 1U6HA 1TKNA 2EPKX 2Q9CA 3EFOB 1NU9C 4MTOA 2R7RA 5L0HA 2EIMC 1YZAA 3UMHA 4C3EA 1T9KA 3EJNA 4JJGA 3TK0A 1RJ9A 1T6UA 2L81A 3JCUQ 2XS8A 3AOUA 3UMKA 3QVYA 4JKVA 5F5HA 4U5CE 4Q5SF 1BR2A 4YWQA 1MMDA 2HMZA 3TOLA 2NSGA 3ZIBA 4G7ZF 1T6QA 2Y3BA 1SR2A 3NG1A 2XL4A 2FGYA 5DS5A 2PX0A 1LS1A 3IEEA 1QZXA 1SMYF 3G4XA 3GANA 3M4CA 3MYIA 3O6XA 4JCZA 3W8HA 3L8JA 1U0BB 1OKKA 4E0IA 2VH3A 3RKOF 3H65A 1FAPB 1J8MF 3ZQVA 3LESA 4D4NA 4C7OB 2AWCA 3SXKA 2WVNA 3UGOA 3SXZA 2R25A 2L6HA 4W8KA 5EHHA 4C7OA 4DRIB 3J06A 2JX0A 3EGXB 1T6IA 2LP4A 1OXKA 2CGEA 4JVSA 3FAPB 2JD3A 2YL1A 5T1DB 1G5ZA 3FVYA 2J9BA 4YN0B 3TOMA 1FFTC 4LDRA 4MTGA 3TJ6A 1HW2A 3C63A 1OKKD 1V55C 5COGA 4PFPA 1NFNA 4O6MA 5L0JA 4U5DE 1D0XA 4CDYA 3UGPA 1ZW3A 3T9OA 5A6KA 1ORSC 3G50A 3U2MA 3JYYA 4EKWA 1WATA 4WGYA 1APCA 3HNLA 3B0UX 1K40A 1ZHWA 2LQGA 1MMNA 2NPUA 3ZSUA 1HE1A 4XTKA 2H7BA 2ZD9A 3IPMO 1C03A 3U2LA 2B0HA 3K7DA 3LS0A 2EPNA 4BJ1A 5JLIA 2YHSA 4CS9C 3SEOA 2OKUA 4PJLA 5EK0A 1Q0KA 1G8XA 2CDQA 3GODA 3JTLO 1MMAA 1ZU5A 1TFKB 3MX3A 2KNHA 3TQOA 1BR1A 2H7VC 1LKXA 3C8GB 2IOQA 2CYDA 5DVWA 5L0DA 3R2PA 2Q4FA 1H7IA 1A0BA 4GEHA 2LFFA 2IBFA 1GQAA 1OCCC 2HKVA 3LNMB 5KYXA 2Y39A 4HE8D 4JC7A 4I1MA 3MBGA 2WVQA 1YAUO 1OW7A 1NLXA 1Z5ZA 2EPLX 4JW1A 4MS2A 4PJMA 4BJTA 4PJJA 4E17A 2NG1A 4JRZA 3JYHA 5CI8A 1PV3A 2P7VA 3ASNC 3PMRA 1UFBA 3C8GD 4AE4B 5BQIA 1H9GA 1MNEA 4JTDB 5JVEA 3HKKA 2F22A 5KYYB 2J46A 2PNOA 2MHRA 2Y3HA 2YEVA 3C62A 1NZEA 2RSEB 1YA7O 1E84A 5E3AA 2X0CA 4E7SA 1NG1A 2EILC 3C7JA 4IAOA 4U5FE 1K05A 3CSKA 3LLKA 3AQCA 3SXYA 4BJ5A 1D1AA 1ZHZA 2HS5A 3EG9A 3GM2A 3NRHA 3U8PA 4F4BA 2VC9A 2EINC 1AEPA 1RKCA 4EUKB 2C03A 2J0XA 5F5FA 4XEFA 256BA 5D91A 1VB5A 5E2QA 3JT1A 3Q7LA 4IWBA 2QE9A 3B9QA 1CGOA 2AVKA 4EBJA 3KYJA 2GFHA 2OU6A 2ZXPA 2W4BA 3Q6NA 1M2VA 1VLTA 5JP7A 2L6GA 2XLEA 1OR2A 4ANJA 4XPXA 2WVOA 5L0IA 3HNKA 3KMIA 3K1HA 1YDIA 5GPGB 1VYKA 5T3WA 2LCHA 2Q9BA 3ZTZA 5L3QA 4XLPF 4P6IC 1TFOB 2A69F 2OOCA 3DJUB 2XXAB 4IRUA 4CS8C 4K7BA 5A6AA 3RVYA 4ER9A 4U5HA 1RXQA 2BL2A 5CI9A 2NSFA 4OIPF 2R9RB 4EHPA 1QKRA 4I3MA 4KI2A 4OIQF 4IAQA 4NC3A 5A69A 2XS1A 3KKBA 4YL1A 2PP4A 3EHNA 4M63A 3ZG1A 1OQCA 4Z9JA 2P1AA 3S29A 3S9OA 4UDVA 1V74B 2LD6A 3NYMA 1KNYA 3A11A 4U9DA 3SYNA 1FMWA 3W4YA 3ZTMA 2MYSA 1FR0A 5DS6A 4W8PA 4YL0A 1V4AA 2CW0F 2NUPA 2UUIA 3DXJF 4WJ0A 4DRJB 2VASA 1H9TA 1M2OA 3GEEA 4HFKB 2OJED 4JURI 1VLSA 2LK4A 4CDVA 1SF8A 3UMIA 5A6BD 2Z15A 2YQYA 5AC4A 1YZCA 3DE9A 4FX5A 2RD9A 1IW7F 3S84A 3DWWA 3L34A 1RJ9B 2G3KA 2OCCC 2YLGA 3Q7GA 4A2NB 3X2QC 2QUPA 2R7VA 1BBHA 3MLGA 3KYIA 3JSEO 4HFFB 3V5YA 4CS9A 2EIJC 3NKEA 4GQHA 4AL1A 2QTVA 2WZLA 3IQ5A 3KPHA 3NYLA 1HMOA 1OCZC 5FZTA 1N1CA 1WOLA 3U5SA 1OW8A 1Z23A 4L6RA 4CX9A 2WL8A 1XZQA 1YYXA 1WASA 1RKEA 1WGWA
chains in the Genus database with same CATH topology
1VLTA 1WASA 4Z9IA 1JMWA 4Z9HA 2LIGA 1VLSA 4Z9JA 3T9OA 2ASRA 4H54A 3ATPA 1WATA 2D4UA 1LIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLT A;  1WAS A;  4Z9I A;  1JMW A;  4Z9H A;  2LIG A;  1VLS A;  4Z9J A;  3T9O A;  2ASR A;  4H54 A;  3ATP A;  1WAT A;  2D4U A;  1LIH A; 
#chains in the Genus database with same CATH topology
 1QLE C;  1JR8 A;  2IXM A;  2OEV A;  3FOP A;  2Y3D A;  3K1I A;  3QTH A;  4IGG A;  4O7G A;  3V7O A;  4C3B A;  4DVY P;  1FFH A;  5IY5 C;  3CZ6 A;  1U89 A;  3RF3 A;  4JTC B;  3U9M A;  4ZLD A;  2YKZ A;  5JSL A;  2G62 A;  3RQG A;  4ZLC A;  2AU5 A;  4CDA A;  4IAR A;  3DI5 A;  4MVS A;  5B1A C;  2C04 A;  4YJW A;  2XLO A;  3FOO A;  2CCY A;  4I44 A;  3ZDL A;  1HMD A;  1PD1 A;  2DB4 A;  2R05 A;  1V54 C;  5E3C A;  4PK4 A;  5COF A;  3POV A;  3AG2 C;  3I5P A;  5JRA A;  3VRC A;  4LLC A;  1KU2 A;  5F28 E;  1C02 A;  3BRJ A;  1B68 A;  4CBE A;  4LAC B;  2D5R B;  3OA1 A;  5EGY A;  3EH2 A;  2XLM A;  2ZXW C;  2KW3 C;  2Q3T A;  3HNI A;  4E7Z A;  1L3P A;  2VCA A;  3VF0 A;  3ZQY A;  2H8A A;  2YVK A;  1JOG A;  1KTM A;  4NTB A;  5CIV A;  2VCC A;  2HUJ A;  3SZR A;  2CNW A;  5AC5 A;  3GOR A;  3VAY A;  1VYI A;  3V5Z A;  4HEA J;  1CGM E;  2PBE A;  1NU7 D;  4XWJ A;  4U5B E;  3IHU A;  1Z7Q c;  3RQF A;  2OG2 A;  3ZWI A;  3L1M A;  4BJ6 C;  5KYX B;  3M15 A;  2J8W A;  4FES A;  4JJF A;  3S90 A;  2J7P A;  2YWA A;  4BG0 A;  4DRH B;  2QLA A;  4CS7 A;  4DJ9 A;  4U5E E;  1VTM P;  4WAB A;  2XL8 A;  4CIH A;  1FMV A;  1MQV A;  2TMV P;  3S28 A;  2ZXO A;  3ZC4 A;  2XLV A;  1YA9 A;  3G4Z A;  1ORJ A;  1YAR O;  2KSF A;  4NQF A;  4O79 A;  1L7C A;  4XPW A;  2L6F A;  2M64 A;  4RD9 A;  3FXH A;  3FHD A;  3RYL A;  1M56 C;  2OJQ A;  2D4U A;  1G4U S;  1UG7 A;  3NMJ A;  3PCV A;  4KNW A;  4N6H A;  2KYH A;  1I5N A;  3H2V A;  3HNJ A;  4LDK A;  3B0V C;  3N0T A;  3RFY A;  4G7O F;  3EG9 B;  2WZG A;  4AX2 A;  1D0Z A;  3AG1 C;  3E70 C;  2NUT A;  3WOD F;  5BUO A;  3QMK A;  1WN0 A;  4MVM A;  4CSA C;  1XZP A;  4PAC A;  2DYR C;  4OIN F;  3ATP A;  3MYF A;  2J0W A;  4J32 B;  4MTF A;  3PDM P;  1GM5 A;  1EA8 A;  1JPJ A;  1ZVZ A;  1EKY A;  1TR2 A;  1ZU4 A;  1OCO C;  1SZI A;  3OWT A;  3IQ6 A;  2W45 A;  4GYT A;  1XWJ A;  2YL0 A;  5B3S C;  5KYW B;  1M2V B;  5L0F A;  3K6B A;  5HV9 A;  3T4R A;  5KYW A;  4JE9 A;  2I15 A;  1D1C A;  3ABK C;  4J7Y A;  3U9J A;  1R5I D;  4J30 B;  4H4K C;  1ZYR F;  3FMS A;  2R7T A;  2J9V A;  1NFO A;  2XLW A;  5COM A;  4CIP A;  2HMQ A;  1HY5 A;  1MMG A;  4YT8 A;  1A7E A;  4YL3 A;  1WTY A;  1HE9 A;  2P6V A;  5L0C A;  4LLE A;  3W2V A;  3RIP A;  4E18 A;  1JRA A;  1O87 A;  2Q7R A;  4DXW A;  5JT4 A;  2R7S A;  5DQT A;  3NYJ A;  4G0H A;  1ZHT A;  1E83 A;  4YT4 A;  1VK5 A;  1W2W A;  1TWG A;  4FWV A;  1A7V A;  2FFH A;  1I4Z A;  3ZVR A;  2WZF A;  2XLH A;  4JEB A;  5AGF A;  2J9U A;  3HTK C;  5JS5 A;  3SP1 A;  2Y3G A;  4C3D A;  4NY3 A;  5B3I A;  2I8B A;  3U8V A;  5DQZ A;  5HSW A;  3C18 A;  3AG4 C;  3W8I A;  3AQB A;  2R7U A;  1Z3I X;  3N2Z B;  3KH2 A;  3EZH A;  1AUE A;  2O9X A;  1FTS A;  2R7W A;  2PX3 A;  2Q00 A;  4Q7C A;  4NTA A;  2NUP B;  4I1O B;  4KC9 A;  5BQH A;  2G3V A;  4LER A;  1RMV A;  1LM3 B;  2XSE A;  1BZ4 A;  1A41 A;  3I5Q A;  1S7Z A;  2HFI A;  3NKD A;  3DMD A;  3DZA A;  3MFN A;  1ZHY A;  4BEM J;  2R7O A;  2AWY A;  1CPQ A;  3KL4 A;  3LJB A;  5A6J A;  4NCQ A;  1S05 A;  2UUH A;  3AG3 C;  4JIO A;  2IYL D;  2HV6 A;  3EH1 A;  3O10 A;  3ABM C;  1ZHX A;  4B6I A;  3DE8 A;  5KYU A;  1Y6D A;  3GM3 A;  3NMI A;  4BJ5 C;  2VB6 A;  4MQ9 F;  1TWA A;  1OCR C;  3A9C A;  5KYN A;  1M6T A;  4JTA B;  4NTF A;  4BEJ A;  1D1B A;  3M4B A;  4JZA A;  3LNR A;  4PR9 A;  3LAY A;  3DAF A;  1OR3 A;  1Q0D A;  3SXM A;  3T6J A;  3CAX A;  4QDL A;  4DBQ A;  2HV7 A;  4U9E A;  4XQ1 A;  1IZM A;  1LE4 A;  1RKE B;  4DBR A;  1MND A;  3L8I A;  4BJ6 A;  2XRH A;  4RDA A;  2R7X A;  1H6G A;  3JRM O;  2GA0 A;  2L7A A;  3FAJ A;  4MVQ A;  4ULW A;  3U0C A;  2XL6 A;  3ASO C;  2YRF A;  3C8Z A;  1LI5 A;  2IM8 A;  3HLZ A;  3EFO A;  4P9T A;  5DS4 A;  3LS1 A;  3AJM A;  1T5O A;  2QNL A;  4A4A A;  3IQC A;  2YL3 A;  1Q0G A;  4ULV A;  2P61 A;  1LE2 A;  2LSE A;  3EGD B;  3QZC A;  4K1O A;  4G78 A;  4E0H A;  3EGD A;  4MVZ A;  3T6B A;  1WWP A;  4BPM A;  4EWC A;  2M4E A;  2V3C C;  3BEH A;  1LVK A;  3U3F A;  1Q0F A;  2IXN A;  3DKA A;  5L0G A;  1Q0M A;  2A68 F;  4AK9 A;  1JAF A;  4FAP B;  4KNV A;  3B0P A;  2YL7 A;  1QQ3 A;  5E33 A;  4IB4 A;  1HW1 A;  4YT2 A;  4CSA A;  1K04 A;  4MND A;  3CQZ A;  4Z9H A;  3S27 A;  1JPN A;  1YYJ A;  1RCP A;  2DYS C;  2QY9 A;  2W4M A;  3EGX A;  2PFD A;  1CGN A;  4EBK A;  4MVU A;  3GEH A;  4XEK A;  4QI0 A;  4AL0 A;  1OW6 A;  5K0I A;  2ETS A;  2ZPA A;  3LUT B;  1BR4 A;  4PJN A;  4Q4Z F;  3K66 A;  4MW8 A;  1FNT c;  3UR3 C;  4WGZ A;  1VMA A;  2JPU A;  3M1C B;  3DD7 A;  2KK1 A;  2MWQ A;  2XM0 A;  3AGT A;  2Y69 C;  1YVI A;  2BE5 F;  3F47 A;  3O55 A;  4K0D A;  4P9F A;  1E85 A;  2CNW D;  3DAG A;  1C17 M;  1PD0 A;  3L0I A;  3GWN A;  3EHM A;  3N24 A;  3RW0 A;  4CS8 A;  4XEV A;  3NDB B;  2EIK C;  2KJG A;  1TQG A;  3I4U A;  3W2W A;  2XLD A;  2W9Y A;  3GM1 A;  3K33 A;  3R7C A;  2J7P D;  4O6Y A;  2LIG A;  2OQM A;  2GWW A;  3UNG C;  3E9V A;  2BC5 A;  1Y4C A;  4OIO F;  3C8G A;  3JZ0 A;  2NUT B;  1BDJ B;  3RVZ A;  1ZZP A;  2XM4 A;  1LPE A;  3QW1 A;  4IJJ A;  2YLD A;  3K1I C;  4ONS A;  4OIR F;  1GGQ A;  3IQT A;  3RH3 A;  1I4Y A;  1ORY A;  4DVZ A;  1TWH A;  5L3V A;  4MVR A;  3U3B A;  2A0U A;  3TUL A;  4DOZ A;  1NSG B;  2AP3 A;  2EPM X;  1E2X A;  2HJ3 A;  4EBB A;  1R4T A;  3WAQ A;  3B29 A;  1YLM A;  1M57 C;  4AE4 A;  5DLJ A;  2HSQ A;  2E87 A;  5D92 A;  5KYY A;  4O6N A;  5TJ5 E;  3ECS A;  1ZW2 A;  4J7T A;  4LDQ A;  2DGJ A;  5BQG A;  2HJM A;  4RBN A;  1YJG A;  5B1B C;  2P0N A;  2J45 A;  3ABL C;  2ZXR A;  1A7D A;  1LIH A;  3EZI A;  4KBL A;  2B0J A;  4XPY A;  3T6G B;  3PHF 2;  2A1D D;  3RQE A;  1OXB A;  4MVO A;  3TD7 A;  2WB7 A;  1LS4 A;  3GWL A;  2V26 A;  3OEO A;  4EIY A;  2PF4 E;  4U5G A;  3Q6M A;  4X0R A;  3TJ5 A;  3WG7 C;  2HSB A;  2KQ9 A;  1EI7 A;  1VOM A;  1TWC A;  3SNH A;  4PFO A;  3LEO A;  4G7H F;  1DOW A;  2DI3 A;  1T01 A;  2KC3 A;  4H54 A;  4CJO A;  2ICW G;  1AVO B;  3LLI A;  3FDQ A;  1E86 A;  2VCB A;  2IXP A;  2HZ8 A;  1Z6A A;  4N06 A;  3B71 A;  1CPR A;  3V5X A;  3GEI A;  2LFD A;  3LEV A;  3DJN B;  3M79 A;  1NBB A;  2A6H F;  1G4W R;  3NMK A;  3QW0 A;  4YT5 A;  3QVZ A;  5FCL A;  2ASR A;  2YZS A;  2XXA A;  4JEA A;  1DOV A;  1O5H A;  2L9J A;  3ITF A;  2IXO A;  4N6C A;  1J8Y F;  2GAQ A;  2J9W A;  3H2U A;  2EPO A;  3F46 A;  4Z9I A;  3VM6 A;  4YK5 A;  2OEX A;  2KGO A;  3DM9 B;  5KYU B;  2A0B A;  3DM5 A;  3US6 A;  3AGU A;  3O39 A;  3EPV A;  4R32 A;  1F1M A;  2YLI A;  2A6E F;  3WHN A;  3VYW A;  2X51 A;  3JRT A;  1ST6 A;  2H7O A;  5A6B A;  2R02 A;  5T3T A;  2GDC A;  5JUA A;  4XLN F;  3HJC A;  1QVX A;  1EQ1 A;  1QSP A;  1JMW A;  1D0Y A;  2R03 A;  3S0X A;  2R7Q A;  1SYQ A;  4OD4 A;  4QI2 A;  3CEX A;  2Q9A A;  4N4W A;  4OD5 A;  1LI7 A;  4CJG A;  4D4X A;  4JCH A;  3X1O A;  3JSZ A;  1O3U A;  2FAP B;  1PCX A;  1QPU A;  1GS9 A;  3EQL F;  4MW3 A;  1Z63 A;  1U6H A;  1TKN A;  2EPK X;  2Q9C A;  3EFO B;  1NU9 C;  4MTO A;  2R7R A;  5L0H A;  2EIM C;  1YZA A;  3UMH A;  4C3E A;  1T9K A;  3EJN A;  4JJG A;  3TK0 A;  1RJ9 A;  1T6U A;  2L81 A;  3JCU Q;  2XS8 A;  3AOU A;  3UMK A;  3QVY A;  4JKV A;  5F5H A;  4U5C E;  4Q5S F;  1BR2 A;  4YWQ A;  1MMD A;  2HMZ A;  3TOL A;  2NSG A;  3ZIB A;  4G7Z F;  1T6Q A;  2Y3B A;  1SR2 A;  3NG1 A;  2XL4 A;  2FGY A;  5DS5 A;  2PX0 A;  1LS1 A;  3IEE A;  1QZX A;  1SMY F;  3G4X A;  3GAN A;  3M4C A;  3MYI A;  3O6X A;  4JCZ A;  3W8H A;  3L8J A;  1U0B B;  1OKK A;  4E0I A;  2VH3 A;  3RKO F;  3H65 A;  1FAP B;  1J8M F;  3ZQV A;  3LES A;  4D4N A;  4C7O B;  2AWC A;  3SXK A;  2WVN A;  3UGO A;  3SXZ A;  2R25 A;  2L6H A;  4W8K A;  5EHH A;  4C7O A;  4DRI B;  3J06 A;  2JX0 A;  3EGX B;  1T6I A;  2LP4 A;  1OXK A;  2CGE A;  4JVS A;  3FAP B;  2JD3 A;  2YL1 A;  5T1D B;  1G5Z A;  3FVY A;  2J9B A;  4YN0 B;  3TOM A;  1FFT C;  4LDR A;  4MTG A;  3TJ6 A;  1HW2 A;  3C63 A;  1OKK D;  1V55 C;  5COG A;  4PFP A;  1NFN A;  4O6M A;  5L0J A;  4U5D E;  1D0X A;  4CDY A;  3UGP A;  1ZW3 A;  3T9O A;  5A6K A;  1ORS C;  3G50 A;  3U2M A;  3JYY A;  4EKW A;  1WAT A;  4WGY A;  1APC A;  3HNL A;  3B0U X;  1K40 A;  1ZHW A;  2LQG A;  1MMN A;  2NPU A;  3ZSU A;  1HE1 A;  4XTK A;  2H7B A;  2ZD9 A;  3IPM O;  1C03 A;  3U2L A;  2B0H A;  3K7D A;  3LS0 A;  2EPN A;  4BJ1 A;  5JLI A;  2YHS A;  4CS9 C;  3SEO A;  2OKU A;  4PJL A;  5EK0 A;  1Q0K A;  1G8X A;  2CDQ A;  3GOD A;  3JTL O;  1MMA A;  1ZU5 A;  1TFK B;  3MX3 A;  2KNH A;  3TQO A;  1BR1 A;  2H7V C;  1LKX A;  3C8G B;  2IOQ A;  2CYD A;  5DVW A;  5L0D A;  3R2P A;  2Q4F A;  1H7I A;  1A0B A;  4GEH A;  2LFF A;  2IBF A;  1GQA A;  1OCC C;  2HKV A;  3LNM B;  5KYX A;  2Y39 A;  4HE8 D;  4JC7 A;  4I1M A;  3MBG A;  2WVQ A;  1YAU O;  1OW7 A;  1NLX A;  1Z5Z A;  2EPL X;  4JW1 A;  4MS2 A;  4PJM A;  4BJT A;  4PJJ A;  4E17 A;  2NG1 A;  4JRZ A;  3JYH A;  5CI8 A;  1PV3 A;  2P7V A;  3ASN C;  3PMR A;  1UFB A;  3C8G D;  4AE4 B;  5BQI A;  1H9G A;  1MNE A;  4JTD B;  5JVE A;  3HKK A;  2F22 A;  5KYY B;  2J46 A;  2PNO A;  2MHR A;  2Y3H A;  2YEV A;  3C62 A;  1NZE A;  2RSE B;  1YA7 O;  1E84 A;  5E3A A;  2X0C A;  4E7S A;  1NG1 A;  2EIL C;  3C7J A;  4IAO A;  4U5F E;  1K05 A;  3CSK A;  3LLK A;  3AQC A;  3SXY A;  4BJ5 A;  1D1A A;  1ZHZ A;  2HS5 A;  3EG9 A;  3GM2 A;  3NRH A;  3U8P A;  4F4B A;  2VC9 A;  2EIN C;  1AEP A;  1RKC A;  4EUK B;  2C03 A;  2J0X A;  5F5F A;  4XEF A;  256B A;  5D91 A;  1VB5 A;  5E2Q A;  3JT1 A;  3Q7L A;  4IWB A;  2QE9 A;  3B9Q A;  1CGO A;  2AVK A;  4EBJ A;  3KYJ A;  2GFH A;  2OU6 A;  2ZXP A;  2W4B A;  3Q6N A;  1M2V A;  1VLT A;  5JP7 A;  2L6G A;  2XLE A;  1OR2 A;  4ANJ A;  4XPX A;  2WVO A;  5L0I A;  3HNK A;  3KMI A;  3K1H A;  1YDI A;  5GPG B;  1VYK A;  5T3W A;  2LCH A;  2Q9B A;  3ZTZ A;  5L3Q A;  4XLP F;  4P6I C;  1TFO B;  2A69 F;  2OOC A;  3DJU B;  2XXA B;  4IRU A;  4CS8 C;  4K7B A;  5A6A A;  3RVY A;  4ER9 A;  4U5H A;  1RXQ A;  2BL2 A;  5CI9 A;  2NSF A;  4OIP F;  2R9R B;  4EHP A;  1QKR A;  4I3M A;  4KI2 A;  4OIQ F;  4IAQ A;  4NC3 A;  5A69 A;  2XS1 A;  3KKB A;  4YL1 A;  2PP4 A;  3EHN A;  4M63 A;  3ZG1 A;  1OQC A;  4Z9J A;  2P1A A;  3S29 A;  3S9O A;  4UDV A;  1V74 B;  2LD6 A;  3NYM A;  1KNY A;  3A11 A;  4U9D A;  3SYN A;  1FMW A;  3W4Y A;  3ZTM A;  2MYS A;  1FR0 A;  5DS6 A;  4W8P A;  4YL0 A;  1V4A A;  2CW0 F;  2NUP A;  2UUI A;  3DXJ F;  4WJ0 A;  4DRJ B;  2VAS A;  1H9T A;  1M2O A;  3GEE A;  4HFK B;  2OJE D;  4JUR I;  1VLS A;  2LK4 A;  4CDV A;  1SF8 A;  3UMI A;  5A6B D;  2Z15 A;  2YQY A;  5AC4 A;  1YZC A;  3DE9 A;  4FX5 A;  2RD9 A;  1IW7 F;  3S84 A;  3DWW A;  3L34 A;  1RJ9 B;  2G3K A;  2OCC C;  2YLG A;  3Q7G A;  4A2N B;  3X2Q C;  2QUP A;  2R7V A;  1BBH A;  3MLG A;  3KYI A;  3JSE O;  4HFF B;  3V5Y A;  4CS9 A;  2EIJ C;  3NKE A;  4GQH A;  4AL1 A;  2QTV A;  2WZL A;  3IQ5 A;  3KPH A;  3NYL A;  1HMO A;  1OCZ C;  5FZT A;  1N1C A;  1WOL A;  3U5S A;  1OW8 A;  1Z23 A;  4L6R A;  4CX9 A;  2WL8 A;  1XZQ A;  1YYX A;  1WAS A;  1RKE A;  1WGW A; 
#chains in the Genus database with same CATH homology
 1VLT A;  1WAS A;  4Z9I A;  1JMW A;  4Z9H A;  2LIG A;  1VLS A;  4Z9J A;  3T9O A;  2ASR A;  4H54 A;  3ATP A;  1WAT A;  2D4U A;  1LIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...