4NTAA

Mus musculus ltc4 synthase in apo form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
147
structure length
147
Chain Sequence
b'HHHKDEVALLATVTLVGVLLQAYFSLQVISARRAFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQLRLTPLYASARALWLLVAMAALGLLVHFLPGTLRTALFRWLQM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Mus Musculus LTC4 synthase in apo form
rcsb
source organism Mus musculus
molecule tags Lyase
total genus 56
structure length 147
sequence length 147
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4ntaA00
5BQHA 5K0IA 3LEOA 4J7YA 3HKKA 5BQIA 2Q7RA 4JRZA 4JCZA 4JC7A 3DWWA 5HV9A 2PNOA 5BQGA 4NTFA 3B29A 4YK5A 2H8AA 4AL0A 4AL1A 4YL1A 4WABA 4NTBA 4YL3A 4NTAA 4J7TA 2UUHA 2UUIA 4YL0A 4BPMA 3PCVA
chains in the Genus database with same CATH superfamily
3VF0A 4BG0A 1YAUO 3DZAA 2OG2A 3BEHA 3LJBA 4CS9C 2R7OA 4KI2A 3HKKA 3V5YA 5L0JA 3EGDA 5L3VA 5DS5A 4JJGA 1M2OA 3T6JA 3W8HA 4JKVA 4C3EA 1BR2A 1Y6DA 1UG7A 3RFYA 3ZTMA 3TOMA 4CDAA 3RQGA 2DYRC 4Q4ZF 4C3DA 4AL0A 4AL1A 5JVEA 1YYXA 1J8YF 3QVZA 1ZU5A 2CNWD 1ZHXA 1Y4CA 2CYDA 4AX2A 1K04A 1G8XA 3EQLF 1VB5A 5D92A 3UMKA 2G3KA 3KYJA 1U89A 1T6QA 2XL8A 4YT5A 3JYYA 2R03A 2Z15A 3EJNA 3L0IA 5A6AA 2JX0A 2QUPA 1D1CA 4G7ZF 2CNWA 1BDJB 1PD1A 2IXOA 2O9XA 1S05A 3DJUB 1MNDA 2YLGA 3ZTZA 1VYIA 1G4US 5IY5C 5GPGB 3NYJA 1M56C 2EPOA 1YA9A 4KNWA 3HNIA 4Q7CA 1CGNA 1D1AA 3G4ZA 2HMQA 1ORSC 4DVYP 1NSGB 4JCHA 5D91A 2R7XA 1ZW3A 3W2WA 3Q7GA 1H9TA 1OKKD 2EPMX 3V5XA 1GS9A 2EIKC 2H8AA 1I5NA 2IXPA 2LK4A 3FOOA 4WGYA 4Z9HA 5L0GA 1E85A 3EG9A 1ORYA 1OXBA 2Q9CA 1VOMA 2ZD9A 1JMWA 1OKKA 3C8ZA 2YLIA 3B71A 3S28A 3PMRA 2EPLX 4YN0B 1H9GA 1Z63A 3VM6A 4XLPF 3K66A 4MVRA 2A0BA 1DOVA 5COFA 3JSEO 5JP7A 4CX9A 1VLSA 2PF4E 3TJ5A 4E0HA 1Z3IX 1NLXA 1V4AA 3WODF 1SMYF 1U6HA 3UMIA 2AU5A 4JZAA 3GEIA 2NSFA 1TKNA 3QW1A 3QVYA 2KGOA 1ZHTA 1OCZC 4EBBA 3MFNA 1E86A 4I1MA 3S0XA 1FTSA 3M79A 4EKWA 3AG2C 3F46A 4UDVA 3AG3C 2VCBA 3B29A 3HTKC 2NG1A 1D1BA 4P9TA 2R7TA 4QI2A 1NFNA 2EIMC 3LLIA 4GYTA 5DQZA 3TULA 1V74B 4BEJA 1CPRA 4G0HA 3FDQA 1Q0FA 5JLIA 2XL4A 3T9OA 5F5FA 2NPUA 2KJGA 1O3UA 4JE9A 2XS8A 2IBFA 3CSKA 3O10A 2BL2A 2UUHA 2WVNA 4XEVA 4DBRA 3POVA 4WGZA 2HFIA 4CJOA 2IOQA 1EQ1A 2YVKA 2CGEA 3SNHA 4MVQA 1GM5A 2WVQA 3JZ0A 3OA1A 1APCA 5L0IA 2HKVA 4JRZA 2P0NA 4IAOA 2OJQA 2R02A 5KYYB 1EKYA 1F1MA 3C18A 1A7EA 1AVOB 1FMVA 2QLAA 4OD4A 2AWYA 3O6XA 2M64A 3NYMA 3UNGC 4OD5A 4C7OB 2RSEB 2R05A 4KBLA 2A0UA 5KYUA 4PR9A 1YDIA 4EHPA 4K7BA 1YZCA 3U9MA 4CIHA 1LS1A 3LLKA 3RYLA 4U5DE 2PFDA 1BBHA 1GGQA 2WVOA 4H54A 3GEEA 3O39A 4FESA 4XPXA 5L3QA 4M63A 2M4EA 3H2UA 3I4UA 4ZLDA 3IQCA 1A7VA 2ETSA 2C03A 3FOPA 4YL0A 3U3FA 3PDMP 3SXKA 3RH3A 1BZ4A 3U2MA 4E17A 1JOGA 2XLOA 5DS4A 2YQYA 4J7YA 4AE4A 2J45A 2Y69C 1JPJA 1G5ZA 2Q7RA 5EHHA 4E18A 1NU9C 2JPUA 4P6IC 4BJ6A 4E7SA 2NUTB 3ITFA 2CW0F 1NU7D 4RD9A 1TWHA 1A41A 1WOLA 4ONSA 1HE9A 2J7PD 3GANA 1CGME 4IB4A 4EIYA 2X0CA 2PBEA 2P7VA 1RJ9B 1VK5A 4YWQA 2DYSC 4H4KC 3DM5A 2LFFA 3ABMC 3DM9B 3C8GA 5JUAA 5EK0A 4JIOA 2YZSA 2J7PA 4NTBA 1OQCA 1QLEC 1Z5ZA 3X1OA 3RKOF 3EFOB 4DBQA 3U5SA 2LP4A 4N06A 3NMIA 2VH3A 2XXAA 1TR2A 1G4WR 2W4MA 2XLMA 5T1DB 4XEKA 5JT4A 4O79A 4J30B 5KYXA 3T6BA 2P1AA 2VC9A 4X0RA 4RBNA 1D0YA 1XZQA 2H7BA 1WTYA 2XRHA 2Y3DA 3DAGA 3HNLA 4I1OB 4ZLCA 1T6IA 3TD7A 4NC3A 1CPQA 2R7UA 1JAFA 4LLCA 1VLTA 2YL0A 2W45A 2XS1A 1MMGA 3W4YA 4OINF 2D5RB 2G62A 3F47A 3AQBA 1AEPA 1TWGA 2P6VA 2ZXRA 3AQCA 1MNEA 3C62A 4F4BA 4L6RA 4PJJA 3L1MA 4U5CE 1XZPA 4CIPA 3JCUQ 3EGDB 4J7TA 1OW8A 1LE4A 4U5HA 1MMDA 1YJGA 2H7OA 3EPVA 1OW7A 2X51A 1VMAA 1TFKB 3LUTB 5DQTA 5BQHA 3HLZA 1ST6A 4PFOA 4A4AA 4PJLA 3ZSUA 3RVZA 2OU6A 2A6EF 2KK1A 3QW0A 4IRUA 1R5ID 1PV3A 2Q9AA 2OOCA 3GEHA 2KW3C 3V5ZA 4IGGA 3GWLA 4LERA 2OQMA 3U9JA 5B3IA 4ULWA 2CDQA 2EIJC 1I4ZA 2HSQA 5B1BC 4BJ6C 3MBGA 3ZWIA 3SXMA 4WJ0A 4EWCA 2IXMA 3KPHA 3S9OA 4PJMA 3ZQYA 3QZCA 3NRHA 4W8KA 1D0ZA 3TK0A 2JD3A 3AGTA 1TQGA 4BPMA 3T6GB 3IQTA 3Q7LA 1V54C 4OIOF 2ICWG 3ECSA 3L8IA 4DRJB 3N24A 2QNLA 5B1AC 3DD7A 2XSEA 3EHNA 1C02A 1T9KA 2LD6A 2QTVA 4CDVA 2LQGA 4HFKB 3QMKA 1Q0KA 3ZDLA 4XLNF 2VASA 1ZHZA 3E9VA 3LS1A 3SEOA 1ZHWA 3US6A 5EGYA 4D4XA 1QPUA 5E3CA 3W2VA 4CJGA 1TWCA 1M57C 2IM8A 2IXNA 1E83A 2B0HA 2Y39A 2NUPB 4I3MA 4Z9JA 3J06A 4WABA 1BR4A 3FAPB 4AK9A 5CIVA 3K1IA 1CGOA 3C7JA 3MX3A 4DVZA 1T01A 1LM3B 2HJ3A 1LPEA 3L34A 3GORA 3CAXA 2HUJA 4G7HF 4GQHA 1WASA 1KTMA 3JT1A 2HJMA 2NSGA 2MYSA 1ORJA 1J8MF 2A69F 3DE8A 4LDKA 4PFPA 2IYLD 3CQZA 1DOWA 2YL7A 2J8WA 2KYHA 5TJ5E 2QE9A 3EH2A 4YT2A 2E87A 3M4BA 2HV6A 5BQGA 4NTFA 1OCOC 4LLEA 3U2LA 3UR3C 2BC5A 3JYHA 1QKRA 1RXQA 5KYYA 5DVWA 5T3WA 1YZAA 4O7GA 3WHNA 1L7CA 4OIQF 2HV7A 5A69A 4E7ZA 4C7OA 1RKEB 2H7VC 3R2PA 5A6KA 2HSBA 1IW7F 4QDLA 1FMWA 3AJMA 1YYJA 3K33A 4N6HA 4U5GA 2FFHA 2ASRA 4EUKB 3PCVA 4JEBA 1VYKA 1EA8A 3MYIA 1RKCA 4PACA 1LI7A 1HMDA 2AP3A 4A2NB 3NDBB 4PK4A 1M6TA 3JSZA 3K7DA 4JCZA 4JC7A 4LACB 1KU2A 2HMZA 2KC3A 2ZXWC 4U5BE 1Z7Qc 4U9DA 3VYWA 3RVYA 2L6HA 3S90A 2Y3BA 3U8PA 5HV9A 1SR2A 1FNTc 2CCYA 3C8GD 3RW0A 2B0JA 2DB4A 3AG1C 3EH1A 1TFOB 3WG7C 1Q0GA 5B3SC 1OCRC 1MQVA 1K05A 1OR2A 3EGXB 1OXKA 3NKDA 4MS2A 2NUTA 5L0DA 3U3BA 2PX0A 3LS0A 1HY5A 1ZYRF 4MVMA 5A6BD 5KYNA 5FZTA 2KQ9A 2XLHA 4MTFA 4NTAA 3HJCA 5COGA 4MVZA 5T3TA 1UFBA 2GA0A 1A7DA 2MHRA 2Y3HA 2J9WA 3SZRA 3ZVRA 5KYWB 4DRIB 2XM0A 3RIPA 3B9QA 1LVKA 3IEEA 3KYIA 5A6BA 3UGOA 2I15A 4JURI 2EPKX 3Q6MA 2R7QA 3FXHA 4XPYA 3LEOA 3IQ6A 3DMDA 3K1IC 1FFHA 2A68F 4KNVA 3L8JA 1HMOA 4MVOA 5CI9A 3VRCA 2R7VA 1PD0A 2FAPB 2PX3A 1GQAA 2KSFA 3EFOA 3K6BA 1ZVZA 2AVKA 3E70C 3JRMO 3RQEA 2GFHA 1Q0DA 3K1HA 1S7ZA 1MMAA 1M2VB 4O6YA 5JS5A 1ZZPA 3B0PA 3KMIA 3U8VA 3VAYA 1U0BB 2WB7A 2D4UA 1O87A 3NMJA 1QSPA 2P61A 3IHUA 2C04A 5JRAA 2R7RA 3KL4A 4MW8A 3ABKC 3DXJF 5DS6A 3NKEA 3NYLA 3GM2A 4YL3A 4CSAA 2YL1A 4RDAA 3DJNB 3GWNA 4K1OA 5E3AA 3UMHA 3W8IA 2AWCA 1AUEA 2A1DD 3IPMO 2YWAA 3LNRA 5E33A 1ZW2A 4NQFA 3GODA 1Q0MA 2YRFA 4EBKA 2R25A 4C3BA 5COMA 4ANJA 5F28E 3CZ6A 4O6NA 2ZXPA 3ZG1A 5FCLA 3SXYA 1H7IA 2Q4FA 2EPNA 1YARO 3MLGA 1PCXA 4K0DA 2L6GA 4BJ1A 4E0IA 2DGJA 2OEXA 3G50A 3S84A 1BR1A 4YK5A 4N4WA 4PJNA 4FAPB 5AC5A 2LIGA 1IZMA 2HS5A 3DAFA 3GM1A 1WATA 5K0IA 1ZHYA 3I5PA 4MQ9F 4YL1A 1HW2A 3Q6NA 4G7OF 4B6IA 4FWVA 3HNJA 5AC4A 4CS8A 2J0XA 1LE2A 1YLMA 1SZIA 5L0HA 2WZFA 1KNYA 2L9JA 3IQ5A 4IWBA 3X2QC 2YEVA 2TMVP 3NMKA 1D0XA 2OEVA 1JRAA 1ZU4A 2VB6A 2XM4A 3FHDA 2GAQA 3NG1A 4MVSA 2QY9A 2OJED 4FX5A 2OKUA 1LS4A 3LNMB 4U5FE 3BRJA 4CBEA 4Q5SF 3M4CA 2LSEA 4G78A 1JR8A 2GWWA 3EG9B 1FFTC 5DLJA 4HFFB 3ATPA 3MYFA 1NG1A 2PNOA 4XWJA 2Q9BA 2YKZA 2MWQA 4MVUA 1NZEA 1B68A 1WWPA 2FGYA 4IAQA 3R7CA 1FAPB 5BUOA 3ZIBA 4ULVA 2RD9A 3CEXA 1HE1A 3FAJA 4JTAB 3M1CB 4MNDA 2EILC 1RCPA 2HZ8A 1TWAA 4I44A 3H2VA 1NFOA 4LDQA 3EHMA 3OEOA 2I8BA 4JTDB 2W9YA 1OR3A 4KC9A 3RQFA 3KH2A 2UUIA 1OW6A 5E2QA 2NUPA 3U0CA 4OIPF 4DJ9A 4CSAC 3N2ZB 4XPWA 3QTHA 2V3CC 3H65A 3S29A 3UGPA 2J9VA 1C03A 4NY3A 2R7WA 4P9FA 4ER9A 1HW1A 2XLWA 2YL3A 3DWWA 4YJWA 3SXZA 1I4YA 3WAQA 2GDCA 1WN0A 1A0BA 2DI3A 4Z9IA 1L3PA 4BJ5A 4DOZA 3ASOC 4QI0A 3ZC4A 256BA 1QVXA 1FR0A 1SF8A 3PHF2 2YLDA 4EBJA 4D4NA 4HEAJ 3O55A 2VCCA 3FVYA 1T6UA 5CI8A 2EINC 3A9CA 4CS9A 2XLVA 3TJ6A 3EZIA 2XLDA 3TOLA 2XLEA 3A11A 3AGUA 3C63A 3N0TA 1RMVA 3ABLC 4HE8D 1MMNA 3EZHA 1WGWA 5F5HA 4CS8C 2KNHA 1RKEA 2VCAA 4JTCB 2F22A 1E2XA 1LI5A 1LKXA 5BQIA 5KYUB 1T5OA 4U9EA 4JW1A 3FMSA 3AOUA 5AGFA 4GEHA 1R4TA 5HSWA 1E84A 3T4RA 2L81A 2LFDA 2L6FA 4JJFA 3B0VC 3DI5A 4DXWA 1C17M 1YA7O 2R9RB 3LAYA 3LESA 1EI7A 4N6CA 3S27A 3RF3A 4YT4A 2ZPAA 1LIHA 2G3VA 2J0WA 4AE4B 4NCQA 4MTGA 2R7SA 3EGXA 5JSLA 4CS7A 4R32A 1RJ9A 3V7OA 1JPNA 1V55C 4YT8A 4XTKA 4XQ1A 1K40A 1O5HA 2Y3GA 3AG4C 3GM3A 4JEAA 3SP1A 4LDRA 5L0CA 3B0UX 1W2WA 1OCCC 2LCHA 3ASNC 5KYWA 4O6MA 5A6JA 1Z6AA 1QQ3A 2J9UA 2L7AA 3I5QA 4IJJA 2XL6A 2J9BA 2ZXOA 3KKBA 2J46A 2PP4A 3C8GB 2WL8A 4BJTA 2BE5F 4BEMJ 1VTMP 2YHSA 1YVIA 2OCCC 3DE9A 1SYQA 3JRTA 4XEFA 3JTLO 4MW3A 3M15A 4IARA 3DKAA 4U5EE 2Q3TA 2Q00A 3G4XA 2XXAB 2WZLA 3SYNA 4J32B 4DRHB 4W8PA 5KYXB 1M2VA 3TQOA 3OWTA 4BJ5C 4CDYA 2V26A 4OIRF 3ZQVA 5L0FA 3LEVA 1NBBA 1Z23A 2A6HF 3HNKA 1N1CA 2W4BA 1QZXA 1H6GA 4MTOA 4JVSA 2WZGA 1XWJA
chains in the Genus database with same CATH topology
5BQHA 5K0IA 3LEOA 4J7YA 3HKKA 5BQIA 2Q7RA 4JRZA 4JCZA 4JC7A 3DWWA 5HV9A 2PNOA 5BQGA 4NTFA 3B29A 4YK5A 2H8AA 4AL0A 4AL1A 4YL1A 4WABA 4NTBA 4YL3A 4NTAA 4J7TA 2UUHA 2UUIA 4YL0A 4BPMA 3PCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BQH A;  5K0I A;  3LEO A;  4J7Y A;  3HKK A;  5BQI A;  2Q7R A;  4JRZ A;  4JCZ A;  4JC7 A;  3DWW A;  5HV9 A;  2PNO A;  5BQG A;  4NTF A;  3B29 A;  4YK5 A;  2H8A A;  4AL0 A;  4AL1 A;  4YL1 A;  4WAB A;  4NTB A;  4YL3 A;  4NTA A;  4J7T A;  2UUH A;  2UUI A;  4YL0 A;  4BPM A;  3PCV A; 
#chains in the Genus database with same CATH topology
 3VF0 A;  4BG0 A;  1YAU O;  3DZA A;  2OG2 A;  3BEH A;  3LJB A;  4CS9 C;  2R7O A;  4KI2 A;  3HKK A;  3V5Y A;  5L0J A;  3EGD A;  5L3V A;  5DS5 A;  4JJG A;  1M2O A;  3T6J A;  3W8H A;  4JKV A;  4C3E A;  1BR2 A;  1Y6D A;  1UG7 A;  3RFY A;  3ZTM A;  3TOM A;  4CDA A;  3RQG A;  2DYR C;  4Q4Z F;  4C3D A;  4AL0 A;  4AL1 A;  5JVE A;  1YYX A;  1J8Y F;  3QVZ A;  1ZU5 A;  2CNW D;  1ZHX A;  1Y4C A;  2CYD A;  4AX2 A;  1K04 A;  1G8X A;  3EQL F;  1VB5 A;  5D92 A;  3UMK A;  2G3K A;  3KYJ A;  1U89 A;  1T6Q A;  2XL8 A;  4YT5 A;  3JYY A;  2R03 A;  2Z15 A;  3EJN A;  3L0I A;  5A6A A;  2JX0 A;  2QUP A;  1D1C A;  4G7Z F;  2CNW A;  1BDJ B;  1PD1 A;  2IXO A;  2O9X A;  1S05 A;  3DJU B;  1MND A;  2YLG A;  3ZTZ A;  1VYI A;  1G4U S;  5IY5 C;  5GPG B;  3NYJ A;  1M56 C;  2EPO A;  1YA9 A;  4KNW A;  3HNI A;  4Q7C A;  1CGN A;  1D1A A;  3G4Z A;  2HMQ A;  1ORS C;  4DVY P;  1NSG B;  4JCH A;  5D91 A;  2R7X A;  1ZW3 A;  3W2W A;  3Q7G A;  1H9T A;  1OKK D;  2EPM X;  3V5X A;  1GS9 A;  2EIK C;  2H8A A;  1I5N A;  2IXP A;  2LK4 A;  3FOO A;  4WGY A;  4Z9H A;  5L0G A;  1E85 A;  3EG9 A;  1ORY A;  1OXB A;  2Q9C A;  1VOM A;  2ZD9 A;  1JMW A;  1OKK A;  3C8Z A;  2YLI A;  3B71 A;  3S28 A;  3PMR A;  2EPL X;  4YN0 B;  1H9G A;  1Z63 A;  3VM6 A;  4XLP F;  3K66 A;  4MVR A;  2A0B A;  1DOV A;  5COF A;  3JSE O;  5JP7 A;  4CX9 A;  1VLS A;  2PF4 E;  3TJ5 A;  4E0H A;  1Z3I X;  1NLX A;  1V4A A;  3WOD F;  1SMY F;  1U6H A;  3UMI A;  2AU5 A;  4JZA A;  3GEI A;  2NSF A;  1TKN A;  3QW1 A;  3QVY A;  2KGO A;  1ZHT A;  1OCZ C;  4EBB A;  3MFN A;  1E86 A;  4I1M A;  3S0X A;  1FTS A;  3M79 A;  4EKW A;  3AG2 C;  3F46 A;  4UDV A;  3AG3 C;  2VCB A;  3B29 A;  3HTK C;  2NG1 A;  1D1B A;  4P9T A;  2R7T A;  4QI2 A;  1NFN A;  2EIM C;  3LLI A;  4GYT A;  5DQZ A;  3TUL A;  1V74 B;  4BEJ A;  1CPR A;  4G0H A;  3FDQ A;  1Q0F A;  5JLI A;  2XL4 A;  3T9O A;  5F5F A;  2NPU A;  2KJG A;  1O3U A;  4JE9 A;  2XS8 A;  2IBF A;  3CSK A;  3O10 A;  2BL2 A;  2UUH A;  2WVN A;  4XEV A;  4DBR A;  3POV A;  4WGZ A;  2HFI A;  4CJO A;  2IOQ A;  1EQ1 A;  2YVK A;  2CGE A;  3SNH A;  4MVQ A;  1GM5 A;  2WVQ A;  3JZ0 A;  3OA1 A;  1APC A;  5L0I A;  2HKV A;  4JRZ A;  2P0N A;  4IAO A;  2OJQ A;  2R02 A;  5KYY B;  1EKY A;  1F1M A;  3C18 A;  1A7E A;  1AVO B;  1FMV A;  2QLA A;  4OD4 A;  2AWY A;  3O6X A;  2M64 A;  3NYM A;  3UNG C;  4OD5 A;  4C7O B;  2RSE B;  2R05 A;  4KBL A;  2A0U A;  5KYU A;  4PR9 A;  1YDI A;  4EHP A;  4K7B A;  1YZC A;  3U9M A;  4CIH A;  1LS1 A;  3LLK A;  3RYL A;  4U5D E;  2PFD A;  1BBH A;  1GGQ A;  2WVO A;  4H54 A;  3GEE A;  3O39 A;  4FES A;  4XPX A;  5L3Q A;  4M63 A;  2M4E A;  3H2U A;  3I4U A;  4ZLD A;  3IQC A;  1A7V A;  2ETS A;  2C03 A;  3FOP A;  4YL0 A;  3U3F A;  3PDM P;  3SXK A;  3RH3 A;  1BZ4 A;  3U2M A;  4E17 A;  1JOG A;  2XLO A;  5DS4 A;  2YQY A;  4J7Y A;  4AE4 A;  2J45 A;  2Y69 C;  1JPJ A;  1G5Z A;  2Q7R A;  5EHH A;  4E18 A;  1NU9 C;  2JPU A;  4P6I C;  4BJ6 A;  4E7S A;  2NUT B;  3ITF A;  2CW0 F;  1NU7 D;  4RD9 A;  1TWH A;  1A41 A;  1WOL A;  4ONS A;  1HE9 A;  2J7P D;  3GAN A;  1CGM E;  4IB4 A;  4EIY A;  2X0C A;  2PBE A;  2P7V A;  1RJ9 B;  1VK5 A;  4YWQ A;  2DYS C;  4H4K C;  3DM5 A;  2LFF A;  3ABM C;  3DM9 B;  3C8G A;  5JUA A;  5EK0 A;  4JIO A;  2YZS A;  2J7P A;  4NTB A;  1OQC A;  1QLE C;  1Z5Z A;  3X1O A;  3RKO F;  3EFO B;  4DBQ A;  3U5S A;  2LP4 A;  4N06 A;  3NMI A;  2VH3 A;  2XXA A;  1TR2 A;  1G4W R;  2W4M A;  2XLM A;  5T1D B;  4XEK A;  5JT4 A;  4O79 A;  4J30 B;  5KYX A;  3T6B A;  2P1A A;  2VC9 A;  4X0R A;  4RBN A;  1D0Y A;  1XZQ A;  2H7B A;  1WTY A;  2XRH A;  2Y3D A;  3DAG A;  3HNL A;  4I1O B;  4ZLC A;  1T6I A;  3TD7 A;  4NC3 A;  1CPQ A;  2R7U A;  1JAF A;  4LLC A;  1VLT A;  2YL0 A;  2W45 A;  2XS1 A;  1MMG A;  3W4Y A;  4OIN F;  2D5R B;  2G62 A;  3F47 A;  3AQB A;  1AEP A;  1TWG A;  2P6V A;  2ZXR A;  3AQC A;  1MNE A;  3C62 A;  4F4B A;  4L6R A;  4PJJ A;  3L1M A;  4U5C E;  1XZP A;  4CIP A;  3JCU Q;  3EGD B;  4J7T A;  1OW8 A;  1LE4 A;  4U5H A;  1MMD A;  1YJG A;  2H7O A;  3EPV A;  1OW7 A;  2X51 A;  1VMA A;  1TFK B;  3LUT B;  5DQT A;  5BQH A;  3HLZ A;  1ST6 A;  4PFO A;  4A4A A;  4PJL A;  3ZSU A;  3RVZ A;  2OU6 A;  2A6E F;  2KK1 A;  3QW0 A;  4IRU A;  1R5I D;  1PV3 A;  2Q9A A;  2OOC A;  3GEH A;  2KW3 C;  3V5Z A;  4IGG A;  3GWL A;  4LER A;  2OQM A;  3U9J A;  5B3I A;  4ULW A;  2CDQ A;  2EIJ C;  1I4Z A;  2HSQ A;  5B1B C;  4BJ6 C;  3MBG A;  3ZWI A;  3SXM A;  4WJ0 A;  4EWC A;  2IXM A;  3KPH A;  3S9O A;  4PJM A;  3ZQY A;  3QZC A;  3NRH A;  4W8K A;  1D0Z A;  3TK0 A;  2JD3 A;  3AGT A;  1TQG A;  4BPM A;  3T6G B;  3IQT A;  3Q7L A;  1V54 C;  4OIO F;  2ICW G;  3ECS A;  3L8I A;  4DRJ B;  3N24 A;  2QNL A;  5B1A C;  3DD7 A;  2XSE A;  3EHN A;  1C02 A;  1T9K A;  2LD6 A;  2QTV A;  4CDV A;  2LQG A;  4HFK B;  3QMK A;  1Q0K A;  3ZDL A;  4XLN F;  2VAS A;  1ZHZ A;  3E9V A;  3LS1 A;  3SEO A;  1ZHW A;  3US6 A;  5EGY A;  4D4X A;  1QPU A;  5E3C A;  3W2V A;  4CJG A;  1TWC A;  1M57 C;  2IM8 A;  2IXN A;  1E83 A;  2B0H A;  2Y39 A;  2NUP B;  4I3M A;  4Z9J A;  3J06 A;  4WAB A;  1BR4 A;  3FAP B;  4AK9 A;  5CIV A;  3K1I A;  1CGO A;  3C7J A;  3MX3 A;  4DVZ A;  1T01 A;  1LM3 B;  2HJ3 A;  1LPE A;  3L34 A;  3GOR A;  3CAX A;  2HUJ A;  4G7H F;  4GQH A;  1WAS A;  1KTM A;  3JT1 A;  2HJM A;  2NSG A;  2MYS A;  1ORJ A;  1J8M F;  2A69 F;  3DE8 A;  4LDK A;  4PFP A;  2IYL D;  3CQZ A;  1DOW A;  2YL7 A;  2J8W A;  2KYH A;  5TJ5 E;  2QE9 A;  3EH2 A;  4YT2 A;  2E87 A;  3M4B A;  2HV6 A;  5BQG A;  4NTF A;  1OCO C;  4LLE A;  3U2L A;  3UR3 C;  2BC5 A;  3JYH A;  1QKR A;  1RXQ A;  5KYY A;  5DVW A;  5T3W A;  1YZA A;  4O7G A;  3WHN A;  1L7C A;  4OIQ F;  2HV7 A;  5A69 A;  4E7Z A;  4C7O A;  1RKE B;  2H7V C;  3R2P A;  5A6K A;  2HSB A;  1IW7 F;  4QDL A;  1FMW A;  3AJM A;  1YYJ A;  3K33 A;  4N6H A;  4U5G A;  2FFH A;  2ASR A;  4EUK B;  3PCV A;  4JEB A;  1VYK A;  1EA8 A;  3MYI A;  1RKC A;  4PAC A;  1LI7 A;  1HMD A;  2AP3 A;  4A2N B;  3NDB B;  4PK4 A;  1M6T A;  3JSZ A;  3K7D A;  4JCZ A;  4JC7 A;  4LAC B;  1KU2 A;  2HMZ A;  2KC3 A;  2ZXW C;  4U5B E;  1Z7Q c;  4U9D A;  3VYW A;  3RVY A;  2L6H A;  3S90 A;  2Y3B A;  3U8P A;  5HV9 A;  1SR2 A;  1FNT c;  2CCY A;  3C8G D;  3RW0 A;  2B0J A;  2DB4 A;  3AG1 C;  3EH1 A;  1TFO B;  3WG7 C;  1Q0G A;  5B3S C;  1OCR C;  1MQV A;  1K05 A;  1OR2 A;  3EGX B;  1OXK A;  3NKD A;  4MS2 A;  2NUT A;  5L0D A;  3U3B A;  2PX0 A;  3LS0 A;  1HY5 A;  1ZYR F;  4MVM A;  5A6B D;  5KYN A;  5FZT A;  2KQ9 A;  2XLH A;  4MTF A;  4NTA A;  3HJC A;  5COG A;  4MVZ A;  5T3T A;  1UFB A;  2GA0 A;  1A7D A;  2MHR A;  2Y3H A;  2J9W A;  3SZR A;  3ZVR A;  5KYW B;  4DRI B;  2XM0 A;  3RIP A;  3B9Q A;  1LVK A;  3IEE A;  3KYI A;  5A6B A;  3UGO A;  2I15 A;  4JUR I;  2EPK X;  3Q6M A;  2R7Q A;  3FXH A;  4XPY A;  3LEO A;  3IQ6 A;  3DMD A;  3K1I C;  1FFH A;  2A68 F;  4KNV A;  3L8J A;  1HMO A;  4MVO A;  5CI9 A;  3VRC A;  2R7V A;  1PD0 A;  2FAP B;  2PX3 A;  1GQA A;  2KSF A;  3EFO A;  3K6B A;  1ZVZ A;  2AVK A;  3E70 C;  3JRM O;  3RQE A;  2GFH A;  1Q0D A;  3K1H A;  1S7Z A;  1MMA A;  1M2V B;  4O6Y A;  5JS5 A;  1ZZP A;  3B0P A;  3KMI A;  3U8V A;  3VAY A;  1U0B B;  2WB7 A;  2D4U A;  1O87 A;  3NMJ A;  1QSP A;  2P61 A;  3IHU A;  2C04 A;  5JRA A;  2R7R A;  3KL4 A;  4MW8 A;  3ABK C;  3DXJ F;  5DS6 A;  3NKE A;  3NYL A;  3GM2 A;  4YL3 A;  4CSA A;  2YL1 A;  4RDA A;  3DJN B;  3GWN A;  4K1O A;  5E3A A;  3UMH A;  3W8I A;  2AWC A;  1AUE A;  2A1D D;  3IPM O;  2YWA A;  3LNR A;  5E33 A;  1ZW2 A;  4NQF A;  3GOD A;  1Q0M A;  2YRF A;  4EBK A;  2R25 A;  4C3B A;  5COM A;  4ANJ A;  5F28 E;  3CZ6 A;  4O6N A;  2ZXP A;  3ZG1 A;  5FCL A;  3SXY A;  1H7I A;  2Q4F A;  2EPN A;  1YAR O;  3MLG A;  1PCX A;  4K0D A;  2L6G A;  4BJ1 A;  4E0I A;  2DGJ A;  2OEX A;  3G50 A;  3S84 A;  1BR1 A;  4YK5 A;  4N4W A;  4PJN A;  4FAP B;  5AC5 A;  2LIG A;  1IZM A;  2HS5 A;  3DAF A;  3GM1 A;  1WAT A;  5K0I A;  1ZHY A;  3I5P A;  4MQ9 F;  4YL1 A;  1HW2 A;  3Q6N A;  4G7O F;  4B6I A;  4FWV A;  3HNJ A;  5AC4 A;  4CS8 A;  2J0X A;  1LE2 A;  1YLM A;  1SZI A;  5L0H A;  2WZF A;  1KNY A;  2L9J A;  3IQ5 A;  4IWB A;  3X2Q C;  2YEV A;  2TMV P;  3NMK A;  1D0X A;  2OEV A;  1JRA A;  1ZU4 A;  2VB6 A;  2XM4 A;  3FHD A;  2GAQ A;  3NG1 A;  4MVS A;  2QY9 A;  2OJE D;  4FX5 A;  2OKU A;  1LS4 A;  3LNM B;  4U5F E;  3BRJ A;  4CBE A;  4Q5S F;  3M4C A;  2LSE A;  4G78 A;  1JR8 A;  2GWW A;  3EG9 B;  1FFT C;  5DLJ A;  4HFF B;  3ATP A;  3MYF A;  1NG1 A;  2PNO A;  4XWJ A;  2Q9B A;  2YKZ A;  2MWQ A;  4MVU A;  1NZE A;  1B68 A;  1WWP A;  2FGY A;  4IAQ A;  3R7C A;  1FAP B;  5BUO A;  3ZIB A;  4ULV A;  2RD9 A;  3CEX A;  1HE1 A;  3FAJ A;  4JTA B;  3M1C B;  4MND A;  2EIL C;  1RCP A;  2HZ8 A;  1TWA A;  4I44 A;  3H2V A;  1NFO A;  4LDQ A;  3EHM A;  3OEO A;  2I8B A;  4JTD B;  2W9Y A;  1OR3 A;  4KC9 A;  3RQF A;  3KH2 A;  2UUI A;  1OW6 A;  5E2Q A;  2NUP A;  3U0C A;  4OIP F;  4DJ9 A;  4CSA C;  3N2Z B;  4XPW A;  3QTH A;  2V3C C;  3H65 A;  3S29 A;  3UGP A;  2J9V A;  1C03 A;  4NY3 A;  2R7W A;  4P9F A;  4ER9 A;  1HW1 A;  2XLW A;  2YL3 A;  3DWW A;  4YJW A;  3SXZ A;  1I4Y A;  3WAQ A;  2GDC A;  1WN0 A;  1A0B A;  2DI3 A;  4Z9I A;  1L3P A;  4BJ5 A;  4DOZ A;  3ASO C;  4QI0 A;  3ZC4 A;  256B A;  1QVX A;  1FR0 A;  1SF8 A;  3PHF 2;  2YLD A;  4EBJ A;  4D4N A;  4HEA J;  3O55 A;  2VCC A;  3FVY A;  1T6U A;  5CI8 A;  2EIN C;  3A9C A;  4CS9 A;  2XLV A;  3TJ6 A;  3EZI A;  2XLD A;  3TOL A;  2XLE A;  3A11 A;  3AGU A;  3C63 A;  3N0T A;  1RMV A;  3ABL C;  4HE8 D;  1MMN A;  3EZH A;  1WGW A;  5F5H A;  4CS8 C;  2KNH A;  1RKE A;  2VCA A;  4JTC B;  2F22 A;  1E2X A;  1LI5 A;  1LKX A;  5BQI A;  5KYU B;  1T5O A;  4U9E A;  4JW1 A;  3FMS A;  3AOU A;  5AGF A;  4GEH A;  1R4T A;  5HSW A;  1E84 A;  3T4R A;  2L81 A;  2LFD A;  2L6F A;  4JJF A;  3B0V C;  3DI5 A;  4DXW A;  1C17 M;  1YA7 O;  2R9R B;  3LAY A;  3LES A;  1EI7 A;  4N6C A;  3S27 A;  3RF3 A;  4YT4 A;  2ZPA A;  1LIH A;  2G3V A;  2J0W A;  4AE4 B;  4NCQ A;  4MTG A;  2R7S A;  3EGX A;  5JSL A;  4CS7 A;  4R32 A;  1RJ9 A;  3V7O A;  1JPN A;  1V55 C;  4YT8 A;  4XTK A;  4XQ1 A;  1K40 A;  1O5H A;  2Y3G A;  3AG4 C;  3GM3 A;  4JEA A;  3SP1 A;  4LDR A;  5L0C A;  3B0U X;  1W2W A;  1OCC C;  2LCH A;  3ASN C;  5KYW A;  4O6M A;  5A6J A;  1Z6A A;  1QQ3 A;  2J9U A;  2L7A A;  3I5Q A;  4IJJ A;  2XL6 A;  2J9B A;  2ZXO A;  3KKB A;  2J46 A;  2PP4 A;  3C8G B;  2WL8 A;  4BJT A;  2BE5 F;  4BEM J;  1VTM P;  2YHS A;  1YVI A;  2OCC C;  3DE9 A;  1SYQ A;  3JRT A;  4XEF A;  3JTL O;  4MW3 A;  3M15 A;  4IAR A;  3DKA A;  4U5E E;  2Q3T A;  2Q00 A;  3G4X A;  2XXA B;  2WZL A;  3SYN A;  4J32 B;  4DRH B;  4W8P A;  5KYX B;  1M2V A;  3TQO A;  3OWT A;  4BJ5 C;  4CDY A;  2V26 A;  4OIR F;  3ZQV A;  5L0F A;  3LEV A;  1NBB A;  1Z23 A;  2A6H F;  3HNK A;  1N1C A;  2W4B A;  1QZX A;  1H6G A;  4MTO A;  4JVS A;  2WZG A;  1XWJ A; 
#chains in the Genus database with same CATH homology
 5BQH A;  5K0I A;  3LEO A;  4J7Y A;  3HKK A;  5BQI A;  2Q7R A;  4JRZ A;  4JCZ A;  4JC7 A;  3DWW A;  5HV9 A;  2PNO A;  5BQG A;  4NTF A;  3B29 A;  4YK5 A;  2H8A A;  4AL0 A;  4AL1 A;  4YL1 A;  4WAB A;  4NTB A;  4YL3 A;  4NTA A;  4J7T A;  2UUH A;  2UUI A;  4YL0 A;  4BPM A;  3PCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...