4NTAA

Mus musculus ltc4 synthase in apo form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
147
structure length
147
Chain Sequence
HHHKDEVALLATVTLVGVLLQAYFSLQVISARRAFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQLRLTPLYASARALWLLVAMAALGLLVHFLPGTLRTALFRWLQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
publication title Mus Musculus LTC4 synthase in apo form
rcsb
source organism Mus musculus
total genus 56
structure length 147
sequence length 147
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4ntaA00
5HV9A 4YL3A 4JRZA 4JCZA 2UUHA 3DWWA 4AL0A 3HKKA 4YL1A 3PCVA 2PNOA 4WABA 2H8AA 5BQGA 2UUIA 5K0IA 4JC7A 4NTBA 4YL0A 4YK5A 4AL1A 4J7YA 5BQIA 4NTAA 3B29A 4NTFA 3LEOA 2Q7RA 4J7TA 4BPMA 5BQHA
chains in the Genus database with same CATH superfamily
4IGGA 3GEEA 1ZYRF 3K33A 2J8WA 1WWPA 1ZW2A 3UMIA 1RCPA 2Y3DA 3ASOC 4FWVA 3W2VA 2HSQA 2PP4A 2XLDA 2HV7A 5E3AA 2R7UA 3VM6A 4WABA 1LIHA 2Q9AA 3GWLA 3Q6NA 1Z7Qc 3RVYA 4EUKB 4BEMJ 1W2WA 1OR3A 3PHF2 4YJWA 3MYFA 4HEAJ 4B6IA 3NMIA 3BEHA 3EHNA 3QW1A 3VYWA 1T6IA 3M4BA 2CCYA 1QSPA 2ICWG 1IW7F 1Z63A 1XZQA 1MMAA 1GGQA 1RXQA 1JMWA 1K05A 5B3SC 1D0XA 2VCCA 3RIPA 1U89A 1YZAA 5F28E 2HUJA 2XLHA 4G0HA 5KYXB 2C04A 3L1MA 3AGTA 4N4WA 3BRJA 3UR3C 4BPMA 1OW7A 1MMDA 2OOCA 2DGJA 2I8BA 1O5HA 3EZHA 4PJLA 4BJ6C 3ZTMA 1RMVA 3AG2C 2HJ3A 5KYYB 1XWJA 3W8HA 2ZD9A 1A7VA 3AG1C 3SEOA 2W9YA 2IXOA 3FOOA 3Q7GA 3TK0A 1VYKA 1ZHWA 1K40A 3SNHA 2EPKX 5K0IA 1OW8A 2KC3A 2KK1A 2W4BA 5B1BC 1C02A 5T3WA 3U9JA 1BDJB 3B0PA 3OEOA 1V4AA 3DJNB 1T6QA 2LSEA 2EPOA 1RKCA 2IYLD 5TJ5E 1D1AA 3EGXB 3HLZA 1BR1A 1WOLA 2A6EF 4Q7CA 3JTLO 2YL0A 4W8KA 3WHNA 4XLPF 2IM8A 2WZLA 1VLTA 3K1IA 4I1MA 3HNKA 5KYUA 1OQCA 3GEIA 2WZGA 2XXAA 4DRIB 1SZIA 2P61A 4DJ9A 3ZSUA 4G7HF 2ZXRA 1ZHZA 3ITFA 4JTDB 1GS9A 1Q0MA 1Q0DA 3LS1A 2OJED 1OCRC 2H7VC 4MVZA 4BJ1A 4PR9A 2VB6A 4IAOA 4PACA 4U5DE 4EIYA 1U6HA 1TWGA 3IPMO 3L34A 3U5SA 4XEKA 3PCVA 3SYNA 3S84A 4Q4ZF 3X1OA 2OKUA 3T6JA 4JURI 4I3MA 2HMZA 1OXBA 3S9OA 2JX0A 1JAFA 2XLVA 1JOGA 4RD9A 2H7BA 4CDVA 2EPLX 4CSAC 4DBQA 2EIKC 2VCAA 2XS8A 3KKBA 4XTKA 3E70C 4J7YA 2PX3A 4DRHB 3ZQYA 1NU9C 3NYMA 1PV3A 2AWCA 1MNDA 1R5ID 4MW3A 2PF4E 3B0UX 4U9EA 3KH2A 5GPGB 2VH3A 1FFHA 2YZSA 1LS4A 3DKAA 3EPVA 3OA1A 3ABMC 3US6A 1E85A 1GQAA 2R05A 2EPNA 5JP7A 3NMJA 1JR8A 4K0DA 2L6FA 5IY5C 4H4KC 4JCHA 2CNWD 2M4EA 3EJNA 4GQHA 3S29A 3IHUA 1I4ZA 4DVZA 3FMSA 2BL2A 4OIOF 1SMYF 3AGUA 5A6AA 2NSGA 2BE5F 5CI9A 2YL1A 2IXMA 3MBGA 2YQYA 4ULWA 2JD3A 2B0JA 2A1DD 3QVZA 3GM1A 1ZVZA 3ZVRA 1YLMA 5T3TA 2L81A 4JJGA 4H54A 5KYNA 3DJUB 4OIRF 5L0IA 4MQ9F 2FFHA 4AL1A 1TWHA 2BC5A 2YHSA 3B29A 1ORSC 3IEEA 4O6YA 2R02A 3DMDA 3LS0A 4M63A 3O6XA 4Z9JA 3TQOA 5KYUB 1EKYA 2MHRA 3H65A 2IXNA 4A2NB 2CNWA 3SP1A 5CIVA 2J45A 3G4XA 4MVRA 1NU7D 1VYIA 1UFBA 3S0XA 3UGOA 2ETSA 1S05A 2VASA 3C18A 2XL4A 1I5NA 1YZCA 4YL3A 5DLJA 5L0HA 3OWTA 3Q6MA 4JCZA 4O6NA 1JPNA 4NY3A 5KYWA 2J9UA 1ZW3A 2TMVP 4AL0A 1QKRA 2DI3A 1SF8A 3POVA 3ZQVA 3T4RA 4G78A 4O79A 3U3BA 1T6UA 1FAPB 1H7IA 2CW0F 1BBHA 3ATPA 1OR2A 3N24A 1T01A 4RDAA 1CGNA 4K1OA 4MTGA 5A6JA 1C17M 2YVKA 5F5HA 1A7DA 5JVEA 3KPHA 3V5XA 2XM4A 4KNWA 1FMWA 1CGME 1A0BA 4K7BA 1H9GA 2CDQA 4IAQA 3GODA 3T6GB 4QI2A 3LLKA 1D1CA 1TR2A 4NCQA 4LERA 4WJ0A 4CJOA 2J9BA 4XEVA 2KNHA 2QLAA 1SR2A 1G5ZA 1FNTc 1T5OA 1J8MF 2V3CC 2J7PD 2EINC 1F1MA 1HW1A 3JSEO 4MVQA 5A6BD 1LI7A 2Q9BA 3EHMA 2J46A 2EILC 4DXWA 4AE4A 1YYJA 2V26A 3TOMA 2XL6A 4EWCA 2Q00A 1WGWA 2Y3HA 1O3UA 1R4TA 1HE9A 3K1IC 2H8AA 4N6HA 4CS8A 3EH1A 5A6KA 4MW8A 5E2QA 4NTBA 3DI5A 1FTSA 2RSEB 3HNJA 1YAUO 3EG9A 3C8GD 1AUEA 4RBNA 3N2ZB 1Z3IX 1ZHXA 2J7PA 3JYYA 3W4YA 4ZLDA 3C8ZA 2XL8A 3HJCA 1HMOA 4EBKA 5A6BA 2FAPB 4DRJB 2LD6A 4JTAB 2EIJC 3E9VA 1ORJA 1G4US 3MYIA 3WODF 2C03A 4DVYP 1LKXA 256BA 4EHPA 2YLDA 2QNLA 3M4CA 4WGYA 5AC4A 3RFYA 5HV9A 5KYWB 2LQGA 4PFPA 1C03A 3WAQA 4CX9A 1V55C 3EFOB 2OU6A 4CJGA 1TKNA 3HKKA 3B0VC 2GA0A 4CS7A 1L3PA 2XM0A 1SYQA 3C8GA 4EBJA 3FHDA 4JZAA 4OD5A 2G62A 4C7OA 3G50A 1RKEB 2CYDA 3FAJA 4AK9A 1JRAA 1A7EA 1E84A 1RJ9A 2ZXWC 2FGYA 2WZFA 5KYYA 3LNMB 2R7WA 3NRHA 1OCCC 2NSFA 1M56C 3TJ6A 4NQFA 4ONSA 1QPUA 1OKKD 1WTYA 2R7RA 4Q5SF 3B9QA 3GEHA 3LEOA 3QTHA 3ABLC 3TJ5A 3S28A 3ZTZA 4J7TA 3VAYA 1PCXA 4Z9HA 4U5GA 3RH3A 4U5FE 3U8VA 1H6GA 3CZ6A 4U5BE 3RKOF 3DAGA 3O10A 2KGOA 4P9FA 3JZ0A 3L8JA 4JW1A 1CGOA 4AE4B 2LIGA 1TQGA 3G4ZA 3V5YA 1N1CA 3FOPA 1IZMA 4YL1A 4XLNF 2H7OA 1YA7O 3ASNC 5COFA 2IBFA 2PX0A 4XWJA 1OKKA 1M57C 2HZ8A 3L0IA 1QQ3A 3C63A 2IOQA 4P6IC 3O39A 1LE2A 4JC7A 3JRMO 3EG9B 4BEJA 4O6MA 4PJNA 2OQMA 3H2UA 2YLIA 3TOLA 1APCA 2R7OA 3UMKA 3U0CA 3FVYA 4XPXA 5JLIA 1NBBA 3T9OA 2L9JA 3CEXA 1NLXA 1YYXA 4PJJA 4OINF 5B1AC 3U8PA 4C3EA 3S90A 3O55A 4P9TA 1A41A 2L7AA 2YEVA 2P7VA 2KYHA 2WVOA 4BJ5A 3FDQA 1ZZPA 1VMAA 2MYSA 3RVZA 2OG2A 2EIMC 4I1OB 3C8GB 2XRHA 3SXMA 3QZCA 2DB4A 2OCCC 3GM3A 4C7OB 2PBEA 1M2VA 2HKVA 4KBLA 3AG3C 4FESA 1RJ9B 3LNRA 4PJMA 3DXJF 2I15A 4X0RA 4U5CE 3A11A 3U2MA 4YL0A 4IWBA 3EGDA 2Y3GA 4J32B 4JE9A 4NTFA 4DOZA 1NFNA 5COGA 2XXAB 3VF0A 3RW0A 2WL8A 1OXKA 3K66A 4MVUA 3U3FA 2MWQA 4CS8C 4E17A 5DQZA 2E87A 1NFOA 2NG1A 3JYHA 4ZLCA 4XPYA 3EH2A 3DAFA 1LI5A 3JSZA 3LLIA 2G3KA 2HSBA 5L0GA 3M79A 1TWCA 3RQFA 2CGEA 3ZWIA 2KW3C 2J0XA 3DM5A 1BZ4A 1E2XA 4F4BA 2LCHA 3M1CB 3NG1A 4O7GA 4YN0B 1TWAA 4G7ZF 1LM3B 4BG0A 2XS1A 4E18A 1LE4A 2PFDA 3LESA 4YK5A 5L3QA 5COMA 4UDVA 2NUTA 1MQVA 3C7JA 1G8XA 1YVIA 5E3CA 1VK5A 4CDAA 3M15A 5EHHA 4KI2A 3JCUQ 2D4UA 3KYJA 4JJFA 1MMGA 3MX3A 4IB4A 3AOUA 1E86A 3RQEA 2WVNA 3V7OA 1O87A 1FMVA 1YDIA 2J0WA 3DD7A 4MTFA 1LS1A 3CAXA 3LAYA 3RYLA 3U2LA 3K1HA 2WVQA 4EKWA 1M2VB 2YWAA 5HSWA 5F5FA 3GORA 5L0DA 1D1BA 1HY5A 4LLEA 2R7SA 1Z5ZA 1JPJA 4PK4A 3FAPB 4XEFA 4HE8D 4A4AA 3EGDB 1Z6AA 1NSGB 5JT4A 5JS5A 2DYSC 3JRTA 2P1AA 4MS2A 2XLEA 3K6BA 4N06A 1G4WR 3W8IA 1NG1A 5BQIA 3AQBA 4NC3A 4ULVA 3GM2A 3S27A 1VTMP 2A69F 1V54C 4R32A 2R7TA 4Z9IA 3I4UA 2R03A 3C62A 2HMQA 4KNVA 4D4XA 5JRAA 2GAQA 4QDLA 2AP3A 5CI8A 2GWWA 5T1DB 2A68F 2L6HA 3F47A 5D91A 3EZIA 5AC5A 1KNYA 1LVKA 1Q0GA 3U9MA 4FX5A 1Y4CA 1ZU5A 3IQTA 4D4NA 2J9VA 4JTCB 4ER9A 1GM5A 4AX2A 2R7XA 2B0HA 5EK0A 4JKVA 3DE8A 3GANA 1BR2A 3NKEA 2HJMA 3UNGC 2NUTB 4CS9C 1M6TA 1WASA 4CDYA 5D92A 1Q0FA 2YRFA 4BJ5C 2ZPAA 5EGYA 2LFFA 3KMIA 3IQ5A 1ZU4A 4U9DA 2NUPA 2A6HF 4MVOA 5BUOA 1YARO 4OIPF 1PD0A 3IQCA 1VOMA 1D0YA 3HNLA 4U5HA 2R25A 2OJQA 1HE1A 2Q3TA 2DYRC 2AVKA 1J8YF 2O9XA 1Z23A 3V5ZA 4E7ZA 4C3DA 2L6GA 2GDCA 3CSKA 2HFIA 2P0NA 4CBEA 3QW0A 4E0HA 2WB7A 2R7QA 2QUPA 2A0BA 3ECSA 1TFKB 3IQ6A 3NYJA 3ZG1A 3RQGA 3B71A 3QMKA 1MNEA 4GYTA 1ST6A 2X0CA 3MFNA 1ZHTA 2D5RB 4NTAA 5FCLA 4LDRA 2ZXOA 3DM9B 4JEBA 2OEXA 2LK4A 4PFOA 3JT1A 4YWQA 2XSEA 2JPUA 3AJMA 5A69A 4G7OF 2R7VA 1YA9A 4JRZA 3T6BA 1OW6A 1B68A 3A9CA 2XLOA 2XLWA 2QE9A 5DS6A 3ZIBA 1I4YA 1WATA 4LDKA 4ANJA 2G3VA 3PMRA 3TULA 1LPEA 5DVWA 1OCOC 4E7SA 2Q4FA 2GFHA 3QVYA 2YLGA 3HTKC 2Z15A 2R9RB 1HMDA 2X51A 5L0FA 1PD1A 1ORYA 2UUIA 4WGZA 1UG7A 2Y39A 5BQGA 3ZC4A 4BJ6A 4YT2A 3AQCA 3HNIA 5JUAA 1Y6DA 3J06A 1D0ZA 4YT4A 2NUPB 1V74B 2VCBA 1BR4A 5L3VA 3UGPA 1QVXA 3NDBB 1T9KA 3F46A 1K04A 1FR0A 4OIQF 2IXPA 3L8IA 2LFDA 3NKDA 2OEVA 3SXKA 3VRCA 3WG7C 5DS4A 2KJGA 2Y3BA 4IRUA 1DOWA 3K7DA 4LLCA 3SXYA 3DZAA 5BQHA 3TD7A 1U0BB 2ZXPA 2KSFA 3AG4C 2ASRA 2M64A 3MLGA 4N6CA 4I44A 2QTVA 3ABKC 4XQ1A 4FAPB 2VC9A 1QLEC 4CIPA 1DOVA 4JEAA 2AU5A 1KU2A 1NZEA 2QY9A 5E33A 3EQLF 2PNOA 1H9TA 3X2QC 1HW2A 3DE9A 1TFOB 3N0TA 3H2VA 1KTMA 1VLSA 4LDQA 4CS9A 2NPUA 3GWNA 5L0CA 3W2WA 1AEPA 4MTOA 1EQ1A 1S7ZA 3FXHA 1OCZC 3KL4A 4HFKB 1E83A 1EA8A 2XLMA 1FFTC 2KQ9A 2Y69C 1EI7A 4MVSA 2Q9CA 4W8PA 2Q7RA 3KYIA 3LUTB 1WN0A 3R2PA 5KYXA 1M2OA 4HFFB 4CSAA 3SXZA 2P6VA 5L0JA 2UUHA 3DWWA 5JSLA 1Q0KA 4IARA 2AWYA 4J30B 1CPRA 4JVSA 3SZRA 3NMKA 3Q7LA 1YJGA 3EFOA 4E0IA 2W4MA 5DS5A 4DBRA 2F22A 3UMHA 3LJBA 4C3BA 2LP4A 1L7CA 4BJTA 1CPQA 1VB5A 2EPMX 4JIOA 4EBBA 4CIHA 1RKEA 3R7CA 4IJJA 3ZDLA 5B3IA 1XZPA 1ZHYA 5DQTA 2J9WA 4KC9A 4OD4A 5AGFA 2RD9A 3I5PA 4QI0A 1AVOB 3I5QA 4MNDA 1MMNA 4U5EE 4MVMA 2YL3A 3PDMP 2W45A 5FZTA 4L6RA 3LEVA 3EGXA 2HV6A 4XPWA 4YT5A 3NYLA 3CQZA 4GEHA 3RF3A 1QZXA 2HS5A 2YL7A 2A0UA 4YT8A 2YKZA 4LACB
chains in the Genus database with same CATH topology
5HV9A 4YL3A 4JRZA 4JCZA 2UUHA 3DWWA 4AL0A 3HKKA 4YL1A 3PCVA 2PNOA 4WABA 2H8AA 5BQGA 2UUIA 5K0IA 4JC7A 4NTBA 4YL0A 4YK5A 4AL1A 4J7YA 5BQIA 4NTAA 3B29A 4NTFA 3LEOA 2Q7RA 4J7TA 4BPMA 5BQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HV9 A;  4YL3 A;  4JRZ A;  4JCZ A;  2UUH A;  3DWW A;  4AL0 A;  3HKK A;  4YL1 A;  3PCV A;  2PNO A;  4WAB A;  2H8A A;  5BQG A;  2UUI A;  5K0I A;  4JC7 A;  4NTB A;  4YL0 A;  4YK5 A;  4AL1 A;  4J7Y A;  5BQI A;  4NTA A;  3B29 A;  4NTF A;  3LEO A;  2Q7R A;  4J7T A;  4BPM A;  5BQH A; 
#chains in the Genus database with same CATH topology
 4IGG A;  3GEE A;  1ZYR F;  3K33 A;  2J8W A;  1WWP A;  1ZW2 A;  3UMI A;  1RCP A;  2Y3D A;  3ASO C;  4FWV A;  3W2V A;  2HSQ A;  2PP4 A;  2XLD A;  2HV7 A;  5E3A A;  2R7U A;  3VM6 A;  4WAB A;  1LIH A;  2Q9A A;  3GWL A;  3Q6N A;  1Z7Q c;  3RVY A;  4EUK B;  4BEM J;  1W2W A;  1OR3 A;  3PHF 2;  4YJW A;  3MYF A;  4HEA J;  4B6I A;  3NMI A;  3BEH A;  3EHN A;  3QW1 A;  3VYW A;  1T6I A;  3M4B A;  2CCY A;  1QSP A;  2ICW G;  1IW7 F;  1Z63 A;  1XZQ A;  1MMA A;  1GGQ A;  1RXQ A;  1JMW A;  1K05 A;  5B3S C;  1D0X A;  2VCC A;  3RIP A;  1U89 A;  1YZA A;  5F28 E;  2HUJ A;  2XLH A;  4G0H A;  5KYX B;  2C04 A;  3L1M A;  3AGT A;  4N4W A;  3BRJ A;  3UR3 C;  4BPM A;  1OW7 A;  1MMD A;  2OOC A;  2DGJ A;  2I8B A;  1O5H A;  3EZH A;  4PJL A;  4BJ6 C;  3ZTM A;  1RMV A;  3AG2 C;  2HJ3 A;  5KYY B;  1XWJ A;  3W8H A;  2ZD9 A;  1A7V A;  3AG1 C;  3SEO A;  2W9Y A;  2IXO A;  3FOO A;  3Q7G A;  3TK0 A;  1VYK A;  1ZHW A;  1K40 A;  3SNH A;  2EPK X;  5K0I A;  1OW8 A;  2KC3 A;  2KK1 A;  2W4B A;  5B1B C;  1C02 A;  5T3W A;  3U9J A;  1BDJ B;  3B0P A;  3OEO A;  1V4A A;  3DJN B;  1T6Q A;  2LSE A;  2EPO A;  1RKC A;  2IYL D;  5TJ5 E;  1D1A A;  3EGX B;  3HLZ A;  1BR1 A;  1WOL A;  2A6E F;  4Q7C A;  3JTL O;  2YL0 A;  4W8K A;  3WHN A;  4XLP F;  2IM8 A;  2WZL A;  1VLT A;  3K1I A;  4I1M A;  3HNK A;  5KYU A;  1OQC A;  3GEI A;  2WZG A;  2XXA A;  4DRI B;  1SZI A;  2P61 A;  4DJ9 A;  3ZSU A;  4G7H F;  2ZXR A;  1ZHZ A;  3ITF A;  4JTD B;  1GS9 A;  1Q0M A;  1Q0D A;  3LS1 A;  2OJE D;  1OCR C;  2H7V C;  4MVZ A;  4BJ1 A;  4PR9 A;  2VB6 A;  4IAO A;  4PAC A;  4U5D E;  4EIY A;  1U6H A;  1TWG A;  3IPM O;  3L34 A;  3U5S A;  4XEK A;  3PCV A;  3SYN A;  3S84 A;  4Q4Z F;  3X1O A;  2OKU A;  3T6J A;  4JUR I;  4I3M A;  2HMZ A;  1OXB A;  3S9O A;  2JX0 A;  1JAF A;  2XLV A;  1JOG A;  4RD9 A;  2H7B A;  4CDV A;  2EPL X;  4CSA C;  4DBQ A;  2EIK C;  2VCA A;  2XS8 A;  3KKB A;  4XTK A;  3E70 C;  4J7Y A;  2PX3 A;  4DRH B;  3ZQY A;  1NU9 C;  3NYM A;  1PV3 A;  2AWC A;  1MND A;  1R5I D;  4MW3 A;  2PF4 E;  3B0U X;  4U9E A;  3KH2 A;  5GPG B;  2VH3 A;  1FFH A;  2YZS A;  1LS4 A;  3DKA A;  3EPV A;  3OA1 A;  3ABM C;  3US6 A;  1E85 A;  1GQA A;  2R05 A;  2EPN A;  5JP7 A;  3NMJ A;  1JR8 A;  4K0D A;  2L6F A;  5IY5 C;  4H4K C;  4JCH A;  2CNW D;  2M4E A;  3EJN A;  4GQH A;  3S29 A;  3IHU A;  1I4Z A;  4DVZ A;  3FMS A;  2BL2 A;  4OIO F;  1SMY F;  3AGU A;  5A6A A;  2NSG A;  2BE5 F;  5CI9 A;  2YL1 A;  2IXM A;  3MBG A;  2YQY A;  4ULW A;  2JD3 A;  2B0J A;  2A1D D;  3QVZ A;  3GM1 A;  1ZVZ A;  3ZVR A;  1YLM A;  5T3T A;  2L81 A;  4JJG A;  4H54 A;  5KYN A;  3DJU B;  4OIR F;  5L0I A;  4MQ9 F;  2FFH A;  4AL1 A;  1TWH A;  2BC5 A;  2YHS A;  3B29 A;  1ORS C;  3IEE A;  4O6Y A;  2R02 A;  3DMD A;  3LS0 A;  4M63 A;  3O6X A;  4Z9J A;  3TQO A;  5KYU B;  1EKY A;  2MHR A;  3H65 A;  2IXN A;  4A2N B;  2CNW A;  3SP1 A;  5CIV A;  2J45 A;  3G4X A;  4MVR A;  1NU7 D;  1VYI A;  1UFB A;  3S0X A;  3UGO A;  2ETS A;  1S05 A;  2VAS A;  3C18 A;  2XL4 A;  1I5N A;  1YZC A;  4YL3 A;  5DLJ A;  5L0H A;  3OWT A;  3Q6M A;  4JCZ A;  4O6N A;  1JPN A;  4NY3 A;  5KYW A;  2J9U A;  1ZW3 A;  2TMV P;  4AL0 A;  1QKR A;  2DI3 A;  1SF8 A;  3POV A;  3ZQV A;  3T4R A;  4G78 A;  4O79 A;  3U3B A;  1T6U A;  1FAP B;  1H7I A;  2CW0 F;  1BBH A;  3ATP A;  1OR2 A;  3N24 A;  1T01 A;  4RDA A;  1CGN A;  4K1O A;  4MTG A;  5A6J A;  1C17 M;  2YVK A;  5F5H A;  1A7D A;  5JVE A;  3KPH A;  3V5X A;  2XM4 A;  4KNW A;  1FMW A;  1CGM E;  1A0B A;  4K7B A;  1H9G A;  2CDQ A;  4IAQ A;  3GOD A;  3T6G B;  4QI2 A;  3LLK A;  1D1C A;  1TR2 A;  4NCQ A;  4LER A;  4WJ0 A;  4CJO A;  2J9B A;  4XEV A;  2KNH A;  2QLA A;  1SR2 A;  1G5Z A;  1FNT c;  1T5O A;  1J8M F;  2V3C C;  2J7P D;  2EIN C;  1F1M A;  1HW1 A;  3JSE O;  4MVQ A;  5A6B D;  1LI7 A;  2Q9B A;  3EHM A;  2J46 A;  2EIL C;  4DXW A;  4AE4 A;  1YYJ A;  2V26 A;  3TOM A;  2XL6 A;  4EWC A;  2Q00 A;  1WGW A;  2Y3H A;  1O3U A;  1R4T A;  1HE9 A;  3K1I C;  2H8A A;  4N6H A;  4CS8 A;  3EH1 A;  5A6K A;  4MW8 A;  5E2Q A;  4NTB A;  3DI5 A;  1FTS A;  2RSE B;  3HNJ A;  1YAU O;  3EG9 A;  3C8G D;  1AUE A;  4RBN A;  3N2Z B;  1Z3I X;  1ZHX A;  2J7P A;  3JYY A;  3W4Y A;  4ZLD A;  3C8Z A;  2XL8 A;  3HJC A;  1HMO A;  4EBK A;  5A6B A;  2FAP B;  4DRJ B;  2LD6 A;  4JTA B;  2EIJ C;  3E9V A;  1ORJ A;  1G4U S;  3MYI A;  3WOD F;  2C03 A;  4DVY P;  1LKX A;  256B A;  4EHP A;  2YLD A;  2QNL A;  3M4C A;  4WGY A;  5AC4 A;  3RFY A;  5HV9 A;  5KYW B;  2LQG A;  4PFP A;  1C03 A;  3WAQ A;  4CX9 A;  1V55 C;  3EFO B;  2OU6 A;  4CJG A;  1TKN A;  3HKK A;  3B0V C;  2GA0 A;  4CS7 A;  1L3P A;  2XM0 A;  1SYQ A;  3C8G A;  4EBJ A;  3FHD A;  4JZA A;  4OD5 A;  2G62 A;  4C7O A;  3G50 A;  1RKE B;  2CYD A;  3FAJ A;  4AK9 A;  1JRA A;  1A7E A;  1E84 A;  1RJ9 A;  2ZXW C;  2FGY A;  2WZF A;  5KYY A;  3LNM B;  2R7W A;  3NRH A;  1OCC C;  2NSF A;  1M56 C;  3TJ6 A;  4NQF A;  4ONS A;  1QPU A;  1OKK D;  1WTY A;  2R7R A;  4Q5S F;  3B9Q A;  3GEH A;  3LEO A;  3QTH A;  3ABL C;  3TJ5 A;  3S28 A;  3ZTZ A;  4J7T A;  3VAY A;  1PCX A;  4Z9H A;  4U5G A;  3RH3 A;  4U5F E;  3U8V A;  1H6G A;  3CZ6 A;  4U5B E;  3RKO F;  3DAG A;  3O10 A;  2KGO A;  4P9F A;  3JZ0 A;  3L8J A;  4JW1 A;  1CGO A;  4AE4 B;  2LIG A;  1TQG A;  3G4Z A;  3V5Y A;  1N1C A;  3FOP A;  1IZM A;  4YL1 A;  4XLN F;  2H7O A;  1YA7 O;  3ASN C;  5COF A;  2IBF A;  2PX0 A;  4XWJ A;  1OKK A;  1M57 C;  2HZ8 A;  3L0I A;  1QQ3 A;  3C63 A;  2IOQ A;  4P6I C;  3O39 A;  1LE2 A;  4JC7 A;  3JRM O;  3EG9 B;  4BEJ A;  4O6M A;  4PJN A;  2OQM A;  3H2U A;  2YLI A;  3TOL A;  1APC A;  2R7O A;  3UMK A;  3U0C A;  3FVY A;  4XPX A;  5JLI A;  1NBB A;  3T9O A;  2L9J A;  3CEX A;  1NLX A;  1YYX A;  4PJJ A;  4OIN F;  5B1A C;  3U8P A;  4C3E A;  3S90 A;  3O55 A;  4P9T A;  1A41 A;  2L7A A;  2YEV A;  2P7V A;  2KYH A;  2WVO A;  4BJ5 A;  3FDQ A;  1ZZP A;  1VMA A;  2MYS A;  3RVZ A;  2OG2 A;  2EIM C;  4I1O B;  3C8G B;  2XRH A;  3SXM A;  3QZC A;  2DB4 A;  2OCC C;  3GM3 A;  4C7O B;  2PBE A;  1M2V A;  2HKV A;  4KBL A;  3AG3 C;  4FES A;  1RJ9 B;  3LNR A;  4PJM A;  3DXJ F;  2I15 A;  4X0R A;  4U5C E;  3A11 A;  3U2M A;  4YL0 A;  4IWB A;  3EGD A;  2Y3G A;  4J32 B;  4JE9 A;  4NTF A;  4DOZ A;  1NFN A;  5COG A;  2XXA B;  3VF0 A;  3RW0 A;  2WL8 A;  1OXK A;  3K66 A;  4MVU A;  3U3F A;  2MWQ A;  4CS8 C;  4E17 A;  5DQZ A;  2E87 A;  1NFO A;  2NG1 A;  3JYH A;  4ZLC A;  4XPY A;  3EH2 A;  3DAF A;  1LI5 A;  3JSZ A;  3LLI A;  2G3K A;  2HSB A;  5L0G A;  3M79 A;  1TWC A;  3RQF A;  2CGE A;  3ZWI A;  2KW3 C;  2J0X A;  3DM5 A;  1BZ4 A;  1E2X A;  4F4B A;  2LCH A;  3M1C B;  3NG1 A;  4O7G A;  4YN0 B;  1TWA A;  4G7Z F;  1LM3 B;  4BG0 A;  2XS1 A;  4E18 A;  1LE4 A;  2PFD A;  3LES A;  4YK5 A;  5L3Q A;  5COM A;  4UDV A;  2NUT A;  1MQV A;  3C7J A;  1G8X A;  1YVI A;  5E3C A;  1VK5 A;  4CDA A;  3M15 A;  5EHH A;  4KI2 A;  3JCU Q;  2D4U A;  3KYJ A;  4JJF A;  1MMG A;  3MX3 A;  4IB4 A;  3AOU A;  1E86 A;  3RQE A;  2WVN A;  3V7O A;  1O87 A;  1FMV A;  1YDI A;  2J0W A;  3DD7 A;  4MTF A;  1LS1 A;  3CAX A;  3LAY A;  3RYL A;  3U2L A;  3K1H A;  2WVQ A;  4EKW A;  1M2V B;  2YWA A;  5HSW A;  5F5F A;  3GOR A;  5L0D A;  1D1B A;  1HY5 A;  4LLE A;  2R7S A;  1Z5Z A;  1JPJ A;  4PK4 A;  3FAP B;  4XEF A;  4HE8 D;  4A4A A;  3EGD B;  1Z6A A;  1NSG B;  5JT4 A;  5JS5 A;  2DYS C;  3JRT A;  2P1A A;  4MS2 A;  2XLE A;  3K6B A;  4N06 A;  1G4W R;  3W8I A;  1NG1 A;  5BQI A;  3AQB A;  4NC3 A;  4ULV A;  3GM2 A;  3S27 A;  1VTM P;  2A69 F;  1V54 C;  4R32 A;  2R7T A;  4Z9I A;  3I4U A;  2R03 A;  3C62 A;  2HMQ A;  4KNV A;  4D4X A;  5JRA A;  2GAQ A;  4QDL A;  2AP3 A;  5CI8 A;  2GWW A;  5T1D B;  2A68 F;  2L6H A;  3F47 A;  5D91 A;  3EZI A;  5AC5 A;  1KNY A;  1LVK A;  1Q0G A;  3U9M A;  4FX5 A;  1Y4C A;  1ZU5 A;  3IQT A;  4D4N A;  2J9V A;  4JTC B;  4ER9 A;  1GM5 A;  4AX2 A;  2R7X A;  2B0H A;  5EK0 A;  4JKV A;  3DE8 A;  3GAN A;  1BR2 A;  3NKE A;  2HJM A;  3UNG C;  2NUT B;  4CS9 C;  1M6T A;  1WAS A;  4CDY A;  5D92 A;  1Q0F A;  2YRF A;  4BJ5 C;  2ZPA A;  5EGY A;  2LFF A;  3KMI A;  3IQ5 A;  1ZU4 A;  4U9D A;  2NUP A;  2A6H F;  4MVO A;  5BUO A;  1YAR O;  4OIP F;  1PD0 A;  3IQC A;  1VOM A;  1D0Y A;  3HNL A;  4U5H A;  2R25 A;  2OJQ A;  1HE1 A;  2Q3T A;  2DYR C;  2AVK A;  1J8Y F;  2O9X A;  1Z23 A;  3V5Z A;  4E7Z A;  4C3D A;  2L6G A;  2GDC A;  3CSK A;  2HFI A;  2P0N A;  4CBE A;  3QW0 A;  4E0H A;  2WB7 A;  2R7Q A;  2QUP A;  2A0B A;  3ECS A;  1TFK B;  3IQ6 A;  3NYJ A;  3ZG1 A;  3RQG A;  3B71 A;  3QMK A;  1MNE A;  4GYT A;  1ST6 A;  2X0C A;  3MFN A;  1ZHT A;  2D5R B;  4NTA A;  5FCL A;  4LDR A;  2ZXO A;  3DM9 B;  4JEB A;  2OEX A;  2LK4 A;  4PFO A;  3JT1 A;  4YWQ A;  2XSE A;  2JPU A;  3AJM A;  5A69 A;  4G7O F;  2R7V A;  1YA9 A;  4JRZ A;  3T6B A;  1OW6 A;  1B68 A;  3A9C A;  2XLO A;  2XLW A;  2QE9 A;  5DS6 A;  3ZIB A;  1I4Y A;  1WAT A;  4LDK A;  4ANJ A;  2G3V A;  3PMR A;  3TUL A;  1LPE A;  5DVW A;  1OCO C;  4E7S A;  2Q4F A;  2GFH A;  3QVY A;  2YLG A;  3HTK C;  2Z15 A;  2R9R B;  1HMD A;  2X51 A;  5L0F A;  1PD1 A;  1ORY A;  2UUI A;  4WGZ A;  1UG7 A;  2Y39 A;  5BQG A;  3ZC4 A;  4BJ6 A;  4YT2 A;  3AQC A;  3HNI A;  5JUA A;  1Y6D A;  3J06 A;  1D0Z A;  4YT4 A;  2NUP B;  1V74 B;  2VCB A;  1BR4 A;  5L3V A;  3UGP A;  1QVX A;  3NDB B;  1T9K A;  3F46 A;  1K04 A;  1FR0 A;  4OIQ F;  2IXP A;  3L8I A;  2LFD A;  3NKD A;  2OEV A;  3SXK A;  3VRC A;  3WG7 C;  5DS4 A;  2KJG A;  2Y3B A;  4IRU A;  1DOW A;  3K7D A;  4LLC A;  3SXY A;  3DZA A;  5BQH A;  3TD7 A;  1U0B B;  2ZXP A;  2KSF A;  3AG4 C;  2ASR A;  2M64 A;  3MLG A;  4N6C A;  4I44 A;  2QTV A;  3ABK C;  4XQ1 A;  4FAP B;  2VC9 A;  1QLE C;  4CIP A;  1DOV A;  4JEA A;  2AU5 A;  1KU2 A;  1NZE A;  2QY9 A;  5E33 A;  3EQL F;  2PNO A;  1H9T A;  3X2Q C;  1HW2 A;  3DE9 A;  1TFO B;  3N0T A;  3H2V A;  1KTM A;  1VLS A;  4LDQ A;  4CS9 A;  2NPU A;  3GWN A;  5L0C A;  3W2W A;  1AEP A;  4MTO A;  1EQ1 A;  1S7Z A;  3FXH A;  1OCZ C;  3KL4 A;  4HFK B;  1E83 A;  1EA8 A;  2XLM A;  1FFT C;  2KQ9 A;  2Y69 C;  1EI7 A;  4MVS A;  2Q9C A;  4W8P A;  2Q7R A;  3KYI A;  3LUT B;  1WN0 A;  3R2P A;  5KYX A;  1M2O A;  4HFF B;  4CSA A;  3SXZ A;  2P6V A;  5L0J A;  2UUH A;  3DWW A;  5JSL A;  1Q0K A;  4IAR A;  2AWY A;  4J30 B;  1CPR A;  4JVS A;  3SZR A;  3NMK A;  3Q7L A;  1YJG A;  3EFO A;  4E0I A;  2W4M A;  5DS5 A;  4DBR A;  2F22 A;  3UMH A;  3LJB A;  4C3B A;  2LP4 A;  1L7C A;  4BJT A;  1CPQ A;  1VB5 A;  2EPM X;  4JIO A;  4EBB A;  4CIH A;  1RKE A;  3R7C A;  4IJJ A;  3ZDL A;  5B3I A;  1XZP A;  1ZHY A;  5DQT A;  2J9W A;  4KC9 A;  4OD4 A;  5AGF A;  2RD9 A;  3I5P A;  4QI0 A;  1AVO B;  3I5Q A;  4MND A;  1MMN A;  4U5E E;  4MVM A;  2YL3 A;  3PDM P;  2W45 A;  5FZT A;  4L6R A;  3LEV A;  3EGX A;  2HV6 A;  4XPW A;  4YT5 A;  3NYL A;  3CQZ A;  4GEH A;  3RF3 A;  1QZX A;  2HS5 A;  2YL7 A;  2A0U A;  4YT8 A;  2YKZ A;  4LAC B; 
#chains in the Genus database with same CATH homology
 5HV9 A;  4YL3 A;  4JRZ A;  4JCZ A;  2UUH A;  3DWW A;  4AL0 A;  3HKK A;  4YL1 A;  3PCV A;  2PNO A;  4WAB A;  2H8A A;  5BQG A;  2UUI A;  5K0I A;  4JC7 A;  4NTB A;  4YL0 A;  4YK5 A;  4AL1 A;  4J7Y A;  5BQI A;  4NTA A;  3B29 A;  4NTF A;  3LEO A;  2Q7R A;  4J7T A;  4BPM A;  5BQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...