3VM6A

Crystal structure of ribose-1,5-bisphosphate isomerase from thermococcus kodakarensis kod1 in complex with alpha-d-ribose-1,5-bisphosphate
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
321
structure length
321
Chain Sequence
AVVKEVLEIAEKIKNMEIRGAGKIARSAAYALQLQAEKSKATNVDEFWKEMKQAAKILFETRPTAVSLPNALRYVMHRGKIAYSSGADLEQLRFVIINAAKEFIHNSEKALERIGEFGAKRIEDGDVIMTHSHSKAAISVMKTAWEQGKDIKVIVTETRPKWQGKITAKELASYGIPVIYVVDSAARHYMKMTDKVVMGADSITVNGAVINKIGTALIALTAKEHRVWTMIAAETYKFHPETMLGQLVEIEMRDPTEVIPEDELKTWPKNIEVWNPAFDVTPPEYVDVIITERGIIPPYAAIDILREEFGWALKYTEPWED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Translation initiation factor eIF-2B, delta subunit
publication title Dynamic, ligand-dependent conformational change triggers reaction of ribose-1,5-bisphosphate isomerase from Thermococcus kodakarensis KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 112
structure length 321
sequence length 321
chains with identical sequence B, C
ec nomenclature ec 5.3.1.29: Ribose 1,5-bisphosphate isomerase.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 3vm6A01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3vm6A02
2YVKA 3A11A 3ECSA 4ZEOA 1VB5A 1W2WB 4LDQA 4LDRA 3A9CA 1T9KA 4ZEMA 2A0UA 3VM6A 1T5OA 5DBOA 2YRFA
chains in the Genus database with same CATH superfamily
3D6MA 2GZHA 3MPUA 2JS7A 4N82A 2GZRA 4AO6A 1ZCAA 2BBOA 4ZAVA 5EE3A 3UUWA 2CSXA 1YI8A 2X0KA 4YXFA 3UK7A 1M6VA 3F3MA 3WJ1A 3KKKA 1OWLA 1HNNA 4ICIA 4EGFA 3CO0S 1GD1O 2I4RA 4TKVA 3EXHC 2HBYA 3MB5A 4K1LA 3IUNA 3GARA 1I2AA 4DBRA 3U60B 2XYQA 1IM5A 1M9NA 3LHKA 2IXAA 3UXHA 5JLJA 2G5TA 2AMVA 1DCMA 4KYIB 1F8UA 4JVLA 3O1JC 1AKVA 3KYIB 2WC1A 2Y1DA 3SHWA 2YH2A 5L45A 4DXHA 1H3EA 5DHTA 3C63A 3LDFA 4OFXA 2AE2A 4F9GA 5DGXA 2XGGA 1KQPA 4RVCA 1OIVA 5L3ZA 1X1DA 3BX1A 3MCUA 2SKCA 5EPEA 5CDYA 2WE8A 5IT4A 3FUCA 4DLXA 5FLXA 2ZB2A 5B2ZA 2H2DA 2W2LA 3RSSA 4HWOA 2P0AA 2G3VA 1I4DD 3ZDZB 7ADHA 4K7BA 1P5FA 3QUBA 3ZDFA 3CKKA 1PEDA 1WBJB 4K05A 3JZ0A 2JI8A 1L3IA 1J21A 2ZITA 4K1OA 4S1WA 3G3EA 3K0FA 1FMTA 4O0LA 4GMHA 2RHTA 1OCZC 4BDSA 1XAGA 2CXSA 2VQSA 2K7FA 4BV3A 4DR4B 1Q7RA 4OEHA 3BF8A 3O5AA 3DNFA 4MQ9F 3V4RA 1KI9A 2XDQB 4HNSA 1VSQA 1E99A 5T3TA 3BXPA 3VR2A 2W9YA 2NU9A 3IURA 4RD9A 3U31A 5AK5A 1JALA 1M6HA 4PYRA 1HL7A 1GADO 1M8FA 3A1VA 3G50A 2V59A 3UJAA 4A8JB 2DFVA 5F35A 3TUIC 4MW5A 3TUZC 1KEWA 4Z4IA 4B82A 4Q5SF 1AKRA 3RVSA 2M9MA 4NZZA 1PZGA 4F1JA 1UBNA 1T26A 2JZNA 3Q6MA 4LF5B 2EC5A 2P0NA 2HNAA 1DO2A 4IHKA 3IIKA 1Q20A 4I2NA 4HN2A 2DBRA 1JB1A 4OI0A 2W6QA 1FXSA 4QDXA 1JZTA 2R6R1 4PACA 3VPBA 4DT1B 4HEAJ 3ZGNA 4GMDA 2QJFA 2BDTA 2E37A 5AHOA 1PVDA 2UZ4A 5BSKA 1FS4A 2FW6A 4WXYB 5WRFA 1VTKA 1QIHA 4N7BA 1NP6A 2XV1A 1AUPA 2H1VA 4Q19A 1XPUA 2QX7A 3FKQA 1DKPA 3INTA 3A06A 3OQMA 1CUCA 2A6PA 2HMAA 3EE6A 3E61A 5C7IO 2CF5A 4BFWA 7MHTA 3JD3A 2Q3FA 5HFAA 2X42A 4FVTA 1JFVA 1EUDB 1M10A 2D5AA 2DUNA 3ZOZA 1ZK1A 3HYCA 5AJXA 5J4YA 3L4EA 1SZPA 4IIBA 4I1PA 1LLDA 3V8RA 1P0MA 3QMPA 4JIOA 4FFPA 5JADA 2GLXA 1IAQA 4LJRA 3OJFA 4G1MB 4CS9C 4JR0A 3VHRA 2QD1A 1P1IA 1YUBA 2KX7A 3DG9A 5JHGB 3H6KA 4TXMA 4YO7A 1D1CA 1IHXA 1E9CA 4CKWA 2C4HA 3LLIA 3ES9A 3DVLA 1KYTA 4ZCQA 3OZWA 1T8PA 1T6ZA 3LGXA 1EFRA 1RWKA 1PK8A 5B1DA 2NXEA 4Z86A 1QZXA 1FYDA 2IL1A 3GNLA 3IX7A 4MW3A 2OQ2A 3L02A 3L92A 4AJEA 1GGVA 5HA5A 2YLDA 3H04A 1PR3A 2J7PA 3GRCA 3SICE 1EUYA 1M8PA 3CVOA 3AGTA 2H9YA 3RIHA 4YDSA 3RRJA 1PR0A 2WINI 1OHHA 4UOZA 4ECEA 4U0KA 2WHXA 3J81A 4MMZB 2B2CA 1KE2A 4KUGA 2Y77A 2NZYA 2QRLA 1LBEA 1H6AA 1NVEA 4N6GA 4D8UA 2RMKA 2AFHB 4URWR 3VPCA 2WMOB 5BYBA 3WSVA 4CKYA 4TX1A 3KFXA 5JDCA 4I4CA 1HOTA 2W2PA 5LA6B 1M2WA 3BE5A 5H82A 3AX6A 2VDRB 2HX1A 4BX2A 3GX1A 5HYVA 2P6PA 1KP9A 1T4GA 4Q47A 3W79A 4MWCA 2BL2A 3LX6A 2QF7A 5AR1A 2VF4X 3M2TA 1Y6DA 1RWBA 3EHDA 1RXQA 4AJOA 3W8RA 3MCZA 3RYCB 2PS0A 3S6JA 1FP1D 1FMWA 1T4CA 3WG9A 3U3BA 2D5LA 3Q15C 2R1TB 3E9YA 3TZLA 4ETIA 2GWWA 1VJ5A 2FJ0A 4WUTA 3KKEA 4ZI7F 1YT5A 1H4VB 2FEOA 2EIHA 4LYAA 1PS9A 2C9ZA 4UDVA 3EBLA 1U8FO 3NKFA 4DCOA 1ZUNB 3NYLA 4FILA 4M9RA 4H6WA 4DQKA 1O3YA 5AC4A 3CVJA 1UEJA 2I9KA 3B1ZA 1WZ2A 1WXDA 4RX1A 5KQGA 3TNJA 1JB9A 4LMRA 5I5EA 1JPUA 1L3CA 1MU0A 2ZTUA 2XQKA 3ZY5A 3EVNA 1DP4A 5FQOA 1UMBB 4PRZA 4PV7A 1HTTA 1MOSA 3RYHA 2YWXA 1J0XO 1O89A 5JO0A 1DVRA 4CEIA 5E8RA 1U3GA 3EISA 2Q3TA 2BFDA 1W87A 1MBZA 4FLEA 4U2CA 3OEOA 4L07A 1WBBA 3HJBA 1D4FA 2ZUVA 2RK6A 5EYPB 1RLUA 4NJMA 1IOZA 3DWEX 3UAYA 4NCAA 1GZ3A 3PYMA 2ZLBA 4M0DA 1ONOA 4EPXA 4MV6A 5B4VA 1JR8A 4LN1A 4RTOA 3NHYA 1SRQA 3WYEA 4PTLA 2R7VA 2GPTA 3UT5B 4JSYA 1L6RA 2IDKA 3THXA 2AA3A 2P91A 3KB1A 5FPHA 5F78A 2PGOA 2WJGA 1G2IA 2VQ6A 2NN3C 1J0DA 1I2DA 4M0UA 4EJ2A 3HKEA 3DMPA 4V02A 1OV6A 4RJ2A 1S2LA 2ODAA 5K0SA 4HQNA 3V8PA 2NUBA 4IOKA 4BNLA 4MUBA 3A11A 2FAXA 3VC2A 1JG7A 4KVAA 1BAPA 1QVWA 2YXLA 3EZ9A 1U2GA 1YB2A 4LYDA 1IM2A 4IVNA 2FPWA 5DWDA 5AKIA 3IV9A 4P31A 4P84A 1CY4A 1Q3HA 3I2IA 5DIZA 2R8BA 1KDYA 4YS6A 3LDGA 3SXUB 2GA8A 2EP8A 2OK8A 1ELOA 3K1IC 5IVHA 2OHXA 1RAIA 2ZD9A 3RUHA 5BV1A 4AFNA 4EKDA 1GZDA 3ZHCA 4R5HA 2J9FB 1REQA 3AINA 4WZZA 1KMIY 1V2GA 1D2MA 2EL7A 4EQ6A 3N87A 4XLZA 2N9UA 4ESHA 1XCOA 2G0AA 2ZRHA 3F1KA 1GNRA 1IMOA 1AKNA 1MEEA 1XNQB 2C84A 1I3LA 3QJYA 4P5EA 4YJGA 1XQ9A 2JX0A 1OH6A 3I04M 4S05A 1PNRA 1TECE 1TKAA 2J6IA 1YCGA 2YCBA 2PH7A 1F7UA 1OZFA 3VUFA 1A96A 1NV9A 2IZ5A 4DCUA 2C2OA 1HTBA 4IKEA 3GIWA 3FI0A 3MYIA 1FFTC 3UMIA 3LFTA 1WDTA 4TVSA 3AG4C 3R7DA 3S5UA 1W36B 2H1HA 4MRNA 3ROFA 1YS2X 2I6UA 2H11A 3BJIC 4HDSA 3SZRA 5J5VA 4S1NA 5LJIA 5LDGA 4JP3A 1NONA 4RLQA 1KTIA 4HAZA 3BMNA 2WFLB 4OBEA 4KDRA 1V11A 2C3YA 3D3EA 1W76A 5DYIA 1ZIYA 4JVNA 1JIQA 2VB6A 4AROA 3MT0A 3BORA 1ZOOA 3FPEA 2QSJA 4PS0A 2HRRA 2FGJA 1PHRA 4WE3A 4QRIA 5BQGA 4K6KA 4TZ6A 2ZVQX 4Q4AB 4D4KA 4NHEA 1COWD 1G6HA 3CINA 2YNMA 1QR6A 4H0FA 1XVUA 3CTMA 3AILA 2CGEA 4JGIA 1BS9A 1T4MA 1CJCA 3WLLA 2XCLA 4L2IB 2QTZA 1RXYA 1OGIA 4MQEB 3DE1X 1J90A 2LUOA 2LFDA 1SEPA 1BBHA 3NIWA 4G0ZA 1M33A 4D9JA 3CRZA 4R54A 4UEOA 3IT2A 5TEVA 3TI9A 1YZVA 1B41A 3DD1A 2QY9A 5F4ZA 1SOAA 2JEOA 4F84A 1QQ7A 2R62A 1TVKB 1W85B 4H7HA 4TMXA 2ZATA 1SCUB 3OZAA 4DSZA 2I6FA 1YZLA 5IVDA 4YROA 4J0HA 1ZRNA 2HK9A 2I2CA 1OH8A 4FOLA 1A2KC 5KQLA 1B8UA 2E1PA 1XZMA 5KTKA 3IQFA 4Z1MD 3N0VA 4UUQA 2HCBA 3IBCA 3K70D 3ZI7A 4BWFB 4G07A 5KEIA 2OEXA 1I0LA 2FPMA 3HSKA 4GYKA 2FFAA 1YB6A 1NLYA 2H7XA 3DJFA 2H85A 1WB9A 2G83A 4YAEA 3VTKA 1O4WA 3ADDA 4DG5A 1RXIA 4FESA 4IIHA 5B57C 2OSVA 4C7XA 5EE0A 1F17A 5EGSA 1D8AA 4GM4A 3ESDA 4NU8X 4WBNB 2YMPA 3KLBA 3IO3A 2L0XA 4MVJH 3SNHA 3P9ZA 3H11B 3FMVA 3K1YA 2CHUA 2Q21A 4JI6B 3K0AA 1BHO1 1DBSA 5CYOA 3V7OA 5JARA 1F14A 1GN9A 4BXOA 1Y1PA 2R60A 3KETA 2Y1WA 1M34A 2AOTA 5BNWA 1RAAA 1S0UA 4LECA 2BBTA 1TLTA 1NJSA 2TYSB 1MX3A 2VJMB 5D00A 3LUBA 5BN4B 2FMIA 2R25A 2R7WA 1JE1A 3KVOA 4GZ6A 1NBEA 4EPVA 4WBSA 2JAPA 3TX6A 4NF2A 3FAPB 2WR8A 3PLNA 4QARA 2F3TA 5EKXA 4Q4DA 3CYFA 1QNLA 5JAOA 1GQRA 2FW0A 3P9QA 4KGVA 2EQAA 3O26A 5K4GA 1U4SA 1LRJA 3D8HA 1OPRA 2QI9F 4OIMA 4F5ZA 3T99A 3CF4G 5CBPA 2V4MA 2DHEA 4HQRA 1N3IA 2FX2A 1XJ5A 4K86A 4ZU1X 4HLCA 1Q83A 3ZK9A 4B6EA 4F3RA 3ZBPA 1NQOA 4N54A 1AQNA 2X77A 3V8EA 3TOZA 5CK5A 2VDWB 4EB8A 3BGWA 3ER8A 4FAPB 2AN1A 2B8WA 4RNDB 2B98A 3I61A 3ZEIA 4HRAA 3DE0X 3MUOA 3AL0C 1VA4A 4YCAA 2RI1A 3AKZA 3H9CA 4UU1A 3HYTA 4ENRA 4NENB 4V39A 2GCOA 4NYJR 5K3AA 5TR9A 4XPWA 1JEAA 1FJHA 1L5VA 2GUWA 3DLAA 2PYZA 5IAEA 2XJ4A 4E7PA 5D3QA 2BHRA 3O4RA 4JW1A 4MQFB 4TXJA 3EPKA 3WNCA 3GOHA 3CMMA 3K0EA 2BMFA 2FOXA 4DNOA 2E49A 4AMZA 1IUKA 1NPDA 2ZRCA 3B6KA 4IDDA 1EBBA 3M1LA 1RKEA 3K30A 4R7ZA 3GBVA 1C9NA 2RH9B 2R86A 3OJ0A 4X95A 2VTKA 1M1YB 1GL9B 3JYPA 3H2IA 2AUNA 4FYMA 4YT5A 3WRVA 2HJRA 3IRVA 2QT9A 1Z68A 1C41A 3D3WA 5CGQB 1JNYA 1BJKA 5ICSA 2QUHA 1AIPA 2PUFA 1N78A 2DTXA 1C1DB 4V38A 3Q3HA 1B14A 4MYTA 5JWRA 3CR8A 1OFUX 4UPVA 3IQTA 4BQSA 4AX8A 4CM7A 2FW7A 2FP4B 3T3EA 2A1UB 4G81A 2HMZA 1IZ7A 1GUZA 1KZ4A 4C29A 2WWFA 2ZBVA 1N8TA 4DJAA 1PEKE 5E6RB 3EIEA 3O8OA 3TQOA 4C22A 1VB3A 5B53A 2CCGA 4NDNE 2XRFA 5BMVA 1XN1A 5IU6A 2FU5C 5G4LA 4TMTA 3PX7A 1H5UA 4YFVA 5CCBA 1P77A 4RADA 5DTQA 1SUWA 2IPNA 3AM5A 5E6SA 5CCXA 2P5YA 4A2NB 2E4UA 1POXA 4IF4A 1FQWA 1N5KA 3LUDA 1NKSA 1GILA 3PNBA 2A0YA 1WCXA 3IESA 3CEXA 2MSEB 3VUEA 2QTMA 3ISTA 1V1MB 1U0FA 5C4IA 1CHDA 3MFYA 5HTKA 3D9QX 3UCEA 1Z0IA 1ZYUA 1O94C 2K2QB 4Z8YA 2YHIB 3D7RA 2QX8A 3INNA 2BJWA 2CNBA 4H1UA 2AKEA 4WXHA 1Y33E 4Q7JB 4YAWA 4MK4A 2BM8A 1Z83A 3PI7A 4AXBA 3GELA 1FQKA 5F7OA 5DBFA 1UFRA 4AJIA 2XNSA 5I7OA 1C29B 3BDAA 3M6VA 1MJ5A 3ROPA 3JRTA 3H4IA 3D6TB 3A04A 4RJKA 4ZTUB 1MF7A 3SXYA 3NXSA 3TGWA 3GGDA 2P5TB 5BSEA 1SZJG 2QKYA 2EGGA 3QUCA 3ETGA 3BUSA 5TGDA 4HOYA 4NVRA 4LBZA 4PCUA 3T6JA 3N7TA 1EZZA 1ISMA 1XD2A 4HN4B 1PEAA 2XGOA 1K7EB 4PHTA 2F1IA 1XRRA 4V1CI 3WADA 1KOLA 3HB9A 3ZV4A 3CHYA 2R4TA 4FP9A 5GTDA 4M0MA 2GVZC 3ADKA 3FCAA 3UHFA 4ZI5A 4WY5A 1RW4A 3M6WA 3SIXA 1V5GA 5CTAA 3ZIDA 4L5CA 2ZT6A 3KV1A 4JB8A 4HATA 1ZN7A 5BR8B 4X9XA 5IK2A 3RVOA 4CM4A 2PUBA 1YACA 2CYAA 1B1CA 3QE3A 3KB8A 4L6RA 4ID3A 3P9YA 3KXPA 3EQ6A 3NHRA 3GBPA 5EMHA 2HQ1A 4FN4A 1YS9A 2ZYDA 4MVJA 3ZCQA 1QP4A 1P75A 4IW3B 5EJ2A 4UREA 2OB2A 4OJYA 2PFSA 5DLDA 1N8SA 4QFCA 3JWGA 2WKSA 3T7CA 4C5AA 4BNYA 3SBOA 2QL6A 4I3GA 4F4IA 1D1BA 2HZ7A 3GJTA 1VSVA 3ZXIA 3Q9SA 2Q45A 2WZLA 3C3KA 4HAVA 4N8DA 4Y2JA 3FPCA 1PZXA 3QK7A 4DUGD 3I9FA 4IAQA 2G1JA 2OZEA 3FOPA 1Q1EA 3HKCA 2GHQA 4FE4A 5DGIA 1CZRA 1E4EB 5IC6A 4WZAA 3HNLA 1BX3A 1Y4ZA 1J0EA 4U9DA 1XKLA 3OUTA 2HIMA 1IQ0A 5FH9A 1JP7A 4PF1A 4Z9JA 4L0QA 3HNOA 4RK0A 3RFCA 1JA0A 3QLUC 1F2UB 4CFYA 4XWGA 1L1FA 1CUFA 3DKIA 5ITZB 4PG5A 3LPDA 4WK2B 4EGQA 1EFDN 2ZSFA 5KCZA 1KPIA 1G63A 4OP2A 1S8NA 3T1TA 3E8MA 3IXMA 1WKVA 3IUYA 3ZE2B 4OUDB 5IAGA 1EM6A 4P36A 2AWCA 5MN6A 1EA8A 2MOKA 5LXTF 2J5RA 4BMZA 1SXJC 2OHGA 1PJAA 4F56A 1NF9A 4CKZA 3QVTA 3WR5A 4YQYA 5FI1B 4CLOA 1KFBB 2WTEA 3DULA 1IWPB 2JAXA 1FS6A 5SICE 3EGCA 5JDIC 3ANSA 4FGKA 3MXTA 1WZIA 1H2XA 4YIHA 4Z9FA 5BRNA 4ARUA 3FTPA 3UMSA 4TWRA 4G0NA 4G86A 4B3CA 4BO0A 2YV5A 1IK6A 3PK0A 5DHQA 4HRVA 2JIPA 3C85A 3KWLA 1MGPA 3PQ6A 3K8YA 1V9LA 5JCZA 821PA 2I6GA 1WLSA 3T1HB 2QLAA 1RD4A 2IWRA 2EFJA 3QKTA 3QITA 2FSVC 3K71B 1N2HA 2WKWA 3QTTA 1QVRA 4QOEA 4QO8A 4FGWA 2VZLA 3ZNOA 1A77A 1ZHWA 1VHQA 1TMGE 4IYRA 2Z8XA 3EZ2A 4XVCA 3MJ4A 1R9GA 5BP7A 2W6ID 1R16A 2ESRA 5EKUA 2FKAA 5GJBA 4EEZA 4WX2B 1RZVA 2EJUA 1CR6A 2O7RA 3LM8A 2IGTA 1JBQA 1CK4A 2UYYA 1FYWA 4R2HA 3WBKA 3ABRB 4HEA6 3WMWA 1GFZA 1PG2A 3PDIB 4E11A 4XDZA 2ASVA 3JAKB 1RQLA 2JGKA 5E3JA 4PXSA 3ENNA 2RD2A 4XSGA 1J9ZA 3ABOB 4K9OA 3BWXA 1ZAYA 3CB2A 3TPCA 1UJMA 2BTQA 3ZV6A 1SVUA 1YC5A 2QL5A 2YC4C 5LU8A 221PA 4OFWA 3S1AA 4WCDA 1K5GA 4BNNA 3EZHA 4AY3A 2GR9A 4J6FA 4C4AA 2GAFA 3ULKA 4PE5B 1YTLA 5L0GA 2XTMA 3FRJA 2JFHA 2YWFA 3HZZA 4FYHA 5EE9A 4IX9A 4RIIA 3F7TA 2J87A 5F2OA 3C3PA 3H4TA 1H3NA 1NW4A 1IE3A 1JA9A 3ROQA 3EVGA 1AF7A 2OL4A 2OD2A 2R7LA 2VTVA 4PRYA 3CBGA 2Y3DA 2ORED 5CI8A 1ECLA 4TYMA 4HC4A 2C2MA 5ENZA 3QVVA 1MQ9A 3OKPA 1HTWA 3NNDA 4LLEA 4Q93A 2HF9A 1S2IA 4ZVPA 1JUDA 3SD7A 2W90A 3IQ5A 1DRKA 3K6JA 4KRXA 2XL6A 1VYTA 1XUOA 4QA9A 4Z4QA 5A9TA 4ZO6A 3NTOA 1QE3A 3OVMA 3DKRA 3P2IA 1NLZA 1NU8A 4IGGA 3PFWO 2GK3A 1CVLA 1N3LA 1WD5A 5TXGA 1AUXA 2DHCA 4H15A 3E9QA 4MWDA 3G2QA 2YOFA 3QLEA 3TXAA 3HY4A 1XOIA 1AKUA 3MTDA 3CWZA 2HU7A 2LPMA 1MJNA 3FDZB 2Z8YM 4IRUB 1QOQB 1LSJA 1CS4C 3D8UA 3LSTA 3AH8A 1L7PA 5FTLA 4POAA 3K1HA 2M1XA 2D7DA 3W6OA 4B2LA 1DWOA 4MZDA 5JALA 3V80A 2WMDA 3UZUA 3Q7TA 2CE2X 5FBZA 5IBCA 2GK6A 1XVVA 2G77B 4OJTA 2AC7A 4CIBA 3KQVA 1Z0ZA 2H5EA 3IEUA 5FWYB 1YDIA 3AETA 1UQRA 2ONCA 4U7TB 3RU9A 4YHBA 1O96A 4B3TB 4DE5A 1U0BB 1Z6ZA 1I6WA 5EP1A 2I55A 4Q1DA 2X0NA 1F06A 3TXXA 2DFNA 2G1UA 2Z4RA 4GHWA 1KKLA 2Y1OA 1SPXA 4B76A 1DQNA 2YASA 1ZGGA 4EY8A 5K0JA 3HJFA 3G1WA 5I4CA 4X20B 2FPKA 4BS9A 3R2PA 2B9VA 5G0TA 2IPMA 1HDEA 4GMFA 2TMDA 2DR3A 2NVOA 1KQFA 4L1KA 4XD7A 3ZI0A 1X13A 3OCXA 1ZONA 3VKGA 3KBOA 5E2QA 3ZDXB 1AVOB 3TH5A 3ZHOA 1V16A 1RJ9B 4C2BA 2Y3BA 4V3CA 3HKDB 3AF3A 3ZU2A 3C1AA 1PZEA 3PZBA 5M7EA 1LSSA 1RMQA 2I4LA 2J32A 4MUFA 2OA0A 2RG1A 3GNSA 1MO5A 5C5IA 3LJBA 2JGFA 2YMQA 2XXBA 3VPDA 3LUKA 2BEJA 3GODA 3LNTA 3EGVA 4KLNA 2XOKA 4L8WB 3GLKA 4XI9A 1UKCA 4L4UA 5B58T 3NAMA 3BWCA 4KXVA 5KQMA 3WFJA 5DHSA 2XLEA 4NY3A 2J0UB 2NYVA 1NTOA 5KDLA 3BWEA 3U62A 1MOQA 1FNTc 1P7VA 4H4DA 3S2UA 3PX3A 5BRAA 1RQNA 4W63A 5AUOB 1EAYA 1JG2A 1XCJA 3SZMA 2RSLA 3EGDB 2AOVA 2ONJA 3RRXA 1G2QA 3OQHA 4Q02A 2PO7A 4I9UA 4H7DA 4L72A 3H83A 3THRA 2ZJ3A 2XGSA 1ULTA 5DHUA 3CRRA 1Z5OA 2NO7A 3DS8A 1QHGA 2ZPUA 4JFRA 4HWPA 4D92A 1L5LA 1PYOA 1N1MA 2ZVDA 3IR6A 4L5BA 1QV6A 4Q6WA 4IS2A 2OPBA 2CXNA 2G8NA 3EUEA 2XEXA 3MSCA 4FONA 2RH8A 1LSUA 2J3KA 2G82A 1PGPA 1KVTA 3EEQA 1KQGA 1OF1A 2OG2A 3C5HA 3L4BA 3ZKWA 4CUZA 3IHUA 2OBBA 2C9MA 1ABBA 2EBUA 3C5WP 1O9BA 1U98A 2YQ4A 5EJGA 1YB7A 1I80A 3MS2A 2QM0A 3M8KA 1MHTA 2GBPA 2QORA 3CNLA 3QVGA 1D9ZA 1P39A 2EPNA 2YOGA 2MWQA 3D81A 4GPAA 1R4NB 3OD5A 4MRPA 4EMSA 1GGNA 2G9UA 4GOXA 1OAAA 1C8BA 3ENZA 5KVQA 1P74A 3JX9A 4OF4A 1CZNA 2Q1SA 5KYWB 3IT1A 3M83A 3V1NA 4U5CE 3AHJA 3MCVA 3TIGA 4DNPA 4U4AA 3V46A 2BGWA 3SXZA 5HKKA 1ZXBA 4QBGB 4AAYA 4GT1A 4F11A 3A2KA 4P0TA 1SY7A 1IWBB 2AMYA 2W00A 3LUCA 1SD5A 2B1IA 3LCJA 4Y9TA 3LPLA 2C4WA 5D91A 5AUQA 3NT5A 1QH1A 3VYVA 3AI7A 4EF6A 4JLVA 2O7VA 2FRDA 1U1FA 4DXWA 3I72A 5CEJA 1O6ZA 2CFRA 3EXAA 3L4SO 3CKMA 2FUG1 2ZXEA 5CDUA 2OLEA 3H17A 3LESA 4N0EA 5B1IA 1L7OA 4IFBA 1D04A 2CVFA 3O0TA 2JHFA 5C52B 1EDEA 1OVMA 5H9WA 4UE2A 1CUBA 1PT6A 1KC3A 5DTMA 1CERA 1KI4A 3N75A 3D5TA 5DW0A 3A1DA 2D62A 3R3JA 2ZYGA 4P3YA 3K6SA 3FDJA 2W2TA 1SIUA 4FNGA 2Z5FA 3D1LA 4QRDA 1NI4B 4XUEA 1BH2A 4GECA 4PYQA 2GASA 5M29A 3T52A 5JZSA 3BCUA 1TUGA 2NP7A 1JNXX 3TBHA 3WIUA 3KKNA 4FFLA 2ZWVA 1CQXA 3ZWPA 4YT2A 2ERYA 3MQ2A 4OHCA 1HPLA 3CLTC 3V3TA 3RRYA 1O6GA 5FEMA 3LGAA 1GPKA 2WOJA 3OFJA 4DR7B 1C3OB 4KPYA 2QTVA 4AX4A 1VFPA 1XPJA 1V4VA 1P8AA 5FZTA 3PMRA 1I30A 2P78A 3E05A 1Y6RA 1UXHA 2ATIA 2Q9UA 5JOQA 1R5JA 1QZTA 1XTKA 3QFRA 2P9JA 3TKYA 3FKJA 2CC2A 1F4LA 4GMKA 1EFVB 4CIXA 2H4JA 1IOWA 1LPPA 4Q7CA 2P3SA 2VI5A 1NNUA 5EI5A 2JASA 2LGJA 3AL3A 2G06A 4KIJA 2EFYA 4XGIA 3CURA 4M87A 4YREA 3DE7X 3FUTA 5CFZA 4FZ3A 1DINA 1H2BA 3QTBA 1X7GA 1RI1A 5EUCA 4BP3A 5DS6A 2JJYA 2ZREA 4RK1A 1L9XA 1SN7A 1G8PA 3FNFA 3VOTA 3BGIA 4WUVA 2O5CA 2HT6A 2G0NA 2RGEA 3BRWA 4OQEA 4LDKA 1FFAA 3L7NA 3V4PB 3GORA 1K0UA 1I8TA 2IJGX 4WN3A 1EI9A 3WB9A 1RCTE 4ME6A 1SD2A 4URUR 3U0VA 3C8GB 2EZTA 1OCOC 1SUPA 1FNSA 2R48A 5CW1A 3PC4A 1N5MA 4G8DA 1HQDA 2YY7A 4KLCA 4KSBA 1KFJB 4UDXX 2PGIA 1WMEA 4MTFA 1AJEA 2GESA 4AKHA 4ER9A 1BX1A 5JBIA 3ILYA 5DNAA 2M32A 2DFTA 3N5KA 1NUTA 3WNZA 4ZEVA 4TLDA 4NEQA 4F4UA 4G5QA 4U5QA 3I9LA 2CLHB 5JLIA 3MCTA 1DX9A 4OL0A 1JJBA 4QPDA 2XZOA 4F6CA 3FNQA 4YYEA 2LW7A 4GE3A 10MHA 1IB0A 3KT3A 2X51A 3QVYA 4LXQA 3I3OA 1H4QA 3Q9LA 2A9OA 3F96A 1XZJA 4OHWA 3FSEA 3OJEA 2IU6A 3AIMA 3DEKA 5AQ1A 3QEMB 4I8XA 3UMYA 4AN1A 4AT1A 2J9UA 3A1CA 5L0DA 4D7AA 3MTBA 1DLJA 5FWXB 5EWJB 4MVRA 1DFGA 5G0VA 1U28C 1ZG3A 4EA8A 2XLVA 1SIOA 2SCUB 4RH1A 3TZHA 3FR7A 5FPSA 4QBFA 1MPTA 3V1KA 4LACB 3KU1A 4O2BB 4UBNA 1FP4A 9LDTA 4FR5A 1NE2A 2OR3A 3K1IA 1YQWA 5E9AA 2DETA 4L8FA 3H5TA 4Q12A 3L1JA 1DADA 3ROEA 3H3JA 4JI4B 3E9RA 1JLKA 1G3MA 2VAXA 3MGAA 2V0NA 5EMNA 4GR9A 2IXFA 1NMXA 3S2ZA 3B8HA 4M46A 4N5MA 3O6VA 1JKFA 4PBRA 1QHEA 3DDOA 3WWZA 2VOJA 3UFBA 5KU1A 3BMOA 1YJ5A 1Z0AA 2VP0A 4YA6A 4KE9A 1KQ3A 4DLVA 4HFFB 3C3AA 3Q7QA 5CURA 1DRJA 4LF7B 3LU1A 4ZARA 3DYVA 1TCCA 1K3FA 2NADA 3IBYA 3WK6A 2QG4A 3HP7A 4HAUA 4NQZA 2PSDA 1E9AA 1ODKA 3IRUA 2BGLA 4MLZA 3K70C 2LDBA 3AG1C 3UR3C 1RC8A 4JRZA 4JJ6A 4QGSA 2IA5A 2FSGA 4FNMA 1FTQA 2I22A 2RHJA 3Q5EA 1K7SN 3OT5A 2XB2A 4C0LA 1ZFNA 2GPAA 1M2HA 1X0XA 3BTOA 3AKEA 2QZPA 1H9GA 1WXEA 1QQBA 4ZIRB 3OJWA 3SQMA 1YHNA 1XG5A 4F3NA 2CCJA 4DIEA 1OTHA 5L3QA 2Y05A 3I1IA 2B5VA 3RYIA 1OJLA 3KD3A 4OIQF 2VTBA 1FNMA 3GFGA 2FUCA 1VJDA 4KQFA 5BN5A 5CB4F 2VLBA 3CZ4A 4WGZA 2H7VA 3UTCA 1HYBA 4U1RA 3WQRA 4CE6A 1JGTA 3B82A 7AT1A 5H70A 3LEVA 1M0WA 3R7AA 1KO5A 2NX2A 1TWCA 1G4AE 2IT1A 1VOMA 2LKDA 4CM3A 1YI0A 3DMNA 4B3IA 2OP0A 1R6VA 3MMNA 2YJ5A 3KALA 5G2OA 3T5MA 5EFZA 3QU5A 4GQIA 3KXLA 1PZHA 5KO2A 3PGJA 2WI8A 1FW8A 5AXCA 2AJTA 4MRMA 5HM8A 2VK4A 3CY6A 3NCTA 3TG2A 1XTBA 1VLZA 1N2JA 4H3VA 4R1TA 3MA0A 2JB9A 2F8SA 2ODBA 2X3FA 3C3EA 4OFZA 3U4HA 4NJOA 4RJJA 3KEQA 2XDWA 4O8ZA 4C2TA 1USGA 2C54A 3BQNB 1BXRB 5JAQA 2VKTA 3H9QA 1EE2A 4W7IA 5KAMA 3EIXA 3GGSA 4JCHA 1E6UA 3ED1A 2X0IA 4H1WA 3AOUA 5BUCA 1VG0B 1CUYA 2G4CA 4MDYA 2PKRA 3WLEA 2BSQA 5MFZA 4B2PA 2O7SA 3PXBA 4N3AA 1QB7A 1A0OA 1JR3E 4JNCA 4CKBA 4HI0E 3OEEA 1EWYA 4OYRA 3SX4A 2NO4A 4IHJF 4DV4B 1PJTA 4WESA 3JARA 4GZ3A 1IBMB 2XSZA 3R20A 2FWRA 2R7QA 3O90A 1VYIA 4TUYA 4AJNA 3DC2A 3VU3A 1J20A 3I37X 5ALGA 2GKGA 4ZK6A 4OAOA 3F7OA 4JLDA 5EJMA 2G6TA 2RGNC 3VGJA 2FDCA 3DT8A 1NXQA 1X94A 1DT3A 3AJMA 1BGVA 3BKWA 4ZO8A 4QI0A 1Z5PA 3KHUA 3GVIA 3T5PA 3B3FA 3L8IA 1DV2A 1D6NA 1FDRA 4WW0A 4UATA 1GTG1 3LYUA 4X65B 2HM7A 1DRUA 4YWQA 2H59A 4A4DA 3D1JA 4ACBA 3AEYA 1YS4A 4PYIA 1NNEA 2QR2A 4TV9B 2GARA 4Q9DA 4A15A 2YMLA 2BD0A 4TVOA 1WTCA 5ARCA 4H59A 2Q2WA 5CX4A 1LD3A 2VYND 2O20A 1P2FA 3SIRA 4JSRA 1CEXA 1TF2A 2IHNA 2IXEA 4IEFB 3LV8A 4ETNA 4WY2A 2FUEA 3PF9A 4E0HA 1OLUB 5EJ6A 2YN2A 5ARDA 1HKHA 3ISVA 3WP0A 2LIPA 1MD9A 2QQ0A 3ZNQA 5A62A 1YJQA 1UH5A 3ME5A 1B8PA 1VDZA 5LQAA 3MMXA 4O4LB 2OCKA 1UJ6A 1ZXLA 1WSAA 3MILA 4X60A 4RU1A 3AKDA 3M3PA 5CT4A 2FJUA 2LVBA 2EZ8A 2VXCA 4HWSA 5GVSA 4NV3A 2Z83A 3UUFA 2IP4A 1UJBA 2O8CA 3CZPA 2GXQA 1Z0KA 4F71A 3EPRA 3VKUA 2ZRDA 4KAAA 1EUQA 4JY7A 3BIJA 2I6QA 2PGXA 2J5BA 4L85A 4N7MA 1O6CA 2FOLA 2JZOA 4NBUA 1JWBB 2VH5R 3O8LA 4DKXA 4GC9A 1QSPA 4Y6QA 1JU4A 4G1VA 3IVGA 2JFPA 1XEFA 4R0MA 4YWHA 4H16A 1BEZA 1L4FA 1USVA 2Q1WA 2OHOA 4PSAA 2IPAB 3H1AA 5J4KA 2J3JA 3SX2A 1XELA 5AI0A 3EGXA 4XEHA 4L5JA 4CQJA 5BT8A 5LB4A 1VQ1A 1W34A 3ZBTA 4BU1A 1C17M 1MENA 2X0JA 1MUUA 5HP4A 1O5IA 3NOQA 4MI6A 2BHNA 3UOAB 1BGWA 5AVYA 5B3JC 2AG1A 2YFHA 4YH1A 3PWTA 2Q1YA 2GJ8A 3UHJA 3U4GA 3F6PA 3WLRA 4ZCIA 721PA 1TA0A 4C78A 3MFNA 2RI6A 1P1JA 4URYR 5HZMA 3RBZA 1D0IA 2BISA 4CLRB 2YZKA 3UH0A 2RDMA 2ASRA 4B40A 3NFYA 1ZM9A 3MHTA 2OESA 4G89A 2O59A 3LPNA 2BFBB 2YWCA 3KKOA 1V6SA 2JGNA 2XI4A 1QFSA 4LJYA 1WULS 4CLXA 2XD9A 5AD1A 3OZCA 3EIQA 3B2NA 4LVCA 1PQUA 1I1QB 4CDMA 1HDCA 2GMWA 2EDCA 3EH1A 3Q12A 1J39A 4QYXA 3GLVA 1Y6FA 3WYFA 2QPAA 3FZEA 2FUG6 3DBIA 3PE4A 4Q9KA 5J2UF 2J09A 4O1MA 4AW9A 5HRAA 1DC3A 2ODNA 3KB2A 5BV0A 4NCXA 1Y5RA 2AEMA 3F6SA 2WJWA 1WWPA 4HH3C 4YLGA 1O95C 3DDHA 3R7WA 2NT4A 2VBGA 4FWBA 1WP4A 4FCWA 4RVSA 2IYVA 2ZKIA 1FDOA 4R3NA 3T7DA 4G1EB 1T9GS 3W2IA 4IQ8A 4MNDA 1H42A 2D7JA 3K09A 1X39A 3NJRA 1WG8A 2P1AA 3IJ5A 3ZJVA 5GM2A 1I24A 2Y27A 3N0WA 3ETDA 1X7ZA 1UJ5A 1X2EA 1KAEA 1K5PA 2F8LA 1EU1A 2VN8A 4CHTA 4L73A 4K2AA 3P4UA 4B84A 1VLLA 1VKJA 3I0NA 1NFNA 5LKAA 4OK5A 1GPAA 2B1RA 5JY6A 4PLFA 5L7YA 1ZOIA 3LJKA 4GZ5A 3ND8A 1YQ9A 1QMPA 3Q7RA 3FSGA 5K8JB 4D46A 1NMQA 1ZD3A 3DEJA 3DVSX 3FHOA 5CXXA 2BTOA 2X8LA 2XMRA 1L5MA 3ELBA 4ZZ0A 3IUMA 2QDXA 4P2BA 1I6KA 4CEHB 5ELLA 1Z8HA 5KNDD 1JQAA 4JYAB 4YMHA 3ZQYA 2AS0A 5IW8A 4MDEA 3ACCA 4WKPA 2X2FA 1CQJB 3RC2A 3TRHA 3ZZMA 4R84A 1TLLA 1UR5A 2GDJA 3CQZA 4YBZA 1SQFA 1G5ZA 1KARA 1FP6A 4F4FA 2PCLA 4U6QA 3GJQA 5KSPA 1G41A 4M9UA 3LWDA 1QVAA 3UW1A 1MV8A 1FLAA 1ZIXA 4II7A 2ZRAA 1KYIA 4RANA 4OI4A 2X14A 4DNFA 4AL4A 1XA0A 1A5ZA 3ZU5A 5CU7A 4JKVA 3KFLA 2GAJA 4JZKA 4W8GA 1GGEA 4YHHB 1DBIA 2WBLC 2KE5A 4C4OA 4FD3A 3ZJ4A 2CJYA 3ZDEA 2V0CA 5HJ5A 2B21A 4YRDA 4NBNA 1Q12A 3NFRA 5KTRA 4BP8A 5T4FA 5IC5A 4GIBA 5IH7A 4KYUA 3U4DA 4F60A 2NTNA 2YV1A 1DUIA 2C0QA 5DK6A 3L49A 4IEEA 3TOXA 1E3JA 3F5MA 1DJOA 5T7BA 1RP7A 1ZJ5A 3NWBA 3COWA 4R8SA 3PGXA 3VVLA 5JAIA 1U8TA 2AQKA 4KFRA 1DNPA 3H9GA 3NVKI 2NU6B 1WMBA 2DR2A 4YO8A 1O8BA 2B8EA 2H0AA 2Y93A 4LQDA 2FRVA 4EW2A 2QLJA 1T15A 3BAZA 4JROA 5C1IA 2H57A 4WNAA 2R4UA 5IBRA 5IJ0B 5JR3A 1DC7A 2WAAA 4BEBA 4OXNA 1G9XA 2OCDA 4NZ9A 4FI3F 3ON5A 4KR2A 2D1FA 3N9IA 1HQYE 4UXIA 3GGJA 3K9WA 4ND7A 1TNDA 2PRSA 1G42A 2ID9A 4WVLA 1A27A 1VSUA 1R0ZA 3EG5A 4JUDX 3UGTA 5I51A 1PQYA 5H8WA 3MAJA 1A88A 3GWLA 4HAOA 4RZXA 1RSZA 3GAZA 4NI5A 5EJ9A 4KOAA 1QNFA 4RVNA 5JZ9A 3T5TA 2A1DD 4KPFC 2W98A 2YXNA 1LUAA 5EIXA 4G78A 4IV0A 1UUFA 1DB3A 4PLVA 4GI3A 2HS5A 5HKBA 1RQGA 4DCNA 3HDHA 1GVNB 3FTFA 4TGLA 4ZZ1A 3OEHD 1JR2A 1NLFA 1UBTS 4TSFD 1UBKS 4Q3KA 1SKYE 1NFOA 5HF6A 4LIPD 3JQCA 5G1NA 1V39A 3EIWA 5BMVF 1Q19A 2W2XA 3WI7A 5H68A 1SHZA 5HTOA 1JXMA 5AJWA 3G23A 4JP5A 2F9LA 1MVNA 3REQA 4G5HA 2C4UA 5KZMB 3H2YA 2DTEA 2RSEB 3AC0A 1ITZA 5D8DA 5KAPA 4ZT6A 3R9XB 3F97A 3NPMA 1IVYA 3EC7A 4ND5A 2L6HA 1ODIA 4JZYA 3RREA 2BKEA 2XNDD 1VI2A 2AF3C 1L4BA 1KBOA 5MN4A 5D6OA 1QAMA 4P34A 2IZ1A 3TIXB 2Q5OA 3FWHA 4KIFA 3B12A 6GPBA 1K6IA 1OXBA 2XMPA 4H7KA 4I36A 4FS8A 3KZOA 3WL7A 4J76A 4OD4A 3TD2A 1R50A 2PBLA 3Q7PA 1DEHA 2P9FA 3HN7A 5HEKA 2HK8A 3G49A 4EVQA 4WASA 1DJNA 5CFQA 1WOLA 1XEWX 5FFFA 3HFRA 1QRAA 1K5HA 3O2QB 4NJEA 2LWIA 4JL5A 3ASVA 1SA0A 3RUIA 3E2MA 2J3LA 2BCGY 2WT9A 3KTAA 1YWGO 1DX4A 2IHBA 2ZTVA 3H0CA 2DSNA 3DWGA 5AKJA 1ZL0A 3UC9A 3NAGA 4DV5B 1VSTA 4R1UA 4ZICA 4NARA 1BXGB 4KTTE 2FCRA 3NEYA 4LISA 1N5RA 2YN4A 4MRVA 4LTNA 5F1KA 3QY0A 4O2LA 4KC0A 5EZYA 2YW9A 3OKCA 3LBNA 4LNUB 4TLAA 4RIFA 4KYTA 4GRDA 1F5NA 2QSYA 1U31A 3P0RA 4OMUA 4ENVA 3SAJA 2IEDA 4AQDA 4C4SA 3RF3A 3E5HA 4N4AA 4Q15A 1KWKA 2XT0A 5FRDA 2VQ3A 4CHGA 1E0JA 2I7XA 2N0SA 4FKZA 1XTTA 4IXDA 1RBQA 1HI9A 3MWFA 4LZZA 4MVJF 2ANBA 5BW8A 4C1BA 4S2EA 1WXIA 4V0ME 2RHMA 4R05A 3EEBA 3H1BA 3ZJTA 2EIMC 3BHMA 1A5SB 3HFJA 3JTMA 1R8XA 4DF3A 4H7EA 4IH1A 2KHZA 2AQHA 3GROA 1OGJA 1OUMA 5DKFA 1GKLA 4CIPA 4CR7A 4AYWA 1R9NA 2AMJA 1M2OA 5C4GB 4IV5A 2PQ0A 3TRIA 2I91A 2QRKA 3MAAC 2O0LA 3EZ6A 4U5XA 5AVKA 1O03A 4RK7A 1QYCA 1YJXA 4N7JA 1T1GA 3H2ZA 4G97A 2WYHA 4HGRA 2O2HA 4N5LA 1M34E 2P3OA 5ALEA 1C0KA 4PJMA 1JHPA 1ZM3A 4GXQA 4RELA 4JBIA 3DMYA 4E5UA 2VPXA 4AJJA 2DPGA 3U56A 1A9YA 1X9IA 1U7OA 3GFTA 3E9DA 5E95A 2DWCA 3WLFA 1SGWA 1UP7A 4RGQA 5JRZA 3HYRA 2C42A 3K1JA 4NAVA 2CWWA 4PTYA 4GL2A 3D6UA 4EHBA 4JCOA 1RIIA 2QD5A 4UXJA 4ESVA 4XFDA 1MG5A 2CL6X 2V7WA 4C03A 1E4VA 3S1SA 1FTWA 1L7XA 3BH7A 2JD0A 4IGIA 1XB2A 5BN3A 1CEYA 3DMFA 2YRFA 4H1HA 4QDLA 1L8XA 3C6ZA 4TTSA 1CD5A 3WLJA 1EEXB 5IKPA 4UDYX 4TTJA 4YJ3A 3ZWNA 4KWTA 1Y9DA 2NYRA 5G41A 5B55A 4RV9A 2AOWA 1NQUA 2E21A 4DMHA 1QDEA 3UWMA 2XAUA 4DCSA 2CMDA 2DI3A 4UUBA 2ATEA 4YRCA 3OZIA 1BOOA 3JQ7B 3W77A 4TL7A 4KXQA 4X8LA 1UM9A 2ZYTX 4WLNA 3HEBA 3P0FA 2E87A 2ZM6B 1FPQA 3ODPA 3MWDB 3K4PA 4RY2A 4A6DA 4Y9DA 2OBYA 4RMHA 4F4JA 4MVCA 4UFPA 1KZ6A 4EGSA 3G79A 3AEKB 3G0GA 1VECA 2EBHX 3W5AA 1CJKC 2ZXOA 1XEAA 4R1NA 4E5KA 5BSGA 3WQQA 2YVAA 4WCFB 2V26A 1D07A 2XBUA 2Q3MA 4HDRA 4ZDIA 1HFKA 3GGPA 1SELA 3IP3A 1FMJA 3M82A 2VCCA 4LYGA 3ZWAA 1TE2A 3HGMA 4KU4A 4RA9B 5K45A 1ADJA 3RARA 1US8B 1RRFA 4C7MA 3SZUA 1VHJA 4BKOA 3B2QA 4P32A 1XJWA 1VYUA 1IXYA 5GADl 5D2CA 3T9EA 2EEZA 3KWJA 3WK8A 5MF6A 2IV2X 1CQIA 1TQGA 2WM3A 2J0VA 4RF4A 1YS1X 3OSZA 3TCNA 4DYDA 1JDSA 3E7WA 1E69A 3ABMC 1R00A 2FLKA 1JEJA 3BJZA 3DHEA 3ZTMA 4PO1A 3UUEA 1LGYA 3GMSA 3A8TA 5ALWA 1CEEA 1A3CA 1LLFA 1DHTA 5DI3A 3VPHA 3QW2A 4UTRA 3TJRA 3AERB 1VMAA 4UCQA 1OFHA 3HNRA 1UL1X 2G3YA 1TEXA 2CNDA 2R7UA 1BN7A 3NWOA 4POOA 4LHYA 1MIOA 3BT7A 1KJQA 1BHSA 3PJFA 5K6RA 5GQSA 5A3RA 2OCLA 3IA7A 3TBFA 2W6OA 3PQ7A 4C4ZA 4JLMA 2ZQ5A 1YL7A 4IMPA 1U2PA 3OCCA 3HB0A 4WK4B 4G7HF 5FPKA 5LZ4A 2DPXA 3E70C 2QWXA 1OXKA 2VKQA 3IBSA 2P4QA 1LVKA 3RIYA 5DHFA 5JVDF 1G5TA 3HPQA 2OORC 3FMSA 1CR0A 1ZMBA 5F76A 2XCSB 4K9NA 3SYRA 3GIDA 4NRDA 4WKCA 3HDVA 4ZI3A 1GFWA 4KFTA 2GTIA 1L7NA 2Z3ZA 4ZANA 1E1MA 3CBQA 4PZEA 3L6BA 2QTBA 1RYZA 1C7IA 1PFGA 1EVIA 2AQ8A 1Z12A 3HCAA 3OICA 1OWOA 3ZE0B 2FN4A 2IXMA 4KR9A 2R1VA 5HFNA 1S5PA 1KIMA 3EODA 1NU6A 3B3AA 4UKDA 2C77A 5LD2C 1SUAA 3N07A 4GVPA 4WABA 5C7OO 4AL1A 3PEFA 1VIMA 2A9FA 2GKOA 2V96A 3SQOA 1R8SA 5ARBA 2Z43A 4XLNF 5K1ZA 3ZDQA 4IWBA 5T8KA 1QLWA 5LP6B 2O4CA 3K8QA 1UAAA 5L3VA 3GEGA 4D82A 1BN6A 2E85A 2BEKA 1VRVA 2DQYA 1UC8A 4YV2A 3JQAD 2PBRA 5JNLA 5FR1A 4RKFA 2Y0PA 4EB3A 4PFKA 2ZI5A 3RV3A 4HL6A 2H2IA 3VKWA 1SKAA 1SVOA 4YRSA 4ZAZA 9ABPA 2EFEB 1X80B 3LVQE 1ODLA 1QRRA 3AG2C 3QYJA 2OGZA 1CRWG 3PWZA 3R3WA 1E2LA 2Q46A 3OE7D 1W52X 4PPQA 1XTSA 1ZIDA 2HFJA 1TM4E 4XA8A 4QOIA 4HHEA 3BWDD 2FZ4A 3CB4A 1NBOA 3LFUA 2OILA 4DYVA 2HHHB 5ALFA 5COBA 5SYNA 5C8YA 2BC9A 4ISCA 3SYNA 2ZTHA 3FCEA 3S9OA 2FEMA 2CEKA 3GEPA 5KPDA 9ATCA 5I8WA 1NL3A 3KAJA 3ZCXA 1C30B 1E3WB 4WZAE 3CNQS 4BVLA 5AH0A 1TDJA 3NPAA 1NF3A 1JTVA 4HZUA 3KOOA 4JBGA 3AHFA 1JW9B 3ORRA 3NVMB 4KI2A 2WJ3A 1QFMA 3AK4A 4G4JA 4MLDA 1LTHR 2NZ8A 4O4JB 4H2DA 3UWDA 3DBHB 2NZJA 1YVDA 4QXPA 1COWA 1FBNA 1ZOPA 2PUGA 2ROQA 1GTRA 2EYUA 1PF7E 4KQ9A 2Z6VA 2ARKA 4MO9A 3RVBA 1OLXA 4DBQA 4LBWA 3EXHA 3B5JA 2UVPA 3QG1A 4EIYA 2D1TA 3G1UA 1OA0A 3KR2A 3L84A 1W46A 3CVYA 3CCCA 2BGTA 4CS7A 2LIVA 1YFJA 1PQWA 3O38A 2ZQYA 3ZV7A 1E0DA 4YUXA 3UH1A 3LLKA 3DE4X 3SSNA 2VDQB 3I12A 3WA6A 1TM2A 2BP7A 2PUTA 1USUA 2PMDA 3AY3A 5EZSA 5KX5B 1R3UA 3RFFA 4REQA 4CI9A 2FMKA 5I9TA 3LXXA 2LNDA 3VR5H 4DUYB 5ALUA 2ZWPA 2D5IA 3GLFA 3IKTA 2FK7A 4FYPA 4JJGA 3LSYA 4LJ7A 3FTEA 1MXFA 3CZAA 3V7FA 2DOKA 4JC8A 1YE5A 4DLUA 1JFFA 1X1EA 2Y68A 4FEYA 3FLBA 1G8AA 5THXA 1J0AA 3AUXA 3RYTC 2E7ZA 1IY8A 1XHFA 5H1YA 3UK0A 1DPFA 1QH8B 3DUWA 4K0RA 3ASZA 1K7YA 4PR3A 1N36B 2VRWA 3THSA 3JY6A 5JECA 1ZW2A 3N2NA 3BSFA 2YIMA 1QV9A 3ZWWA 1EVZA 1E63A 1XTQA 3WGOA 3PDJA 3GPDG 3R6LA 5H7XA 1NWCA 3AESB 3KKLA 3ND7A 1Q5PA 5HKAA 2YXBA 2YCLA 2QPLA 1IPFA 1JILA 3MFQA 2YWAA 1NW8A 3V9AA 2XM0A 2EFDB 2W7TA 1U99A 4DHEA 3SCZA 3HCPA 3KC2A 4NCKA 5ALMA 3M81A 1QLJA 2XQIA 2B30A 4WLVA 1IFXA 1MG0A 2AMLA 1HMPA 4TZ0A 4A2QA 2G17A 2RG7A 1GRNA 3KZNA 1OASA 1II8B 3ND9A 2R66A 3W8HA 3GLHE 1L4NA 3GCWA 3W2TA 3HLTA 2Q49A 4BYMA 2Q9BA 3PX2A 3NEAA 1PJSA 3G85A 2RJNA 1CR2A 3WK4A 3ML1A 1SCAA 3R2JA 4U7JA 2SICE 1HDOA 4CS8C 5JH7B 4PAWA 4C7KA 2GGSA 2KC3A 4KG7A 1G8SA 4X85A 3GQBA 2XD4A 4RSRA 3MRXA 3PKZA 4H18A 4FT4A 4CS9A 3RVLA 3MJRA 2VLIA 3MJTA 4JFAA 1VI5A 1SBYA 3EEIA 1NXSA 3BB3A 2QJRA 1OI7A 4CM9D 3IDQA 2DLDA 2Z2XA 1PI3A 4I1OA 1DKUA 1K97A 1XN4A 4OQNA 4V1CB 2X7HA 2ZYVX 4FTWA 3SG0A 4X90A 3RK4A 1JAIA 1KJNA 4IDHA 4XLLA 3LWBA 5ALIA 4IZHA 3UMRA 3EF0A 3TEFA 1NBMD 2I4IA 3WHLA 4FJ2A 4LK3A 2QQFA 1Y82A 1CNMA 4JEHA 1QQ5A 2V6JA 3OQ1A 1BCRB 3QUTA 4BX3A 3FDXA 3F47A 4JHLA 3FVRA 2O23A 3TQRA 4M8KA 4Z9YA 1UAYA 4QASA 1UMCA 1CY7A 4QBKA 2HWUA 4OXYA 1KMHB 4BKUA 1ODFA 2CKDA 5FWNA 1HE5A 3L0PA 1RAHA 1TJYA 4KQ1A 4QNMA 2F7SA 3VKHA 1ZVVA 4BMSA 2EOAA 3KSAC 4Q82A 3C5EA 4UAGA 3BK7A 2ZSJA 4AVYA 3IA2A 1I51A 2H4HA 4P9TA 1LEHA 1CS0A 4RTKA 4LWOA 2JK0A 2QM3A 3LNMB 3HU1A 1QIFA 4XCXA 3RJZA 3DH0A 1VL0A 1M67A 3OAAD 4IWNA 4MWTA 5TX7A 1XZ8A 3EUFA 1VMDA 4Y67A 1R74A 4IXTA 6PFKA 4DLZA 1I9GA 2FPPB 5KJ1A 2NVBA 4NOJA 1YDWA 1FW6A 3T9DA 3BMCA 3SPXA 2IY7A 2V9ZA 4BLVA 3SBEA 3DF7A 4CTNA 2JARA 1O4VA 4PLHA 4XQCA 4LY6A 3W9YA 4P53A 3VV3A 2PGLA 1M75A 3BJMA 2BCJQ 1JDTA 3BM5A 4HDNB 4W5OA 4AZVA 3QFHA 3OLXA 5H3CA 4D98A 2EZ9A 3F0TA 3O73A 5EHXA 1Y9JA 4HDKB 5H3HA 1VRCA 2NYAA 3C8UA 3OJOA 2O2IA 3G9QA 4HH4A 3VZSA 3BGSA 1QF7A 1GKYA 1YRWA 4HAIA 4EL5A 1JG6A 2JG3A 2JKYA 3CM0A 3GPLA 2HFIA 2OY0A 4I5IA 3KUDA 5CJJA 2IYYA 1NIPA 1SO8A 3MJSA 2XL8A 1MMDA 4B3JA 1R0XA 4KQCA 5EXXA 3DUFA 1UBFA 3Q8XB 1Z34A 3VR1A 2KBFA 3N0TA 2Q07A 4ZRMA 1TZCA 3UIEA 2OE2A 3D7NA 3QQ5A 5DN9A 2IZ7A 1T0IA 1QC5A 2YQYA 2Y6VA 1HDGO 3RS0A 5BOSB 3SXKA 3KJEA 2FXIA 4O33A 3SR4A 3NDRA 1RBZA 1UQUA 2GRJA 4MP6A 1SOWA 1QYIA 4AUKA 2H2FA 3LVBA 3S2GA 3KL2A 4YUVA 4EG7A 4UNRA 4RZQA 3ZLBA 2XODA 4DDTA 3L2OB 5DNYB 3P4YA 5AJHA 1P2DA 1WMDA 3VR5A 2WUFA 2H0QA 2XUJA 4G36A 4XUGB 3ZEAA 1IEQA 4B3GA 1YZGA 4RHCA 1I7NA 5TMDA 1NMSA 2Q2OA 3ZD6A 3ZE6A 4LOHA 5F98A 2H54A 3M0EA 4FZJA 4K87A 3DDWA 4CKCA 3E1KA 4L4ZA 3RTAA 1WPRA 3KAPA 5B7QA 3WICA 1SUCA 2Q3EA 3Q4GA 1XP8A 4ENTA 1GA4A 4LOAA 2C0PA 2Q4RA 1Z22A 1CR1A 3PITA 4XIGS 4ZEOA 4YT4A 1RMYA 2JZCA 3MF4A 4I5EA 2WSSD 5C7YA 1AZLA 1Y5NA 2OO7A 2QTRA 4UDNA 1YQUA 4KQMA 2Y1LA 4BUZA 1R3DA 4B6GA 3I4UA 4OJKA 4Y2VA 4ZV7A 2X3UA 3I2JA 4DXAA 1LPMA 6AT1A 1XCBA 1VJ0A 5FKJA 4M4SA 1BH6A 2E6UX 1K89A 4CQMA 1CQWA 5A2QA 2DWUA 1HDZA 3VMFA 5ELXA 2E1RA 2H1OA 1M7GA 3O82A 4EBJA 3SSAA 1L3PA 4UM9D 3GWNA 2OHFA 2P9BA 2FLVA 3PU6A 2BEVB 4BLSA 5I9IA 4MUYA 3FJOA 1R66A 2XLOA 2EKLA 1XK7A 1SIBE 3L9XA 1G4UR 1SQ0A 4MUNA 5TNXA 4LXYA 2JL1A 5U9CA 1EUCA 4OLAA 1NLMA 1O95A 3CE9A 4A8HA 2GEKA 2C2XA 1YA6A 3EXEA 3ZXUB 1QV7A 1OQCA 3G13A 4HNQA 1TKNA 3HDTA 2UYOA 2O2GA 4FFBB 4Y2GA 1XTRA 3RIPA 3V2HA 2PMBA 2YLGA 3R0VA 2IPLA 4FYJA 4MS3A 1SUFA 1ZICA 4FHGA 1TQ4A 3PPIA 4W1QA 1NIJA 1V7ZA 2DTDA 5AJZA 2WVNA 1QSGA 1WKBA 2FF7A 1OBFO 3KUCA 2SECE 3WGYA 4MOWA 1BJRE 2VC9A 2AR9A 4UQPA 5JQGB 2QN7A 4FFNA 3EPHA 2WG2A 3UWOA 4IY1A 4DM4A 1IL0A 1Z45A 3MC1A 3ICQB 2R0QC 4R1MA 4BOYA 4OHVA 3FIUA 3GLUA 1X7WB 1ZK4A 4A23A 1P17A 3BJRA 3QXXA 1J0CA 4JLKA 2QGFA 3TOMA 1IN6A 4NC9A 3L8JA 4WPGA 3QVZA 1P9LA 2VXOA 4B3HA 1L4HA 3SDSA 1SR2A 4OJQA 4WOJA 3O0DA 1RKUA 2J0QA 3DXXA 5IBPA 1Q2UA 1UMDA 1G6OA 4YEDA 2QAGB 1R0CA 2GVNA 2VR1A 3JQDA 3L18A 4EB6B 3JQ8A 1YCFA 3C18A 3VISA 2IUTA 2AH5A 2VS1A 2WPDD 1C7FA 2GHTA 1ES9A 4KPUA 1LX7A 3DZCA 2E55A 1NW9B 4AZ3A 1T5SA 3B71A 2C29D 4CX9A 1MB2A 4OLJA 3BEOA 3BL8A 1OX6A 2QGNA 1PV1A 1CULC 1NZDA 4DBLE 5IJ9A 2I2AA 2OZLB 2PL1A 1E92A 1F2VA 4KITB 2YYZA 3X2FA 2BJVA 3WLPA 1O0BA 2PQ6A 4MQUA 2NAFA 4RLHA 2B2XA 4J1TC 5T4BA 2DFDA 4JDPA 4EUKB 1Y1TA 2HUPA 3VHLB 4GM0A 5TQ2A 1ZJZA 4YN3A 3R0ZA 4P98A 4C89A 3OIYA 2I03A 2R5NA 1HE9A 1LC3A 2GK4A 3DOEA 1HSZA 2VATA 2FZVA 3R76A 1JEEA 3SFZA 4D6XA 3MTAA 1N5DA 5KYUB 3B1XA 4LX8A 3GPBA 4HZGA 3CX4A 4HG2A 4TWJA 1HRKA 4U0JA 1AH2A 2OAEA 2AKAB 1RHJA 4PX3A 4YP1A 3ZZUA 1Z3CA 3FNIA 3UAOA 4HTAA 4TLMB 3DQZA 2N46A 4L8YA 2A9KA 3D3NA 1OH7A 4ALJA 3KSBC 3ZKAA 4DRYA 2PLRA 3GV0A 2WKRA 2A7QA 2FZLA 4NOKA 2OU6A 4L9RA 4ILEA 1PL7A 2YWEA 3ZGVA 1KERA 3PPWA 1CRZA 4K9PA 4NH4A 3P9NA 1G66A 2I7VA 2FWNA 2P62A 5T6MA 2CL7X 4JLOA 1H8ED 5D92A 2XOEA 4D79A 3UHPA 2G9ZA 1TIBA 2I8CA 4LY3A 2ZBGA 2D13A 4BCCA 3LKBA 2YUTA 5SV2A 2PKWA 4HB4A 2IRWA 1SHUX 2HA2A 4QPPA 1HYGA 4BEJA 1P4JA 2GM5A 1F2TB 3MJEA 3HFSA 4LAFA 3CN7A 3B0UX 2QY6A 2ZUWA 1OR2A 3NMKA 4C07A 3F1LA 4DDVA 3L0CA 5DCLA 5A6JA 4I99A 3TM4A 3WHNA 5F3WB 4CKEB 4J90A 4JXKA 3OM1A 4B7CA 3HLYA 4U2BA 4O4HA 2BTEA 2ZE8A 3L7JA 2OP1A 2FN9A 2QE6A 5SZHB 4CCYA 4E15A 5LCXA 3RF6A 1MO6A 2XVMA 5JVEA 4ABYA 2BIFA 4IJJA 3JATA 5K0BA 3OA1A 4KO2S 1NNSA 8ADHA 3D0QA 3EA0A 3TNDA 3DO5A 3CVVA 3G8YA 1G8JA 3D8SA 2XRYA 1WPXA 3KAQA 2VAWA 2PLWA 3NH6A 1V1RA 3V2UA 5B7NA 3X43A 1YMQA 4AG5A 1KYQA 4EAAA 3LWZA 2QG6A 3WNDA 1VJ1A 3ZTZA 4AYXA 4GYYA 5KNBD 4LK2A 3ZK7A 3TLYA 4OINF 2JHPA 4EJSB 1DQSA 4D4MA 3FETA 3ZZTA 3UHOA 3VVBA 2X40A 3QE2A 3MZ0A 2QNLA 3NALA 5HZGA 4G1BA 1OXMA 2C1ZA 1MT0A 5CT9A 4BMYA 1JSXA 4M1YA 4ARBA 5B37A 2YIDA 1U0RA 4IF6A 2G1KA 2BLNA 1T9ZA 4UU8A 3ELYA 1PNTA 4HNRA 4BVJA 1GIAA 2PR7A 3U48A 4I4LA 2C7OA 2JRLA 2OQMA 4YGYA 3ND5A 2OAQ1 4GEGA 4RH0A 1XQ6A 2V98A 4FOSA 4OQXA 2VTDA 4L9WA 4BGDA 1W73A 1Q0LA 1LDMA 1Y5IA 2FSUA 4QLBA 5IX8A 2IH4A 1UBSB 1T1JA 3V6LA 3WRXC 1GRRA 4P81A 2WJAA 4M36A 2OMEA 2JJ2D 2CF6A 5A7GA 3GD7A 3CMCO 4A03A 4TV8A 2D5CA 1RHKA 1KVRA 4D41A 4GWKA 1SB8A 1SCKA 1YBMA 2ANCA 1R4MA 1XRPA 1Z47A 2B8JA 3T7EA 1O94A 4JB0A 5DNDA 3ZWMA 2CDAA 2F43A 4LJLA 3HVHA 5T67A 5AOAA 5K09A 2IODA 2P7HA 4FXOA 2E3JA 1KY3A 4ULWA 1CDOA 3U5TA 3M2PA 1H69A 1TOAA 1P45A 1T5IA 1MGOA 1U9JA 3D4LA 2AHOA 2XA9A 2B4QA 1IN7A 3IV7A 2P27A 1G17A 1CUUA 1DCKA 4ARIA 3VZBA 4UXHA 1T6NA 4RS3A 1YR1A 4Q1VA 1U2TA 5J43A 3VFDA 2RIRA 2JIRA 4MIEA 1N2CA 1XF1A 4HEQA 4M9QA 4A0RA 2ZUBA 3VKVA 1E2PA 4G5OA 3H5RA 1N8NA 2VJCA 4IKOA 3LY9A 2PLFA 2ZJAA 2J85A 4NZPA 3N24A 1L4EA 3BWBA 1F4VA 1T36A 1U3DA 1NRWA 4PZUA 2F9MA 4NDAA 1DV1A 1OXXK 3RS5A 4LC1A 1N7HA 2F1OA 4K6HA 2OBLA 4E2ZA 1BHQ1 5F2EA 5B3LA 2V7PA 4YVFA 5LNK1 2W2MA 2G0TA 3ZE9A 5L7TA 3AWDA 3DEIA 4IDBA 2QVLA 3D31A 2O8EB 3K5WA 2IIPA 1U3CA 1MB4A 2PU7A 3COSA 4O79A 5EZ6B 4JDUA 2HDOA 1S3SA 4DY6A 2R68A 5LWHA 3CRNA 2B78A 3HUUA 3FDQA 1E8NA 1MA3A 1F38A 2CSUA 1QO9A 4Q39A 2DSTA 4M1TA 4LGCA 4LXUA 3LDHA 2NV2B 4BPMA 3LBIA 1R8QA 5HIIA 5TGTA 4BNVA 3IIEA 4TMYA 3TF5A 5SYMA 5B6IA 1R6XA 4GPTA 5F64A 1XRSB 3AUJB 4F9EA 5KTTA 2XECA 4G0MA 3FWNA 3KD2A 4EP1A 2JIMA 3EAFA 4N6HA 2MSWA 1VHWA 3QLUA 2CMKA 4RPHA 4DS3A 1D7AA 2RHRA 4FK8A 1U04A 1K40A 4LE2A 1TX4B 3BWVA 4DL9A 1GN8A 1H6GA 3TBKA 3NASA 1CF9A 4KYVA 4D43A 4RTNA 1IXZA 4ZPJA 1AM4D 5AVUA 4JTCB 1K86A 1LRKA 5A9SB 4O63O 4RGVA 1SXJA 4LSWA 3IT3A 1C7QA 5CLGA 2R7MA 2HD4A 2NV0A 3NP7A 1Y7HA 1JHAA 3WSWA 1NX6A 2IYOA 2OC4A 1Y3AA 3KXDA 1JH8A 2G8LA 1Q1QA 1XZPA 2DWQA 4GOKA 2GZ3A 3I6ZA 3KLOA 3EDQA 1IYZA 5JRDS 4HLQB 5COMA 3L46A 1U1EA 4OHBA 2X0DA 2ALJA 8GPBA 3HKBA 3R4VA 4CQNA 1TYEB 5JDIA 2D5RB 1Y6QA 5AKXA 4MITA 3PC7A 2Q5QA 3HY6A 3PHF2 1A9SA 1N77A 1EYZA 3RS2A 1F8YA 4NCHA 5ER9A 3EVBA 2IUEA 2RGUA 4MYDA 4EZIA 1GNTA 2ZFUA 1UJNA 4MPDA 4YI5A 3U7QB 3FGZA 1U2EA 3USZA 3B6ZA 2TSYB 3GDOA 2CFOA 5EUQB 2CUTA 1CTQA 3U5ZB 4UFNA 5J23A 1NA5A 2AX4A 3I5MA 3TLCA 5EJEA 2OQRA 3L7YA 4IICA 3LC7O 4BO9A 1RLMA 3H9BA 5BSRA 1TFRA 4KK4A 1X8JA 2FSVA 3X1YA 4Q66C 3W2VA 2PG3A 3LA8A 1QBGA 2HGZA 3O2SB 3KOUA 5GV8A 5AXBA 4FHZA 2Q6TA 3L6EA 4AE4B 4XVUA 1SU4A 1HW2A 1X74A 3RQIA 2FYTA 2O8FB 3SQWA 1TRHA 2BDUA 1N6IA 3DLPX 2CYBA 3I2FA 2XDAA 3E5NA 1I01A 3OTIA 3TTXA 3MELA 2M98A 4ARAA 2AC2A 4NBVA 1PR2A 1EX7A 4ALLA 1XZAA 4PLTA 4QX6A 4AZ0A 3KQYA 2V45A 1ZM7A 1ZUIA 4B4VA 4MRRA 1FS5A 1D0VA 1QF9A 2BZ0A 4L78A 2H9AA 2O14A 1M1NB 1PFWA 5FA6A 3O21A 1FJXA 1ZW1A 4HPJB 4LRXA 3DV0B 1RWMA 1J5XA 2PFKA 2JBHA 2D6FA 1WY5A 1H6DA 5A6SA 2OHHA 3LE8A 1WQ4A 1NX9A 1U5BB 2WUGA 4DDHA 5FORA 1JYEA 1VIYA 3G5TA 1NN3A 2BMVA 2BEWB 1FNDA 2I7CA 2HMWA 3EMBA 4BO8A 4ZO7A 2IH5A 5K0LA 3GVHA 4JI7B 3KYDA 1ESNA 5ES3A 1FFEA 5CVDA 2JCXA 2QT0A 2CK3D 2W5UA 3PNSA 2N1BA 1P91A 1JI0A 1VPDA 1BHJA 1KO8A 4EHLA 3HJNA 4JJEA 1FR0A 2ID4A 2XF2A 3CPEA 1NY5A 2Q3CA 4JOQA 1I7DA 3ICWA 5DF1A 5EZYF 1ADCA 3BL6A 1AGYA 4FYVA 1EPUA 4RTJA 4TS9A 1Y9EA 1FC0A 1W2WB 3TOVA 3CF4A 3RF7A 1CUXA 4ZZ2A 2WNSA 2IOHA 1QH0A 2OOCA 4AKTA 1NVAA 5K4AA 1YR2A 2YR0A 4OGGA 3ZCUA 2VCHA 3UGPA 3F5QA 1U7UA 4TVBA 1CETA 3JZFA 2IEYA 3H6HA 4PFSA 5IWCA 3O8BA 1PWZA 4FFSA 3GW8A 4GOJA 1BWSA 4G5FA 5JE8A 4PO9A 2HPAA 2KWIA 2BE5F 4YFYA 4C05A 3VR3D 5TT1A 3WIOA 2GM3A 2ZANA 4QPJC 1KK3A 5KMGA 3RRFA 1P2VA 3JVUA 1RKXA 3OPQA 4RDIA 2WW8A 5DLYA 5EXPA 2GWHA 3ZS8A 4DQ0A 2Q9CA 3GLIA 3LP5A 1XJ0A 2P5UA 3FMIA 2XHZA 4CEJB 4KHZA 1AURA 3IAS1 3MW8A 1ONBA 1P0QA 1DXHA 3IJEB 4CLEA 2DLCX 4EGJA 2C2ZA 1NT4A 4AIIA 2JFWA 1NC3A 2PX0A 3TL2A 2P4SA 1N57A 4MLPA 1H1DA 1JECA 2ZJ2A 1RHQA 4CTKA 4KMOA 4RAOA 1GTVA 3QELA 2JANA 3SN6A 1BU8A 1ZL2A 4G5GA 2X4GA 4O2AB 3PGA1 4F86A 3IB3A 2ZRLA 1V54C 2D0OB 3ZWXA 2IZZA 1SBQA 5LYJB 2EFHB 3LZCA 2V5UA 1JV2B 1UBCA 1FXWA 4U2GA 4NCIA 3F4KA 1RPTA 5J2TB 1UODA 4DDKA 4DTIA 1XVLA 3RR2A 3NNSA 2JC3A 3RT7A 4EF4A 1B8NA 3L1IA 2QRVA 1E18A 2E4AA 1JLLA 3S2IA 3LQ4A 4H6XA 5MFPA 1GPMA 3AHCA 1WHSB 4B35A 1YA9A 2YW2A 3ANMA 1UXIA 2WNIA 1M2GA 3GQVA 1JEQA 4G85A 4BRWA 1JIKA 2BMEA 4GX0A 3EZIA 3RUDA 3KKBA 3K15A 2IZ6A 1HH4A 1Y4AE 4DVGA 1FUKA 2A67A 2R1UA 4TTQA 2P5SA 4DEYA 1KKUA 2O06A 3AJRA 1Q1GA 3T8YA 4QDZA 3B1FA 3KPHA 5TVGA 3A6FA 4R69A 2Y6UA 3ZGXA 3DPSA 1T5HX 3WQSB 3P0IA 5DSZA 2WYOA 4GOOD 1G291 3ORSA 3IEKA 5EIHA 1ENOA 4OHPA 1X1TA 1AK9A 3WIBA 1N7JA 3EJ6A 1KIAA 9LDBA 5I9NA 4ZC8A 1H0RA 2VWQA 3RC3A 4AWAA 1KK1A 2OQIA 5CCEA 2JGJA 3H2KA 4QTTB 2QD4A 3IEVA 3N39C 4GSKA 4K81B 3OTWA 3OIVA 3KKQA 3NMUF 1GPJA 3NW9A 2R6ZA 2CLEB 4NWIA 4W5WA 2WHPB 3K73O 1H3FA 4KPGA 3RWMB 4GQAA 2X5KO 4XYLA 4MS4B 3AFMA 2BY4A 4U3JA 3JSZA 4HYEA 1TC2A 2P6OA 4ZZIA 2QP4A 4K7JA 4INAA 2OZVA 3PC2A 2XMZA 3HRIA 3PYLA 4ZGBA 5GONB 1IU9A 5I7SA 1HGXA 4US1R 1MABB 3SF8A 3O9MA 3O55A 4GPBA 3WHIA 4ZQHA 3T3MB 4WFJA 4MP3A 2GNAA 2J0XA 1MQSA 3GT0A 1PO7A 4NBWA 3PC6A 2V3WA 4XQEA 2G3KA 3ZN2A 3GZNB 1JL3A 3EFBA 3LVFO 3SP1A 2FP3A 2J6HA 4GW3A 2CVPA 5EHNA 3KO8A 3JCUQ 3C8ZA 3S2YA 3MMPA 2CDBA 2PU5A 4XGRA 5H81A 2Q4EA 5M5BA 5L8VA 2V7VA 4LFCB 3FVQA 1R1DA 5CIYA 2QMUA 4JZAA 4HGYA 3RU3A 3L6CA 1ZD5A 4EM6A 5JAUA 4RA6A 4JKIA 4IH9A 3QU2A 4A8PA 1I1HA 1OSNA 2QMQA 1QO0D 3U9JA 4EG1A 3UNGC 2VYNA 3EHEA 4BC0A 3VAYA 1NUQA 4QQ8A 2QROA 1DWQA 3VPAA 4K2HA 1W88A 3B60A 3EQZA 3BVPA 2HNBA 5EWLA 3RAFC 4FBLA 5AVVA 1J8QA 5FUWA 4Q37A 4HV4A 5UKDA 3DE3X 1RWOA 2IDJA 4R1PA 4HSGA 3PDWA 5CVEA 5AJUA 4FMDB 4B43A 5I6DA 4CBEA 4MB0A 4MUKA 1L7AA 5EXSA 2WKQA 3LXUX 3MEQA 3HB4X 2GN4A 2VDNB 4MPJA 3DEFA 3W6UA 2QZJA 3PHCA 1QU3A 2CXQA 3MBIA 3EUWA 4IZOA 4BLOA 1JXOA 3ZDCA 3RS9A 2O54A 3UA3A 1JR6A 3DOHA 1FDWA 3GANA 3DL4A 1W4AA 2WG0A 4IYJA 4F2HA 4B8WA 3LK6A 1LTQA 1P81A 3EG9A 5CA0B 4NTBA 3AV3A 4CIHA 1P5RA 4A26A 2CXRA 1YZFA 4C1NA 1FP7A 3ANTA 1L0BA 3MOIA 1XWFA 2FZGA 2VHYA 4KDFA 1PV3A 3E22A 2DX7A 2BDEA 1OX4B 4Q3NA 2Q0SA 3BPSA 2ISSD 5DISB 1TUEA 4LZPA 4J9VA 4FYYA 2Y2VA 4G1UC 1PBNA 4Q4HB 1OB2A 3TNFA 4HLUC 1VJTA 3Q3EA 4C6TA 1R0YA 3SYTA 4WKOA 2UYHA 4Z5XA 4WV3A 3TXYA 4I55A 4NBLA 1DOAA 2H6EA 4D4NA 3GMDA 1AQLA 2D3WA 2V03A 5HKLA 5FBQB 4REOA 4RHUA 1C9YA 4HLNA 3B2EA 4B0PA 5B3IA 4BZZA 1PNVA 3OCJA 2JAOA 1GAEO 4RDHA 4XLTA 2DAPA 3QWHA 2G25A 5C1DA 3JQ9C 5C8YF 4HTFA 4F6RB 1W8IA 2PL5A 4EMTA 1M56C 1L5KA 1IUNA 3CW9A 1GGKA 2WMNB 2PLNA 2ZKLA 1DELA 4EI8A 5L0HA 4AO7A 2IU3A 1BS1A 2NSFA 3A2LA 4BAGA 2O7NA 3AHGA 3U3XA 1NNI1 2O4UX 5F5FA 4A7PA 1A76A 1RWWA 1LPAB 1C9KA 2AZXA 3EGWA 3II6X 1K9SA 4M2LA 1ODCA 3PT9A 3JASB 2Z2KA 4MHTA 3O8NA 2UXBB 4IMIB 1ZLXA 2OOSA 5LNK6 2PP4A 1DRVA 2I6SA 1CIJA 4PFOA 4R8KA 3BMXA 4MVJE 4BMOB 4GYJA 4URVR 4EIWA 3ZDBA 2VJBA 4IJWA 4Z4EA 2MSLA 4HDMA 3ZHSA 2RGDA 4EF5A 1IQPA 3OJCA 2QMYA 2OVFA 1V8FA 1FNBA 5A2GA 2WPNA 1HT1E 3I6MA 4YUWA 3NWJA 2QU7A 2DYKA 3LP6A 3O6XA 1CP3A 3EFOB 3C6BA 1BJTA 1RQXA 4LV5B 1QQ3A 1HG0A 4KCGA 3I9NA 1K7FB 1W36D 3C3CA 1QANA 3QVUA 3UJNA 4K6MA 3EXFA 3CG4A 4WLUA 4GLOA 2EFGA 2OEVA 1S2MA 2O8NA 3NG1A 3H2JA 2IQ5A 3ZCTA 4ZVOA 2BGKA 4QTUB 5K0ZA 1TR2A 1U28A 3JYYA 2B99A 3M33A 1MMGA 3GPCA 5CH3A 1GQSA 3C3YA 1A8UA 3E9EA 4UOEA 2GJ4A 1FX1A 3ZDYB 3V7YA 3QYPA 4A0FA 1EP2B 1YRLA 3GWZA 5EMLA 3VX4A 1KVSA 5A1JA 2CVZA 3CT4A 1GYRA 1SVSA 3IP8A 1E94E 4W5QA 4PZPA 2F8MA 3PZRA 4NAUA 1CUWA 4BLWA 1FNNA 3L7OA 4Q4JB 2JFQA 3UGKA 3L0IB 4M49A 4TROA 5KDOA 5D3MB 2O8DA 1A9PA 1QYWA 1TPYA 3WGQA 2B1QA 2AK3A 2WA1A 4C04A 1CJUC 2RHCA 3I34X 4BLUA 1L7VC 4NK5A 1H2RS 3LO8A 2JGDB 2GF0A 1CJMA 2B37A 3M6UA 3PGVA 4ZJUA 4O59O 2H5JA 2NNWB 2H63A 1DWPA 4TLEA 1T29A 3TINA 1VTMP 4RTPA 1ONPA 2X22A 1HYEA 2C8JA 4J2TA 4G01B 3FPAA 2P9QA 4MKZA 3GDFA 5M3BA 4NBSA 5BN1A 1I33A 3QU7A 5K3FA 2AI1A 4P7JA 2HF8A 2EDAA 4Z1MA 3O39A 3BSSA 4DANA 4WJLA 1NJ5A 1TVMA 5A9RA 3ZQUA 3AUTA 3D02A 4ANFA 2FX5A 5L40A 1S2GA 3IP6A 1PJZA 3IEPA 3CTPA 1JHMA 2KYHA 2G72A 2ZIVB 4TMWA 4DAEA 2XYPA 3LL7A 1ATIA 4AD8A 1W4BA 2GM9A 5TJ9A 3QU9A 5DBHX 2MSCB 3A4YA 2VOEA 3LA6A 2CFCA 3LECA 2MSKA 2IX9A 4WDRA 1U0TA 4E5YA 4BVHA 3WBFA 2WAMA 1P1HA 5TJ5E 2XE4A 1TUBA 1NATA 3O2NA 5HV9A 1P2GA 5B3KA 2ZDQA 3ZHZA 4DR2B 4NATA 1JAXA 3BGOS 3GGGA 3TZKA 4BE4A 3RK0A 3THYB 1T1EA 3ZV5A 3KP1A 1T13A 1A9XA 1A9RA 2QK4A 3QOFA 2ZIWB 1Z7Qc 1XTJA 1Z17A 3M4NA 4S2UA 1QOPB 2B3TA 2ORIA 5JSHA 4U9UA 2ZS9A 1XV5A 2GCEA 4E4RA 2O1EA 4JQZA 4MDFA 4WMLA 3D2AA 2PBZA 3AY0A 1KY4A 1RHUA 4II3A 4Q03A 2ZJ8A 2IVFA 1CNEA 2QRMA 3VQTA 1BDJA 1ZEMA 5LIRA 4ARZA 1W2HA 3M70A 3I9OA 1U8YA 3T7SA 1V7PC 4JVOA 1BMQA 5F3RA 4IMJB 4TRNA 1YAUO 3VPFA 4ZYXA 2QOEA 4CIAA 4Q7LA 4AURA 2R11A 3EVDA 4DWOA 5L95A 4KBFA 5KSOA 3FHJA 1ZNYA 4IHQA 1YL6A 1GPNA 2XRMA 5CLQA 1QLHA 4MA5A 4MTCA 4FIZA 2QN8A 2RKWA 2J9WA 1DARA 1INLA 4MW6A 1GTJ1 2C03A 3T12A 1SVWA 3HI6A 4JYBA 5A6AA 1KH1A 4Q7KA 4G0HA 3U3OA 4LPSA 3BD9A 4MULA 3UXEA 3X1XA 5BYAA 4I9GA 1MQVA 4C4YA 1IY1A 2FB9A 3E23A 1BTOA 2XTZA 5KHAA 2ISQA 4WZBA 1HO3A 3G4XA 1ZGBA 5BWOA 1IDN1 2FPGB 3BAFA 2PX2A 4B4OA 3ICOA 3KSDO 4QL3A 1A8HA 2FZWA 1T3SA 1JQBA 1IK4A 5JTUA 3NGMA 1R4AA 3DWWA 3BRJA 4DJFC 4HZIA 2WP8J 3S44A 2WNHA 1E2DA 1VDMA 1WOYA 4HGPA 4P4NA 1STOA 3AY7A 4AS2A 1UANA 2GZ1A 3LBFA 4BKMA 3RYFA 2NUPA 3V8BA 3IAS6 2RGNA 1GKIA 1RM5A 2ZZKA 4XIJA 2WF9A 1PTJC 3A14A 3F3YA 4RLFA 2YS7A 3TTUA 3TPZA 4TXHA 4RNCA 3W8EA 1QONA 4QT0A 1AQYA 1JSCA 3MTQA 4HEHA 1H2FA 2AOUA 4XQ0A 5LBUA 4HE8D 4YRQA 3LW7A 3VZRA 1PDOA 3PQ4A 1YARO 5LQUA 1OYVA 2XUPA 3SOPA 5EKSA 2H7CA 1FIUA 2ZE5A 4C7JA 3DAYA 4Y0NA 1HY3A 4CIVA 5LQKA 5LJLA 3G7SA 1D1PA 2HA0A 1W59A 3QF4A 4IWXA 4KJXA 2IYSA 4BMCA 1OYYA 1OIWA 2COKA 2IKSA 4W8OA 1A4XA 2ZR8A 1D4ZA 1XZGA 1PV2A 1U3VA 3TYXA 4MYCA 1LDEA 4OY3A 4G0QA 3P94A 4KV9A 2C5BA 4FZVA 4A8TA 5CH5A 2YV3A 3LX5A 3I4FA 5FWDA 2AR7A 2M2IA 2O2EA 3WL5A 2WYVA 5FL7D 1T91A 2PT7A 4KNYA 1YU6A 4EYSA 5IAOA 3A3KA 1W5TA 1VLSA 3KKPA 3NJ4A 3SIPA 4CDYA 4OH1A 3ZCPA 5CBKA 1Y8RA 1T9BA 4KREA 2PX4A 3I39X 1GY8A 4S1OA 1TZMA 2WVGA 4D9HA 1YNSA 3C8MA 3KIPA 4H3SA 4HS4A 3ITEA 3U7JA 1KGDA 5HK9A 3E84A 3LVRE 1HBJA 4XGQA 3PXUA 1H2AS 3U6BA 4US0R 4E2YA 2W2VA 2FR8C 4HFKB 6CHYA 5JYCA 4YLEA 5DLJA 3QKSB 2PRZA 3M4YA 3R5HA 4Z0NA 1VPLA 3O7MA 3WYCA 2RHGB 3GFBA 4AY5A 4IXNA 3DOUA 4QJ4A 5AI5A 3ID6C 5DPMA 1JFLA 1JQLB 2W70A 1PL8A 4FEAA 4X6LA 4B9EA 2JCVA 3WL6A 1J97A 1GZ6A 1QHXA 5D86A 2BZ1A 1OCCC 1E7YA 4RZ3A 3QX9A 3ILVA 5CVJA 1I3MA 1Z33A 4B4WA 3LC0A 2PYDA 4O4IA 4DXDA 4Q7QA 4KHPB 4BX8A 1GPYA 1RLJA 1UXKA 5AW4A 3I6IA 4R2JA 4G4GA 1X92A 1XQ1A 4CMJA 3U7IA 3ZZNA 2ORYA 3TLKA 5CAEB 2ZSKA 3U8VA 2E4ZA 1N9GB 5B3JA 2VUIB 2WKPA 2JJMA 4WSOA 4E1AA 4BVBA 4YRAA 3ICPA 3C6QA 1ILWA 3UAXA 2P68A 2AJCA 1QS0B 4MIKA 3G89A 3VDXA 2CYCA 2P4HX 2PA0A 3F3KA 1HDRA 4B83A 4R32A 5FEUA 3NIFB 3HE3A 3K32A 2FDRA 4N3CA 1UK7A 5ALRA 1JEDA 2QLMA 2O3JA 5TF4A 3M5DA 4PVDA 2JJ8A 1QP8A 3JVVA 5DI9A 3OEYA 1PJCA 4U5GA 1W19A 4A2PA 5DOZA 1EXWA 5DBEX 4OLHA 1O6FA 4NYMR 1MNAA 3MWJA 2V7BA 5H83A 4C7OB 3QZUA 1VJCA 3RS4A 4D9NA 3A2NA 4C0WA 16PKA 4OX9Y 4XX0A 4DUGA 5GOZA 3TW8A 3GFSA 4GLFA 1Z0FA 3OHPA 3N8IA 1PE0A