4NTAA

Mus musculus ltc4 synthase in apo form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
147
structure length
147
Chain Sequence
HHHKDEVALLATVTLVGVLLQAYFSLQVISARRAFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQLRLTPLYASARALWLLVAMAALGLLVHFLPGTLRTALFRWLQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Mus Musculus LTC4 synthase in apo form
rcsb
source organism Mus musculus
molecule tags Lyase
total genus 56
structure length 147
sequence length 147
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4ntaA00
2H8AA 4NTFA 2UUIA 5HV9A 4JC7A 4J7YA 4NTBA 4YL3A 5BQGA 2Q7RA 4BPMA 3DWWA 4AL0A 4YL0A 4JRZA 4J7TA 4AL1A 4NTAA 3HKKA 5BQHA 4YL1A 5BQIA 4WABA 3PCVA 2UUHA 4JCZA 5K0IA 4YK5A 3B29A 2PNOA 3LEOA
chains in the Genus database with same CATH superfamily
1CGNA 3S90A 3HNJA 3POVA 2J7PD 3IHUA 3DAFA 2J0XA 1FNTc 1PCXA 4UDVA 2LCHA 3ABMC 4IB4A 4XPYA 3ZTMA 4LDRA 3M79A 2J0WA 3BRJA 4G0HA 2YVKA 3EHNA 3JSZA 4NC3A 5E3AA 1PV3A 3LLIA 4EWCA 5DS5A 2V3CC 1E85A 4WJ0A 2L81A 2Q7RA 1AVOB 4HFFB 5L0GA 2PX0A 3N24A 3R2PA 4CX9A 1CPQA 3DWWA 3TQOA 5A6AA 1G4WR 3LNMB 3UMKA 3ZVRA 2CYDA 1TWHA 1E83A 3KKBA 4N6HA 3K7DA 5COFA 4YT8A 3RH3A 2W4BA 1YYJA 3DKAA 2J9BA 2RSEB 3NG1A 3NYJA 5T3TA 5DLJA 1YYXA 3EGDA 5JSLA 4WGYA 1H9TA 4NQFA 1QVXA 4F4BA 3AJMA 3SXYA 2NPUA 2YL3A 1V74B 3V5ZA 1U0BB 1V54C 2P6VA 3U9JA 3DE9A 3C8GD 3B9QA 2R7UA 1O3UA 2R7QA 3T6BA 1AUEA 2W4MA 3I5QA 3K1IA 2LQGA 4EBBA 1M2VA 1TFKB 5L3VA 2YL1A 3GM3A 4Z9IA 5COGA 4BJ6C 3QTHA 1W2WA 4C3EA 2GA0A 1IW7F 4JIOA 4Q5SF 2BL2A 3RQGA 3EJNA 1FMVA 1O87A 4YT5A 4HE8D 1ZHWA 4O6NA 3NDBB 4N6CA 4JEAA 4MQ9F 4EKWA 3V7OA 2M4EA 3GWNA 2A68F 2XL6A 1GM5A 2KC3A 1H7IA 1YLMA 2YL0A 3AG3C 3F47A 2A0UA 2WZLA 3CQZA 3NMIA 4JCZA 1OKKD 4U5HA 2NUTA 4DJ9A 3B29A 3K33A 4LDKA 5CIVA 2PNOA 2EIKC 3SP1A 1R4TA 3RQFA 2RD9A 3VRCA 1FFHA 2H8AA 4DRHB 2FFHA 1M6TA 5D92A 3MYFA 4U5CE 4EHPA 2R7SA 1LE4A 2R7OA 4IWBA 4Z9JA 1K04A 5L0HA 5L3QA 3KPHA 4YT2A 4MW8A 1BR2A 3DM5A 3Q6MA 4JJFA 2XXAB 2OOCA 3LESA 1XZQA 2OEXA 4HFKB 4O6YA 4OD4A 4I44A 4PJLA 3FOPA 3U8PA 1EQ1A 3SZRA 2B0JA 3AOUA 1VOMA 3ATPA 4FWVA 3U8VA 1MMGA 2A1DD 2LFDA 2GWWA 3B71A 1Q0MA 2D4UA 4PACA 4CSAA 2KQ9A 4BJ1A 1BBHA 3Q7LA 4C7OB 3QVYA 3E70C 2XRHA 3FDQA 5BQHA 2LFFA 2TMVP 4MTFA 3DM9B 4KBLA 3FAJA 4BJ5C 5BQIA 1VYIA 1T6IA 3WG7C 3ZC4A 3WODF 4FAPB 2XLDA 1BZ4A 2VASA 4PJNA 4U5BE 2HSBA 2EILC 2XM4A 2ETSA 3HNLA 3ASNC 5F28E 1NU7D 2QUPA 2FAPB 4LLCA 4U5FE 1LS4A 1VLSA 1MQVA 2X51A 1Q0KA 4JC7A 3B0UX 3MLGA 1OR2A 4DVYP 4EBJA 1JPNA 1MNEA 1TWGA 2A6EF 3EPVA 1YVIA 3C18A 3C8GB 1Z63A 3NMKA 2IYLD 3S28A 2A6HF 3QZCA 4BEMJ 3C62A 1T01A 4MNDA 4MVQA 1RMVA 2L6FA 2WZFA 3LEVA 1V4AA 3G4ZA 3HKKA 3PHF2 1CPRA 3I4UA 5JLIA 2BC5A 1F1MA 3GODA 3GEEA 2L9JA 4JKVA 4IJJA 1C03A 4K0DA 4XPWA 1ZU5A 3EFOA 3UMIA 5KYWA 4YK5A 3RVYA 3X2QC 3KMIA 1OQCA 3RKOF 3ZQVA 1S05A 1LPEA 3GEHA 3O6XA 3T6GB 1ZU4A 1Y4CA 1G8XA 2DGJA 1Z7Qc 1E86A 3DJNB 1YJGA 4OD5A 4JW1A 4IARA 4BEJA 3BEHA 3B0PA 2VB6A 4M63A 2WVOA 2MYSA 2ZXPA 4JVSA 5A6JA 3HLZA 2AVKA 4C3BA 1TR2A 1V55C 1FFTC 3DAGA 1HE9A 4YL0A 2WL8A 4PK4A 2R7WA 2QLAA 1NSGB 3CAXA 1GGQA 2EINC 3HTKC 3GORA 3E9VA 1NFOA 3CSKA 3JRMO 5CI9A 4H54A 4BJ6A 1T9KA 2BE5F 3RQEA 1E2XA 1M57C 4DBRA 2UUHA 4MTOA 2P0NA 4W8KA 3AQBA 3V5XA 3EH2A 3AG2C 3SNHA 4U5DE 3X1OA 256BA 2E87A 4OIRF 2NSFA 2VCBA 5KYXB 3ZSUA 3EGXA 3ZWIA 1D0XA 4G7HF 2FGYA 3U3FA 2IXNA 3U3BA 4GQHA 1BDJB 1VK5A 2J46A 1HY5A 2I15A 2LSEA 2WZGA 3VYWA 5HV9A 3LLKA 3RFYA 5E2QA 1NLXA 3Q7GA 3FMSA 2Y3HA 1C02A 2WB7A 2XLEA 1WATA 3C63A 3CEXA 2NUPA 4MVZA 1APCA 2X0CA 3US6A 4AE4B 1ZHYA 3DZAA 1ZZPA 2DYRC 2YKZA 4CJOA 4K7BA 1J8MF 5KYYB 1JPJA 2Q00A 2Q9AA 1RXQA 2R7RA 3AG4C 5BUOA 4MW3A 1VLTA 1JRAA 5COMA 2HMQA 1U6HA 3S27A 3TOMA 4X0RA 2R7TA 1Q0GA 3LEOA 1OCCC 1OW7A 3DI5A 3S29A 4BJ5A 2XM0A 3A9CA 5EGYA 2WVNA 3DE8A 2R02A 3LAYA 3PMRA 1PD1A 2F22A 4JJGA 2KGOA 3ZQYA 3PDMP 2HJ3A 3N0TA 3IPMO 2HKVA 4I3MA 5AC5A 1M2OA 1QKRA 1A7DA 4D4XA 2IXPA 3WAQA 4MVSA 4ULWA 3LNRA 1D1BA 3NYMA 4LLEA 4MTGA 4E0HA 4G7OF 3UNGC 2R03A 2LD6A 2R05A 3EG9B 3EH1A 4O7GA 4XEKA 5T1DB 1YDIA 4NTAA 3JZ0A 4O79A 4Q7CA 4Z9HA 4G7ZF 3EZHA 2O9XA 3UGOA 3IQ5A 1WGWA 4JCHA 4JTAB 4WABA 1JR8A 2A69F 2Q3TA 4L6RA 4JZAA 5KYUB 1RKEA 2ZPAA 2J9VA 3AQCA 3DD7A 5B1AC 1A7VA 3MX3A 1MMDA 1R5ID 1RCPA 3RW0A 3JTLO 4LDQA 4CDAA 3NRHA 5EHHA 1ORSC 3MBGA 4KNWA 2ICWG 4GEHA 4J7YA 5A69A 4MVMA 3SXKA 1T6QA 1EA8A 2CNWA 1WTYA 3QW1A 5FZTA 5BQGA 1WASA 2EPLX 2H7BA 2QNLA 4XLPF 3EFOB 1ZHTA 4YWQA 3SEOA 5B3SC 2ASRA 4JEBA 2R7XA 1TQGA 4E18A 1QZXA 2B0HA 1VMAA 3UMHA 2DYSC 2AWYA 1LI7A 2JPUA 2XLVA 2YZSA 3OEOA 2NSGA 2YLDA 2Y3GA 5A6KA 3IEEA 1EKYA 1ORJA 2J45A 2Y39A 2KK1A 3M4CA 3HNKA 3O10A 1RKCA 5JT4A 5L0CA 1KTMA 4EUKB 1SF8A 1SYQA 4CS8C 4J30B 2VH3A 1NFNA 2VCCA 3W4YA 4ER9A 1YAUO 1B68A 2YWAA 3O39A 3W2WA 4AX2A 4QI2A 1H9GA 2PF4E 4GYTA 1VB5A 3ZTZA 1ZW2A 3A11A 2DI3A 1WOLA 3L34A 4XLNF 1TFOB 4PR9A 1BR4A 1OW8A 3ABLC 1GQAA 1G4US 2R7VA 3TJ6A 4DVZA 2EPMX 2Q4FA 4MVUA 2H7VC 3U5SA 1Y6DA 3JT1A 4XQ1A 1ST6A 1CGME 3VF0A 2XLWA 1HMDA 3IQTA 3EZIA 2DB4A 2NUPB 2AU5A 1ZVZA 1JAFA 5B1BC 4OINF 1OCOC 2G62A 2HMZA 2UUIA 1A7EA 4XWJA 2AP3A 1KU2A 4CIPA 2IXOA 2OJED 1FAPB 3FVYA 2R9RB 2Y3DA 5A6BD 3JSEO 3RVZA 1Q0FA 1LM3B 4QDLA 1KNYA 5JP7A 4OIOF 3EGDB 5A6BA 1FR0A 4AL0A 4FX5A 2OQMA 3ASOC 1L7CA 4AL1A 2J7PA 3NKEA 2L6HA 2G3VA 3TOLA 5L0IA 2Z15A 2XXAA 5L0JA 5JS5A 2WVQA 1J8YF 2R25A 1NZEA 5TJ5E 1HW1A 5FCLA 2XSEA 2OCCC 4IAOA 5L0DA 3N2ZB 1LKXA 2HV7A 5HSWA 2XL4A 1D0YA 4CBEA 4MVRA 1M2VB 3T4RA 1RJ9A 5E3CA 4LACB 1ZHZA 2HFIA 3JYHA 5AC4A 4NTFA 1QPUA 1DOWA 1XZPA 2OKUA 3K1HA 3FXHA 2HS5A 5B3IA 3GEIA 4J32B 4RD9A 4CIHA 2IOQA 2CDQA 3IQ6A 1CGOA 2M64A 1NG1A 4N4WA 2LK4A 3H65A 4JE9A 1HMOA 4JRZA 4J7TA 1HE1A 3NYLA 4PJMA 3C8GA 2NUTB 2YQYA 3TJ5A 4OIPF 1A0BA 2J9UA 2YRFA 1YA7O 3TULA 1PD0A 2XS1A 3WHNA 4ANJA 2HSQA 4YL1A 4CDYA 3MYIA 2YL7A 3S0XA 2Q9BA 3K6BA 4PFPA 1AEPA 4DRIB 2QTVA 3H2UA 5D91A 3T6JA 1EI7A 5JUAA 1M56C 2HZ8A 1GS9A 2P7VA 4XEFA 2IM8A 3QW0A 2CW0F 5DQTA 2EIJC 4EIYA 1SMYF 1OKKA 4JTDB 3ECSA 1OCZC 1ZYRF 3AG1C 4JTCB 4R32A 5KYNA 2Q9CA 3G4XA 1U89A 3S84A 2MHRA 4IRUA 4CS8A 2GDCA 3KYJA 3H2VA 3W2VA 1Z6AA 3C8ZA 5DVWA 3RYLA 1HW2A 2HUJA 3OA1A 1WWPA 1XWJA 3FOOA 1YZCA 2J9WA 3EHMA 4ONSA 3ABKC 4A2NB 4E7ZA 2OJQA 2JX0A 5K0IA 1OR3A 3CZ6A 1WN0A 3M15A 2CCYA 1A41A 1QQ3A 1MMNA 3JYYA 2C04A 4E0IA 4ZLDA 2KNHA 5IY5C 5JVEA 3ITFA 1JOGA 3M4BA 4E17A 3DMDA 1UG7A 4CJGA 4D4NA 1LS1A 2GAQA 4HEAJ 4A4AA 5KYXA 3J06A 1E84A 2D5RB 4CS9C 2PBEA 2L7AA 2W45A 1FTSA 2VCAA 2AWCA 3IQCA 2VC9A 4NTBA 4XPXA 3T9OA 3K66A 3B0VC 1C17M 2V26A 3QMKA 1QLEC 1NBBA 4K1OA 1OW6A 4RBNA 4BPMA 4EBKA 2ZXOA 5F5FA 1K05A 5KYWB 2YEVA 3LUTB 4I1OB 4AE4A 3I5PA 3U2LA 2ZXWC 1G5ZA 2JD3A 2XLHA 4JURI 3RIPA 3UGPA 1S7ZA 5JRAA 5KYYA 1ZW3A 1I4ZA 1Z5ZA 4I1MA 1D1AA 2KYHA 5L0FA 4U9DA 5GPGB 2KW3C 2IBFA 3EQLF 2HJMA 3NKDA 5CI8A 4H4KC 1TWCA 1Z3IX 2XLMA 3W8IA 1TKNA 2XL8A 2YHSA 4DBQA 3ZIBA 2GFHA 4QI0A 2OU6A 3SXZA 2EIMC 5DQZA 4ULVA 4G78A 4KC9A 5EK0A 4XTKA 2EPKX 1SR2A 3DXJF 3GWLA 3TD7A 3U9MA 2PX3A 1VTMP 2EPNA 4WGZA 1BR1A 3MFNA 3RF3A 2Y69C 3VAYA 4AK9A 3O55A 4CS7A 1H6GA 2ZXRA 2P1AA 2PP4A 4N06A 4P9FA 4U5GA 4KI2A 4RDAA 1ORYA 2OEVA 1RJ9B 4Q4ZF 3EGXB 3G50A 1ZHXA 1D0ZA 1N1CA 5AGFA 3EG9A 1IZMA 3VM6A 1T5OA 2H7OA 1QSPA 2CNWD 3K1IC 4YJWA 2G3KA 4FESA 4NY3A 1FMWA 3GANA 2HV6A 2YLIA 3L0IA 1T6UA 1SZIA 3TK0A 5DS4A 4E7SA 4BG0A 3JRTA 4LERA 1LI5A 3SYNA 5KYUA 2W9YA 3GM1A 2OG2A 5T3WA 1LVKA 2C03A 2LP4A 3F46A 3KH2A 5E33A 4MVOA 3SXMA 4U9EA 2MWQA 3U0CA 2YLGA 2P61A 3OWTA 4YL3A 3GM2A 1I5NA 4DRJB 4BJTA 4IAQA 4KNVA 3L1MA 1VYKA 2EPOA 3HNIA 1I4YA 2A0BA 2ZD9A 1OXKA 3L8IA 1Q0DA 4B6IA 3HJCA 1OXBA 3QVZA 1D1CA 2L6GA 4NCQA 4P9TA 1DOVA 1MNDA 1Z23A 2IXMA 2J8WA 1LE2A 3KL4A 3ZG1A 1NU9C 4C7OA 3L8JA 4DOZA 3JCUQ 1L3PA 1O5HA 5F5HA 2LIGA 1LIHA 1MMAA 3U2MA 2I8BA 2PFDA 3R7CA 4DXWA 4CSAC 4OIQF 3UR3C 3LS0A 2Y3BA 4YT4A 4YN0B 2XS8A 1YARO 3AGTA 2KSFA 2XLOA 3AGUA 4IGGA 3C7JA 4P6IC 1K40A 4ZLCA 4U5EE 1UFBA 5DS6A 1YZAA 3W8HA 1JMWA 4PFOA 1OCRC 4O6MA 3V5YA 3M1CB 4CS9A 1RKEB 3FHDA 3NMJA 1TWAA 2KJGA 3FAPB 3S9OA 3PCVA 4MS2A 2QE9A 4C3DA 4XEVA 2QY9A 1YA9A 3KYIA 3ZDLA 3LS1A 4PJJA 3DJUB 4CDVA 3LJBA 3Q6NA 4W8PA 2CGEA 2NG1A
chains in the Genus database with same CATH topology
2H8AA 4NTFA 2UUIA 5HV9A 4JC7A 4J7YA 4NTBA 4YL3A 5BQGA 2Q7RA 4BPMA 3DWWA 4AL0A 4YL0A 4JRZA 4J7TA 4AL1A 4NTAA 3HKKA 5BQHA 4YL1A 5BQIA 4WABA 3PCVA 2UUHA 4JCZA 5K0IA 4YK5A 3B29A 2PNOA 3LEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H8A A;  4NTF A;  2UUI A;  5HV9 A;  4JC7 A;  4J7Y A;  4NTB A;  4YL3 A;  5BQG A;  2Q7R A;  4BPM A;  3DWW A;  4AL0 A;  4YL0 A;  4JRZ A;  4J7T A;  4AL1 A;  4NTA A;  3HKK A;  5BQH A;  4YL1 A;  5BQI A;  4WAB A;  3PCV A;  2UUH A;  4JCZ A;  5K0I A;  4YK5 A;  3B29 A;  2PNO A;  3LEO A; 
#chains in the Genus database with same CATH topology
 1CGN A;  3S90 A;  3HNJ A;  3POV A;  2J7P D;  3IHU A;  3DAF A;  2J0X A;  1FNT c;  1PCX A;  4UDV A;  2LCH A;  3ABM C;  4IB4 A;  4XPY A;  3ZTM A;  4LDR A;  3M79 A;  2J0W A;  3BRJ A;  4G0H A;  2YVK A;  3EHN A;  3JSZ A;  4NC3 A;  5E3A A;  1PV3 A;  3LLI A;  4EWC A;  5DS5 A;  2V3C C;  1E85 A;  4WJ0 A;  2L81 A;  2Q7R A;  1AVO B;  4HFF B;  5L0G A;  2PX0 A;  3N24 A;  3R2P A;  4CX9 A;  1CPQ A;  3DWW A;  3TQO A;  5A6A A;  1G4W R;  3LNM B;  3UMK A;  3ZVR A;  2CYD A;  1TWH A;  1E83 A;  3KKB A;  4N6H A;  3K7D A;  5COF A;  4YT8 A;  3RH3 A;  2W4B A;  1YYJ A;  3DKA A;  2J9B A;  2RSE B;  3NG1 A;  3NYJ A;  5T3T A;  5DLJ A;  1YYX A;  3EGD A;  5JSL A;  4WGY A;  1H9T A;  4NQF A;  1QVX A;  4F4B A;  3AJM A;  3SXY A;  2NPU A;  2YL3 A;  1V74 B;  3V5Z A;  1U0B B;  1V54 C;  2P6V A;  3U9J A;  3DE9 A;  3C8G D;  3B9Q A;  2R7U A;  1O3U A;  2R7Q A;  3T6B A;  1AUE A;  2W4M A;  3I5Q A;  3K1I A;  2LQG A;  4EBB A;  1M2V A;  1TFK B;  5L3V A;  2YL1 A;  3GM3 A;  4Z9I A;  5COG A;  4BJ6 C;  3QTH A;  1W2W A;  4C3E A;  2GA0 A;  1IW7 F;  4JIO A;  4Q5S F;  2BL2 A;  3RQG A;  3EJN A;  1FMV A;  1O87 A;  4YT5 A;  4HE8 D;  1ZHW A;  4O6N A;  3NDB B;  4N6C A;  4JEA A;  4MQ9 F;  4EKW A;  3V7O A;  2M4E A;  3GWN A;  2A68 F;  2XL6 A;  1GM5 A;  2KC3 A;  1H7I A;  1YLM A;  2YL0 A;  3AG3 C;  3F47 A;  2A0U A;  2WZL A;  3CQZ A;  3NMI A;  4JCZ A;  1OKK D;  4U5H A;  2NUT A;  4DJ9 A;  3B29 A;  3K33 A;  4LDK A;  5CIV A;  2PNO A;  2EIK C;  3SP1 A;  1R4T A;  3RQF A;  2RD9 A;  3VRC A;  1FFH A;  2H8A A;  4DRH B;  2FFH A;  1M6T A;  5D92 A;  3MYF A;  4U5C E;  4EHP A;  2R7S A;  1LE4 A;  2R7O A;  4IWB A;  4Z9J A;  1K04 A;  5L0H A;  5L3Q A;  3KPH A;  4YT2 A;  4MW8 A;  1BR2 A;  3DM5 A;  3Q6M A;  4JJF A;  2XXA B;  2OOC A;  3LES A;  1XZQ A;  2OEX A;  4HFK B;  4O6Y A;  4OD4 A;  4I44 A;  4PJL A;  3FOP A;  3U8P A;  1EQ1 A;  3SZR A;  2B0J A;  3AOU A;  1VOM A;  3ATP A;  4FWV A;  3U8V A;  1MMG A;  2A1D D;  2LFD A;  2GWW A;  3B71 A;  1Q0M A;  2D4U A;  4PAC A;  4CSA A;  2KQ9 A;  4BJ1 A;  1BBH A;  3Q7L A;  4C7O B;  3QVY A;  3E70 C;  2XRH A;  3FDQ A;  5BQH A;  2LFF A;  2TMV P;  4MTF A;  3DM9 B;  4KBL A;  3FAJ A;  4BJ5 C;  5BQI A;  1VYI A;  1T6I A;  3WG7 C;  3ZC4 A;  3WOD F;  4FAP B;  2XLD A;  1BZ4 A;  2VAS A;  4PJN A;  4U5B E;  2HSB A;  2EIL C;  2XM4 A;  2ETS A;  3HNL A;  3ASN C;  5F28 E;  1NU7 D;  2QUP A;  2FAP B;  4LLC A;  4U5F E;  1LS4 A;  1VLS A;  1MQV A;  2X51 A;  1Q0K A;  4JC7 A;  3B0U X;  3MLG A;  1OR2 A;  4DVY P;  4EBJ A;  1JPN A;  1MNE A;  1TWG A;  2A6E F;  3EPV A;  1YVI A;  3C18 A;  3C8G B;  1Z63 A;  3NMK A;  2IYL D;  3S28 A;  2A6H F;  3QZC A;  4BEM J;  3C62 A;  1T01 A;  4MND A;  4MVQ A;  1RMV A;  2L6F A;  2WZF A;  3LEV A;  1V4A A;  3G4Z A;  3HKK A;  3PHF 2;  1CPR A;  3I4U A;  5JLI A;  2BC5 A;  1F1M A;  3GOD A;  3GEE A;  2L9J A;  4JKV A;  4IJJ A;  1C03 A;  4K0D A;  4XPW A;  1ZU5 A;  3EFO A;  3UMI A;  5KYW A;  4YK5 A;  3RVY A;  3X2Q C;  3KMI A;  1OQC A;  3RKO F;  3ZQV A;  1S05 A;  1LPE A;  3GEH A;  3O6X A;  3T6G B;  1ZU4 A;  1Y4C A;  1G8X A;  2DGJ A;  1Z7Q c;  1E86 A;  3DJN B;  1YJG A;  4OD5 A;  4JW1 A;  4IAR A;  4BEJ A;  3BEH A;  3B0P A;  2VB6 A;  4M63 A;  2WVO A;  2MYS A;  2ZXP A;  4JVS A;  5A6J A;  3HLZ A;  2AVK A;  4C3B A;  1TR2 A;  1V55 C;  1FFT C;  3DAG A;  1HE9 A;  4YL0 A;  2WL8 A;  4PK4 A;  2R7W A;  2QLA A;  1NSG B;  3CAX A;  1GGQ A;  2EIN C;  3HTK C;  3GOR A;  3E9V A;  1NFO A;  3CSK A;  3JRM O;  5CI9 A;  4H54 A;  4BJ6 A;  1T9K A;  2BE5 F;  3RQE A;  1E2X A;  1M57 C;  4DBR A;  2UUH A;  4MTO A;  2P0N A;  4W8K A;  3AQB A;  3V5X A;  3EH2 A;  3AG2 C;  3SNH A;  4U5D E;  3X1O A;  256B A;  2E87 A;  4OIR F;  2NSF A;  2VCB A;  5KYX B;  3ZSU A;  3EGX A;  3ZWI A;  1D0X A;  4G7H F;  2FGY A;  3U3F A;  2IXN A;  3U3B A;  4GQH A;  1BDJ B;  1VK5 A;  2J46 A;  1HY5 A;  2I15 A;  2LSE A;  2WZG A;  3VYW A;  5HV9 A;  3LLK A;  3RFY A;  5E2Q A;  1NLX A;  3Q7G A;  3FMS A;  2Y3H A;  1C02 A;  2WB7 A;  2XLE A;  1WAT A;  3C63 A;  3CEX A;  2NUP A;  4MVZ A;  1APC A;  2X0C A;  3US6 A;  4AE4 B;  1ZHY A;  3DZA A;  1ZZP A;  2DYR C;  2YKZ A;  4CJO A;  4K7B A;  1J8M F;  5KYY B;  1JPJ A;  2Q00 A;  2Q9A A;  1RXQ A;  2R7R A;  3AG4 C;  5BUO A;  4MW3 A;  1VLT A;  1JRA A;  5COM A;  2HMQ A;  1U6H A;  3S27 A;  3TOM A;  4X0R A;  2R7T A;  1Q0G A;  3LEO A;  1OCC C;  1OW7 A;  3DI5 A;  3S29 A;  4BJ5 A;  2XM0 A;  3A9C A;  5EGY A;  2WVN A;  3DE8 A;  2R02 A;  3LAY A;  3PMR A;  1PD1 A;  2F22 A;  4JJG A;  2KGO A;  3ZQY A;  3PDM P;  2HJ3 A;  3N0T A;  3IPM O;  2HKV A;  4I3M A;  5AC5 A;  1M2O A;  1QKR A;  1A7D A;  4D4X A;  2IXP A;  3WAQ A;  4MVS A;  4ULW A;  3LNR A;  1D1B A;  3NYM A;  4LLE A;  4MTG A;  4E0H A;  4G7O F;  3UNG C;  2R03 A;  2LD6 A;  2R05 A;  3EG9 B;  3EH1 A;  4O7G A;  4XEK A;  5T1D B;  1YDI A;  4NTA A;  3JZ0 A;  4O79 A;  4Q7C A;  4Z9H A;  4G7Z F;  3EZH A;  2O9X A;  3UGO A;  3IQ5 A;  1WGW A;  4JCH A;  4JTA B;  4WAB A;  1JR8 A;  2A69 F;  2Q3T A;  4L6R A;  4JZA A;  5KYU B;  1RKE A;  2ZPA A;  2J9V A;  3AQC A;  3DD7 A;  5B1A C;  1A7V A;  3MX3 A;  1MMD A;  1R5I D;  1RCP A;  3RW0 A;  3JTL O;  4LDQ A;  4CDA A;  3NRH A;  5EHH A;  1ORS C;  3MBG A;  4KNW A;  2ICW G;  4GEH A;  4J7Y A;  5A69 A;  4MVM A;  3SXK A;  1T6Q A;  1EA8 A;  2CNW A;  1WTY A;  3QW1 A;  5FZT A;  5BQG A;  1WAS A;  2EPL X;  2H7B A;  2QNL A;  4XLP F;  3EFO B;  1ZHT A;  4YWQ A;  3SEO A;  5B3S C;  2ASR A;  4JEB A;  2R7X A;  1TQG A;  4E18 A;  1QZX A;  2B0H A;  1VMA A;  3UMH A;  2DYS C;  2AWY A;  1LI7 A;  2JPU A;  2XLV A;  2YZS A;  3OEO A;  2NSG A;  2YLD A;  2Y3G A;  5A6K A;  3IEE A;  1EKY A;  1ORJ A;  2J45 A;  2Y39 A;  2KK1 A;  3M4C A;  3HNK A;  3O10 A;  1RKC A;  5JT4 A;  5L0C A;  1KTM A;  4EUK B;  1SF8 A;  1SYQ A;  4CS8 C;  4J30 B;  2VH3 A;  1NFN A;  2VCC A;  3W4Y A;  4ER9 A;  1YAU O;  1B68 A;  2YWA A;  3O39 A;  3W2W A;  4AX2 A;  4QI2 A;  1H9G A;  2PF4 E;  4GYT A;  1VB5 A;  3ZTZ A;  1ZW2 A;  3A11 A;  2DI3 A;  1WOL A;  3L34 A;  4XLN F;  1TFO B;  4PR9 A;  1BR4 A;  1OW8 A;  3ABL C;  1GQA A;  1G4U S;  2R7V A;  3TJ6 A;  4DVZ A;  2EPM X;  2Q4F A;  4MVU A;  2H7V C;  3U5S A;  1Y6D A;  3JT1 A;  4XQ1 A;  1ST6 A;  1CGM E;  3VF0 A;  2XLW A;  1HMD A;  3IQT A;  3EZI A;  2DB4 A;  2NUP B;  2AU5 A;  1ZVZ A;  1JAF A;  5B1B C;  4OIN F;  1OCO C;  2G62 A;  2HMZ A;  2UUI A;  1A7E A;  4XWJ A;  2AP3 A;  1KU2 A;  4CIP A;  2IXO A;  2OJE D;  1FAP B;  3FVY A;  2R9R B;  2Y3D A;  5A6B D;  3JSE O;  3RVZ A;  1Q0F A;  1LM3 B;  4QDL A;  1KNY A;  5JP7 A;  4OIO F;  3EGD B;  5A6B A;  1FR0 A;  4AL0 A;  4FX5 A;  2OQM A;  3ASO C;  1L7C A;  4AL1 A;  2J7P A;  3NKE A;  2L6H A;  2G3V A;  3TOL A;  5L0I A;  2Z15 A;  2XXA A;  5L0J A;  5JS5 A;  2WVQ A;  1J8Y F;  2R25 A;  1NZE A;  5TJ5 E;  1HW1 A;  5FCL A;  2XSE A;  2OCC C;  4IAO A;  5L0D A;  3N2Z B;  1LKX A;  2HV7 A;  5HSW A;  2XL4 A;  1D0Y A;  4CBE A;  4MVR A;  1M2V B;  3T4R A;  1RJ9 A;  5E3C A;  4LAC B;  1ZHZ A;  2HFI A;  3JYH A;  5AC4 A;  4NTF A;  1QPU A;  1DOW A;  1XZP A;  2OKU A;  3K1H A;  3FXH A;  2HS5 A;  5B3I A;  3GEI A;  4J32 B;  4RD9 A;  4CIH A;  2IOQ A;  2CDQ A;  3IQ6 A;  1CGO A;  2M64 A;  1NG1 A;  4N4W A;  2LK4 A;  3H65 A;  4JE9 A;  1HMO A;  4JRZ A;  4J7T A;  1HE1 A;  3NYL A;  4PJM A;  3C8G A;  2NUT B;  2YQY A;  3TJ5 A;  4OIP F;  1A0B A;  2J9U A;  2YRF A;  1YA7 O;  3TUL A;  1PD0 A;  2XS1 A;  3WHN A;  4ANJ A;  2HSQ A;  4YL1 A;  4CDY A;  3MYI A;  2YL7 A;  3S0X A;  2Q9B A;  3K6B A;  4PFP A;  1AEP A;  4DRI B;  2QTV A;  3H2U A;  5D91 A;  3T6J A;  1EI7 A;  5JUA A;  1M56 C;  2HZ8 A;  1GS9 A;  2P7V A;  4XEF A;  2IM8 A;  3QW0 A;  2CW0 F;  5DQT A;  2EIJ C;  4EIY A;  1SMY F;  1OKK A;  4JTD B;  3ECS A;  1OCZ C;  1ZYR F;  3AG1 C;  4JTC B;  4R32 A;  5KYN A;  2Q9C A;  3G4X A;  1U89 A;  3S84 A;  2MHR A;  4IRU A;  4CS8 A;  2GDC A;  3KYJ A;  3H2V A;  3W2V A;  1Z6A A;  3C8Z A;  5DVW A;  3RYL A;  1HW2 A;  2HUJ A;  3OA1 A;  1WWP A;  1XWJ A;  3FOO A;  1YZC A;  2J9W A;  3EHM A;  4ONS A;  3ABK C;  4A2N B;  4E7Z A;  2OJQ A;  2JX0 A;  5K0I A;  1OR3 A;  3CZ6 A;  1WN0 A;  3M15 A;  2CCY A;  1A41 A;  1QQ3 A;  1MMN A;  3JYY A;  2C04 A;  4E0I A;  4ZLD A;  2KNH A;  5IY5 C;  5JVE A;  3ITF A;  1JOG A;  3M4B A;  4E17 A;  3DMD A;  1UG7 A;  4CJG A;  4D4N A;  1LS1 A;  2GAQ A;  4HEA J;  4A4A A;  5KYX A;  3J06 A;  1E84 A;  2D5R B;  4CS9 C;  2PBE A;  2L7A A;  2W45 A;  1FTS A;  2VCA A;  2AWC A;  3IQC A;  2VC9 A;  4NTB A;  4XPX A;  3T9O A;  3K66 A;  3B0V C;  1C17 M;  2V26 A;  3QMK A;  1QLE C;  1NBB A;  4K1O A;  1OW6 A;  4RBN A;  4BPM A;  4EBK A;  2ZXO A;  5F5F A;  1K05 A;  5KYW B;  2YEV A;  3LUT B;  4I1O B;  4AE4 A;  3I5P A;  3U2L A;  2ZXW C;  1G5Z A;  2JD3 A;  2XLH A;  4JUR I;  3RIP A;  3UGP A;  1S7Z A;  5JRA A;  5KYY A;  1ZW3 A;  1I4Z A;  1Z5Z A;  4I1M A;  1D1A A;  2KYH A;  5L0F A;  4U9D A;  5GPG B;  2KW3 C;  2IBF A;  3EQL F;  2HJM A;  3NKD A;  5CI8 A;  4H4K C;  1TWC A;  1Z3I X;  2XLM A;  3W8I A;  1TKN A;  2XL8 A;  2YHS A;  4DBQ A;  3ZIB A;  2GFH A;  4QI0 A;  2OU6 A;  3SXZ A;  2EIM C;  5DQZ A;  4ULV A;  4G78 A;  4KC9 A;  5EK0 A;  4XTK A;  2EPK X;  1SR2 A;  3DXJ F;  3GWL A;  3TD7 A;  3U9M A;  2PX3 A;  1VTM P;  2EPN A;  4WGZ A;  1BR1 A;  3MFN A;  3RF3 A;  2Y69 C;  3VAY A;  4AK9 A;  3O55 A;  4CS7 A;  1H6G A;  2ZXR A;  2P1A A;  2PP4 A;  4N06 A;  4P9F A;  4U5G A;  4KI2 A;  4RDA A;  1ORY A;  2OEV A;  1RJ9 B;  4Q4Z F;  3EGX B;  3G50 A;  1ZHX A;  1D0Z A;  1N1C A;  5AGF A;  3EG9 A;  1IZM A;  3VM6 A;  1T5O A;  2H7O A;  1QSP A;  2CNW D;  3K1I C;  4YJW A;  2G3K A;  4FES A;  4NY3 A;  1FMW A;  3GAN A;  2HV6 A;  2YLI A;  3L0I A;  1T6U A;  1SZI A;  3TK0 A;  5DS4 A;  4E7S A;  4BG0 A;  3JRT A;  4LER A;  1LI5 A;  3SYN A;  5KYU A;  2W9Y A;  3GM1 A;  2OG2 A;  5T3W A;  1LVK A;  2C03 A;  2LP4 A;  3F46 A;  3KH2 A;  5E33 A;  4MVO A;  3SXM A;  4U9E A;  2MWQ A;  3U0C A;  2YLG A;  2P61 A;  3OWT A;  4YL3 A;  3GM2 A;  1I5N A;  4DRJ B;  4BJT A;  4IAQ A;  4KNV A;  3L1M A;  1VYK A;  2EPO A;  3HNI A;  1I4Y A;  2A0B A;  2ZD9 A;  1OXK A;  3L8I A;  1Q0D A;  4B6I A;  3HJC A;  1OXB A;  3QVZ A;  1D1C A;  2L6G A;  4NCQ A;  4P9T A;  1DOV A;  1MND A;  1Z23 A;  2IXM A;  2J8W A;  1LE2 A;  3KL4 A;  3ZG1 A;  1NU9 C;  4C7O A;  3L8J A;  4DOZ A;  3JCU Q;  1L3P A;  1O5H A;  5F5H A;  2LIG A;  1LIH A;  1MMA A;  3U2M A;  2I8B A;  2PFD A;  3R7C A;  4DXW A;  4CSA C;  4OIQ F;  3UR3 C;  3LS0 A;  2Y3B A;  4YT4 A;  4YN0 B;  2XS8 A;  1YAR O;  3AGT A;  2KSF A;  2XLO A;  3AGU A;  4IGG A;  3C7J A;  4P6I C;  1K40 A;  4ZLC A;  4U5E E;  1UFB A;  5DS6 A;  1YZA A;  3W8H A;  1JMW A;  4PFO A;  1OCR C;  4O6M A;  3V5Y A;  3M1C B;  4CS9 A;  1RKE B;  3FHD A;  3NMJ A;  1TWA A;  2KJG A;  3FAP B;  3S9O A;  3PCV A;  4MS2 A;  2QE9 A;  4C3D A;  4XEV A;  2QY9 A;  1YA9 A;  3KYI A;  3ZDL A;  3LS1 A;  4PJJ A;  3DJU B;  4CDV A;  3LJB A;  3Q6N A;  4W8P A;  2CGE A;  2NG1 A; 
#chains in the Genus database with same CATH homology
 2H8A A;  4NTF A;  2UUI A;  5HV9 A;  4JC7 A;  4J7Y A;  4NTB A;  4YL3 A;  5BQG A;  2Q7R A;  4BPM A;  3DWW A;  4AL0 A;  4YL0 A;  4JRZ A;  4J7T A;  4AL1 A;  4NTA A;  3HKK A;  5BQH A;  4YL1 A;  5BQI A;  4WAB A;  3PCV A;  2UUH A;  4JCZ A;  5K0I A;  4YK5 A;  3B29 A;  2PNO A;  3LEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...