1JMWA

Propagating conformational changes over long (and short) distances
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
MNQQGFVISNELRQQQSELTSTWDLMLQTRINLARSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methyl-accepting chemotaxis protein II
publication title Propagating conformational changes over long (and short) distances in proteins.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
total genus 50
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2001-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1jmwA00
1VLTA 3ATPA 1WASA 1JMWA 1VLSA 4Z9HA 4Z9JA 1LIHA 2D4UA 3T9OA 2ASRA 1WATA 4Z9IA 2LIGA 4H54A
chains in the Genus database with same CATH superfamily
1OCRC 3W8HA 4J32B 4MNDA 1Z5ZA 4U5DE 4Z9JA 4MVOA 4WGYA 3U3FA 1WWPA 5A6BA 4IRUA 1CPRA 3RH3A 2OEXA 2A6EF 5L0HA 1I4ZA 2P1AA 1PD0A 2NSGA 4IJJA 3T4RA 3W2VA 2WVNA 4MW3A 4XWJA 5HV9A 2YWAA 4B6IA 1LPEA 2A1DD 2Q9CA 3DD7A 1OQCA 5L0DA 3ZQVA 1E86A 1NZEA 1PD1A 5KYUA 1YARO 2WZFA 2H7BA 3FXHA 1DOWA 5CIVA 3B29A 4BJ5C 4J7YA 5DS4A 3MYIA 1CPQA 2Y3HA 1I4YA 3FHDA 2BL2A 1MNEA 3N24A 4I44A 2CNWD 2O9XA 3GEHA 3IEEA 5A6KA 3I5PA 5L3QA 3LAYA 4JC7A 5AGFA 2HS5A 2AP3A 4PFOA 1OXKA 1UG7A 5JLIA 4JE9A 3T9OA 5DQTA 3CZ6A 4K0DA 5E2QA 4Q5SF 3K6BA 1XZPA 4PR9A 3AG4C 1UFBA 2NUPA 3L8JA 2L6FA 3ATPA 3M4CA 2HMZA 1KNYA 1T6UA 3DAFA 3LS1A 2J0WA 2OEVA 2R7UA 4LDRA 5KYYB 3ASOC 4NTAA 3I4UA 4C3EA 3O39A 1XZQA 1H9TA 1TR2A 3J06A 2CCYA 1LS1A 2AWCA 3NRHA 2Q7RA 5JVEA 1YA7O 2OJQA 4LDQA 4CDYA 2J46A 4D4NA 2I15A 2YL1A 3KPHA 1CGOA 3MYFA 4JRZA 4O6YA 4EWCA 2VCAA 3DM5A 1Z63A 1YZCA 2EINC 3JCUQ 4N4WA 4E18A 3O10A 5KYWA 5L0FA 1AUEA 1BDJB 2UUIA 1YVIA 4MVMA 3K1IA 3X1OA 3ZG1A 2Q4FA 2R7SA 3LJBA 5DLJA 1RXQA 5JP7A 1D0XA 1K05A 1YLMA 1ZU4A 2G62A 3ITFA 1ZHZA 4CBEA 4YL0A 1WASA 3NKDA 1AVOB 4OD4A 2ETSA 4AK9A 4BJ6A 1JAFA 2A69F 3KYIA 4JJFA 3U3BA 2AVKA 2R7RA 3HNLA 4JTCB 5BQGA 3JZ0A 4LLCA 1QKRA 4OD5A 1V74B 1Q0MA 1QPUA 4P9FA 2L6HA 4DVYP 3PDMP 4M63A 1NG1A 2A0UA 1VYIA 5D92A 4L6RA 2W9YA 3DZAA 4MTFA 2D5RB 1TWCA 2J7PD 3A11A 4DJ9A 5L0IA 1JPNA 1M2VB 5B1BC 3IHUA 2J9UA 2ZXWC 3EFOA 2C03A 3KMIA 3V5XA 1FMVA 2KGOA 2YZSA 3UMHA 4U5FE 3SP1A 1MMAA 1MMDA 3QVYA 1C03A 256BA 4KI2A 3T6JA 1NLXA 3K66A 4HFKB 1ORSC 1LVKA 3Q6MA 4ZLCA 2ZXPA 1OW8A 2BE5F 1IZMA 4E7ZA 1RCPA 4H4KC 1W2WA 1H6GA 1ZHWA 2EIKC 5COGA 1G4WR 1MQVA 5EHHA 2EPNA 2GWWA 2VB6A 2YL3A 3DWWA 2IOQA 4IARA 1LE2A 4ULWA 3JRTA 4XPYA 4YK5A 1YZAA 1Q0GA 4JTAB 3VM6A 2JPUA 1Q0DA 2LSEA 3WAQA 2WVOA 4HEAJ 3M1CB 2Q00A 1G4US 2EPLX 3M4BA 1OCCC 1R5ID 1K40A 2XSEA 2I8BA 4P6IC 4EUKB 2ZXOA 3GEEA 2MYSA 4NQFA 3TOLA 1WATA 1ZYRF 1V4AA 3GWLA 2H7VC 1B68A 4H54A 4JJGA 3RF3A 4XPXA 1O87A 2DGJA 4KC9A 1WOLA 2RD9A 1BR4A 2QY9A 1OKKA 3ASNC 3EH2A 1RKEA 4LDKA 2FGYA 1ZW3A 5KYUB 1SR2A 2J9WA 3WODF 4CS8A 2XXAA 2QTVA 4IGGA 5JUAA 2KK1A 4QI2A 3EGDB 2LIGA 2PP4A 5BQIA 3G50A 3BRJA 3HLZA 3JTLO 1BBHA 1Z23A 4JIOA 1HW2A 4NY3A 3CAXA 4EBKA 2ICWG 1BZ4A 1NBBA 2FAPB 2HSBA 4U9EA 4YJWA 1T6QA 2Y69C 1OCZC 1LE4A 3ABLC 5EK0A 1Z7Qc 2YLGA 1NU7D 3DKAA 1G8XA 3LUTB 3Q7GA 1LIHA 3KH2A 2L9JA 2V26A 4K1OA 3C62A 2A0BA 4FX5A 4PJJA 4J7TA 2ZD9A 4BEMJ 4E0HA 4YT8A 3TULA 3DMDA 3FOOA 4JW1A 4ER9A 2P7VA 1VMAA 3R2PA 4JCZA 4EBJA 1R4TA 2IXMA 1JOGA 2XS8A 4JKVA 1JRAA 1KTMA 1MMGA 4FAPB 3HNIA 5GPGB 2WB7A 3B9QA 4MVQA 5KYWB 3WHNA 2CNWA 1YDIA 3E70C 3EGDA 1ORYA 1VLSA 3B71A 1LI5A 1LI7A 1SYQA 3VYWA 3CEXA 4W8KA 2JX0A 3EG9A 3FMSA 2XLHA 4ULVA 2NUTB 3B0UX 1FR0A 4EKWA 3NMKA 3HNJA 3L1MA 1WTYA 3IPMO 4I1OB 4LERA 3UNGC 4CS9C 1E85A 1PV3A 4X0RA 5F28E 2J9BA 2OKUA 2Y3DA 3T6BA 4PJLA 1ZHYA 3ZC4A 1JMWA 1LM3B 3JRMO 4NC3A 2P61A 3E9VA 4PACA 5F5HA 1L3PA 3ZTZA 1YYJA 5L0JA 5B3IA 4IWBA 2TMVP 5B1AC 2QUPA 2DYSC 2IXPA 2ZXRA 2UUHA 3C8GD 3EFOB 1RKCA 1BR2A 2J0XA 1ZHTA 2R9RB 2YL0A 4MVSA 2HUJA 4Q4ZF 2HSQA 1RJ9A 1YJGA 1Y6DA 2G3VA 3OWTA 4ONSA 3EZIA 1BR1A 4AL0A 3QVZA 4P9TA 5KYXA 1D0YA 2XL6A 1M2OA 3C63A 3LLIA 1RMVA 3RIPA 1ZU5A 2EPMX 3NMJA 3C18A 3DE9A 3DJNB 2XS1A 1AEPA 2KQ9A 4WGZA 2F22A 3RYLA 3MLGA 3DI5A 2IXNA 2XLOA 3H65A 4I3MA 2HKVA 4CSAA 1ZHXA 2EIJC 3LS0A 3RVYA 4U5HA 1GGQA 2XLDA 1TKNA 3G4XA 3AGUA 1D1CA 2J8WA 4CJOA 5HSWA 3FAJA 3FOPA 2NUTA 2MWQA 3CQZA 2EPOA 3OEOA 5JS5A 4YWQA 2IBFA 3UMKA 5AC5A 5AC4A 1U0BB 4G7HF 3O6XA 5JSLA 2YHSA 3ZVRA 2GAQA 1S7ZA 2YRFA 3KKBA 4MW8A 2J7PA 1VYKA 4RD9A 1J8MF 4AL1A 4CDAA 1E84A 5T1DB 3PCVA 5BQHA 1VLTA 3A9CA 2XLMA 2ZPAA 3U8VA 1FFTC 1YYXA 1NU9C 1RKEB 1O3UA 4BJ5A 4OIOF 2B0HA 4MVUA 2EILC 3W4YA 2R7OA 1YA9A 2HJMA 2Z15A 4N6HA 1OR3A 2H8AA 2XXAB 3HKKA 2NG1A 3RQGA 3B0PA 1HW1A 3K33A 4OIRF 4E7SA 3UGOA 1VB5A 1GM5A 1T9KA 3ZTMA 1WN0A 3L8IA 3TQOA 3VRCA 1TFOB 1T6IA 1A7EA 4FWVA 3V7OA 4GYTA 5D91A 3ZIBA 3LNRA 4QDLA 2OU6A 3K1HA 1G5ZA 3U2MA 2HZ8A 1EKYA 3UMIA 4O6MA 4RBNA 3NMIA 3KYJA 4JVSA 2Y39A 3AOUA 2LQGA 3IQ5A 4JZAA 3V5ZA 5EGYA 4E17A 2R02A 2KJGA 3W2WA 1K04A 4LACB 4CIPA 1TWAA 2AWYA 4U5BE 2HV6A 1OW6A 1N1CA 2M4EA 3Q7LA 1C02A 1Q0FA 4EHPA 1CGNA 3LESA 4FESA 4CDVA 5JRAA 2R7VA 3Q6NA 3HJCA 3EPVA 3VF0A 1T01A 2KC3A 2M64A 3N2ZB 4N6CA 4OIQF 4NCQA 1DOVA 3POVA 2NPUA 2PX0A 5FCLA 4ANJA 2X0CA 1SZIA 3CSKA 3U9MA 3ZSUA 4YL1A 4MTOA 3NYJA 3NYMA 4JURI 3ZQYA 1HMDA 5L3VA 4G7OF 4D4XA 2L7AA 3EG9B 3MFNA 1L7CA 4I1MA 4XEVA 5DQZA 2YQYA 4JEBA 2A6HF 5DS5A 3SXZA 4G78A 3W8IA 1I5NA 3EHNA 3SZRA 1C17M 2R05A 3U0CA 1WGWA 4XLNF 1U6HA 3F47A 1TWHA 2W45A 4IAOA 2KYHA 2Q3TA 5COFA 4K7BA 4EBBA 1VOMA 1CGME 1FFHA 4MVZA 1Y4CA 2DB4A 2LK4A 2LP4A 4BEJA 3C7JA 3QW1A 4YT4A 2PX3A 2XRHA 2CYDA 3EHMA 1VK5A 5B3SC 2YVKA 4DXWA 2OJED 3UR3C 1RJ9B 2ASRA 3U5SA 4DBRA 2VCCA 4QI0A 4XPWA 2CGEA 3S0XA 5KYXB 3PHF2 4MVRA 4O79A 4JTDB 3NYLA 3C8ZA 3RFYA 3SXMA 2LFFA 4DRJB 3FDQA 1D1BA 2R25A 3U8PA 3VAYA 2HV7A 1ORJA 5CI8A 1GS9A 1ZVZA 2XLVA 3L34A 3K1IC 3RW0A 1NSGB 4KBLA 4Z9HA 1Z3IX 2L81A 4E0IA 3JYYA 3AQCA 1QVXA 3QTHA 4CIHA 1OXBA 2VC9A 2YL7A 3UGPA 5A69A 4BJ6C 1O5HA 2IM8A 5E3CA 5JT4A 4KNWA 3RQEA 1TQGA 1GQAA 2EPKX 2QE9A 3MBGA 1ZW2A 2P0NA 3NKEA 5E3AA 3S28A 5A6BD 1JPJA 1A0BA 4DRHB 5L0GA 2KW3C 4O7GA 1V54C 2XLEA 4XTKA 2WZGA 2LD6A 2PNOA 4U9DA 4YL3A 4G7ZF 4GQHA 1QZXA 2RSEB 1FMWA 3S27A 4C7OA 5DVWA 2GA0A 3EQLF 3C8GA 1J8YF 3EGXA 3JSZA 3JT1A 1HY5A 4YT2A 1FTSA 2J45A 2XM0A 4Q7CA 3H2UA 3ZWIA 3H2VA 3X2QC 3ABKC 3WG7C 2G3KA 1Q0KA 4XQ1A 2YEVA 1HE9A 1M56C 3QZCA 2W4BA 4N06A 3DJUB 1ST6A 3GM1A 1E83A 2MHRA 3ABMC 1APCA 2QLAA 4DBQA 2XM4A 2YKZA 2R7XA 2IXOA 4XEKA 2AU5A 4AX2A 5K0IA 5L0CA 2VCBA 4C3BA 3RQFA 4PFPA 1KU2A 2XL8A 1OCOC 3IQCA 2JD3A 3AG1C 4F4BA 2A68F 2KSFA 1NFNA 3TJ5A 3EJNA 3M15A 4XEFA 3GM3A 5TJ5E 2WL8A 2E87A 4BG0A 4UDVA 3RVZA 3MX3A 1QSPA 2CW0F 2DI3A 1NFOA 1FAPB 4U5CE 4U5GA 3T6GB 3QMKA 4BJ1A 3PMRA 2XL4A 1D1AA 2LCHA 3FVYA 3IQTA 3V5YA 1S05A 2WZLA 3LEOA 3ZDLA 3U9JA 2Q9AA 1VTMP 3NDBB 5IY5C 2L6GA 2HMQA 4CS8C 1EQ1A 3GEIA 1HE1A 2Q9BA 1H7IA 3BEHA 3EH1A 1LS4A 3OA1A 3TJ6A 3N0TA 4BPMA 3JYHA 3GODA 4LLEA 3SEOA 2HFIA 4JEAA 4IB4A 1LKXA 5E33A 5A6JA 1QLEC 1PCXA 3AQBA 1MMNA 4CS9A 3DE8A 4YT5A 3RKOF 4C3DA 4U5EE 5FZTA 4DRIB 3LNMB 3AG2C 3U2LA 3HTKC 3R7CA 2B0JA 4AE4B 1A41A 1QQ3A 3TOMA 3SXYA 2R7WA 3LLKA 4GEHA 5T3TA 3NG1A 4DOZA 5KYYA 1Z6AA 3ECSA 3FAPB 5A6AA 1OW7A 5F5FA 3S90A 5COMA 1A7DA 2H7OA 4MTGA 4NTFA 4PJMA 4J30B 3SXKA 1M6TA 2W4MA 2YLDA 1U89A 1SMYF 3DM9B 3S29A 3US6A 1E2XA 4ZLDA 3GM2A 4A2NB 1YAUO 1ZZPA 2VASA 3M79A 5KYNA 4IAQA 4WABA 2PF4E 4W8PA 2YLIA 3QW0A 5BUOA 4KNVA 4BJTA 1SF8A 4CJGA 2IYLD 1TWGA 1A7VA 4HE8D 1XWJA 2KNHA 1TFKB 2CDQA 2R7QA 3GANA 1H9GA 2HJ3A 2OQMA 3AGTA 1MNDA 3SNHA 3SYNA 3S9OA 4NTBA 2XLWA 4PJNA 2WVQA 4EIYA 4MQ9F 2R03A 2X51A 3HNKA 2OCCC 1F1MA 3IQ6A 4OINF 4A4AA 4AE4A 3B0VC 2EIMC 3GWNA 3DXJF 5T3WA 4OIPF 3EZHA 1M2VA 4HFFB 1M57C 1HMOA 4WJ0A 3AJMA 2GFHA 3TK0A 3G4ZA 2NSFA 1EI7A 3L0IA 2OOCA 4MS2A 4C7OB 1OKKD 1T5OA 4O6NA 4Z9IA 2R7TA 3AG3C 2PBEA 3C8GB 4JCHA 2BC5A 2VH3A 2Y3GA 3EGXB 3K7DA 3KL4A 4YN0B 4CS7A 4CX9A 3JSEO 3DAGA 1IW7F 3I5QA 3S84A 2DYRC 4XLPF 5CI9A 1FNTc 2PFDA 2QNLA 2OG2A 4DVZA 1V55C 2GDCA 3TD7A 2C04A 1OR2A 2D4UA 2LFDA 2J9VA 3F46A 2P6VA 2Y3BA 1EA8A 2FFHA 1D0ZA 1JR8A 4PK4A 4R32A 4CSAC 3O55A 4RDAA 2NUPB 3GORA 4G0HA 5DS6A 2V3CC 3LEVA
chains in the Genus database with same CATH topology
1VLTA 3ATPA 1WASA 1JMWA 1VLSA 4Z9HA 4Z9JA 1LIHA 2D4UA 3T9OA 2ASRA 1WATA 4Z9IA 2LIGA 4H54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLT A;  3ATP A;  1WAS A;  1JMW A;  1VLS A;  4Z9H A;  4Z9J A;  1LIH A;  2D4U A;  3T9O A;  2ASR A;  1WAT A;  4Z9I A;  2LIG A;  4H54 A; 
#chains in the Genus database with same CATH topology
 1OCR C;  3W8H A;  4J32 B;  4MND A;  1Z5Z A;  4U5D E;  4Z9J A;  4MVO A;  4WGY A;  3U3F A;  1WWP A;  5A6B A;  4IRU A;  1CPR A;  3RH3 A;  2OEX A;  2A6E F;  5L0H A;  1I4Z A;  2P1A A;  1PD0 A;  2NSG A;  4IJJ A;  3T4R A;  3W2V A;  2WVN A;  4MW3 A;  4XWJ A;  5HV9 A;  2YWA A;  4B6I A;  1LPE A;  2A1D D;  2Q9C A;  3DD7 A;  1OQC A;  5L0D A;  3ZQV A;  1E86 A;  1NZE A;  1PD1 A;  5KYU A;  1YAR O;  2WZF A;  2H7B A;  3FXH A;  1DOW A;  5CIV A;  3B29 A;  4BJ5 C;  4J7Y A;  5DS4 A;  3MYI A;  1CPQ A;  2Y3H A;  1I4Y A;  3FHD A;  2BL2 A;  1MNE A;  3N24 A;  4I44 A;  2CNW D;  2O9X A;  3GEH A;  3IEE A;  5A6K A;  3I5P A;  5L3Q A;  3LAY A;  4JC7 A;  5AGF A;  2HS5 A;  2AP3 A;  4PFO A;  1OXK A;  1UG7 A;  5JLI A;  4JE9 A;  3T9O A;  5DQT A;  3CZ6 A;  4K0D A;  5E2Q A;  4Q5S F;  3K6B A;  1XZP A;  4PR9 A;  3AG4 C;  1UFB A;  2NUP A;  3L8J A;  2L6F A;  3ATP A;  3M4C A;  2HMZ A;  1KNY A;  1T6U A;  3DAF A;  3LS1 A;  2J0W A;  2OEV A;  2R7U A;  4LDR A;  5KYY B;  3ASO C;  4NTA A;  3I4U A;  4C3E A;  3O39 A;  1XZQ A;  1H9T A;  1TR2 A;  3J06 A;  2CCY A;  1LS1 A;  2AWC A;  3NRH A;  2Q7R A;  5JVE A;  1YA7 O;  2OJQ A;  4LDQ A;  4CDY A;  2J46 A;  4D4N A;  2I15 A;  2YL1 A;  3KPH A;  1CGO A;  3MYF A;  4JRZ A;  4O6Y A;  4EWC A;  2VCA A;  3DM5 A;  1Z63 A;  1YZC A;  2EIN C;  3JCU Q;  4N4W A;  4E18 A;  3O10 A;  5KYW A;  5L0F A;  1AUE A;  1BDJ B;  2UUI A;  1YVI A;  4MVM A;  3K1I A;  3X1O A;  3ZG1 A;  2Q4F A;  2R7S A;  3LJB A;  5DLJ A;  1RXQ A;  5JP7 A;  1D0X A;  1K05 A;  1YLM A;  1ZU4 A;  2G62 A;  3ITF A;  1ZHZ A;  4CBE A;  4YL0 A;  1WAS A;  3NKD A;  1AVO B;  4OD4 A;  2ETS A;  4AK9 A;  4BJ6 A;  1JAF A;  2A69 F;  3KYI A;  4JJF A;  3U3B A;  2AVK A;  2R7R A;  3HNL A;  4JTC B;  5BQG A;  3JZ0 A;  4LLC A;  1QKR A;  4OD5 A;  1V74 B;  1Q0M A;  1QPU A;  4P9F A;  2L6H A;  4DVY P;  3PDM P;  4M63 A;  1NG1 A;  2A0U A;  1VYI A;  5D92 A;  4L6R A;  2W9Y A;  3DZA A;  4MTF A;  2D5R B;  1TWC A;  2J7P D;  3A11 A;  4DJ9 A;  5L0I A;  1JPN A;  1M2V B;  5B1B C;  3IHU A;  2J9U A;  2ZXW C;  3EFO A;  2C03 A;  3KMI A;  3V5X A;  1FMV A;  2KGO A;  2YZS A;  3UMH A;  4U5F E;  3SP1 A;  1MMA A;  1MMD A;  3QVY A;  1C03 A;  256B A;  4KI2 A;  3T6J A;  1NLX A;  3K66 A;  4HFK B;  1ORS C;  1LVK A;  3Q6M A;  4ZLC A;  2ZXP A;  1OW8 A;  2BE5 F;  1IZM A;  4E7Z A;  1RCP A;  4H4K C;  1W2W A;  1H6G A;  1ZHW A;  2EIK C;  5COG A;  1G4W R;  1MQV A;  5EHH A;  2EPN A;  2GWW A;  2VB6 A;  2YL3 A;  3DWW A;  2IOQ A;  4IAR A;  1LE2 A;  4ULW A;  3JRT A;  4XPY A;  4YK5 A;  1YZA A;  1Q0G A;  4JTA B;  3VM6 A;  2JPU A;  1Q0D A;  2LSE A;  3WAQ A;  2WVO A;  4HEA J;  3M1C B;  2Q00 A;  1G4U S;  2EPL X;  3M4B A;  1OCC C;  1R5I D;  1K40 A;  2XSE A;  2I8B A;  4P6I C;  4EUK B;  2ZXO A;  3GEE A;  2MYS A;  4NQF A;  3TOL A;  1WAT A;  1ZYR F;  1V4A A;  3GWL A;  2H7V C;  1B68 A;  4H54 A;  4JJG A;  3RF3 A;  4XPX A;  1O87 A;  2DGJ A;  4KC9 A;  1WOL A;  2RD9 A;  1BR4 A;  2QY9 A;  1OKK A;  3ASN C;  3EH2 A;  1RKE A;  4LDK A;  2FGY A;  1ZW3 A;  5KYU B;  1SR2 A;  2J9W A;  3WOD F;  4CS8 A;  2XXA A;  2QTV A;  4IGG A;  5JUA A;  2KK1 A;  4QI2 A;  3EGD B;  2LIG A;  2PP4 A;  5BQI A;  3G50 A;  3BRJ A;  3HLZ A;  3JTL O;  1BBH A;  1Z23 A;  4JIO A;  1HW2 A;  4NY3 A;  3CAX A;  4EBK A;  2ICW G;  1BZ4 A;  1NBB A;  2FAP B;  2HSB A;  4U9E A;  4YJW A;  1T6Q A;  2Y69 C;  1OCZ C;  1LE4 A;  3ABL C;  5EK0 A;  1Z7Q c;  2YLG A;  1NU7 D;  3DKA A;  1G8X A;  3LUT B;  3Q7G A;  1LIH A;  3KH2 A;  2L9J A;  2V26 A;  4K1O A;  3C62 A;  2A0B A;  4FX5 A;  4PJJ A;  4J7T A;  2ZD9 A;  4BEM J;  4E0H A;  4YT8 A;  3TUL A;  3DMD A;  3FOO A;  4JW1 A;  4ER9 A;  2P7V A;  1VMA A;  3R2P A;  4JCZ A;  4EBJ A;  1R4T A;  2IXM A;  1JOG A;  2XS8 A;  4JKV A;  1JRA A;  1KTM A;  1MMG A;  4FAP B;  3HNI A;  5GPG B;  2WB7 A;  3B9Q A;  4MVQ A;  5KYW B;  3WHN A;  2CNW A;  1YDI A;  3E70 C;  3EGD A;  1ORY A;  1VLS A;  3B71 A;  1LI5 A;  1LI7 A;  1SYQ A;  3VYW A;  3CEX A;  4W8K A;  2JX0 A;  3EG9 A;  3FMS A;  2XLH A;  4ULV A;  2NUT B;  3B0U X;  1FR0 A;  4EKW A;  3NMK A;  3HNJ A;  3L1M A;  1WTY A;  3IPM O;  4I1O B;  4LER A;  3UNG C;  4CS9 C;  1E85 A;  1PV3 A;  4X0R A;  5F28 E;  2J9B A;  2OKU A;  2Y3D A;  3T6B A;  4PJL A;  1ZHY A;  3ZC4 A;  1JMW A;  1LM3 B;  3JRM O;  4NC3 A;  2P61 A;  3E9V A;  4PAC A;  5F5H A;  1L3P A;  3ZTZ A;  1YYJ A;  5L0J A;  5B3I A;  4IWB A;  2TMV P;  5B1A C;  2QUP A;  2DYS C;  2IXP A;  2ZXR A;  2UUH A;  3C8G D;  3EFO B;  1RKC A;  1BR2 A;  2J0X A;  1ZHT A;  2R9R B;  2YL0 A;  4MVS A;  2HUJ A;  4Q4Z F;  2HSQ A;  1RJ9 A;  1YJG A;  1Y6D A;  2G3V A;  3OWT A;  4ONS A;  3EZI A;  1BR1 A;  4AL0 A;  3QVZ A;  4P9T A;  5KYX A;  1D0Y A;  2XL6 A;  1M2O A;  3C63 A;  3LLI A;  1RMV A;  3RIP A;  1ZU5 A;  2EPM X;  3NMJ A;  3C18 A;  3DE9 A;  3DJN B;  2XS1 A;  1AEP A;  2KQ9 A;  4WGZ A;  2F22 A;  3RYL A;  3MLG A;  3DI5 A;  2IXN A;  2XLO A;  3H65 A;  4I3M A;  2HKV A;  4CSA A;  1ZHX A;  2EIJ C;  3LS0 A;  3RVY A;  4U5H A;  1GGQ A;  2XLD A;  1TKN A;  3G4X A;  3AGU A;  1D1C A;  2J8W A;  4CJO A;  5HSW A;  3FAJ A;  3FOP A;  2NUT A;  2MWQ A;  3CQZ A;  2EPO A;  3OEO A;  5JS5 A;  4YWQ A;  2IBF A;  3UMK A;  5AC5 A;  5AC4 A;  1U0B B;  4G7H F;  3O6X A;  5JSL A;  2YHS A;  3ZVR A;  2GAQ A;  1S7Z A;  2YRF A;  3KKB A;  4MW8 A;  2J7P A;  1VYK A;  4RD9 A;  1J8M F;  4AL1 A;  4CDA A;  1E84 A;  5T1D B;  3PCV A;  5BQH A;  1VLT A;  3A9C A;  2XLM A;  2ZPA A;  3U8V A;  1FFT C;  1YYX A;  1NU9 C;  1RKE B;  1O3U A;  4BJ5 A;  4OIO F;  2B0H A;  4MVU A;  2EIL C;  3W4Y A;  2R7O A;  1YA9 A;  2HJM A;  2Z15 A;  4N6H A;  1OR3 A;  2H8A A;  2XXA B;  3HKK A;  2NG1 A;  3RQG A;  3B0P A;  1HW1 A;  3K33 A;  4OIR F;  4E7S A;  3UGO A;  1VB5 A;  1GM5 A;  1T9K A;  3ZTM A;  1WN0 A;  3L8I A;  3TQO A;  3VRC A;  1TFO B;  1T6I A;  1A7E A;  4FWV A;  3V7O A;  4GYT A;  5D91 A;  3ZIB A;  3LNR A;  4QDL A;  2OU6 A;  3K1H A;  1G5Z A;  3U2M A;  2HZ8 A;  1EKY A;  3UMI A;  4O6M A;  4RBN A;  3NMI A;  3KYJ A;  4JVS A;  2Y39 A;  3AOU A;  2LQG A;  3IQ5 A;  4JZA A;  3V5Z A;  5EGY A;  4E17 A;  2R02 A;  2KJG A;  3W2W A;  1K04 A;  4LAC B;  4CIP A;  1TWA A;  2AWY A;  4U5B E;  2HV6 A;  1OW6 A;  1N1C A;  2M4E A;  3Q7L A;  1C02 A;  1Q0F A;  4EHP A;  1CGN A;  3LES A;  4FES A;  4CDV A;  5JRA A;  2R7V A;  3Q6N A;  3HJC A;  3EPV A;  3VF0 A;  1T01 A;  2KC3 A;  2M64 A;  3N2Z B;  4N6C A;  4OIQ F;  4NCQ A;  1DOV A;  3POV A;  2NPU A;  2PX0 A;  5FCL A;  4ANJ A;  2X0C A;  1SZI A;  3CSK A;  3U9M A;  3ZSU A;  4YL1 A;  4MTO A;  3NYJ A;  3NYM A;  4JUR I;  3ZQY A;  1HMD A;  5L3V A;  4G7O F;  4D4X A;  2L7A A;  3EG9 B;  3MFN A;  1L7C A;  4I1M A;  4XEV A;  5DQZ A;  2YQY A;  4JEB A;  2A6H F;  5DS5 A;  3SXZ A;  4G78 A;  3W8I A;  1I5N A;  3EHN A;  3SZR A;  1C17 M;  2R05 A;  3U0C A;  1WGW A;  4XLN F;  1U6H A;  3F47 A;  1TWH A;  2W45 A;  4IAO A;  2KYH A;  2Q3T A;  5COF A;  4K7B A;  4EBB A;  1VOM A;  1CGM E;  1FFH A;  4MVZ A;  1Y4C A;  2DB4 A;  2LK4 A;  2LP4 A;  4BEJ A;  3C7J A;  3QW1 A;  4YT4 A;  2PX3 A;  2XRH A;  2CYD A;  3EHM A;  1VK5 A;  5B3S C;  2YVK A;  4DXW A;  2OJE D;  3UR3 C;  1RJ9 B;  2ASR A;  3U5S A;  4DBR A;  2VCC A;  4QI0 A;  4XPW A;  2CGE A;  3S0X A;  5KYX B;  3PHF 2;  4MVR A;  4O79 A;  4JTD B;  3NYL A;  3C8Z A;  3RFY A;  3SXM A;  2LFF A;  4DRJ B;  3FDQ A;  1D1B A;  2R25 A;  3U8P A;  3VAY A;  2HV7 A;  1ORJ A;  5CI8 A;  1GS9 A;  1ZVZ A;  2XLV A;  3L34 A;  3K1I C;  3RW0 A;  1NSG B;  4KBL A;  4Z9H A;  1Z3I X;  2L81 A;  4E0I A;  3JYY A;  3AQC A;  1QVX A;  3QTH A;  4CIH A;  1OXB A;  2VC9 A;  2YL7 A;  3UGP A;  5A69 A;  4BJ6 C;  1O5H A;  2IM8 A;  5E3C A;  5JT4 A;  4KNW A;  3RQE A;  1TQG A;  1GQA A;  2EPK X;  2QE9 A;  3MBG A;  1ZW2 A;  2P0N A;  3NKE A;  5E3A A;  3S28 A;  5A6B D;  1JPJ A;  1A0B A;  4DRH B;  5L0G A;  2KW3 C;  4O7G A;  1V54 C;  2XLE A;  4XTK A;  2WZG A;  2LD6 A;  2PNO A;  4U9D A;  4YL3 A;  4G7Z F;  4GQH A;  1QZX A;  2RSE B;  1FMW A;  3S27 A;  4C7O A;  5DVW A;  2GA0 A;  3EQL F;  3C8G A;  1J8Y F;  3EGX A;  3JSZ A;  3JT1 A;  1HY5 A;  4YT2 A;  1FTS A;  2J45 A;  2XM0 A;  4Q7C A;  3H2U A;  3ZWI A;  3H2V A;  3X2Q C;  3ABK C;  3WG7 C;  2G3K A;  1Q0K A;  4XQ1 A;  2YEV A;  1HE9 A;  1M56 C;  3QZC A;  2W4B A;  4N06 A;  3DJU B;  1ST6 A;  3GM1 A;  1E83 A;  2MHR A;  3ABM C;  1APC A;  2QLA A;  4DBQ A;  2XM4 A;  2YKZ A;  2R7X A;  2IXO A;  4XEK A;  2AU5 A;  4AX2 A;  5K0I A;  5L0C A;  2VCB A;  4C3B A;  3RQF A;  4PFP A;  1KU2 A;  2XL8 A;  1OCO C;  3IQC A;  2JD3 A;  3AG1 C;  4F4B A;  2A68 F;  2KSF A;  1NFN A;  3TJ5 A;  3EJN A;  3M15 A;  4XEF A;  3GM3 A;  5TJ5 E;  2WL8 A;  2E87 A;  4BG0 A;  4UDV A;  3RVZ A;  3MX3 A;  1QSP A;  2CW0 F;  2DI3 A;  1NFO A;  1FAP B;  4U5C E;  4U5G A;  3T6G B;  3QMK A;  4BJ1 A;  3PMR A;  2XL4 A;  1D1A A;  2LCH A;  3FVY A;  3IQT A;  3V5Y A;  1S05 A;  2WZL A;  3LEO A;  3ZDL A;  3U9J A;  2Q9A A;  1VTM P;  3NDB B;  5IY5 C;  2L6G A;  2HMQ A;  4CS8 C;  1EQ1 A;  3GEI A;  1HE1 A;  2Q9B A;  1H7I A;  3BEH A;  3EH1 A;  1LS4 A;  3OA1 A;  3TJ6 A;  3N0T A;  4BPM A;  3JYH A;  3GOD A;  4LLE A;  3SEO A;  2HFI A;  4JEA A;  4IB4 A;  1LKX A;  5E33 A;  5A6J A;  1QLE C;  1PCX A;  3AQB A;  1MMN A;  4CS9 A;  3DE8 A;  4YT5 A;  3RKO F;  4C3D A;  4U5E E;  5FZT A;  4DRI B;  3LNM B;  3AG2 C;  3U2L A;  3HTK C;  3R7C A;  2B0J A;  4AE4 B;  1A41 A;  1QQ3 A;  3TOM A;  3SXY A;  2R7W A;  3LLK A;  4GEH A;  5T3T A;  3NG1 A;  4DOZ A;  5KYY A;  1Z6A A;  3ECS A;  3FAP B;  5A6A A;  1OW7 A;  5F5F A;  3S90 A;  5COM A;  1A7D A;  2H7O A;  4MTG A;  4NTF A;  4PJM A;  4J30 B;  3SXK A;  1M6T A;  2W4M A;  2YLD A;  1U89 A;  1SMY F;  3DM9 B;  3S29 A;  3US6 A;  1E2X A;  4ZLD A;  3GM2 A;  4A2N B;  1YAU O;  1ZZP A;  2VAS A;  3M79 A;  5KYN A;  4IAQ A;  4WAB A;  2PF4 E;  4W8P A;  2YLI A;  3QW0 A;  5BUO A;  4KNV A;  4BJT A;  1SF8 A;  4CJG A;  2IYL D;  1TWG A;  1A7V A;  4HE8 D;  1XWJ A;  2KNH A;  1TFK B;  2CDQ A;  2R7Q A;  3GAN A;  1H9G A;  2HJ3 A;  2OQM A;  3AGT A;  1MND A;  3SNH A;  3SYN A;  3S9O A;  4NTB A;  2XLW A;  4PJN A;  2WVQ A;  4EIY A;  4MQ9 F;  2R03 A;  2X51 A;  3HNK A;  2OCC C;  1F1M A;  3IQ6 A;  4OIN F;  4A4A A;  4AE4 A;  3B0V C;  2EIM C;  3GWN A;  3DXJ F;  5T3W A;  4OIP F;  3EZH A;  1M2V A;  4HFF B;  1M57 C;  1HMO A;  4WJ0 A;  3AJM A;  2GFH A;  3TK0 A;  3G4Z A;  2NSF A;  1EI7 A;  3L0I A;  2OOC A;  4MS2 A;  4C7O B;  1OKK D;  1T5O A;  4O6N A;  4Z9I A;  2R7T A;  3AG3 C;  2PBE A;  3C8G B;  4JCH A;  2BC5 A;  2VH3 A;  2Y3G A;  3EGX B;  3K7D A;  3KL4 A;  4YN0 B;  4CS7 A;  4CX9 A;  3JSE O;  3DAG A;  1IW7 F;  3I5Q A;  3S84 A;  2DYR C;  4XLP F;  5CI9 A;  1FNT c;  2PFD A;  2QNL A;  2OG2 A;  4DVZ A;  1V55 C;  2GDC A;  3TD7 A;  2C04 A;  1OR2 A;  2D4U A;  2LFD A;  2J9V A;  3F46 A;  2P6V A;  2Y3B A;  1EA8 A;  2FFH A;  1D0Z A;  1JR8 A;  4PK4 A;  4R32 A;  4CSA C;  3O55 A;  4RDA A;  2NUP B;  3GOR A;  4G0H A;  5DS6 A;  2V3C C;  3LEV A; 
#chains in the Genus database with same CATH homology
 1VLT A;  3ATP A;  1WAS A;  1JMW A;  1VLS A;  4Z9H A;  4Z9J A;  1LIH A;  2D4U A;  3T9O A;  2ASR A;  1WAT A;  4Z9I A;  2LIG A;  4H54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...