4NTAA

Mus musculus ltc4 synthase in apo form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
147
structure length
147
Chain Sequence
HHHKDEVALLATVTLVGVLLQAYFSLQVISARRAFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQLRLTPLYASARALWLLVAMAALGLLVHFLPGTLRTALFRWLQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Mus Musculus LTC4 synthase in apo form
rcsb
source organism Mus musculus
molecule tags Lyase
total genus 56
structure length 147
sequence length 147
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4ntaA00
3HKKA 4YK5A 4J7TA 2Q7RA 4WABA 2UUHA 3PCVA 3B29A 4JC7A 4JCZA 4NTAA 4YL3A 5K0IA 4NTBA 4BPMA 5BQGA 4YL0A 3LEOA 4JRZA 4NTFA 3DWWA 4YL1A 2UUIA 4J7YA 4AL0A 5BQIA 5HV9A 5BQHA 2H8AA 2PNOA 4AL1A
chains in the Genus database with same CATH superfamily
1VYIA 3ZVRA 1ST6A 3I5PA 1JPNA 2CNWA 1IZMA 2WVQA 1KU2A 2J46A 4E0HA 5COMA 3I5QA 4JE9A 4W8KA 5T1DB 3M15A 1EKYA 1VLTA 2KSFA 1YDIA 2KYHA 3CSKA 2NUTA 3TULA 3S84A 4I1OB 1U0BB 3AG3C 2HJMA 4CDYA 5B3SC 3W2VA 3LESA 3L8JA 4LACB 3RFYA 3S29A 1HE1A 3VF0A 3W8IA 1NLXA 2FGYA 4E7SA 2GWWA 1YJGA 4H4KC 256BA 5A6BD 3AQBA 4B6IA 3NMIA 1RXQA 1L3PA 4OD4A 1H9GA 3IQ6A 4HE8D 3CEXA 1JMWA 3MYFA 4DRJB 3ECSA 3W2WA 5F5FA 4BJ5A 2PNOA 1ORJA 1TWCA 2R03A 2W9YA 4WGYA 5CI8A 3U3FA 5L0HA 3US6A 4JTCB 1V4AA 3RQGA 2YWAA 2EINC 1M2OA 1JAFA 2AP3A 2IXNA 2KNHA 2P0NA 3CZ6A 2R7OA 3KPHA 3EZIA 4WJ0A 5JRAA 3PDMP 2CCYA 4DBQA 1JR8A 2JX0A 3VRCA 4MW8A 1LE2A 4HFKB 2UUHA 2XLOA 4N4WA 2P61A 1HMOA 3DAFA 1ORYA 1WGWA 2EIJC 3C8ZA 3DJNB 3EG9A 3GM3A 3KL4A 3KYJA 4NTBA 5K0IA 4XLPF 1JPJA 1OW8A 3OWTA 2EPMX 3W4YA 1VK5A 2H7VC 2QLAA 5BUOA 1A7VA 3H2VA 1GS9A 2LP4A 3TJ6A 4DRHB 5HV9A 3RIPA 1E83A 3TQOA 1PD0A 1BR1A 2NG1A 1A7DA 3T6JA 3VAYA 4AL1A 1FAPB 1NBBA 4KNVA 3TOLA 3AJMA 1EI7A 1MNEA 1HE9A 4YK5A 5L3VA 4G7HF 4W8PA 3RKOF 2Q9BA 3T4RA 1NU7D 3KKBA 4XPYA 1QQ3A 2WVNA 4MTGA 1TR2A 3EFOB 1L7CA 2IXOA 4XTKA 1YARO 2W45A 4U5CE 3B29A 2PF4E 4U5HA 1T6QA 2J9VA 2MYSA 2IXMA 4X0RA 4I3MA 5COGA 2XLWA 1MMAA 2E87A 1WWPA 2LSEA 2M4EA 2YEVA 3HNIA 3KH2A 4JJFA 4L6RA 4OD5A 5BQGA 1ZHWA 3T9OA 1NZEA 3DMDA 1A0BA 3NDBB 1I5NA 3LEVA 3J06A 1KTMA 2A0UA 1YZAA 2J9WA 1AUEA 3H2UA 1D1AA 4YT5A 3Q7LA 4AE4A 2OU6A 2YRFA 2H8AA 3T6GB 3HNKA 3BRJA 1A7EA 1QSPA 4EIYA 1ZHTA 2ZXRA 3EJNA 4FX5A 3SNHA 1MQVA 4HEAJ 1J8MF 3QW0A 1RMVA 2XLDA 4CSAC 2QTVA 2Y3GA 3G4XA 5B3IA 2ZXPA 4M63A 1PV3A 1Z6AA 3LS0A 1RJ9A 3LUTB 3ZQYA 4BG0A 2NSGA 4CBEA 2YL1A 4FAPB 3FXHA 4MVQA 3W8HA 3G4ZA 3KYIA 3WAQA 3JYHA 5AGFA 3B0VC 1FMWA 4LERA 5D92A 1JRAA 4GYTA 1YA9A 2AU5A 2L9JA 4KBLA 4LDQA 5CI9A 3ZC4A 4DRIB 3RVZA 2EILC 1MMGA 4QDLA 2L6GA 4LLEA 2R7VA 2ASRA 3H65A 2R02A 4DXWA 2NUPB 1VOMA 1FNTc 1OKKA 4ZLDA 5KYXA 3LLIA 1OR3A 2FFHA 1QVXA 2OJQA 3I4UA 1Q0FA 5DVWA 2LIGA 3N0TA 4Q5SF 4JTDB 1M57C 3QVYA 5EK0A 4K7BA 2YLIA 3EH2A 4JC7A 2JPUA 4JCZA 1M56C 2R7XA 4XQ1A 3A11A 2XLEA 4G7OF 1DOVA 2FAPB 2EPLX 5DS5A 1BZ4A 1OQCA 2IM8A 3JRTA 1H6GA 2Y3DA 3DE8A 1NU9C 2J0XA 4E18A 3NMJA 5JSLA 2KW3C 1QKRA 3M4BA 3TJ5A 4OIQF 4OIOF 3EGDB 3GWNA 4G7ZF 2V3CC 1CPRA 3C8GB 3EGXA 2XM4A 4XWJA 2IXPA 3DD7A 3Q6MA 5DQTA 3PHF2 5E33A 1D1CA 4WABA 3UMIA 2WL8A 5DLJA 5B1BC 1SZIA 3SZRA 4PFOA 1K40A 1C03A 1BDJB 4YT2A 3ITFA 5A6JA 1TWHA 4BEJA 1NSGB 4OIPF 3TOMA 3L0IA 4KNWA 4O6MA 4ZLCA 3TD7A 3UMHA 2A6EF 2GFHA 2J7PA 3EQLF 3UMKA 1C02A 1YYJA 1ZU5A 1D0YA 5L0CA 3MFNA 1RKEB 2WZGA 1APCA 1BR4A 1YVIA 5BQHA 4CS8A 4JZAA 4CX9A 2DI3A 2XM0A 4PJMA 5HSWA 3ZTMA 2XXAB 1E84A 4IRUA 1TFKB 4MVUA 2NSFA 1T6UA 3DE9A 4MTOA 2RD9A 2CYDA 4D4XA 5L0GA 1KNYA 3IEEA 2A69F 4J7TA 2R7SA 4MVSA 5FZTA 2Z15A 2VCBA 4LDRA 4Z9JA 3IPMO 3EHMA 4Z9HA 1SF8A 1ZYRF 4J32B 3ASNC 4NC3A 2CGEA 2L6FA 3QTHA 4YL3A 4EWCA 2BE5F 4PJNA 1E85A 3IQTA 4P9TA 3RH3A 1D0ZA 2HUJA 2GA0A 3M4CA 1LE4A 4P6IC 3U3BA 3FHDA 5E3CA 1ZW3A 3LEOA 3NRHA 4OINF 4Q4ZF 4DVZA 1PCXA 3LAYA 4U9EA 2X51A 1OCOC 2A68F 2CW0F 1OCCC 4WGZA 2EIKC 3JRMO 3N24A 3UR3C 3ASOC 3SXYA 3C63A 3QVZA 1V54C 4BJ6C 2KQ9A 4CSAA 1G8XA 1N1CA 3MYIA 3DZAA 1ZHXA 2IOQA 2XL4A 1T9KA 2PP4A 1RCPA 1OCRC 3K1IC 3MLGA 2LQGA 1AEPA 3BEHA 2NPUA 3R2PA 3QMKA 1XZPA 3U8PA 2R7TA 4RDAA 5AC4A 5KYWB 1ZW2A 4OIRF 3ABLC 3R7CA 1B68A 4GEHA 4YT4A 2GAQA 2RSEB 3IQCA 3U2LA 3C7JA 1G4US 1WOLA 2XLVA 1O3UA 1SYQA 1WTYA 1QLEC 1V74B 1VB5A 2I15A 3C8GD 2NUTB 3PMRA 3GEEA 3L34A 1R4TA 3NYMA 4XEFA 3U2MA 3GEIA 4IWBA 1QZXA 1LS4A 1OW7A 1ZZPA 5KYUB 1BBHA 4BJ1A 3ZWIA 4CIHA 5JLIA 4N06A 4EBJA 5F5HA 4MW3A 3L1MA 1LKXA 5A69A 2D5RB 2QY9A 3NYJA 4EBBA 1Z63A 4H54A 1F1MA 1VTMP 3HKKA 3O55A 2Y39A 4BJ5C 3V7OA 3U9JA 3ZDLA 5DS6A 1LI5A 4EUKB 2O9XA 3DM9B 2ETSA 4CDAA 1M2VA 1Q0KA 1WN0A 2P6VA 5CIVA 2ZPAA 3IHUA 4PACA 2Y3HA 2VCCA 4NTAA 1IW7F 4ONSA 4C3EA 2HV6A 2CDQA 4MS2A 2G3KA 4D4NA 1FFHA 1TWAA 2IYLD 3GANA 4CS9C 4U5DE 1ZU4A 4YL1A 3C62A 4JURI 2YZSA 2X0CA 1M6TA 3KMIA 2IBFA 3ZTZA 3DAGA 1OKKD 5BQIA 3DKAA 4XEVA 4IJJA 2VC9A 4IB4A 3GEHA 3SEOA 1CGOA 3O6XA 3JSZA 2HZ8A 1FR0A 4K1OA 2F22A 5DQZA 4FESA 1HW2A 2MHRA 2Q4FA 2LCHA 1YA7O 2KK1A 2R25A 4J30B 1K04A 2DYRC 3S9OA 5JP7A 3EHNA 5FCLA 2XLHA 2XS1A 3LNMB 3JCUQ 3Q6NA 5T3TA 2EIMC 2KGOA 2LFDA 3B0UX 2OG2A 1YYXA 3NG1A 2EPNA 4ULVA 2ZD9A 1T5OA 1Z23A 4U5EE 1YAUO 1GQAA 2Q9CA 1Y6DA 5B1AC 4NQFA 1RKEA 4MQ9F 3E9VA 3X1OA 3FOOA 5KYNA 4JW1A 4I1MA 4J7YA 4XLNF 4AL0A 2CNWD 2QUPA 2B0HA 4UDVA 1U6HA 1MNDA 3RVYA 2YL7A 1D0XA 2TMVP 4U5GA 5A6AA 2OJED 1SMYF 2AWCA 2I8BA 2LFFA 4LLCA 2QE9A 3GORA 2Y69C 3CQZA 4JEBA 2J8WA 3GM1A 1DOWA 3GODA 2WZFA 3F46A 2DGJA 4EKWA 1I4YA 5JS5A 4AK9A 1LI7A 2J7PD 2M64A 2YLGA 1Y4CA 3S28A 4A2NB 4JCHA 1OXKA 3JTLO 5T3WA 3U8VA 2YHSA 5AC5A 1FFTC 1OW6A 3SXMA 2OEXA 3HNLA 4BPMA 4A4AA 1LVKA 4PR9A 3SYNA 1RJ9B 4CS7A 5JT4A 2R7UA 2XL6A 1E2XA 3DWWA 2J9BA 2XRHA 2WZLA 3RYLA 1H7IA 1OXBA 4C3BA 3DJUB 5KYYB 3AOUA 3K1IA 4ANJA 2P7VA 3JT1A 2YL3A 2OOCA 2R7WA 1YLMA 3JZ0A 2Y3BA 4P9FA 1VYKA 2A0BA 2W4BA 4IAQA 3OA1A 1CGNA 3EFOA 2H7BA 3C18A 4O7GA 2AWYA 1QPUA 4XPWA 4C7OB 2HSBA 3LJBA 3X2QC 2WVOA 1CPQA 3ABKC 3K1HA 4R32A 4YT8A 1G4WR 2LK4A 2ZXOA 3ZSUA 1T6IA 2ZXWC 3NKDA 4G78A 3K7DA 4PFPA 5KYUA 2GDCA 4PJLA 4PK4A 5KYXB 4CDVA 4MNDA 1AVOB 3HJCA 2XL8A 4QI2A 4CJOA 1Z3IX 1ZVZA 2YQYA 2BL2A 1W2WA 1NFNA 2AVKA 1Z7Qc 4LDKA 3U0CA 1MMDA 3FVYA 4JIOA 1FMVA 2BC5A 4C3DA 1CGME 1EQ1A 3GM2A 1RKCA 4O79A 2OQMA 1YZCA 1O5HA 1BR2A 4JVSA 5JVEA 2R7RA 1FTSA 1U89A 3E70C 5E2QA 2WB7A 2J45A 3DI5A 3AG1C 3EH1A 5E3AA 4G0HA 2PFDA 1NFOA 3S0XA 2HFIA 2HJ3A 3AG2C 2J9UA 3OEOA 3WHNA 3NYLA 4CS9A 4IARA 3EGXB 3LNRA 3FAJA 1Q0DA 2PBEA 5L3QA 1PD1A 1VLSA 5A6BA 1H9TA 3A9CA 3AGUA 3TK0A 5COFA 3HLZA 1TQGA 1LPEA 3QZCA 4PJJA 4YL0A 3B71A 4MVOA 4E0IA 1ORSC 4E7ZA 4U5FE 3O10A 2A6HF 2YKZA 4MVMA 4NCQA 1UFBA 4IGGA 1WASA 1WATA 4I44A 4CJGA 3WODF 3DXJF 4GQHA 1J8YF 1XZQA 3VM6A 3SXZA 2NUPA 3Q7GA 4RBNA 4NY3A 3FOPA 3JYYA 1LS1A 4DBRA 2OCCC 2PX3A 3S27A 4CS8C 3V5YA 4O6NA 4YJWA 2YLDA 2Q7RA 1G5ZA 1S05A 5D91A 1MMNA 4F4BA 3AQCA 1LIHA 2C04A 3RW0A 2Q00A 3M79A 3MX3A 3PCVA 3UNGC 1O87A 2YL0A 1HW1A 5TJ5E 3N2ZB 5L0JA 3AG4C 4IAOA 4DJ9A 4HFFB 2EPKX 3GWLA 2UUIA 3T6BA 3QW1A 3VYWA 2H7OA 2HMZA 3AGTA 3U9MA 1OCZC 5GPGB 4AE4B 3EG9B 4MVZA 3EGDA 3RQFA 1TFOB 5L0IA 3ZIBA 5A6KA 2D4UA 2VCAA 3FMSA 3C8GA 1R5ID 4N6CA 1TKNA 3DM5A 4ULWA 2JD3A 3FDQA 3UGOA 4KC9A 2QNLA 1VMAA 3LS1A 4Z9IA 3ZG1A 3POVA 1A41A 2R7QA 4BJTA 5EHHA 4YN0B 2KJGA 5L0DA 4U5BE 2VH3A 5L0FA 1C17M 2OEVA 3SXKA 3G50A 4DVYP 2B0JA 2DB4A 3ZQVA 5DS4A 4EHPA 4ER9A 3FAPB 1S7ZA 2P1AA 1Q0MA 2VB6A 1SR2A 4JJGA 5KYYA 5JUAA 2R05A 1K05A 3LLKA 2Q9AA 4JRZA 4NTFA 2L6HA 3IQ5A 3NKEA 3V5XA 2A1DD 2XSEA 2HKVA 5EGYA 1E86A 2XS8A 4CIPA 2XXAA 2HMQA 3EZHA 5F28E 2L7AA 4JTAB 2MWQA 4C7OA 1ZHYA 2J0WA 3ATPA 4N6HA 4MTFA 2LD6A 4YWQA 3M1CB 2V26A 2KC3A 3WG7C 1XWJA 3F47A 3B9QA 2Q3TA 2OKUA 3UGPA 4O6YA 2ICWG 4QI0A 4K0DA 2XLMA 4DOZA 3B0PA 3RF3A 1Q0GA 2C03A 3JSEO 4U9DA 1LM3B 3O39A 2G3VA 2W4MA 3U5SA 2DYSC 2L81A 3HNJA 4Q7CA 1HY5A 1GM5A 3L8IA 1Z5ZA 3ABMC 4JKVA 1GGQA 1NG1A 4XEKA 1M2VB 3K66A 1T01A 3S90A 3MBGA 1UG7A 2VASA 2YVKA 4MVRA 1JOGA 3K6BA 3RQEA 4KI2A 1ZHZA 4RD9A 2HV7A 4AX2A 1OR2A 3HTKC 2G62A 1EA8A 1V55C 3NMKA 2PX0A 3V5ZA 4BJ6A 4XPXA 3EPVA 1HMDA 2HSQA 4BEMJ 1I4ZA 1TWGA 4EBKA 5IY5C 1D1BA 2R9RB 3CAXA 2EPOA 2HS5A 4FWVA 3SP1A 4JEAA 3K33A 4E17A 5KYWA
chains in the Genus database with same CATH topology
3HKKA 4YK5A 4J7TA 2Q7RA 4WABA 2UUHA 3PCVA 3B29A 4JC7A 4JCZA 4NTAA 4YL3A 5K0IA 4NTBA 4BPMA 5BQGA 4YL0A 3LEOA 4JRZA 4NTFA 3DWWA 4YL1A 2UUIA 4J7YA 4AL0A 5BQIA 5HV9A 5BQHA 2H8AA 2PNOA 4AL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKK A;  4YK5 A;  4J7T A;  2Q7R A;  4WAB A;  2UUH A;  3PCV A;  3B29 A;  4JC7 A;  4JCZ A;  4NTA A;  4YL3 A;  5K0I A;  4NTB A;  4BPM A;  5BQG A;  4YL0 A;  3LEO A;  4JRZ A;  4NTF A;  3DWW A;  4YL1 A;  2UUI A;  4J7Y A;  4AL0 A;  5BQI A;  5HV9 A;  5BQH A;  2H8A A;  2PNO A;  4AL1 A; 
#chains in the Genus database with same CATH topology
 1VYI A;  3ZVR A;  1ST6 A;  3I5P A;  1JPN A;  2CNW A;  1IZM A;  2WVQ A;  1KU2 A;  2J46 A;  4E0H A;  5COM A;  3I5Q A;  4JE9 A;  4W8K A;  5T1D B;  3M15 A;  1EKY A;  1VLT A;  2KSF A;  1YDI A;  2KYH A;  3CSK A;  2NUT A;  3TUL A;  3S84 A;  4I1O B;  1U0B B;  3AG3 C;  2HJM A;  4CDY A;  5B3S C;  3W2V A;  3LES A;  3L8J A;  4LAC B;  3RFY A;  3S29 A;  1HE1 A;  3VF0 A;  3W8I A;  1NLX A;  2FGY A;  4E7S A;  2GWW A;  1YJG A;  4H4K C;  256B A;  5A6B D;  3AQB A;  4B6I A;  3NMI A;  1RXQ A;  1L3P A;  4OD4 A;  1H9G A;  3IQ6 A;  4HE8 D;  3CEX A;  1JMW A;  3MYF A;  4DRJ B;  3ECS A;  3W2W A;  5F5F A;  4BJ5 A;  2PNO A;  1ORJ A;  1TWC A;  2R03 A;  2W9Y A;  4WGY A;  5CI8 A;  3U3F A;  5L0H A;  3US6 A;  4JTC B;  1V4A A;  3RQG A;  2YWA A;  2EIN C;  1M2O A;  1JAF A;  2AP3 A;  2IXN A;  2KNH A;  2P0N A;  3CZ6 A;  2R7O A;  3KPH A;  3EZI A;  4WJ0 A;  5JRA A;  3PDM P;  2CCY A;  4DBQ A;  1JR8 A;  2JX0 A;  3VRC A;  4MW8 A;  1LE2 A;  4HFK B;  2UUH A;  2XLO A;  4N4W A;  2P61 A;  1HMO A;  3DAF A;  1ORY A;  1WGW A;  2EIJ C;  3C8Z A;  3DJN B;  3EG9 A;  3GM3 A;  3KL4 A;  3KYJ A;  4NTB A;  5K0I A;  4XLP F;  1JPJ A;  1OW8 A;  3OWT A;  2EPM X;  3W4Y A;  1VK5 A;  2H7V C;  2QLA A;  5BUO A;  1A7V A;  3H2V A;  1GS9 A;  2LP4 A;  3TJ6 A;  4DRH B;  5HV9 A;  3RIP A;  1E83 A;  3TQO A;  1PD0 A;  1BR1 A;  2NG1 A;  1A7D A;  3T6J A;  3VAY A;  4AL1 A;  1FAP B;  1NBB A;  4KNV A;  3TOL A;  3AJM A;  1EI7 A;  1MNE A;  1HE9 A;  4YK5 A;  5L3V A;  4G7H F;  4W8P A;  3RKO F;  2Q9B A;  3T4R A;  1NU7 D;  3KKB A;  4XPY A;  1QQ3 A;  2WVN A;  4MTG A;  1TR2 A;  3EFO B;  1L7C A;  2IXO A;  4XTK A;  1YAR O;  2W45 A;  4U5C E;  3B29 A;  2PF4 E;  4U5H A;  1T6Q A;  2J9V A;  2MYS A;  2IXM A;  4X0R A;  4I3M A;  5COG A;  2XLW A;  1MMA A;  2E87 A;  1WWP A;  2LSE A;  2M4E A;  2YEV A;  3HNI A;  3KH2 A;  4JJF A;  4L6R A;  4OD5 A;  5BQG A;  1ZHW A;  3T9O A;  1NZE A;  3DMD A;  1A0B A;  3NDB B;  1I5N A;  3LEV A;  3J06 A;  1KTM A;  2A0U A;  1YZA A;  2J9W A;  1AUE A;  3H2U A;  1D1A A;  4YT5 A;  3Q7L A;  4AE4 A;  2OU6 A;  2YRF A;  2H8A A;  3T6G B;  3HNK A;  3BRJ A;  1A7E A;  1QSP A;  4EIY A;  1ZHT A;  2ZXR A;  3EJN A;  4FX5 A;  3SNH A;  1MQV A;  4HEA J;  1J8M F;  3QW0 A;  1RMV A;  2XLD A;  4CSA C;  2QTV A;  2Y3G A;  3G4X A;  5B3I A;  2ZXP A;  4M63 A;  1PV3 A;  1Z6A A;  3LS0 A;  1RJ9 A;  3LUT B;  3ZQY A;  4BG0 A;  2NSG A;  4CBE A;  2YL1 A;  4FAP B;  3FXH A;  4MVQ A;  3W8H A;  3G4Z A;  3KYI A;  3WAQ A;  3JYH A;  5AGF A;  3B0V C;  1FMW A;  4LER A;  5D92 A;  1JRA A;  4GYT A;  1YA9 A;  2AU5 A;  2L9J A;  4KBL A;  4LDQ A;  5CI9 A;  3ZC4 A;  4DRI B;  3RVZ A;  2EIL C;  1MMG A;  4QDL A;  2L6G A;  4LLE A;  2R7V A;  2ASR A;  3H65 A;  2R02 A;  4DXW A;  2NUP B;  1VOM A;  1FNT c;  1OKK A;  4ZLD A;  5KYX A;  3LLI A;  1OR3 A;  2FFH A;  1QVX A;  2OJQ A;  3I4U A;  1Q0F A;  5DVW A;  2LIG A;  3N0T A;  4Q5S F;  4JTD B;  1M57 C;  3QVY A;  5EK0 A;  4K7B A;  2YLI A;  3EH2 A;  4JC7 A;  2JPU A;  4JCZ A;  1M56 C;  2R7X A;  4XQ1 A;  3A11 A;  2XLE A;  4G7O F;  1DOV A;  2FAP B;  2EPL X;  5DS5 A;  1BZ4 A;  1OQC A;  2IM8 A;  3JRT A;  1H6G A;  2Y3D A;  3DE8 A;  1NU9 C;  2J0X A;  4E18 A;  3NMJ A;  5JSL A;  2KW3 C;  1QKR A;  3M4B A;  3TJ5 A;  4OIQ F;  4OIO F;  3EGD B;  3GWN A;  4G7Z F;  2V3C C;  1CPR A;  3C8G B;  3EGX A;  2XM4 A;  4XWJ A;  2IXP A;  3DD7 A;  3Q6M A;  5DQT A;  3PHF 2;  5E33 A;  1D1C A;  4WAB A;  3UMI A;  2WL8 A;  5DLJ A;  5B1B C;  1SZI A;  3SZR A;  4PFO A;  1K40 A;  1C03 A;  1BDJ B;  4YT2 A;  3ITF A;  5A6J A;  1TWH A;  4BEJ A;  1NSG B;  4OIP F;  3TOM A;  3L0I A;  4KNW A;  4O6M A;  4ZLC A;  3TD7 A;  3UMH A;  2A6E F;  2GFH A;  2J7P A;  3EQL F;  3UMK A;  1C02 A;  1YYJ A;  1ZU5 A;  1D0Y A;  5L0C A;  3MFN A;  1RKE B;  2WZG A;  1APC A;  1BR4 A;  1YVI A;  5BQH A;  4CS8 A;  4JZA A;  4CX9 A;  2DI3 A;  2XM0 A;  4PJM A;  5HSW A;  3ZTM A;  2XXA B;  1E84 A;  4IRU A;  1TFK B;  4MVU A;  2NSF A;  1T6U A;  3DE9 A;  4MTO A;  2RD9 A;  2CYD A;  4D4X A;  5L0G A;  1KNY A;  3IEE A;  2A69 F;  4J7T A;  2R7S A;  4MVS A;  5FZT A;  2Z15 A;  2VCB A;  4LDR A;  4Z9J A;  3IPM O;  3EHM A;  4Z9H A;  1SF8 A;  1ZYR F;  4J32 B;  3ASN C;  4NC3 A;  2CGE A;  2L6F A;  3QTH A;  4YL3 A;  4EWC A;  2BE5 F;  4PJN A;  1E85 A;  3IQT A;  4P9T A;  3RH3 A;  1D0Z A;  2HUJ A;  2GA0 A;  3M4C A;  1LE4 A;  4P6I C;  3U3B A;  3FHD A;  5E3C A;  1ZW3 A;  3LEO A;  3NRH A;  4OIN F;  4Q4Z F;  4DVZ A;  1PCX A;  3LAY A;  4U9E A;  2X51 A;  1OCO C;  2A68 F;  2CW0 F;  1OCC C;  4WGZ A;  2EIK C;  3JRM O;  3N24 A;  3UR3 C;  3ASO C;  3SXY A;  3C63 A;  3QVZ A;  1V54 C;  4BJ6 C;  2KQ9 A;  4CSA A;  1G8X A;  1N1C A;  3MYI A;  3DZA A;  1ZHX A;  2IOQ A;  2XL4 A;  1T9K A;  2PP4 A;  1RCP A;  1OCR C;  3K1I C;  3MLG A;  2LQG A;  1AEP A;  3BEH A;  2NPU A;  3R2P A;  3QMK A;  1XZP A;  3U8P A;  2R7T A;  4RDA A;  5AC4 A;  5KYW B;  1ZW2 A;  4OIR F;  3ABL C;  3R7C A;  1B68 A;  4GEH A;  4YT4 A;  2GAQ A;  2RSE B;  3IQC A;  3U2L A;  3C7J A;  1G4U S;  1WOL A;  2XLV A;  1O3U A;  1SYQ A;  1WTY A;  1QLE C;  1V74 B;  1VB5 A;  2I15 A;  3C8G D;  2NUT B;  3PMR A;  3GEE A;  3L34 A;  1R4T A;  3NYM A;  4XEF A;  3U2M A;  3GEI A;  4IWB A;  1QZX A;  1LS4 A;  1OW7 A;  1ZZP A;  5KYU B;  1BBH A;  4BJ1 A;  3ZWI A;  4CIH A;  5JLI A;  4N06 A;  4EBJ A;  5F5H A;  4MW3 A;  3L1M A;  1LKX A;  5A69 A;  2D5R B;  2QY9 A;  3NYJ A;  4EBB A;  1Z63 A;  4H54 A;  1F1M A;  1VTM P;  3HKK A;  3O55 A;  2Y39 A;  4BJ5 C;  3V7O A;  3U9J A;  3ZDL A;  5DS6 A;  1LI5 A;  4EUK B;  2O9X A;  3DM9 B;  2ETS A;  4CDA A;  1M2V A;  1Q0K A;  1WN0 A;  2P6V A;  5CIV A;  2ZPA A;  3IHU A;  4PAC A;  2Y3H A;  2VCC A;  4NTA A;  1IW7 F;  4ONS A;  4C3E A;  2HV6 A;  2CDQ A;  4MS2 A;  2G3K A;  4D4N A;  1FFH A;  1TWA A;  2IYL D;  3GAN A;  4CS9 C;  4U5D E;  1ZU4 A;  4YL1 A;  3C62 A;  4JUR I;  2YZS A;  2X0C A;  1M6T A;  3KMI A;  2IBF A;  3ZTZ A;  3DAG A;  1OKK D;  5BQI A;  3DKA A;  4XEV A;  4IJJ A;  2VC9 A;  4IB4 A;  3GEH A;  3SEO A;  1CGO A;  3O6X A;  3JSZ A;  2HZ8 A;  1FR0 A;  4K1O A;  2F22 A;  5DQZ A;  4FES A;  1HW2 A;  2MHR A;  2Q4F A;  2LCH A;  1YA7 O;  2KK1 A;  2R25 A;  4J30 B;  1K04 A;  2DYR C;  3S9O A;  5JP7 A;  3EHN A;  5FCL A;  2XLH A;  2XS1 A;  3LNM B;  3JCU Q;  3Q6N A;  5T3T A;  2EIM C;  2KGO A;  2LFD A;  3B0U X;  2OG2 A;  1YYX A;  3NG1 A;  2EPN A;  4ULV A;  2ZD9 A;  1T5O A;  1Z23 A;  4U5E E;  1YAU O;  1GQA A;  2Q9C A;  1Y6D A;  5B1A C;  4NQF A;  1RKE A;  4MQ9 F;  3E9V A;  3X1O A;  3FOO A;  5KYN A;  4JW1 A;  4I1M A;  4J7Y A;  4XLN F;  4AL0 A;  2CNW D;  2QUP A;  2B0H A;  4UDV A;  1U6H A;  1MND A;  3RVY A;  2YL7 A;  1D0X A;  2TMV P;  4U5G A;  5A6A A;  2OJE D;  1SMY F;  2AWC A;  2I8B A;  2LFF A;  4LLC A;  2QE9 A;  3GOR A;  2Y69 C;  3CQZ A;  4JEB A;  2J8W A;  3GM1 A;  1DOW A;  3GOD A;  2WZF A;  3F46 A;  2DGJ A;  4EKW A;  1I4Y A;  5JS5 A;  4AK9 A;  1LI7 A;  2J7P D;  2M64 A;  2YLG A;  1Y4C A;  3S28 A;  4A2N B;  4JCH A;  1OXK A;  3JTL O;  5T3W A;  3U8V A;  2YHS A;  5AC5 A;  1FFT C;  1OW6 A;  3SXM A;  2OEX A;  3HNL A;  4BPM A;  4A4A A;  1LVK A;  4PR9 A;  3SYN A;  1RJ9 B;  4CS7 A;  5JT4 A;  2R7U A;  2XL6 A;  1E2X A;  3DWW A;  2J9B A;  2XRH A;  2WZL A;  3RYL A;  1H7I A;  1OXB A;  4C3B A;  3DJU B;  5KYY B;  3AOU A;  3K1I A;  4ANJ A;  2P7V A;  3JT1 A;  2YL3 A;  2OOC A;  2R7W A;  1YLM A;  3JZ0 A;  2Y3B A;  4P9F A;  1VYK A;  2A0B A;  2W4B A;  4IAQ A;  3OA1 A;  1CGN A;  3EFO A;  2H7B A;  3C18 A;  4O7G A;  2AWY A;  1QPU A;  4XPW A;  4C7O B;  2HSB A;  3LJB A;  3X2Q C;  2WVO A;  1CPQ A;  3ABK C;  3K1H A;  4R32 A;  4YT8 A;  1G4W R;  2LK4 A;  2ZXO A;  3ZSU A;  1T6I A;  2ZXW C;  3NKD A;  4G78 A;  3K7D A;  4PFP A;  5KYU A;  2GDC A;  4PJL A;  4PK4 A;  5KYX B;  4CDV A;  4MND A;  1AVO B;  3HJC A;  2XL8 A;  4QI2 A;  4CJO A;  1Z3I X;  1ZVZ A;  2YQY A;  2BL2 A;  1W2W A;  1NFN A;  2AVK A;  1Z7Q c;  4LDK A;  3U0C A;  1MMD A;  3FVY A;  4JIO A;  1FMV A;  2BC5 A;  4C3D A;  1CGM E;  1EQ1 A;  3GM2 A;  1RKC A;  4O79 A;  2OQM A;  1YZC A;  1O5H A;  1BR2 A;  4JVS A;  5JVE A;  2R7R A;  1FTS A;  1U89 A;  3E70 C;  5E2Q A;  2WB7 A;  2J45 A;  3DI5 A;  3AG1 C;  3EH1 A;  5E3A A;  4G0H A;  2PFD A;  1NFO A;  3S0X A;  2HFI A;  2HJ3 A;  3AG2 C;  2J9U A;  3OEO A;  3WHN A;  3NYL A;  4CS9 A;  4IAR A;  3EGX B;  3LNR A;  3FAJ A;  1Q0D A;  2PBE A;  5L3Q A;  1PD1 A;  1VLS A;  5A6B A;  1H9T A;  3A9C A;  3AGU A;  3TK0 A;  5COF A;  3HLZ A;  1TQG A;  1LPE A;  3QZC A;  4PJJ A;  4YL0 A;  3B71 A;  4MVO A;  4E0I A;  1ORS C;  4E7Z A;  4U5F E;  3O10 A;  2A6H F;  2YKZ A;  4MVM A;  4NCQ A;  1UFB A;  4IGG A;  1WAS A;  1WAT A;  4I44 A;  4CJG A;  3WOD F;  3DXJ F;  4GQH A;  1J8Y F;  1XZQ A;  3VM6 A;  3SXZ A;  2NUP A;  3Q7G A;  4RBN A;  4NY3 A;  3FOP A;  3JYY A;  1LS1 A;  4DBR A;  2OCC C;  2PX3 A;  3S27 A;  4CS8 C;  3V5Y A;  4O6N A;  4YJW A;  2YLD A;  2Q7R A;  1G5Z A;  1S05 A;  5D91 A;  1MMN A;  4F4B A;  3AQC A;  1LIH A;  2C04 A;  3RW0 A;  2Q00 A;  3M79 A;  3MX3 A;  3PCV A;  3UNG C;  1O87 A;  2YL0 A;  1HW1 A;  5TJ5 E;  3N2Z B;  5L0J A;  3AG4 C;  4IAO A;  4DJ9 A;  4HFF B;  2EPK X;  3GWL A;  2UUI A;  3T6B A;  3QW1 A;  3VYW A;  2H7O A;  2HMZ A;  3AGT A;  3U9M A;  1OCZ C;  5GPG B;  4AE4 B;  3EG9 B;  4MVZ A;  3EGD A;  3RQF A;  1TFO B;  5L0I A;  3ZIB A;  5A6K A;  2D4U A;  2VCA A;  3FMS A;  3C8G A;  1R5I D;  4N6C A;  1TKN A;  3DM5 A;  4ULW A;  2JD3 A;  3FDQ A;  3UGO A;  4KC9 A;  2QNL A;  1VMA A;  3LS1 A;  4Z9I A;  3ZG1 A;  3POV A;  1A41 A;  2R7Q A;  4BJT A;  5EHH A;  4YN0 B;  2KJG A;  5L0D A;  4U5B E;  2VH3 A;  5L0F A;  1C17 M;  2OEV A;  3SXK A;  3G50 A;  4DVY P;  2B0J A;  2DB4 A;  3ZQV A;  5DS4 A;  4EHP A;  4ER9 A;  3FAP B;  1S7Z A;  2P1A A;  1Q0M A;  2VB6 A;  1SR2 A;  4JJG A;  5KYY A;  5JUA A;  2R05 A;  1K05 A;  3LLK A;  2Q9A A;  4JRZ A;  4NTF A;  2L6H A;  3IQ5 A;  3NKE A;  3V5X A;  2A1D D;  2XSE A;  2HKV A;  5EGY A;  1E86 A;  2XS8 A;  4CIP A;  2XXA A;  2HMQ A;  3EZH A;  5F28 E;  2L7A A;  4JTA B;  2MWQ A;  4C7O A;  1ZHY A;  2J0W A;  3ATP A;  4N6H A;  4MTF A;  2LD6 A;  4YWQ A;  3M1C B;  2V26 A;  2KC3 A;  3WG7 C;  1XWJ A;  3F47 A;  3B9Q A;  2Q3T A;  2OKU A;  3UGP A;  4O6Y A;  2ICW G;  4QI0 A;  4K0D A;  2XLM A;  4DOZ A;  3B0P A;  3RF3 A;  1Q0G A;  2C03 A;  3JSE O;  4U9D A;  1LM3 B;  3O39 A;  2G3V A;  2W4M A;  3U5S A;  2DYS C;  2L81 A;  3HNJ A;  4Q7C A;  1HY5 A;  1GM5 A;  3L8I A;  1Z5Z A;  3ABM C;  4JKV A;  1GGQ A;  1NG1 A;  4XEK A;  1M2V B;  3K66 A;  1T01 A;  3S90 A;  3MBG A;  1UG7 A;  2VAS A;  2YVK A;  4MVR A;  1JOG A;  3K6B A;  3RQE A;  4KI2 A;  1ZHZ A;  4RD9 A;  2HV7 A;  4AX2 A;  1OR2 A;  3HTK C;  2G62 A;  1EA8 A;  1V55 C;  3NMK A;  2PX0 A;  3V5Z A;  4BJ6 A;  4XPX A;  3EPV A;  1HMD A;  2HSQ A;  4BEM J;  1I4Z A;  1TWG A;  4EBK A;  5IY5 C;  1D1B A;  2R9R B;  3CAX A;  2EPO A;  2HS5 A;  4FWV A;  3SP1 A;  4JEA A;  3K33 A;  4E17 A;  5KYW A; 
#chains in the Genus database with same CATH homology
 3HKK A;  4YK5 A;  4J7T A;  2Q7R A;  4WAB A;  2UUH A;  3PCV A;  3B29 A;  4JC7 A;  4JCZ A;  4NTA A;  4YL3 A;  5K0I A;  4NTB A;  4BPM A;  5BQG A;  4YL0 A;  3LEO A;  4JRZ A;  4NTF A;  3DWW A;  4YL1 A;  2UUI A;  4J7Y A;  4AL0 A;  5BQI A;  5HV9 A;  5BQH A;  2H8A A;  2PNO A;  4AL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...