4NTAA

Mus musculus ltc4 synthase in apo form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
147
structure length
147
Chain Sequence
HHHKDEVALLATVTLVGVLLQAYFSLQVISARRAFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQLRLTPLYASARALWLLVAMAALGLLVHFLPGTLRTALFRWLQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mus Musculus LTC4 synthase in apo form
rcsb
source organism Mus musculus
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
total genus 56
structure length 147
sequence length 147
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4ntaA00
3DWWA 3HKKA 5BQGA 4NTBA 4YK5A 3B29A 4WABA 2PNOA 2H8AA 5BQIA 2Q7RA 3LEOA 4JCZA 4J7TA 4AL1A 4AL0A 5K0IA 4NTFA 4YL3A 5HV9A 4JRZA 3PCVA 5BQHA 4JC7A 2UUHA 4NTAA 2UUIA 4YL1A 4BPMA 4J7YA 4YL0A
chains in the Genus database with same CATH superfamily
1OCZC 2ICWG 3ASNC 1FMWA 1V54C 4O79A 1A7DA 5COFA 1YJGA 2J8WA 5L0JA 5B1BC 4XPXA 1J8YF 2C03A 1E83A 1QKRA 1BDJB 1OKKA 2FGYA 5AC4A 5KYYB 2XL8A 3TJ5A 1PD0A 3VYWA 2A69F 3HNJA 4OINF 1CGNA 2Q9BA 4EBBA 4CIHA 3QW1A 5BUOA 4JTAB 2NUPB 2XLDA 4EWCA 4ULWA 2I8BA 3DI5A 2A68F 2GAQA 3FAPB 4NQFA 4CSAC 5B3SC 3GM3A 3TK0A 2YL1A 3KMIA 3DE9A 1XWJA 4J7YA 2OCCC 2VCBA 1JPNA 1XZPA 3LS1A 1TWGA 2XRHA 3I5QA 4DVYP 5JLIA 1LKXA 3N0TA 1ZYRF 3Q6NA 3LS0A 4U5GA 4C7OB 3S84A 2CGEA 2X51A 3ITFA 4U5CE 5JSLA 3BEHA 4OIPF 3N24A 2YQYA 3O6XA 3RFYA 1TWHA 2ZXWC 4BG0A 1M2VB 1Z3IX 3T9OA 3B0VC 3RVZA 3RW0A 3HTKC 3C8GD 3H65A 1CGOA 1ORYA 3CZ6A 2VH3A 3NYMA 3IHUA 1WOLA 3T4RA 5KYNA 1G4US 4PACA 2Y3BA 1ORJA 3V5XA 4IJJA 3NYJA 2HV7A 2LIGA 3GANA 2R7RA 3S27A 2XLEA 4MW8A 4I1MA 5DS6A 4MTOA 4BJ5C 2NUPA 4E7ZA 2J0XA 2EIJC 1MQVA 1NU9C 2R03A 3C63A 1H9GA 1MNEA 1TKNA 3K1HA 3ZDLA 4A2NB 1EQ1A 4KNWA 3M1CB 2WL8A 1SR2A 2J45A 3ABLC 2C04A 3UR3C 4CS9A 3EPVA 4XTKA 4O6YA 3CAXA 2J9WA 2ASRA 1VMAA 1LE2A 2A6HF 1FR0A 2VB6A 4AE4A 3LESA 3NKDA 1OKKD 4NTFA 1O87A 2QY9A 1G4WR 5JVEA 4IRUA 1VTMP 1FAPB 3Q7GA 5CI9A 5B3IA 1T6QA 2J7PD 4IARA 4XPYA 3KL4A 2VCAA 1XZQA 3ATPA 3DAGA 1O5HA 1BR4A 4AK9A 1AVOB 1F1MA 2Y3DA 2G3KA 4HFKB 4BEMJ 1WTYA 1YA7O 1RMVA 1YZAA 2KW3C 1GGQA 2Y3HA 3TOLA 2QUPA 5A6JA 3U0CA 2R7WA 1LI7A 4JE9A 1VOMA 4BJ6C 2YRFA 5T1DB 2IBFA 4K1OA 1PCXA 1JAFA 4KC9A 2HJMA 2R9RB 3AG3C 3C8GB 3DWWA 4JZAA 4XEKA 1BZ4A 5KYUB 2VC9A 4EBKA 3S29A 4OIRF 3C8GA 4CX9A 3LNMB 2ZXRA 2Q7RA 4JCZA 2R7UA 3B0UX 3S28A 2Y69C 2EIKC 2DB4A 2XLOA 3SXKA 3POVA 1J8MF 3UGOA 1QZXA 4OIQF 3HJCA 2KYHA 5TJ5E 2XL4A 4N6HA 2YL3A 5B1AC 3DMDA 5CI8A 4K0DA 3EHMA 1NZEA 3C62A 5L0GA 4BJ5A 4NC3A 1G8XA 2OKUA 2YKZA 3JCUQ 1RXQA 2HS5A 2UUIA 3AJMA 4PJJA 3JZ0A 5F28E 4YT4A 3PDMP 1OR2A 4BJTA 4O6MA 1YA9A 3VAYA 3ZVRA 2IM8A 1AUEA 1IW7F 3AGUA 3EZHA 3I4UA 3MYFA 1FTSA 4OD4A 2KC3A 1A0BA 2HUJA 4MVOA 3M4BA 1HMOA 4G0HA 2BE5F 4HFFB 1V55C 4DBRA 1Y4CA 4E18A 4Z9JA 1HY5A 2EPKX 5A6BD 5KYXA 3GM2A 4WJ0A 4E0HA 1LPEA 4MVQA 1NU7D 1ST6A 2L6HA 3CSKA 2M64A 5E3CA 2VCCA 1UFBA 3A9CA 1QQ3A 4J30B 2H7VC 4FWVA 4HEAJ 4PJLA 4JC7A 4NTAA 3O10A 4ULVA 2L6FA 4G7OF 2Y39A 1C17M 4K7BA 2OEXA 1RJ9A 1E85A 3QZCA 2WZFA 4Z9IA 3DKAA 1RKEA 1KNYA 1JMWA 4G78A 3M79A 4YL0A 2WVOA 3RQGA 3JYYA 3K33A 1EA8A 5BQGA 1C03A 2OJQA 1D0YA 3KKBA 3MX3A 4LLEA 1JPJA 3J06A 2J46A 1Z6AA 3DM5A 2EILC 3NMIA 1D1AA 4YK5A 1HW2A 1MNDA 3U2LA 2YLDA 4Q5SF 2D4UA 1OCRC 4NY3A 3OA1A 1U0BB 4XLNF 1CPRA 1CPQA 2GWWA 2HMQA 2P7VA 2QTVA 2YWAA 5GPGB 3V5YA 1S7ZA 5L3VA 1T6IA 5KYUA 1NBBA 1TWCA 2NSFA 1VYIA 4XEVA 2OEVA 4JEAA 3U2MA 3AQCA 4PFPA 4JJFA 4YJWA 4H54A 3RH3A 1VK5A 2R7SA 1TWAA 1YLMA 3L8IA 3UMKA 1SZIA 3U9MA 1NG1A 3EJNA 1G5ZA 4MVUA 2AWYA 3IQTA 1Z7Qc 5A6AA 4P9FA 4BJ1A 3A11A 2HV6A 4U9EA 1VLTA 4LDRA 1LVKA 2Q3TA 3FOPA 4B6IA 5A6BA 3R2PA 4LDQA 1LIHA 4KNVA 1KU2A 4U5HA 1GQAA 1LS1A 3EFOB 3LEOA 3L1MA 2NPUA 2B0HA 2Q00A 3LLIA 3MLGA 2MHRA 3NG1A 4F4BA 3ABMC 3SXYA 1FMVA 2L81A 1QPUA 2B0JA 3JRMO 4JEBA 4CJGA 1Q0FA 3U3BA 5IY5C 2M4EA 3VRCA 4CJOA 1YZCA 1JOGA 3DD7A 3NRHA 2F22A 3QW0A 4MQ9F 3KH2A 4MVMA 1AEPA 4DBQA 3EGXB 5A69A 2J7PA 5L0FA 3HLZA 4AE4B 1BR1A 4UDVA 3K66A 2Q9CA 2V26A 2PBEA 2HKVA 2WB7A 3DJNB 5D91A 2IOQA 3W2VA 1H7IA 2W4BA 3AGTA 4N4WA 4NTBA 2MYSA 3NKEA 4W8PA 3SXMA 4Q4ZF 5FZTA 3V7OA 1E86A 1H6GA 4KI2A 3VM6A 3RKOF 2J9VA 1T9KA 1EKYA 4J7TA 2HSBA 4X0RA 3HNIA 3RIPA 1PV3A 4C7OA 4MW3A 3GM1A 4GQHA 5HV9A 1Q0DA 1E84A 3WODF 4C3EA 3DM9B 4A4AA 3DZAA 3UNGC 4EUKB 3ZIBA 2GFHA 5BQHA 3DAFA 4IGGA 1ZHXA 2UUHA 3FXHA 1A7VA 4MTFA 2XLVA 3LEVA 3U5SA 1RKEB 1RJ9B 1YYXA 3JSEO 2MWQA 4LERA 3W8IA 3NYLA 4BEJA 4XLPF 2I15A 1DOVA 1OCOC 1V74B 3T6BA 3ZG1A 4MTGA 2XXAA 3ZTZA 2P0NA 3HKKA 3ZSUA 3S0XA 4U9DA 4H4KC 4E7SA 2A1DD 4IAOA 2PNOA 1TFOB 1R4TA 2XXAB 5CIVA 1ZU4A 2R7VA 4YT5A 3M4CA 4LLCA 1SF8A 4BJ6A 1MMGA 2DGJA 3JSZA 4I44A 3V5ZA 4CS8C 3DJUB 2D5RB 3GWLA 1M6TA 2CYDA 5L0IA 1GM5A 1D0ZA 5DS5A 2ZXPA 1NFNA 1Y6DA 1EI7A 5JUAA 2KQ9A 4CS7A 3GEHA 5HSWA 5T3WA 3B9QA 4DRJB 2NUTB 1YVIA 2A0UA 2OU6A 3EFOA 4LACB 2AVKA 4N06A 3ZWIA 1M2VA 2RSEB 3AOUA 2YLIA 4RDAA 4EBJA 1OW8A 2HFIA 1O3UA 3GODA 5COGA 2OQMA 2XS8A 4BPMA 2KSFA 4RBNA 1WWPA 3EG9B 1NSGB 1T5OA 1TQGA 2XM0A 3JYHA 3IQ5A 1Q0MA 4FX5A 4XPWA 3SNHA 2FAPB 3T6JA 3TULA 3SEOA 2L6GA 3VF0A 2YL0A 3AG1C 4L6RA 1WATA 1JR8A 1R5ID 4U5FE 4FAPB 1LI5A 1DOWA 2Y3GA 4O7GA 4JVSA 3GEEA 2ZXOA 2W9YA 1Z5ZA 1PD1A 2JX0A 4MVZA 2J9BA 1RCPA 4JRZA 5EK0A 3WG7C 2EPMX 3C18A 2BL2A 5A6KA 2QLAA 2AWCA 2R05A 2XLWA 3O55A 3RYLA 2WZGA 3X1OA 5DQZA 3E9VA 3G4ZA 3SYNA 1LM3B 3L8JA 4HE8D 3IQ6A 4U5EE 4YT8A 2W45A 2IYLD 2PX0A 1M57C 4I1OB 4QDLA 4ZLDA 4CDVA 2EINC 4PFOA 4JW1A 2AP3A 5D92A 3CEXA 2KNHA 3B71A 2KGOA 4PK4A 2YVKA 2LD6A 1BR2A 4I3MA 3B29A 2CNWD 3F47A 3U8VA 5DLJA 4JIOA 2YLGA 3QTHA 2WVNA 3ZQYA 2XLHA 1NFOA 4AL1A 5K0IA 4GYTA 5F5FA 1ORSC 3H2UA 2KJGA 2CCYA 2PF4E 5JP7A 1K04A 2Q9AA 3MYIA 3SP1A 2H7OA 1TR2A 4ONSA 4Q7CA 1K05A 1KTMA 3WHNA 1S05A 3PCVA 4U5BE 2LP4A 1A7EA 4MVRA 2L9JA 3H2VA 3OEOA 2XSEA 4DRIB 5DS4A 1M56C 1FFHA 2G3VA 3N2ZB 1WASA 3JT1A 4YL1A 2R25A 4CDYA 1ZW2A 2R7OA 1MMNA 3LLKA 3K7DA 4YT2A 2CW0F 3US6A 1I5NA 3KYIA 3EQLF 1ZVZA 3Q6MA 1M2OA 4WGZA 2AU5A 1W2WA 1APCA 2J9UA 4Z9HA 1H9TA 2TMVP 2R7TA 3FHDA 4KBLA 1NLXA 3EGDA 4D4XA 3JTLO 4MVSA 1ZHWA 2WVQA 5BQIA 4DOZA 3UMIA 1D1CA 3EZIA 4XWJA 1I4YA 2DI3A 3I5PA 5JRAA 2H7BA 2Z15A 3GORA 5T3TA 2G62A 4DXWA 4CIPA 3LAYA 3GWNA 4NCQA 4PJNA 3R7CA 3DXJF 1YYJA 2XS1A 3IEEA 5L0CA 2EPLX 2FFHA 3AG4C 2R02A 2R7QA 2A0BA 3BRJA 1OW6A 1Q0KA 2IXNA 1VB5A 4LDKA 4XQ1A 4C3BA 4CS8A 4FESA 4CDAA 4IAQA 3NMJA 1VLSA 3UGPA 3FDQA 3KPHA 5E2QA 1N1CA 5KYXB 3FMSA 3U8PA 1YAUO 3SXZA 3G50A 3RVYA 2Q4FA 2ZPAA 3ZQVA 2J0WA 2ETSA 3IPMO 1FFTC 4OD5A 4JTDB 1OW7A 5KYWB 3ABKC 2EIMC 3K6BA 1Q0GA 1V4AA 3Q7LA 2V3CC 4JURI 3F46A 2W4MA 1WN0A 1QVXA 3C8ZA 3EH2A 3W4YA 3HNKA 5DQTA 4EKWA 2NUTA 1JRAA 1A41A 1YARO 1ZW3A 2LSEA 3NMKA 3OWTA 4PJMA 4E17A 3ASOC 4ER9A 2PFDA 1K40A 5KYWA 4AX2A 3G4XA 3SZRA 3LUTB 2GA0A 2XM4A 1BBHA 2NSGA 2VASA 4CS9C 2O9XA 3KYJA 1HMDA 1SMYF 2WZLA 3W8HA 3FOOA 3K1IA 2QNLA 5L0HA 4W8KA 3B0PA 2E87A 1OCCC 1U6HA 4D4NA 1L7CA 3QMKA 1HW1A 3LNRA 1ZHZA 3ZTMA 2HZ8A 2HSQA 1C02A 2GDCA 4RD9A 1SYQA 2HMZA 5E3AA 3C7JA 3GEIA 4WABA 2LFDA 4IWBA 3QVZA 5JT4A 2P61A 3EH1A 2IXOA 4YN0B 1E2XA 1Z23A 2YL7A 2A6EF 3LJBA 4O6NA 2EPNA 3QVYA 4N6CA 2ZD9A 1D1BA 4DVZA 5AGFA 5EGYA 1MMDA 1OQCA 1HE9A 4EIYA 3S9OA 5L3QA 4M63A 4JTCB 3EHNA 4EHPA 4DJ9A 5AC5A 3MFNA 1ZU5A 1GS9A 3TJ6A 1T01A 3NDBB 4ANJA 3IQCA 1MMAA 1ZZPA 4JCHA 2R7XA 4J32B 4JKVA 1QLEC 5COMA 4GEHA 1HE1A 3MBGA 2LQGA 3FAJA 4R32A 1ZHYA 3E70C 4OIOF 2NG1A 4IB4A 4WGYA 1LE4A 1QSPA 3FVYA 2JD3A 1CGME 2LCHA 3X2QC 2RD9A 4QI0A 2HJ3A 2CNWA 2L7AA 3ZC4A 3RF3A 5KYYA 5DVWA 3EGXA 2DYRC 1Z63A 2LFFA 3CQZA 1B68A 4U5DE 1U89A 4XEFA 2P6VA 4YWQA 2XLMA 3PHF2 3L0IA 2YHSA 3K1IC 1TFKB 2OG2A 2LK4A 1OR3A 4CBEA 3JRTA 2OJED 2X0CA 3W2WA 2DYSC 2CDQA 2BC5A 1VYKA 4C3DA 4MS2A 2P1AA 3RQFA 3T6GB 3RQEA 3ECSA 2KK1A 3U3FA 4CSAA 2YZSA 3DE8A 1I4ZA 1L3PA 3TOMA 3UMHA 4QI2A 2OOCA 5FCLA 3HNLA 2H8AA 3L34A 3O39A 3AQBA 5F5HA 2QE9A 1RKCA 2XL6A 1ZHTA 2IXPA 2YEVA 1YDIA 4MNDA 4AL0A 4G7ZF 3S90A 4YL3A 2EPOA 1UG7A 3M15A 4ZLCA 3AG2C 1WGWA 1IZMA 3WAQA 5L0DA 2IXMA 2PX3A 3TQOA 5E33A 1FNTc 3EG9A 1D0XA 3TD7A 1OXKA 256BA 3U9JA 4E0IA 5EHHA 2PP4A 4G7HF 1T6UA 1LS4A 4P6IC 1OXBA 4JJGA 4DRHB 3PMRA 3EGDB 2JPUA 4P9TA 4PR9A 5JS5A
chains in the Genus database with same CATH topology
3DWWA 3HKKA 5BQGA 4NTBA 4YK5A 3B29A 4WABA 2PNOA 2H8AA 5BQIA 2Q7RA 3LEOA 4JCZA 4J7TA 4AL1A 4AL0A 5K0IA 4NTFA 4YL3A 5HV9A 4JRZA 3PCVA 5BQHA 4JC7A 2UUHA 4NTAA 2UUIA 4YL1A 4BPMA 4J7YA 4YL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWW A;  3HKK A;  5BQG A;  4NTB A;  4YK5 A;  3B29 A;  4WAB A;  2PNO A;  2H8A A;  5BQI A;  2Q7R A;  3LEO A;  4JCZ A;  4J7T A;  4AL1 A;  4AL0 A;  5K0I A;  4NTF A;  4YL3 A;  5HV9 A;  4JRZ A;  3PCV A;  5BQH A;  4JC7 A;  2UUH A;  4NTA A;  2UUI A;  4YL1 A;  4BPM A;  4J7Y A;  4YL0 A; 
#chains in the Genus database with same CATH topology
 1OCZ C;  2ICW G;  3ASN C;  1FMW A;  1V54 C;  4O79 A;  1A7D A;  5COF A;  1YJG A;  2J8W A;  5L0J A;  5B1B C;  4XPX A;  1J8Y F;  2C03 A;  1E83 A;  1QKR A;  1BDJ B;  1OKK A;  2FGY A;  5AC4 A;  5KYY B;  2XL8 A;  3TJ5 A;  1PD0 A;  3VYW A;  2A69 F;  3HNJ A;  4OIN F;  1CGN A;  2Q9B A;  4EBB A;  4CIH A;  3QW1 A;  5BUO A;  4JTA B;  2NUP B;  2XLD A;  4EWC A;  4ULW A;  2I8B A;  3DI5 A;  2A68 F;  2GAQ A;  3FAP B;  4NQF A;  4CSA C;  5B3S C;  3GM3 A;  3TK0 A;  2YL1 A;  3KMI A;  3DE9 A;  1XWJ A;  4J7Y A;  2OCC C;  2VCB A;  1JPN A;  1XZP A;  3LS1 A;  1TWG A;  2XRH A;  3I5Q A;  4DVY P;  5JLI A;  1LKX A;  3N0T A;  1ZYR F;  3Q6N A;  3LS0 A;  4U5G A;  4C7O B;  3S84 A;  2CGE A;  2X51 A;  3ITF A;  4U5C E;  5JSL A;  3BEH A;  4OIP F;  3N24 A;  2YQY A;  3O6X A;  3RFY A;  1TWH A;  2ZXW C;  4BG0 A;  1M2V B;  1Z3I X;  3T9O A;  3B0V C;  3RVZ A;  3RW0 A;  3HTK C;  3C8G D;  3H65 A;  1CGO A;  1ORY A;  3CZ6 A;  2VH3 A;  3NYM A;  3IHU A;  1WOL A;  3T4R A;  5KYN A;  1G4U S;  4PAC A;  2Y3B A;  1ORJ A;  3V5X A;  4IJJ A;  3NYJ A;  2HV7 A;  2LIG A;  3GAN A;  2R7R A;  3S27 A;  2XLE A;  4MW8 A;  4I1M A;  5DS6 A;  4MTO A;  4BJ5 C;  2NUP A;  4E7Z A;  2J0X A;  2EIJ C;  1MQV A;  1NU9 C;  2R03 A;  3C63 A;  1H9G A;  1MNE A;  1TKN A;  3K1H A;  3ZDL A;  4A2N B;  1EQ1 A;  4KNW A;  3M1C B;  2WL8 A;  1SR2 A;  2J45 A;  3ABL C;  2C04 A;  3UR3 C;  4CS9 A;  3EPV A;  4XTK A;  4O6Y A;  3CAX A;  2J9W A;  2ASR A;  1VMA A;  1LE2 A;  2A6H F;  1FR0 A;  2VB6 A;  4AE4 A;  3LES A;  3NKD A;  1OKK D;  4NTF A;  1O87 A;  2QY9 A;  1G4W R;  5JVE A;  4IRU A;  1VTM P;  1FAP B;  3Q7G A;  5CI9 A;  5B3I A;  1T6Q A;  2J7P D;  4IAR A;  4XPY A;  3KL4 A;  2VCA A;  1XZQ A;  3ATP A;  3DAG A;  1O5H A;  1BR4 A;  4AK9 A;  1AVO B;  1F1M A;  2Y3D A;  2G3K A;  4HFK B;  4BEM J;  1WTY A;  1YA7 O;  1RMV A;  1YZA A;  2KW3 C;  1GGQ A;  2Y3H A;  3TOL A;  2QUP A;  5A6J A;  3U0C A;  2R7W A;  1LI7 A;  4JE9 A;  1VOM A;  4BJ6 C;  2YRF A;  5T1D B;  2IBF A;  4K1O A;  1PCX A;  1JAF A;  4KC9 A;  2HJM A;  2R9R B;  3AG3 C;  3C8G B;  3DWW A;  4JZA A;  4XEK A;  1BZ4 A;  5KYU B;  2VC9 A;  4EBK A;  3S29 A;  4OIR F;  3C8G A;  4CX9 A;  3LNM B;  2ZXR A;  2Q7R A;  4JCZ A;  2R7U A;  3B0U X;  3S28 A;  2Y69 C;  2EIK C;  2DB4 A;  2XLO A;  3SXK A;  3POV A;  1J8M F;  3UGO A;  1QZX A;  4OIQ F;  3HJC A;  2KYH A;  5TJ5 E;  2XL4 A;  4N6H A;  2YL3 A;  5B1A C;  3DMD A;  5CI8 A;  4K0D A;  3EHM A;  1NZE A;  3C62 A;  5L0G A;  4BJ5 A;  4NC3 A;  1G8X A;  2OKU A;  2YKZ A;  3JCU Q;  1RXQ A;  2HS5 A;  2UUI A;  3AJM A;  4PJJ A;  3JZ0 A;  5F28 E;  4YT4 A;  3PDM P;  1OR2 A;  4BJT A;  4O6M A;  1YA9 A;  3VAY A;  3ZVR A;  2IM8 A;  1AUE A;  1IW7 F;  3AGU A;  3EZH A;  3I4U A;  3MYF A;  1FTS A;  4OD4 A;  2KC3 A;  1A0B A;  2HUJ A;  4MVO A;  3M4B A;  1HMO A;  4G0H A;  2BE5 F;  4HFF B;  1V55 C;  4DBR A;  1Y4C A;  4E18 A;  4Z9J A;  1HY5 A;  2EPK X;  5A6B D;  5KYX A;  3GM2 A;  4WJ0 A;  4E0H A;  1LPE A;  4MVQ A;  1NU7 D;  1ST6 A;  2L6H A;  3CSK A;  2M64 A;  5E3C A;  2VCC A;  1UFB A;  3A9C A;  1QQ3 A;  4J30 B;  2H7V C;  4FWV A;  4HEA J;  4PJL A;  4JC7 A;  4NTA A;  3O10 A;  4ULV A;  2L6F A;  4G7O F;  2Y39 A;  1C17 M;  4K7B A;  2OEX A;  1RJ9 A;  1E85 A;  3QZC A;  2WZF A;  4Z9I A;  3DKA A;  1RKE A;  1KNY A;  1JMW A;  4G78 A;  3M79 A;  4YL0 A;  2WVO A;  3RQG A;  3JYY A;  3K33 A;  1EA8 A;  5BQG A;  1C03 A;  2OJQ A;  1D0Y A;  3KKB A;  3MX3 A;  4LLE A;  1JPJ A;  3J06 A;  2J46 A;  1Z6A A;  3DM5 A;  2EIL C;  3NMI A;  1D1A A;  4YK5 A;  1HW2 A;  1MND A;  3U2L A;  2YLD A;  4Q5S F;  2D4U A;  1OCR C;  4NY3 A;  3OA1 A;  1U0B B;  4XLN F;  1CPR A;  1CPQ A;  2GWW A;  2HMQ A;  2P7V A;  2QTV A;  2YWA A;  5GPG B;  3V5Y A;  1S7Z A;  5L3V A;  1T6I A;  5KYU A;  1NBB A;  1TWC A;  2NSF A;  1VYI A;  4XEV A;  2OEV A;  4JEA A;  3U2M A;  3AQC A;  4PFP A;  4JJF A;  4YJW A;  4H54 A;  3RH3 A;  1VK5 A;  2R7S A;  1TWA A;  1YLM A;  3L8I A;  3UMK A;  1SZI A;  3U9M A;  1NG1 A;  3EJN A;  1G5Z A;  4MVU A;  2AWY A;  3IQT A;  1Z7Q c;  5A6A A;  4P9F A;  4BJ1 A;  3A11 A;  2HV6 A;  4U9E A;  1VLT A;  4LDR A;  1LVK A;  2Q3T A;  3FOP A;  4B6I A;  5A6B A;  3R2P A;  4LDQ A;  1LIH A;  4KNV A;  1KU2 A;  4U5H A;  1GQA A;  1LS1 A;  3EFO B;  3LEO A;  3L1M A;  2NPU A;  2B0H A;  2Q00 A;  3LLI A;  3MLG A;  2MHR A;  3NG1 A;  4F4B A;  3ABM C;  3SXY A;  1FMV A;  2L81 A;  1QPU A;  2B0J A;  3JRM O;  4JEB A;  4CJG A;  1Q0F A;  3U3B A;  5IY5 C;  2M4E A;  3VRC A;  4CJO A;  1YZC A;  1JOG A;  3DD7 A;  3NRH A;  2F22 A;  3QW0 A;  4MQ9 F;  3KH2 A;  4MVM A;  1AEP A;  4DBQ A;  3EGX B;  5A69 A;  2J7P A;  5L0F A;  3HLZ A;  4AE4 B;  1BR1 A;  4UDV A;  3K66 A;  2Q9C A;  2V26 A;  2PBE A;  2HKV A;  2WB7 A;  3DJN B;  5D91 A;  2IOQ A;  3W2V A;  1H7I A;  2W4B A;  3AGT A;  4N4W A;  4NTB A;  2MYS A;  3NKE A;  4W8P A;  3SXM A;  4Q4Z F;  5FZT A;  3V7O A;  1E86 A;  1H6G A;  4KI2 A;  3VM6 A;  3RKO F;  2J9V A;  1T9K A;  1EKY A;  4J7T A;  2HSB A;  4X0R A;  3HNI A;  3RIP A;  1PV3 A;  4C7O A;  4MW3 A;  3GM1 A;  4GQH A;  5HV9 A;  1Q0D A;  1E84 A;  3WOD F;  4C3E A;  3DM9 B;  4A4A A;  3DZA A;  3UNG C;  4EUK B;  3ZIB A;  2GFH A;  5BQH A;  3DAF A;  4IGG A;  1ZHX A;  2UUH A;  3FXH A;  1A7V A;  4MTF A;  2XLV A;  3LEV A;  3U5S A;  1RKE B;  1RJ9 B;  1YYX A;  3JSE O;  2MWQ A;  4LER A;  3W8I A;  3NYL A;  4BEJ A;  4XLP F;  2I15 A;  1DOV A;  1OCO C;  1V74 B;  3T6B A;  3ZG1 A;  4MTG A;  2XXA A;  3ZTZ A;  2P0N A;  3HKK A;  3ZSU A;  3S0X A;  4U9D A;  4H4K C;  4E7S A;  2A1D D;  4IAO A;  2PNO A;  1TFO B;  1R4T A;  2XXA B;  5CIV A;  1ZU4 A;  2R7V A;  4YT5 A;  3M4C A;  4LLC A;  1SF8 A;  4BJ6 A;  1MMG A;  2DGJ A;  3JSZ A;  4I44 A;  3V5Z A;  4CS8 C;  3DJU B;  2D5R B;  3GWL A;  1M6T A;  2CYD A;  5L0I A;  1GM5 A;  1D0Z A;  5DS5 A;  2ZXP A;  1NFN A;  1Y6D A;  1EI7 A;  5JUA A;  2KQ9 A;  4CS7 A;  3GEH A;  5HSW A;  5T3W A;  3B9Q A;  4DRJ B;  2NUT B;  1YVI A;  2A0U A;  2OU6 A;  3EFO A;  4LAC B;  2AVK A;  4N06 A;  3ZWI A;  1M2V A;  2RSE B;  3AOU A;  2YLI A;  4RDA A;  4EBJ A;  1OW8 A;  2HFI A;  1O3U A;  3GOD A;  5COG A;  2OQM A;  2XS8 A;  4BPM A;  2KSF A;  4RBN A;  1WWP A;  3EG9 B;  1NSG B;  1T5O A;  1TQG A;  2XM0 A;  3JYH A;  3IQ5 A;  1Q0M A;  4FX5 A;  4XPW A;  3SNH A;  2FAP B;  3T6J A;  3TUL A;  3SEO A;  2L6G A;  3VF0 A;  2YL0 A;  3AG1 C;  4L6R A;  1WAT A;  1JR8 A;  1R5I D;  4U5F E;  4FAP B;  1LI5 A;  1DOW A;  2Y3G A;  4O7G A;  4JVS A;  3GEE A;  2ZXO A;  2W9Y A;  1Z5Z A;  1PD1 A;  2JX0 A;  4MVZ A;  2J9B A;  1RCP A;  4JRZ A;  5EK0 A;  3WG7 C;  2EPM X;  3C18 A;  2BL2 A;  5A6K A;  2QLA A;  2AWC A;  2R05 A;  2XLW A;  3O55 A;  3RYL A;  2WZG A;  3X1O A;  5DQZ A;  3E9V A;  3G4Z A;  3SYN A;  1LM3 B;  3L8J A;  4HE8 D;  3IQ6 A;  4U5E E;  4YT8 A;  2W45 A;  2IYL D;  2PX0 A;  1M57 C;  4I1O B;  4QDL A;  4ZLD A;  4CDV A;  2EIN C;  4PFO A;  4JW1 A;  2AP3 A;  5D92 A;  3CEX A;  2KNH A;  3B71 A;  2KGO A;  4PK4 A;  2YVK A;  2LD6 A;  1BR2 A;  4I3M A;  3B29 A;  2CNW D;  3F47 A;  3U8V A;  5DLJ A;  4JIO A;  2YLG A;  3QTH A;  2WVN A;  3ZQY A;  2XLH A;  1NFO A;  4AL1 A;  5K0I A;  4GYT A;  5F5F A;  1ORS C;  3H2U A;  2KJG A;  2CCY A;  2PF4 E;  5JP7 A;  1K04 A;  2Q9A A;  3MYI A;  3SP1 A;  2H7O A;  1TR2 A;  4ONS A;  4Q7C A;  1K05 A;  1KTM A;  3WHN A;  1S05 A;  3PCV A;  4U5B E;  2LP4 A;  1A7E A;  4MVR A;  2L9J A;  3H2V A;  3OEO A;  2XSE A;  4DRI B;  5DS4 A;  1M56 C;  1FFH A;  2G3V A;  3N2Z B;  1WAS A;  3JT1 A;  4YL1 A;  2R25 A;  4CDY A;  1ZW2 A;  2R7O A;  1MMN A;  3LLK A;  3K7D A;  4YT2 A;  2CW0 F;  3US6 A;  1I5N A;  3KYI A;  3EQL F;  1ZVZ A;  3Q6M A;  1M2O A;  4WGZ A;  2AU5 A;  1W2W A;  1APC A;  2J9U A;  4Z9H A;  1H9T A;  2TMV P;  2R7T A;  3FHD A;  4KBL A;  1NLX A;  3EGD A;  4D4X A;  3JTL O;  4MVS A;  1ZHW A;  2WVQ A;  5BQI A;  4DOZ A;  3UMI A;  1D1C A;  3EZI A;  4XWJ A;  1I4Y A;  2DI3 A;  3I5P A;  5JRA A;  2H7B A;  2Z15 A;  3GOR A;  5T3T A;  2G62 A;  4DXW A;  4CIP A;  3LAY A;  3GWN A;  4NCQ A;  4PJN A;  3R7C A;  3DXJ F;  1YYJ A;  2XS1 A;  3IEE A;  5L0C A;  2EPL X;  2FFH A;  3AG4 C;  2R02 A;  2R7Q A;  2A0B A;  3BRJ A;  1OW6 A;  1Q0K A;  2IXN A;  1VB5 A;  4LDK A;  4XQ1 A;  4C3B A;  4CS8 A;  4FES A;  4CDA A;  4IAQ A;  3NMJ A;  1VLS A;  3UGP A;  3FDQ A;  3KPH A;  5E2Q A;  1N1C A;  5KYX B;  3FMS A;  3U8P A;  1YAU O;  3SXZ A;  3G50 A;  3RVY A;  2Q4F A;  2ZPA A;  3ZQV A;  2J0W A;  2ETS A;  3IPM O;  1FFT C;  4OD5 A;  4JTD B;  1OW7 A;  5KYW B;  3ABK C;  2EIM C;  3K6B A;  1Q0G A;  1V4A A;  3Q7L A;  2V3C C;  4JUR I;  3F46 A;  2W4M A;  1WN0 A;  1QVX A;  3C8Z A;  3EH2 A;  3W4Y A;  3HNK A;  5DQT A;  4EKW A;  2NUT A;  1JRA A;  1A41 A;  1YAR O;  1ZW3 A;  2LSE A;  3NMK A;  3OWT A;  4PJM A;  4E17 A;  3ASO C;  4ER9 A;  2PFD A;  1K40 A;  5KYW A;  4AX2 A;  3G4X A;  3SZR A;  3LUT B;  2GA0 A;  2XM4 A;  1BBH A;  2NSG A;  2VAS A;  4CS9 C;  2O9X A;  3KYJ A;  1HMD A;  1SMY F;  2WZL A;  3W8H A;  3FOO A;  3K1I A;  2QNL A;  5L0H A;  4W8K A;  3B0P A;  2E87 A;  1OCC C;  1U6H A;  4D4N A;  1L7C A;  3QMK A;  1HW1 A;  3LNR A;  1ZHZ A;  3ZTM A;  2HZ8 A;  2HSQ A;  1C02 A;  2GDC A;  4RD9 A;  1SYQ A;  2HMZ A;  5E3A A;  3C7J A;  3GEI A;  4WAB A;  2LFD A;  4IWB A;  3QVZ A;  5JT4 A;  2P61 A;  3EH1 A;  2IXO A;  4YN0 B;  1E2X A;  1Z23 A;  2YL7 A;  2A6E F;  3LJB A;  4O6N A;  2EPN A;  3QVY A;  4N6C A;  2ZD9 A;  1D1B A;  4DVZ A;  5AGF A;  5EGY A;  1MMD A;  1OQC A;  1HE9 A;  4EIY A;  3S9O A;  5L3Q A;  4M63 A;  4JTC B;  3EHN A;  4EHP A;  4DJ9 A;  5AC5 A;  3MFN A;  1ZU5 A;  1GS9 A;  3TJ6 A;  1T01 A;  3NDB B;  4ANJ A;  3IQC A;  1MMA A;  1ZZP A;  4JCH A;  2R7X A;  4J32 B;  4JKV A;  1QLE C;  5COM A;  4GEH A;  1HE1 A;  3MBG A;  2LQG A;  3FAJ A;  4R32 A;  1ZHY A;  3E70 C;  4OIO F;  2NG1 A;  4IB4 A;  4WGY A;  1LE4 A;  1QSP A;  3FVY A;  2JD3 A;  1CGM E;  2LCH A;  3X2Q C;  2RD9 A;  4QI0 A;  2HJ3 A;  2CNW A;  2L7A A;  3ZC4 A;  3RF3 A;  5KYY A;  5DVW A;  3EGX A;  2DYR C;  1Z63 A;  2LFF A;  3CQZ A;  1B68 A;  4U5D E;  1U89 A;  4XEF A;  2P6V A;  4YWQ A;  2XLM A;  3PHF 2;  3L0I A;  2YHS A;  3K1I C;  1TFK B;  2OG2 A;  2LK4 A;  1OR3 A;  4CBE A;  3JRT A;  2OJE D;  2X0C A;  3W2W A;  2DYS C;  2CDQ A;  2BC5 A;  1VYK A;  4C3D A;  4MS2 A;  2P1A A;  3RQF A;  3T6G B;  3RQE A;  3ECS A;  2KK1 A;  3U3F A;  4CSA A;  2YZS A;  3DE8 A;  1I4Z A;  1L3P A;  3TOM A;  3UMH A;  4QI2 A;  2OOC A;  5FCL A;  3HNL A;  2H8A A;  3L34 A;  3O39 A;  3AQB A;  5F5H A;  2QE9 A;  1RKC A;  2XL6 A;  1ZHT A;  2IXP A;  2YEV A;  1YDI A;  4MND A;  4AL0 A;  4G7Z F;  3S90 A;  4YL3 A;  2EPO A;  1UG7 A;  3M15 A;  4ZLC A;  3AG2 C;  1WGW A;  1IZM A;  3WAQ A;  5L0D A;  2IXM A;  2PX3 A;  3TQO A;  5E33 A;  1FNT c;  3EG9 A;  1D0X A;  3TD7 A;  1OXK A;  256B A;  3U9J A;  4E0I A;  5EHH A;  2PP4 A;  4G7H F;  1T6U A;  1LS4 A;  4P6I C;  1OXB A;  4JJG A;  4DRH B;  3PMR A;  3EGD B;  2JPU A;  4P9T A;  4PR9 A;  5JS5 A; 
#chains in the Genus database with same CATH homology
 3DWW A;  3HKK A;  5BQG A;  4NTB A;  4YK5 A;  3B29 A;  4WAB A;  2PNO A;  2H8A A;  5BQI A;  2Q7R A;  3LEO A;  4JCZ A;  4J7T A;  4AL1 A;  4AL0 A;  5K0I A;  4NTF A;  4YL3 A;  5HV9 A;  4JRZ A;  3PCV A;  5BQH A;  4JC7 A;  2UUH A;  4NTA A;  2UUI A;  4YL1 A;  4BPM A;  4J7Y A;  4YL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...