1JMWA

Propagating conformational changes over long (and short) distances
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
b'MNQQGFVISNELRQQQSELTSTWDLMLQTRINLARSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methyl-accepting chemotaxis protein II
publication title Propagating conformational changes over long (and short) distances in proteins.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
total genus 50
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2001-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1jmwA00
4Z9HA 1JMWA 2D4UA 1LIHA 3T9OA 2ASRA 2LIGA 1WATA 3ATPA 1VLTA 1WASA 4H54A 4Z9IA 4Z9JA 1VLSA
chains in the Genus database with same CATH superfamily
1QLEC 3L0IA 4ONSA 2XLWA 3QZCA 5DLJA 4EBJA 1SMYF 2KGOA 2L6FA 3PCVA 3AG3C 2P6VA 1MNEA 1D0YA 1V4AA 4YN0B 1H9GA 2OU6A 2XM0A 4IJJA 1E84A 5TJ5E 3DJNB 1OCOC 1CGME 5JSLA 2LFDA 4G7ZF 3UNGC 4UDVA 1VK5A 2LIGA 4JRZA 3RVZA 3SZRA 4ZLCA 4QI0A 3MYFA 1YJGA 4JIOA 2YQYA 1MMGA 1D1BA 3ABKC 3RFYA 3H2VA 1M6TA 2ZPAA 3N0TA 1ZHTA 1J8MF 1EI7A 1LI7A 2R25A 3LAYA 4MTGA 1ZVZA 4KBLA 4OD5A 1Z63A 2XLMA 2KK1A 3L8JA 1TFKB 4IGGA 4CS8A 4DJ9A 3EFOB 4E7SA 5E3AA 4OIPF 2Y69C 3RF3A 2R7SA 3FXHA 2EIJC 4G78A 4KNWA 1JOGA 3U8PA 4RBNA 2KYHA 2OJQA 2Y39A 4KNVA 1Y6DA 1T9KA 2WVQA 4XLNF 5DVWA 1TWHA 4NTFA 1LE4A 4PFOA 4PJLA 3EG9B 4D4NA 3WG7C 1G5ZA 3O55A 4EWCA 4J7TA 4YT2A 2CDQA 5JUAA 1ST6A 3UR3C 1NZEA 4U5EE 1CGNA 2HSQA 1Q0MA 4ULVA 5KYWB 1HE9A 4A4AA 2YVKA 3RYLA 2C04A 3ZC4A 1A0BA 2NSGA 2YLGA 4CSAC 3CQZA 1S05A 4WGZA 4BEJA 2IXOA 2NPUA 1VOMA 1YA9A 3LS1A 4HFFB 3EHMA 4BG0A 3ATPA 4O7GA 1TR2A 1UG7A 2CYDA 2UUIA 3DAFA 4U5FE 4L6RA 4BJ5A 2EPLX 2DGJA 4K7BA 3NKDA 4WJ0A 3TOLA 4YT5A 4YWQA 5B3IA 2HJMA 3MX3A 1G4WR 4IARA 1I4YA 3F47A 1WWPA 2NUPB 1E83A 2P61A 2DI3A 2YLDA 3T6GB 3GWLA 1XWJA 1V54C 4N4WA 3SNHA 4E17A 2X51A 3C8GA 5JS5A 2LP4A 2CW0F 2GAQA 3EGXB 4JVSA 1HMDA 3B0UX 4O6MA 3JT1A 3O39A 2P7VA 3HNKA 1FMWA 1FMVA 4PJMA 2A6EF 2WVOA 4AE4B 2UUHA 1IW7F 3DAGA 2QY9A 1OKKA 1QPUA 1R4TA 1FR0A 4MTOA 3KPHA 2VCAA 3CZ6A 3I5PA 3MBGA 1KNYA 4XWJA 5BQHA 3E9VA 4N6CA 2VH3A 3AJMA 3LEOA 1Z6AA 4G7OF 1YYXA 2WZLA 3LJBA 4KI2A 1PCXA 2PP4A 1OW7A 2HV7A 3OEOA 1AVOB 2D4UA 5T3WA 5T3TA 2D5RB 2P1AA 4LACB 3T6JA 3J06A 3KMIA 3DM9B 2RD9A 3NYJA 1K40A 3JSEO 4NTBA 1YYJA 3UMHA 2A6HF 3GORA 4N06A 1VLTA 4MVSA 4LLCA 1EA8A 3ZQVA 5DS4A 5KYXA 5A6BD 1Y4CA 1I5NA 3I4UA 3NKEA 5AC5A 2GDCA 2R03A 2YL3A 2R9RB 4HE8D 2IYLD 3FHDA 4QDLA 1HY5A 1RJ9B 3FAPB 2W9YA 3L1MA 1BDJB 3QW0A 4MVOA 3VRCA 3RH3A 4Z9IA 1LPEA 2J9UA 4LDKA 2XL8A 4PK4A 2JPUA 5KYUB 1LS1A 4CJGA 1Z5ZA 4MS2A 4MNDA 4EUKB 2I15A 3VYWA 3UMIA 4Q4ZF 2H7BA 4U5GA 4DRJB 1OQCA 1VYKA 1UFBA 3ITFA 1E2XA 1CPRA 3OWTA 5L0CA 3T4RA 4C7OB 3NYMA 3K66A 2PNOA 5B1AC 3DE9A 2R7UA 1TFOB 3V7OA 1WN0A 1Z3IX 2Q4FA 3SXZA 1H9TA 1BR4A 3U2MA 3U5SA 2ZXWC 2R7RA 4CDYA 3R2PA 3IPMO 4NY3A 4P6IC 3NYLA 4PR9A 2Q7RA 5COGA 3QVZA 5E3CA 2WVNA 2M64A 1Z23A 3TK0A 1JR8A 3U9JA 1OW8A 5B3SC 2XLVA 1JPJA 2MHRA 1TQGA 3W8IA 3PDMP 3EPVA 3SXKA 5A6BA 5L0FA 2ZXPA 4A2NB 2IXPA 2PF4E 4J30B 4IAOA 2YZSA 3PHF2 3HTKC 2J7PD 3QVYA 5L3VA 4C3EA 4U5BE 1M2VA 4AK9A 1EKYA 4NTAA 3R7CA 4CX9A 2W4BA 3RIPA 1HE1A 1L3PA 1ZW3A 3LNMB 2EPOA 4FAPB 1YVIA 2V26A 3SXYA 3EZHA 2DB4A 4ZLDA 1D1AA 2R7XA 2IBFA 3TULA 4I44A 2E87A 2IM8A 3LNRA 4F4BA 3N2ZB 1VB5A 4H4KC 2OJED 3IQCA 2WL8A 1OXBA 2YL1A 2JD3A 2WB7A 1M2OA 3M4BA 3O6XA 4BPMA 1T5OA 1I4ZA 1MMDA 5BUOA 3POVA 3W8HA 3S0XA 1B68A 3ECSA 1GGQA 1LVKA 4PACA 1ZHWA 1FAPB 4YT4A 2FAPB 1RKEA 1ZHYA 2EPMX 2EPKX 2FFHA 5KYNA 1H7IA 1OXKA 4WABA 2J0XA 2XSEA 4XEFA 5A6KA 4RDAA 1NLXA 3C18A 3K33A 1O3UA 2LK4A 2ZD9A 3X1OA 2NUTA 4O79A 4CS8C 4IRUA 3NDBB 3DD7A 5CI8A 2L6GA 1RCPA 2NSFA 3C7JA 3RVYA 2ZXOA 3AOUA 4U5DE 5D92A 4CDAA 2ZXRA 4KC9A 2BC5A 1CPQA 2YL7A 4JW1A 3B29A 4DOZA 4XLPF 2L6HA 3RQGA 1NG1A 2MWQA 2H8AA 1T01A 3GEEA 3JYHA 3TD7A 1C03A 1XZQA 2Y3BA 4W8PA 3LLIA 4AL0A 4AL1A 3EH2A 4JEBA 3FDQA 2Y3HA 1RJ9A 2A0UA 3IQTA 3VF0A 3S29A 1QVXA 1JPNA 4AX2A 1NBBA 2QLAA 3KH2A 2DYRC 4U5CE 1NFNA 2VC9A 4MQ9F 3DJUB 1YARO 3KYJA 2Q00A 4XPWA 5JLIA 1Q0KA 4RD9A 3BRJA 2Z15A 3ZIBA 5KYYA 1JMWA 1SZIA 1ZYRF 3ABLC 3EH1A 1D1CA 4BJ5C 5F5HA 2XL6A 3Q6NA 1G8XA 4JCZA 4C7OA 4BJ6C 2OEXA 1OCZC 4YT8A 1O87A 2EPNA 5GPGB 2CGEA 3CSKA 3S9OA 2NG1A 3M15A 2BE5F 4J7YA 3W4YA 1T6IA 2PX3A 3HLZA 3U2LA 4E7ZA 5DS5A 3LS0A 1ZHZA 2B0JA 2J8WA 3LLKA 1RMVA 1ORJA 3RQFA 1A7EA 3ZSUA 1MNDA 2HV6A 3CEXA 4MVUA 3DMDA 3ZWIA 3ZQYA 3CAXA 4YJWA 1QQ3A 2B0HA 1LI5A 2H7OA 1D0ZA 3HJCA 3K1IA 2J45A 4LDRA 3U3FA 2ETSA 2HS5A 2KSFA 4CS7A 2P0NA 3MYIA 2R7WA 4OD4A 2QUPA 4DRIB 3S90A 3K1HA 2CCYA 4CS9C 2J46A 1T6UA 1IZMA 3IQ5A 3W2WA 3GM2A 4BEMJ 3TOMA 1KU2A 3FOOA 2G3VA 1E86A 3JTLO 1HW1A 4XEKA 3DM5A 1N1CA 1WOLA 3JYYA 5COFA 1VMAA 3RW0A 3UMKA 3US6A 3B71A 2EILC 5FCLA 1JRAA 2L7AA 3QW1A 4JJGA 1YLMA 2ASRA 3AG1C 5A6AA 3EFOA 5DQTA 1EQ1A 3U0CA 3NMJA 4IB4A 1GM5A 2L81A 2O9XA 3S27A 3AGUA 3QTHA 1NFOA 3M4CA 5F28E 4JZAA 5T1DB 2G3KA 3DE8A 1U0BB 3AQBA 3HNJA 2CNWD 3G4ZA 2HMZA 3G50A 2AWYA 3JSZA 2PFDA 2XS8A 4FWVA 3V5XA 3ZVRA 3Q7GA 3EG9A 1VYIA 3BEHA 3W2VA 1R5ID 2PBEA 4XQ1A 5B1BC 1APCA 4E0HA 3ZTMA 1LIHA 5L0JA 5KYWA 2XLEA 3JCUQ 3NMIA 5A69A 3KYIA 4PJNA 3ZG1A 1O5HA 2W4MA 2W45A 4Q7CA 3RQEA 1LKXA 5AC4A 1OW6A 2XXAB 3C8GB 1PD0A 2GA0A 4MW8A 5A6JA 4JTAB 1H6GA 3TJ5A 3UGOA 2VASA 1VTMP 2YKZA 2EIKC 3QMKA 4CDVA 4G0HA 4J32B 2QTVA 3S84A 2OEVA 4XPXA 4P9FA 2J9BA 3ASOC 3IHUA 4BJ1A 5L0DA 4Z9JA 3K7DA 4X0RA 2TMVP 1ZW2A 2NUPA 3U8VA 4C3BA 2A0BA 2EINC 5D91A 4OIQF 1AEPA 1TWCA 3T6BA 4JCHA 2J0WA 1WATA 4JE9A 3EJNA 2KC3A 3NRHA 3EGXA 3FMSA 5JP7A 1OR2A 4QI2A 4FESA 1BZ4A 1C02A 1TKNA 4GEHA 4CIHA 3Q7LA 5FZTA 4AE4A 3Q6MA 2H7VC 1Q0GA 2AWCA 1ZU4A 4DRHB 3NMKA 3C8ZA 3O10A 1PD1A 4OIRF 2CNWA 2FGYA 2V3CC 5F5FA 2MYSA 3SXMA 5CI9A 1DOVA 4MW3A 3EGDB 3VAYA 3F46A 3ASNC 4O6YA 4U9EA 5AGFA 4YL1A 3SYNA 5KYXB 1K04A 1FTSA 2HZ8A 2Q9CA 1BBHA 1Q0FA 2YLIA 3FOPA 1ORYA 1L7CA 4PFPA 3A11A 5BQIA 3A9CA 5BQGA 4K0DA 1T6QA 5EHHA 2QE9A 4E0IA 2XLDA 1ZHXA 3HNIA 2RSEB 1JAFA 3H2UA 1TWAA 2KNHA 2OKUA 2OCCC 2YL0A 3C62A 1G4US 2HKVA 4JURI 1LS4A 2J9WA 1FFTC 4WGYA 3WAQA 3IQ6A 3UGPA 4M63A 2OOCA 2J7PA 3C8GD 1M56C 5DQZA 4CIPA 4K1OA 3DKAA 1SYQA 3G4XA 5HV9A 1D0XA 4NCQA 2M4EA 4NC3A 4YK5A 4EKWA 3AGTA 1NU7D 1HMOA 2DYSC 3HNLA 5JRAA 4ER9A 1OKKD 5CIVA 4LERA 3AG2C 4Q5SF 2Q3TA 2X0CA 1NU9C 4MVRA 4CSAA 1WGWA 3K6BA 1ZU5A 3KL4A 2JX0A 2XM4A 5KYUA 3DI5A 3RKOF 2XLOA 2XLHA 1E85A 1NSGB 4MVZA 1M57C 1ORSC 4PJJA 5JVEA 2XRHA 3T9OA 3U3BA 4EBBA 4I1MA 4GYTA 5HSWA 4H54A 1MMAA 1LM3B 2WZGA 4XTKA 4JJFA 4EBKA 1GS9A 1OCCC 2KW3C 2R7VA 4U9DA 3ZTZA 1CGOA 1MQVA 1XZPA 1Z7Qc 3VM6A 1RKCA 5JT4A 3MLGA 1GQAA 1M2VB 5L0IA 1ZZPA 4EIYA 3GODA 2YHSA 2AVKA 3NG1A 2LFFA 3AG4C 4MVMA 4BJ6A 4D4XA 3L34A 4MVQA 4P9TA 5E33A 4IAQA 3V5ZA 2F22A 3GM3A 4OINF 1V74B 3SP1A 2XXAA 2KQ9A 1A41A 4JC7A 3GEIA 3M79A 2LD6A 2ICWG 4DXWA 4CJOA 1BR1A 1QKRA 2HSBA 3WHNA 2HMQA 2IXMA 3M1CB 1A7DA 5COMA 3B0VC 1SR2A 2Q9BA 1DOWA 1RKEB 3JRTA 2A68F 4DBRA 3FAJA 4EHPA 2GWWA 3B9QA 4I1OB 2XS1A 4JTDB 4Z9HA 1BR2A 3ABMC 4XPYA 1QSPA 3FVYA 3K1IC 2PX0A 5K0IA 1WASA 2A1DD 2NUTB 4CS9A 1HW2A 1YAUO 2AP3A 1S7ZA 2R7OA 2C03A 2YEVA 4LDQA 1WTYA 3LESA 4B6IA 2R02A 2R7QA 1A7VA 4BJTA 2R7TA 4ANJA 3GM1A 1SF8A 1YA7O 3KKBA 1TWGA 3DWWA 256BA 1QZXA 2Q9AA 4JEAA 2LCHA 2QNLA 3X2QC 3EGDA 1KTMA 3ZDLA 5EGYA 3C63A 2VB6A 3DXJF 3H65A 2I8BA 2R05A 3GANA 3HKKA 4YL0A 4DBQA 3JZ0A 1F1MA 2IOQA 1W2WA 2YWAA 1Q0DA 2HFIA 3EQLF 4HFKB 5EK0A 4R32A 1YDIA 3DZAA 4I3MA 5L0GA 4N6HA 2OG2A 2WZFA 4YL3A 1J8YF 3GWNA 3JRMO 4E18A 2HJ3A 1U6HA 3OA1A 3U9MA 4G7HF 2A69F 4W8KA 1LE2A 1AUEA 1MMNA 1V55C 2VCCA 4LLEA 5IY5C 3TQOA 3V5YA 3EZIA 1YZAA 2XL4A 5L3QA 1OCRC 1PV3A 2EIMC 2HUJA 3I5QA 4GQHA 4U5HA 2GFHA 4NQFA 1YZCA 4ULWA 1FFHA 5E2QA 2BL2A 4C3DA 5KYYB 2LQGA 1VLSA 2AU5A 4MTFA 3TJ6A 4DVYP 4IWBA 3SEOA 5L0HA 2IXNA 1OR3A 3LUTB 5DS6A 2YRFA 4OIOF 2VCBA 3L8IA 2G62A 3IEEA 3S28A 3AQCA 3MFNA 3PMRA 2L9JA 3N24A 3WODF 4DVZA 4HEAJ 2OQMA 2Y3GA 3E70C 3B0PA 2Y3DA 2J9VA 2KJGA 1RXQA 3LEVA 4JTCB 4O6NA 1FNTc 3GEHA 4JKVA 4XEVA 1K05A 1U89A 3EHNA 1C17M 4CBEA 2LSEA 4FX5A
chains in the Genus database with same CATH topology
4Z9HA 1JMWA 2D4UA 1LIHA 3T9OA 2ASRA 2LIGA 1WATA 3ATPA 1VLTA 1WASA 4H54A 4Z9IA 4Z9JA 1VLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z9H A;  1JMW A;  2D4U A;  1LIH A;  3T9O A;  2ASR A;  2LIG A;  1WAT A;  3ATP A;  1VLT A;  1WAS A;  4H54 A;  4Z9I A;  4Z9J A;  1VLS A; 
#chains in the Genus database with same CATH topology
 1QLE C;  3L0I A;  4ONS A;  2XLW A;  3QZC A;  5DLJ A;  4EBJ A;  1SMY F;  2KGO A;  2L6F A;  3PCV A;  3AG3 C;  2P6V A;  1MNE A;  1D0Y A;  1V4A A;  4YN0 B;  1H9G A;  2OU6 A;  2XM0 A;  4IJJ A;  1E84 A;  5TJ5 E;  3DJN B;  1OCO C;  1CGM E;  5JSL A;  2LFD A;  4G7Z F;  3UNG C;  4UDV A;  1VK5 A;  2LIG A;  4JRZ A;  3RVZ A;  3SZR A;  4ZLC A;  4QI0 A;  3MYF A;  1YJG A;  4JIO A;  2YQY A;  1MMG A;  1D1B A;  3ABK C;  3RFY A;  3H2V A;  1M6T A;  2ZPA A;  3N0T A;  1ZHT A;  1J8M F;  1EI7 A;  1LI7 A;  2R25 A;  3LAY A;  4MTG A;  1ZVZ A;  4KBL A;  4OD5 A;  1Z63 A;  2XLM A;  2KK1 A;  3L8J A;  1TFK B;  4IGG A;  4CS8 A;  4DJ9 A;  3EFO B;  4E7S A;  5E3A A;  4OIP F;  2Y69 C;  3RF3 A;  2R7S A;  3FXH A;  2EIJ C;  4G78 A;  4KNW A;  1JOG A;  3U8P A;  4RBN A;  2KYH A;  2OJQ A;  2Y39 A;  4KNV A;  1Y6D A;  1T9K A;  2WVQ A;  4XLN F;  5DVW A;  1TWH A;  4NTF A;  1LE4 A;  4PFO A;  4PJL A;  3EG9 B;  4D4N A;  3WG7 C;  1G5Z A;  3O55 A;  4EWC A;  4J7T A;  4YT2 A;  2CDQ A;  5JUA A;  1ST6 A;  3UR3 C;  1NZE A;  4U5E E;  1CGN A;  2HSQ A;  1Q0M A;  4ULV A;  5KYW B;  1HE9 A;  4A4A A;  2YVK A;  3RYL A;  2C04 A;  3ZC4 A;  1A0B A;  2NSG A;  2YLG A;  4CSA C;  3CQZ A;  1S05 A;  4WGZ A;  4BEJ A;  2IXO A;  2NPU A;  1VOM A;  1YA9 A;  3LS1 A;  4HFF B;  3EHM A;  4BG0 A;  3ATP A;  4O7G A;  1TR2 A;  1UG7 A;  2CYD A;  2UUI A;  3DAF A;  4U5F E;  4L6R A;  4BJ5 A;  2EPL X;  2DGJ A;  4K7B A;  3NKD A;  4WJ0 A;  3TOL A;  4YT5 A;  4YWQ A;  5B3I A;  2HJM A;  3MX3 A;  1G4W R;  4IAR A;  1I4Y A;  3F47 A;  1WWP A;  2NUP B;  1E83 A;  2P61 A;  2DI3 A;  2YLD A;  3T6G B;  3GWL A;  1XWJ A;  1V54 C;  4N4W A;  3SNH A;  4E17 A;  2X51 A;  3C8G A;  5JS5 A;  2LP4 A;  2CW0 F;  2GAQ A;  3EGX B;  4JVS A;  1HMD A;  3B0U X;  4O6M A;  3JT1 A;  3O39 A;  2P7V A;  3HNK A;  1FMW A;  1FMV A;  4PJM A;  2A6E F;  2WVO A;  4AE4 B;  2UUH A;  1IW7 F;  3DAG A;  2QY9 A;  1OKK A;  1QPU A;  1R4T A;  1FR0 A;  4MTO A;  3KPH A;  2VCA A;  3CZ6 A;  3I5P A;  3MBG A;  1KNY A;  4XWJ A;  5BQH A;  3E9V A;  4N6C A;  2VH3 A;  3AJM A;  3LEO A;  1Z6A A;  4G7O F;  1YYX A;  2WZL A;  3LJB A;  4KI2 A;  1PCX A;  2PP4 A;  1OW7 A;  2HV7 A;  3OEO A;  1AVO B;  2D4U A;  5T3W A;  5T3T A;  2D5R B;  2P1A A;  4LAC B;  3T6J A;  3J06 A;  3KMI A;  3DM9 B;  2RD9 A;  3NYJ A;  1K40 A;  3JSE O;  4NTB A;  1YYJ A;  3UMH A;  2A6H F;  3GOR A;  4N06 A;  1VLT A;  4MVS A;  4LLC A;  1EA8 A;  3ZQV A;  5DS4 A;  5KYX A;  5A6B D;  1Y4C A;  1I5N A;  3I4U A;  3NKE A;  5AC5 A;  2GDC A;  2R03 A;  2YL3 A;  2R9R B;  4HE8 D;  2IYL D;  3FHD A;  4QDL A;  1HY5 A;  1RJ9 B;  3FAP B;  2W9Y A;  3L1M A;  1BDJ B;  3QW0 A;  4MVO A;  3VRC A;  3RH3 A;  4Z9I A;  1LPE A;  2J9U A;  4LDK A;  2XL8 A;  4PK4 A;  2JPU A;  5KYU B;  1LS1 A;  4CJG A;  1Z5Z A;  4MS2 A;  4MND A;  4EUK B;  2I15 A;  3VYW A;  3UMI A;  4Q4Z F;  2H7B A;  4U5G A;  4DRJ B;  1OQC A;  1VYK A;  1UFB A;  3ITF A;  1E2X A;  1CPR A;  3OWT A;  5L0C A;  3T4R A;  4C7O B;  3NYM A;  3K66 A;  2PNO A;  5B1A C;  3DE9 A;  2R7U A;  1TFO B;  3V7O A;  1WN0 A;  1Z3I X;  2Q4F A;  3SXZ A;  1H9T A;  1BR4 A;  3U2M A;  3U5S A;  2ZXW C;  2R7R A;  4CDY A;  3R2P A;  3IPM O;  4NY3 A;  4P6I C;  3NYL A;  4PR9 A;  2Q7R A;  5COG A;  3QVZ A;  5E3C A;  2WVN A;  2M64 A;  1Z23 A;  3TK0 A;  1JR8 A;  3U9J A;  1OW8 A;  5B3S C;  2XLV A;  1JPJ A;  2MHR A;  1TQG A;  3W8I A;  3PDM P;  3EPV A;  3SXK A;  5A6B A;  5L0F A;  2ZXP A;  4A2N B;  2IXP A;  2PF4 E;  4J30 B;  4IAO A;  2YZS A;  3PHF 2;  3HTK C;  2J7P D;  3QVY A;  5L3V A;  4C3E A;  4U5B E;  1M2V A;  4AK9 A;  1EKY A;  4NTA A;  3R7C A;  4CX9 A;  2W4B A;  3RIP A;  1HE1 A;  1L3P A;  1ZW3 A;  3LNM B;  2EPO A;  4FAP B;  1YVI A;  2V26 A;  3SXY A;  3EZH A;  2DB4 A;  4ZLD A;  1D1A A;  2R7X A;  2IBF A;  3TUL A;  4I44 A;  2E87 A;  2IM8 A;  3LNR A;  4F4B A;  3N2Z B;  1VB5 A;  4H4K C;  2OJE D;  3IQC A;  2WL8 A;  1OXB A;  2YL1 A;  2JD3 A;  2WB7 A;  1M2O A;  3M4B A;  3O6X A;  4BPM A;  1T5O A;  1I4Z A;  1MMD A;  5BUO A;  3POV A;  3W8H A;  3S0X A;  1B68 A;  3ECS A;  1GGQ A;  1LVK A;  4PAC A;  1ZHW A;  1FAP B;  4YT4 A;  2FAP B;  1RKE A;  1ZHY A;  2EPM X;  2EPK X;  2FFH A;  5KYN A;  1H7I A;  1OXK A;  4WAB A;  2J0X A;  2XSE A;  4XEF A;  5A6K A;  4RDA A;  1NLX A;  3C18 A;  3K33 A;  1O3U A;  2LK4 A;  2ZD9 A;  3X1O A;  2NUT A;  4O79 A;  4CS8 C;  4IRU A;  3NDB B;  3DD7 A;  5CI8 A;  2L6G A;  1RCP A;  2NSF A;  3C7J A;  3RVY A;  2ZXO A;  3AOU A;  4U5D E;  5D92 A;  4CDA A;  2ZXR A;  4KC9 A;  2BC5 A;  1CPQ A;  2YL7 A;  4JW1 A;  3B29 A;  4DOZ A;  4XLP F;  2L6H A;  3RQG A;  1NG1 A;  2MWQ A;  2H8A A;  1T01 A;  3GEE A;  3JYH A;  3TD7 A;  1C03 A;  1XZQ A;  2Y3B A;  4W8P A;  3LLI A;  4AL0 A;  4AL1 A;  3EH2 A;  4JEB A;  3FDQ A;  2Y3H A;  1RJ9 A;  2A0U A;  3IQT A;  3VF0 A;  3S29 A;  1QVX A;  1JPN A;  4AX2 A;  1NBB A;  2QLA A;  3KH2 A;  2DYR C;  4U5C E;  1NFN A;  2VC9 A;  4MQ9 F;  3DJU B;  1YAR O;  3KYJ A;  2Q00 A;  4XPW A;  5JLI A;  1Q0K A;  4RD9 A;  3BRJ A;  2Z15 A;  3ZIB A;  5KYY A;  1JMW A;  1SZI A;  1ZYR F;  3ABL C;  3EH1 A;  1D1C A;  4BJ5 C;  5F5H A;  2XL6 A;  3Q6N A;  1G8X A;  4JCZ A;  4C7O A;  4BJ6 C;  2OEX A;  1OCZ C;  4YT8 A;  1O87 A;  2EPN A;  5GPG B;  2CGE A;  3CSK A;  3S9O A;  2NG1 A;  3M15 A;  2BE5 F;  4J7Y A;  3W4Y A;  1T6I A;  2PX3 A;  3HLZ A;  3U2L A;  4E7Z A;  5DS5 A;  3LS0 A;  1ZHZ A;  2B0J A;  2J8W A;  3LLK A;  1RMV A;  1ORJ A;  3RQF A;  1A7E A;  3ZSU A;  1MND A;  2HV6 A;  3CEX A;  4MVU A;  3DMD A;  3ZWI A;  3ZQY A;  3CAX A;  4YJW A;  1QQ3 A;  2B0H A;  1LI5 A;  2H7O A;  1D0Z A;  3HJC A;  3K1I A;  2J45 A;  4LDR A;  3U3F A;  2ETS A;  2HS5 A;  2KSF A;  4CS7 A;  2P0N A;  3MYI A;  2R7W A;  4OD4 A;  2QUP A;  4DRI B;  3S90 A;  3K1H A;  2CCY A;  4CS9 C;  2J46 A;  1T6U A;  1IZM A;  3IQ5 A;  3W2W A;  3GM2 A;  4BEM J;  3TOM A;  1KU2 A;  3FOO A;  2G3V A;  1E86 A;  3JTL O;  1HW1 A;  4XEK A;  3DM5 A;  1N1C A;  1WOL A;  3JYY A;  5COF A;  1VMA A;  3RW0 A;  3UMK A;  3US6 A;  3B71 A;  2EIL C;  5FCL A;  1JRA A;  2L7A A;  3QW1 A;  4JJG A;  1YLM A;  2ASR A;  3AG1 C;  5A6A A;  3EFO A;  5DQT A;  1EQ1 A;  3U0C A;  3NMJ A;  4IB4 A;  1GM5 A;  2L81 A;  2O9X A;  3S27 A;  3AGU A;  3QTH A;  1NFO A;  3M4C A;  5F28 E;  4JZA A;  5T1D B;  2G3K A;  3DE8 A;  1U0B B;  3AQB A;  3HNJ A;  2CNW D;  3G4Z A;  2HMZ A;  3G50 A;  2AWY A;  3JSZ A;  2PFD A;  2XS8 A;  4FWV A;  3V5X A;  3ZVR A;  3Q7G A;  3EG9 A;  1VYI A;  3BEH A;  3W2V A;  1R5I D;  2PBE A;  4XQ1 A;  5B1B C;  1APC A;  4E0H A;  3ZTM A;  1LIH A;  5L0J A;  5KYW A;  2XLE A;  3JCU Q;  3NMI A;  5A69 A;  3KYI A;  4PJN A;  3ZG1 A;  1O5H A;  2W4M A;  2W45 A;  4Q7C A;  3RQE A;  1LKX A;  5AC4 A;  1OW6 A;  2XXA B;  3C8G B;  1PD0 A;  2GA0 A;  4MW8 A;  5A6J A;  4JTA B;  1H6G A;  3TJ5 A;  3UGO A;  2VAS A;  1VTM P;  2YKZ A;  2EIK C;  3QMK A;  4CDV A;  4G0H A;  4J32 B;  2QTV A;  3S84 A;  2OEV A;  4XPX A;  4P9F A;  2J9B A;  3ASO C;  3IHU A;  4BJ1 A;  5L0D A;  4Z9J A;  3K7D A;  4X0R A;  2TMV P;  1ZW2 A;  2NUP A;  3U8V A;  4C3B A;  2A0B A;  2EIN C;  5D91 A;  4OIQ F;  1AEP A;  1TWC A;  3T6B A;  4JCH A;  2J0W A;  1WAT A;  4JE9 A;  3EJN A;  2KC3 A;  3NRH A;  3EGX A;  3FMS A;  5JP7 A;  1OR2 A;  4QI2 A;  4FES A;  1BZ4 A;  1C02 A;  1TKN A;  4GEH A;  4CIH A;  3Q7L A;  5FZT A;  4AE4 A;  3Q6M A;  2H7V C;  1Q0G A;  2AWC A;  1ZU4 A;  4DRH B;  3NMK A;  3C8Z A;  3O10 A;  1PD1 A;  4OIR F;  2CNW A;  2FGY A;  2V3C C;  5F5F A;  2MYS A;  3SXM A;  5CI9 A;  1DOV A;  4MW3 A;  3EGD B;  3VAY A;  3F46 A;  3ASN C;  4O6Y A;  4U9E A;  5AGF A;  4YL1 A;  3SYN A;  5KYX B;  1K04 A;  1FTS A;  2HZ8 A;  2Q9C A;  1BBH A;  1Q0F A;  2YLI A;  3FOP A;  1ORY A;  1L7C A;  4PFP A;  3A11 A;  5BQI A;  3A9C A;  5BQG A;  4K0D A;  1T6Q A;  5EHH A;  2QE9 A;  4E0I A;  2XLD A;  1ZHX A;  3HNI A;  2RSE B;  1JAF A;  3H2U A;  1TWA A;  2KNH A;  2OKU A;  2OCC C;  2YL0 A;  3C62 A;  1G4U S;  2HKV A;  4JUR I;  1LS4 A;  2J9W A;  1FFT C;  4WGY A;  3WAQ A;  3IQ6 A;  3UGP A;  4M63 A;  2OOC A;  2J7P A;  3C8G D;  1M56 C;  5DQZ A;  4CIP A;  4K1O A;  3DKA A;  1SYQ A;  3G4X A;  5HV9 A;  1D0X A;  4NCQ A;  2M4E A;  4NC3 A;  4YK5 A;  4EKW A;  3AGT A;  1NU7 D;  1HMO A;  2DYS C;  3HNL A;  5JRA A;  4ER9 A;  1OKK D;  5CIV A;  4LER A;  3AG2 C;  4Q5S F;  2Q3T A;  2X0C A;  1NU9 C;  4MVR A;  4CSA A;  1WGW A;  3K6B A;  1ZU5 A;  3KL4 A;  2JX0 A;  2XM4 A;  5KYU A;  3DI5 A;  3RKO F;  2XLO A;  2XLH A;  1E85 A;  1NSG B;  4MVZ A;  1M57 C;  1ORS C;  4PJJ A;  5JVE A;  2XRH A;  3T9O A;  3U3B A;  4EBB A;  4I1M A;  4GYT A;  5HSW A;  4H54 A;  1MMA A;  1LM3 B;  2WZG A;  4XTK A;  4JJF A;  4EBK A;  1GS9 A;  1OCC C;  2KW3 C;  2R7V A;  4U9D A;  3ZTZ A;  1CGO A;  1MQV A;  1XZP A;  1Z7Q c;  3VM6 A;  1RKC A;  5JT4 A;  3MLG A;  1GQA A;  1M2V B;  5L0I A;  1ZZP A;  4EIY A;  3GOD A;  2YHS A;  2AVK A;  3NG1 A;  2LFF A;  3AG4 C;  4MVM A;  4BJ6 A;  4D4X A;  3L34 A;  4MVQ A;  4P9T A;  5E33 A;  4IAQ A;  3V5Z A;  2F22 A;  3GM3 A;  4OIN F;  1V74 B;  3SP1 A;  2XXA A;  2KQ9 A;  1A41 A;  4JC7 A;  3GEI A;  3M79 A;  2LD6 A;  2ICW G;  4DXW A;  4CJO A;  1BR1 A;  1QKR A;  2HSB A;  3WHN A;  2HMQ A;  2IXM A;  3M1C B;  1A7D A;  5COM A;  3B0V C;  1SR2 A;  2Q9B A;  1DOW A;  1RKE B;  3JRT A;  2A68 F;  4DBR A;  3FAJ A;  4EHP A;  2GWW A;  3B9Q A;  4I1O B;  2XS1 A;  4JTD B;  4Z9H A;  1BR2 A;  3ABM C;  4XPY A;  1QSP A;  3FVY A;  3K1I C;  2PX0 A;  5K0I A;  1WAS A;  2A1D D;  2NUT B;  4CS9 A;  1HW2 A;  1YAU O;  2AP3 A;  1S7Z A;  2R7O A;  2C03 A;  2YEV A;  4LDQ A;  1WTY A;  3LES A;  4B6I A;  2R02 A;  2R7Q A;  1A7V A;  4BJT A;  2R7T A;  4ANJ A;  3GM1 A;  1SF8 A;  1YA7 O;  3KKB A;  1TWG A;  3DWW A;  256B A;  1QZX A;  2Q9A A;  4JEA A;  2LCH A;  2QNL A;  3X2Q C;  3EGD A;  1KTM A;  3ZDL A;  5EGY A;  3C63 A;  2VB6 A;  3DXJ F;  3H65 A;  2I8B A;  2R05 A;  3GAN A;  3HKK A;  4YL0 A;  4DBQ A;  3JZ0 A;  1F1M A;  2IOQ A;  1W2W A;  2YWA A;  1Q0D A;  2HFI A;  3EQL F;  4HFK B;  5EK0 A;  4R32 A;  1YDI A;  3DZA A;  4I3M A;  5L0G A;  4N6H A;  2OG2 A;  2WZF A;  4YL3 A;  1J8Y F;  3GWN A;  3JRM O;  4E18 A;  2HJ3 A;  1U6H A;  3OA1 A;  3U9M A;  4G7H F;  2A69 F;  4W8K A;  1LE2 A;  1AUE A;  1MMN A;  1V55 C;  2VCC A;  4LLE A;  5IY5 C;  3TQO A;  3V5Y A;  3EZI A;  1YZA A;  2XL4 A;  5L3Q A;  1OCR C;  1PV3 A;  2EIM C;  2HUJ A;  3I5Q A;  4GQH A;  4U5H A;  2GFH A;  4NQF A;  1YZC A;  4ULW A;  1FFH A;  5E2Q A;  2BL2 A;  4C3D A;  5KYY B;  2LQG A;  1VLS A;  2AU5 A;  4MTF A;  3TJ6 A;  4DVY P;  4IWB A;  3SEO A;  5L0H A;  2IXN A;  1OR3 A;  3LUT B;  5DS6 A;  2YRF A;  4OIO F;  2VCB A;  3L8I A;  2G62 A;  3IEE A;  3S28 A;  3AQC A;  3MFN A;  3PMR A;  2L9J A;  3N24 A;  3WOD F;  4DVZ A;  4HEA J;  2OQM A;  2Y3G A;  3E70 C;  3B0P A;  2Y3D A;  2J9V A;  2KJG A;  1RXQ A;  3LEV A;  4JTC B;  4O6N A;  1FNT c;  3GEH A;  4JKV A;  4XEV A;  1K05 A;  1U89 A;  3EHN A;  1C17 M;  4CBE A;  2LSE A;  4FX5 A; 
#chains in the Genus database with same CATH homology
 4Z9H A;  1JMW A;  2D4U A;  1LIH A;  3T9O A;  2ASR A;  2LIG A;  1WAT A;  3ATP A;  1VLT A;  1WAS A;  4H54 A;  4Z9I A;  4Z9J A;  1VLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...