3VM6A

Crystal structure of ribose-1,5-bisphosphate isomerase from thermococcus kodakarensis kod1 in complex with alpha-d-ribose-1,5-bisphosphate
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
321
structure length
321
Chain Sequence
AVVKEVLEIAEKIKNMEIRGAGKIARSAAYALQLQAEKSKATNVDEFWKEMKQAAKILFETRPTAVSLPNALRYVMHRGKIAYSSGADLEQLRFVIINAAKEFIHNSEKALERIGEFGAKRIEDGDVIMTHSHSKAAISVMKTAWEQGKDIKVIVTETRPKWQGKITAKELASYGIPVIYVVDSAARHYMKMTDKVVMGADSITVNGAVINKIGTALIALTAKEHRVWTMIAAETYKFHPETMLGQLVEIEMRDPTEVIPEDELKTWPKNIEVWNPAFDVTPPEYVDVIITERGIIPPYAAIDILREEFGWALKYTEPWED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor eIF-2B, delta subunit
publication title Dynamic, ligand-dependent conformational change triggers reaction of ribose-1,5-bisphosphate isomerase from Thermococcus kodakarensis KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Isomerase
total genus 112
structure length 321
sequence length 321
chains with identical sequence B, C
ec nomenclature ec 5.3.1.29: Ribose 1,5-bisphosphate isomerase.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 3vm6A01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3vm6A02
1T5OA 5DBOA 3ECSA 4LDQA 2YVKA 3A9CA 4LDRA 4ZEMA 1T9KA 3VM6A 2A0UA 1W2WB 4ZEOA 1VB5A 2YRFA 3A11A
chains in the Genus database with same CATH superfamily
2V7PA 4OFXA 3KUCA 5L40A 2JH8A 4XM2A 1CERA 1E1QD 1YL7A 4MVUA 3VUEA 2IYRA 5AI9A 4ZVNA 1X7DA 4CEIB 1FP4A 2GPBA 3BEDA 3T3DA 1NN0A 3O8QA 4XWKA 2FW9A 1BDJB 2CFCA 2VYVA 3UMFA 2Q5CA 3FCAA 1UPUA 1W1UA 4RVSA 1DAOA 3MUNA 4MUMA 3GA7A 3R3YA 2H0RA 4S35A 3MWKA 1AVOB 2J08A 3DM5A 1CEXA 1GITA 3I9V6 5K3FB 2QL5A 4TTAA 5IT5A 1R9NA 4DMRA 2YC4C 4AS2A 1NXSA 1RC0A 1BMDA 2GZSA 5G4KB 1NW5A 3G2KA 1MIOA 4M1KA 3U26A 2IDMA 4LHXA 3DM9B 2IHBA 1V8OA 3HE3A 2NGRA 1Z47A 3LYUA 5MN6A 3LKVA 4JLBA 4YT8A 3WBKA 3EX7C 1J20A 1E9CA 4X0RA 1NU8A 4I1MA 1AQYA 2P1AA 4IV5A 5HE9A 2LKCA 2O2HA 3VZRA 5KJEA 1QH8B 3C6MA 4FK8A 3MPUA 4UAGA 3VF0A 3GWLA 4G56A 1Z33A 4HWGA 1JSCA 3KTFA 4HFRA 3OT4A 1TJ3A 1B43A 3QUTA 3VVBA 3R5XA 4O2AB 2X15A 4XVHA 3OOEA 4JGIA 3IMCA 4IS3A 2ZT8A 4E46A 2R7XA 1TKRA 3TKLA 3LKBA 2VJDA 3S68A 2OO7A 4HVCA 3BSYA 1OA0A 4AYTA 4BAGA 4LSZA 1JIKA 1HH4A 5THQA 3EDYA 1JHOA 1VHTA 1CXZA 2XGSA 4F4HA 3D6HA 4MVMA 1Y4UA 2Y4NA 3UQYS 3KJXA 1WD5A 1YC5A 2PNFA 2VA9A 2IBSA 4KDRA 4D9MA 3LUKA 3TFOA 4X1IA 4IS2A 5DLQC 4E21A 1DLJA 4LGCA 4LA4A 2G1KA 3A2NA 1F4LA 2XNDA 1YA9A 2OGZA 5DBIA 4XPYA 3BXFA 2HMUA 3V8QA 1I80A 4XWGA 1QYXA 5JZOA 2VBCA 2GBCA 3LPDA 3SGLA 2I9KA 4XYBA 2GEKA 2FR8A 3D54D 3P27A 4NAVA 4OMUA 3LO5A 2QN9A 5F12A 2O5RA 2L0XA 4I66A 4RVFA 4MV8A 1HDZA 4BFCA 5DW0A 2PKQO 2WAYA 5EEGA 2QZ9A 5I9SA 2GPTA 2CHGA 2ZJ5A 1GG8A 1THTA 1O03A 1ZHFA 3HYLA 4BKOA 2C31A 2WIBA 4IO0A 4RGBA 2O2YA 3FLBA 4TYQA 4X8MA 2XZDA 3P2IA 5DP2A 721PA 1SR2A 1JAHA 4MIOA 3ZIUA 5LYJB 4JP8A 5AOAA 4DVZA 4TTSA 3QVMA 5CVEA 2DETA 3UK2A 3UV3A 4UDXX 2XS1A 1WHTB 3FOWA 1J1IA 1SU6A 1DBQA 3H0EA 2O2IA 2QT9A 3TXAA 1E7MA 5KHAA 1ECLA 4MYHA 2Q29A 5B36A 1G9XA 5K0TA 5ESWA 5JARA 2J32A 1JDBC 2Y1OA 2CV1A 2BEWB 4HEA6 3F2VA 4GVXA 3RS5A 4J16C 3KTAA 1MQ9A 4F7WA 3PXGA 1IN8A 1P2DA 1UMCA 1BVRA 3WKEA 2ZUTA 2JIOA 1BXZA 3C6ZA 5EWLB 1BA2A 5JOQA 2AYYA 2Y2UA 2QRLA 3MS7A 4AK9A 3AEUB 2AXPA 1SULA 4HDOB 1RI2A 4XVQA 3B78A 2GZMA 3CXUA 2R2AA 3MBGA 1Q11A 5DGHA 3G5MA 3BA6A 4FGWA 2O6HA 3LP5A 2HJHA 2W4MA 3GAFA 2WM3A 1OY1A 4F4JA 1TZJA 3UWKA 4QPNA 3DLAA 2FXIA 2Y9MB 4CT0A 2UXDB 4M3NA 3QE4A 2QV0A 4EEKA 4R81A 3CH4B 3KIPA 3W2FA 2ZBUA 1GLNA 1U65A 3U0BA 1YRYE 1IVSA 4KZKA 5GGXA 3DCJA 2ID8A 1TM4E 4BN5A 2OKUA 1NXOA 2PR7A 4QZVA 1EGHA 4PBRA 2B83A 3ZW9A 3N75A 3L7YA 3C8HA 1OYYA 3ANYB 2J67A 5ELLA 4MHTA 2ZJ0A 3GJ8A 4C22A 4IOMA 4TZKA 3ZCXA 1GGQA 2CD7A 2D0OB 4P4GA 4RLSA 4EBFA 4Y3UA 1R0KA 2W2PA 3P26A 2Q45A 4HDSA 2Y3IA 1V5GA 2V54A 4CLDA 4B3CA 1C8VB 5E3AA 4JIMA 4FYHA 5CURA 2E4UA 3EC1A 1EGQA 2PL5A 4YT2A 1SXQA 4KQJA 1ZJZA 4GAEA 4QX6A 4MLZA 4XSHA 3H1TA 3WQHA 4L8GA 3PDMP 2FUEA 1J2JA 4D56A 3FLEA 4QA9A 3IMEA 1P91A 3GJYA 3GZ4A 2Y4OA 3FG9A 3KETA 4DUGD 3LA6A 2XM0A 4RHCA 1B15A 2QF7A 4MUHA 3JQ6A 3H8JA 1YRHA 3V7YA 4G0XA 3S81A 1SQ5A 2VWPA 2IS2A 4TYYA 2KJGA 2Y69C 1H6BA 2P9JA 3WDSA 1POXA 4A8JB 1ECCA 1X9IA 1AGXA 1M8GA 1RHRA 5EWMB 5KREA 3EZ2A 1T9ZA 1WOMA 4R32A 2ZSHA 1E8MA 1L5ZA 1NN5A 1ZPDA 1ZN9A 1SGWA 5AIBA 1P7YA 4EO9A 4PIVA 5B2ZA 2HBQA 1Y6QA 4Q1EA 1YWGO 2VF4X 3IAM6 1P7WA 2Y2VA 3CF0A 1JLKA 3HP7A 2ZI3A 4P3PA 3O94A 4EHPA 5JISA 3IUBA 5SZKB 2GLTA 1TYZA 1T9BA 4NF2A 4KSBA 2Y1XA 2PNOA 3PQ3A 5AW7A 4EFDA 1J0AA 1CY0A 1ESEA 4JJ6A 5C3UA 5A6SA 2IDKA 2QD4A 4V03A 1EWYA 4D3SA 1KO4A 4JI8B 2XE8A 2ZSEA 4XWOA 1TQ6A 3B7WA 4J7AA 1T9AA 4TQAA 4MR7B 2H0QA 1VMAA 2YLIA 1B8NA 4OQQA 2YNMC 3HCFA 5K9ZA 3K4QA 5K0EA 4K3UA 2W70A 1C0EA 4TVOA 4WXPA 2J3IA 3NTQA 1H9AA 3DOHA 4L27A 2I7VA 3SIPA 2Z8XA 4LYAA 1LQUA 3C3WA 2Q8PA 4EHFA 2ZANA 4B5KA 3IBTA 5L0DA 4Y0AA 3MX3A 4Z7QB 2E1PA 2WB4A 1PJAA 3T0IA 1BHO1 3E5MA 3OD1A 3H13A 3OUUA 3ZD7A 1MT3A 4N1AA 1M5TA 2QZSA 1HNZB 4DV6B 2BHLA 3OBIA 2X1LA 3EXHB 3C41J 2Z9BA 2W00A 1YZUA 1RSZA 2PS9A 1OGJA 4Z0TA 5DCWA 3RQGA 3L4EA 4AE4A 3PUYA 4CIWA 4BP9A 3I30X 1U8TA 1JMYA 4EF6A 4R2KA 3TL2A 2VHJA 2XT0A 1JZSA 3ZYZA 4W5QA 1JT9A 2Z95A 4P36A 1UKEA 1HZJA 4S0XA 2XJ4A 3A9TA 3JQ8A 1I3MA 4UM9D 2YQ5A 5EAIA 4DTCA 4LVUA 3UY4A 1QG2A 1VBFA 2HA0A 3GHHA 5BVHA 3BOSA 4IIHA 2I7TA 1K7SN 2VASA 1ODSA 3RRZA 2JW5A 4JKOA 1UDCA 4DCUA 4YHBA 5B55A 2VKQA 2ZUSA 2VZLA 1LX6A 1YDGA 3MINB 4D4HA 3ZNQA 1J1ZA 4M0DA 2WZFA 1U5BA 4Q3DA 5K99A 2FFHA 3QJGA 5EJFA 5AI0A 3GWNA 5DN6D 1RW4A 1EQ1A 1M8FA 4ZLCA 6YASA 2X4GA 2GHRA 3NT4A 1VJDA 4OKIA 3M6UA 2P9QA 4G24A 3VOTA 1UADA 4KQ6A 2PU5A 3FHCB 3Q2KA 4L51A 4OHOA 1XZNA 2X3UA 4BYGA 2JGJA 3PD7A 4RZIA 1VHDA 2O0JA 3DOOA 5AIAA 5LA6F 4XLZA 3STWA 3UWOA 4ZODA 1LPBB 4TTJA 1HBJA 2F1JA 3G5TA 3CZ6A 4WZAB 1M34E 1RS0A 2C3YA 4DLVA 2ASVA 3WLLA 3F46A 1ZN2A 1YQQA 1JBQA 4N01A 4NCAA 1KFBB 1QGAA 3UXYA 4EYSA 1CGME 2FZEA 4L4UA 1ZNQO 2XPCA 3FNFA 1T2EA 3NHJA 3KQOA 3QMMA 4BG0A 3GNSA 2R97A 1HT2E 4Z0HO 4YJ2B 2YS7A 4DNFA 1YZCA 3HDJA 3S1AA 3PCRB 1A9XB 1HL3A 1S8OA 2P78A 4TXLA 621PA 1TM1E 3PQ5A 4JYPA 3KYIB 5A4DA 3NWPA 1D0IA 1P7PA 2MWQA 3GOQA 4MROA 2AW3A 2ZPUA 3ACDA 3OWTA 4IRXA 3STTA 1AUVA 5AICA 1Y37A 2R6ZA 4Z0NA 5DM1A 4AJOA 1K7EB 1TLTA 2B3TA 1TQHA 4BX2A 3PNVA 3LBHA 1Z83A 5BPHA 3K9NA 1TGYA 4EG3A 2BFDB 3TZCA 1O8BA 4WFJA 2Q3BA 2ERCA 4EJ0A 3OQOA 1PFYA 3N2NA 5D5PA 1UEXC 3RSCA 2OCXA 1FVOA 1G3MA 5GZ3A 3SEAA 1X9HA 1BO6A 2QE7A 4YWQA 1OB5A 1P7CA 2UKDA 3GD7A 2GKSA 4TMKA 2IVFA 3MMXA 4M0KA 1R4MA 5NLLA 4ICIA 3TQHA 1J9ZA 4P3KA 4UQOA 3ROKA 1JSLA 1KAQA 1LCIA 4EJSC 4D57A 1MBZA 1ENZA 4IZ6A 4IJUA 3VJLA 3I1FA 4MQMA 3ZGLA 1RAGA 3VR4A 4I5IA 3EGXA 2WTAA 3KAKA 2VJKA 4RORA 4ZPJA 1JIUA 3EFHA 4JC4A 3R8XA 4RVHA 4E03A 2OA0A 5JU6A 1PEDA 1YVDA 3TLCA 1GUZA 4R69A 4IXMA 1Z22A 3Q9LA 1Q0HA 2CEKA 3D7RA 3NBQA 4TYMA 3PLNA 2HPAA 2ZXPA 4I4TF 3CNBA 2Q7DA 3ZJYA 1OV4A 4V02A 1BGXT 1YDEA 4CKZA 4C7OA 3O2NA 3GFQA 4UM8B 2QMEA 5HBGA 2C29D 2WHEA 5C5CA 1PNQA 1UWLA 3THRA 1PAUA 4QJ3A 3FUTA 4HO1X 5B1SA 1RZRD 3TW8B 4RW0A 3COSA 1YB7A 4JN6B 1Z8HA 4MW5A 4Q4ZF 1H0KA 2ZYTX 2ILTA 4ZEWA 5DM2A 2QX9A 4IX9A 4FEYA 1AEPA 2OEXA 4Y7CA 1ZS9A 1NVKA 2MYSA 1PK7A 5BWNA 4GPIB 2C94A 4FMDB 2FCAA 3VC1A 1L4HA 3F6PA 4MUEA 1IN5A 5F1OA 4P7GA 4OQPA 4B33A 3BAZA 4MARA 4YP0A 2YYYA 4PVDA 3X44A 4HN4B 4M1MA 2O7SA 5JYCA 4A0SA 3RQEA 1R5NA 3C8DA 3IAAA 4OYLA 3U1VA 3ILYA 3JRMO 5FL7A 4BNYA 4IW3B 3JRWA 1UMBB 2YWBA 3BG5A 5BMVF 5IRCD 2IGTA 3UV6A 2A9KA 2V6JA 1OHHA 1CPQA 1P3Y1 1L7QA 4EKWA 3VR2D 3K0FA 3NI2A 5F35A 5CGZA 2ZTMA 5D2CA 2LPMA 1NOIA 2MYTA 1I1NA 3DVAA 1C8LA 3AOUA 2FZLA 3ESQA 1YR1A 2W11A 2W6JD 4NU0A 5AI5A 1V3VA 2G77B 3UPDA 2KJQA 4PPGA 2CDAA 3ZTYA 2R8BA 4MGHA 3B0PA 1Z4IA 5F4BA 5C4GB 4HGYA 5DYNA 3AG2C 4RQAA 3U1BA 2LK4A 2BZ1A 1XC7A 2AOTB 3SWWA 1PGJA 4B71A 3LIPA 3EG9A 4TN1A 1FZQA 1MVNA 2JLCA 4QEZA 5LQCA 3EJNA 4O0LA 3RD5A 4DLLA 4E7ZA 2VDRB 1H2RS 4KBFA 4TRNA 4ZEXA 3OTOB 4Q3CA 2BFEA 5HF5A 4Y6LA 1OT5A 1QGOA 1PT7A 4Y9RA 2QD1A 1A5SB 2EXXA 4U2FA 3BEOA 1J42A 1E7YA 5KNBD 3D8UA 3BE4A 4IGAA 4K05A 1XP8A 4TLCA 3LZCA 4NZMA 4PC2A 1WATA 2B37A 4FYKA 2W2QA 3UH0A 4PGMA 3T4XA 4KAFA 2L6GA 3KHSA 1NAHA 1OXKB 2C8LA 3RASA 3V4OA 1QIMA 5I01A 1BZYA 2PAFA 3LDFA 4FYYA 2R05A 3Q11A 3I83A 2RIRA 1NC3A 1H2ZA 5A62A 1G6OA 4PG8A 5DI3B 4UCWA 4GBED 5BUCA 4FR0A 3O9VA 3D6JA 3B1VA 1IOLA 2X8JA 3NEYA 3ORHA 3GIWA 3SG0A 1N0VC 3AF0A 2XMDA 5EZYB 1W29A 2Q2QA 4OO3A 4H6XA 2A86A 4XQGA 2FLKA 3OLVA 4G5OA 2QM0A 3EEQA 3RVMA 3UJBA 3UWDA 1JLRA 4EUSA 5K8VA 4C6TB 5HRAA 4X54A 2C2YA 1W87A 1K1EA 4QXPA 1Q6ZA 1Y6JA 1HK7A 2F43B 1SY7A 4PFPA 4YFYA 5HUJA 2CDCA 1N6OA 1ZEMA 2Q5QA 3Q72A 4P2BA 3VTKA 2WPDA 3IDAA 1A9TA 2YJNA 4J3NA 5JWRA 3CINA 5JE8A 4YAIA 1XE3A 1UOEA 2GK7A 2O1EA 2QL9A 2V26A 3IERA 1UOOA 5FTWA 2H52A 4XUDA 4EI9A 2HH9A 4AP5A 5DSXA 3IHUA 1MC5A 1L5RA 5IK2D 3A3KA 1DIAA 4PF1A 1N8NA 1NA5A 1NW9B 5EXPA 2FMUA 4NMWA 2QBYB 2AV6A 1JMKC 3KUUA 4JB8A 1NMEA 1XEXA 3H87A 3L92A 2IKSA 3CSUA 4D9EA 2FDCA 4UBOA 3L46A 4F9FA 3LNRA 3ZXXA 1G2PA 5IPFA 3P9IA 1NMSA 4NABA 4MMYB 1YTLA 5CXXA 4TS3A 1REQB 1LBSA 5GOZA 3IQCA 3X1MA 3W0LB 2FXVA 4M87A 4OXYA 3ZC3A 2YY5A 3F97A 1XCMA 5H02A 1USGA 1NTRA 3P0FA 2YWFA 4GEGA 4Z3DA 3ZSUA 3OTIA 1A7KA 4ZOQI 3NKLA 1E4OA 1HOTA 1NQOA 1QVWA 3VC2A 3GJQA 4ZALA 1XRNA 2R6DA 1THZA 4HNQA 4YJKA 1WZIA 4HL6A 2QLLA 1GUDA 3QEMA 3QTHA 2ADMA 1YV9A 4WBNA 3QUQA 2YMLA 2P40A 1P2SA 4EEXA 2I80A 3L34A 1YU9A 4CDVA 2O3TA 1T4DA 2KLBA 3JTLO 1Q7TA 1UC9A 4XDZA 3VDNB 5ESXA 2JEOA 3N8NA 1HMDA 4RZHA 2J0WA 3G9ZA 3UT5B 4D2IA 5I3CA 2DR0A 4C30A 3RT7A 4C21A 1D4AA 5KOYA 3S2EA 1RTKA 3TXYA 3QTBA 4JQYA 1XSEA 1SD2A 2A0UA 4O2AF 2QRZA 1LLFA 4D5EA 4DSAA 1OWPA 1Z26A 4Q47A 2JJYA 3EF1A 3OQHA 4D4IA 2YW9A 1ZXXA 2UUHA 3VH2A 1K8RA 3OZ7A 5FJJA 2C4MA 3AGQA 4JBYA 3L7KA 3QKRA 3IEPA 3IDFA 4KX3A 2JAOA 5L0GA 2QMOA 4KDEA 1XMVA 3UUFA 1EDEA 1YJXA 1QS0B 1WDWB 3REOA 3L7IA 5AGFA 1LGYA 4EBKA 3ILHA 3DL7A 1U7TA 3AB3A 3IEUA 1QX4A 5I7AA 4B1FA 1WP4A 4L0CA 1RQ7A 4U7HA 4YV0A 4YEDA 5J4VA 4IOKA 1YZLA 1GPBA 2O48X 5F2OA 4ESVA 4YJHA 1YVRA 4BJHB 3EZNA 3F7NA 2BT4A 4PPYA 3BB4A 1Y1TA 5GIPE 1CS4C 1K6JA 4MUJA 4D9CA 3P97A 5A3JA 2BUAA 3GOHA 4EQ6B 4EFNA 2A78A 1RC1A 1UJBA 4P5DA 4A2PA 1PJRA 1ZI9A 4QASA 1R6DA 1PW5A 3CG4A 3HM2A 4IDHA 4QHSA 4RF4A 4RVGA 4LWQA 4JLPA 4CG2A 4RSGA 5GVRA 1CRLA 4EI7A 5IM5A 4HQRA 5KAPA 2CLEB 1NDUA 1GGMA 4MIKA 4MVZA 1I3OA 3GLQA 2ZULA 5LYJF 2NU8A 2JZCA 4CF5A 2C4VA 2QLNA 1L9KA 2EEPA 3PUXA 3JSZA 1P9LA 3GX1A 2FEOA 3ZDEA 4E2YA 3LVFO 1EWVA 2ZPTX 4DRIB 3DZAA 5AO9A 3N53A 3PXAA 4R3WA 2WJYA 4DV2B 4UDYX 1PR2A 3W2WA 1N6KA 4EZIA 3PA6A 2W48A 1YMUA 2CLKB 3GMSA 1JHZA 1LS6A 3PXXA 4HRAA 4YHHB 1G7CA 2GO1A 4U9EA 1RI5A 4RDHA 1CR6A 1K2VN 3MNFA 2WWIA 4ASUD 1NV8A 4Q9AA 2AH5A 2FU5C 4YQEA 4YXFA 2YVLA 3QYFA 1YS2X 2HIGA 3E3AA 1MP0A 1VA4A 4PLPA 1HMYA 3DXFA 4FESA 1ONNA 5E4FA 3I8XA 1NBWB 1EBUA 3M6IA 5DT9A 5KTPA 5A4IS 4R16A 4GOJA 3COJA 1KJIA 4US0R 2H4ZA 2OB2A 2GDCA 5JZMA 2FQQA 3LSYA 1NXXA 4YRBA 2Y39A 2CB9A 4U5FE 4HLUA 2JD2A 3F5DA 4D3FA 2GPAA 2E4VA 3DD5A 6REQA 3C3AA 4A4DA 5B4VA 2GTHA 4ABTA 5AKJA 4EL5A 1OTXA 2VAPA 1U0NA 3MJHA 4J0IA 3PJEA 1O96A 4N06A 1NE7A 2PFSA 1QV7A 4HBGA 4FFMA 1EESA 4N8DA 4KI0A 1DEXA 2VIIA 4MAAA 3BSWA 5EE9A 2FJUA 3QMKA 2P1RA 5IWCA 1FQKA 4EAQA 5IYZA 4YUYA 2DY0A 3KJHA 3W90A 4INZA 1YR8A 1G5ZA 3ITDA 2WHRA 2GNAA 4K9PA 4C2AA 2AFIB 4HJRA 4DVJA 2Z3VA 4MK4A 4JJGA 4KQ1A 1WE2A 5BRAA 2LR0A 4V39A 2HOQA 4I1PA 2HZ7A 4HDCA 2NXCA 4YL1A 2P90A 3U7HB 4HEQA 4CS7A 3PQ6A 3GODA 1RRGA 1TT5A 2W4IA 4RD1A 1QHGA 1M9NA 3FZNA 3C6QA 1P4AA 2A4MA 5KAMA 1GGFA 3I28A 3N2ZB 3A2MA 1XRMA 5COFA 3DP7A 2FX5A 1RHUA 1CGNA 3HFJA 4IR7A 1AXRA 1GPKA 1N3LA 1QTNA 3CLRD 5FV7A 1VPWA 4TS1A 3W5AA 4D0GA 2YV5A 4EB8A 4U7GA 1JJFA 2QAGB 3ZDZB 3P0IA 4XARA 5G1OA 1Y8ZA 1MVLA 2XVYA 3EXG2 4F6LA 1PQ4A 4XSVA 2WUFA 3HS3A 4G0NA 4UE6A 1T5SA 3KU1A 2JLYA 4RSHA 5IBCA 2LE0A 5LA6B 2FI1A 1JYEA 1WUTA 1S2LA 4IZOA 2WU3A 1Z73A 2VDUE 2VHZA 4DW8A 1OH6A 5BUQA 5KMGA 2DFKB 3RTBA 3QELB 2Y1GA 1XCGB 3H8SA 4CM8B 5KKCA 1BQEA 4BEJA 1DQYA 2ZREA 4G9EA 4C14A 2NV2B 5JNRA 1AU9A 221PA 1BVYF 1G8HA 1ZZEA 2JZNA 4TXNA 2G0TA 3SQXA 4A8JC 2JGFA 1P4GA 2W9XA 5FBHA 3O9MA 4I9NA 1PDVA 3P32A 4CV1A 4YAGA 1ZRHA 4CM5A 4DBQA 4IDDA 5T67A 3ENZA 5K0CA 4K1OA 2EZ4A 4HDAA 1T1EA 1X1DA 3QPAA 3P5SA 1GO2A 3HI4A 1HNXB 3JPWA 2LXNA 2DMRA 3E9VA 2R7NA 1R1DA 4AG3A 2AJTA 3HA7A 3FTPA 1K88A 2Z2KA 2PUCA 2EQAA 2X9VA 1CTQA 5AWFC 2C9DA 3DLTA 3STUA 3QW0A 5HFAA 1OJLA 3EQZA 3SJCA 1ECPA 3ITFA 2PQ6A 1X7WA 1U98A 3DNPA 1QO0D 4UE2A 1EDOA 3NIGB 2C9OA 4EYOA 5JV5A 4HN9A 1AK9A 3N86A 1Z18A 1Q2XA 3HB9A 3SXPA 3OZTA 3BCHA 1U8CB 1KTIA 1QQBA 4LGVA 1M6VA 1A1SA 3QWHA 2XUIA 3EIHA 2PFDA 4W5WA 2BEJA 5BSMA 3UJ8A 4QOGA 2TRSB 3IAHA 5KBYA 1XZQA 2CE2X 3JQBA 5JCXA 2AG6A 4Q7JB 4IRUB 1XDUA 1US8A 4WI1A 3R3UA 1DMRA 2PKRA 4GDMA 3STXA 4S24A 4J94A 1ZHOA 4KC9A 3Q1LA 1XTIA 1XZBA 2L19A 2QXTA 4YUXA 2FPGB 4LYEA 4FI3F 4FI3C 4ES6A 2QRHA 1JG3A 5CXSA 2DAPA 3PWKA 4I1UA 2PYZA 1W73A 1M6NA 4LX8A 3EXHC 4OI4A 5GMOA 4D97A 4ZGWA 4EIYA 2JGIA 3AWIA 4J03A 1O87A 3AFNA 4A16A 1Q1AA 1ORIA 1E18A 4ND2A 3WMGA 5J43A 4DLNA 3AG6A 1BGVA 4FC7A 3QKUA 3WYGA 3FA2A 3VPXA 3E9YA 2O9JA 3O74A 3O83A 1EFRA 5C5EA 4GYWA 4KP7A 1VBKA 4TN5A 4JI2B 5DS4A 4PQYA 4Z6KA 4QWMA 2GEBA 2KBFA 1AKRA 1E9EA 2UZ1A 4EY7A 2ZE6A 4WNCA 2FK8A 1P2VA 5KYTA 3ZBUA 2RHWA 4NI5A 4ZOLA 3HV0A 4DWJA 3IKLA 1M2WA 1CUHA 1KFEB 1N7IA 5KYWA 1O5TA 4MGIR 4I36A 1EB9A 1NLZA 2X76A 4KE7A 5BMVB 1SVLA 4NU8X 2XSZD 4PHHA 1T3TA 5DTRA 1L5QA 4GBMA 2E9SA 4B6SA 1YKGA 3N8DA 3WAGA 3OEYA 3W4KA 1NKTA 3NG1A 3HMKA 4OXRA 2RGDA 5AVVA 2OGSA 1IBLB 3GJ5A 2A1UB 2GEDA 2EL7A 2ZSIA 4WH0A 4YJ3A 4AMZA 4AY3A 5CFOA 5TJHA 2WABA 1WCIA 3K6BA 1TAUA 3CUWA 5B3KA 1VG0B 4BNWA 3QWIA 3RYTC 1Z23A 4KDCA 3RAGA 4R2XA 1EE2A 2P2GA 1HPLA 4CM4A 1DG9A 4C7XA 5IAJA 2R1VB 5C4MA 2R7VA 3HDQA 1V74B 3GLIA 1UR5A 4LFBB 3K0EA 1HDYA 4WY8A 5DO9A 1DO8A 3U49A 3DLBA 1IL0A 3VZSA 5LDDC 2E4WA 4F4BA 2XW6A 1K4KA 2HRRA 2CBGA 1A9QA 4PO8A 4WJ0A 3DZCA 3CU5A 5A71A 3EZHA 4P2GA 3DMFA 3R2PA 1SCIA 3WYAA 5IFLA 1WXXA 1T1RA 5JQGB 2DGDA 3PQFA 1GTZA 3V80A 4CM3A 3L1MA 2CZCA 4KXFB 4PSVA 4YUWA 3IDZA 1ZK4A 2H1SA 1CG6A 2V03A 2WUDA 4UBIA 1P0QA 4QXOA 1G59A 2QD3A 2W2NA 4XQ9A 3M79A 5AHKA 2YL7A 1H0HA 1I32A 3TAHA 2W2KA 3SR0A 4QUDA 1Z2NX 3WP0A 1PFUA 4Z9YA 1I7SB 3DMTC 1PV3A 4TMTA 5FQNA 3H19A 2FWPA 2EX0A 1BNCA 2VYVD 3V55A 1ETUA 4FILA 1M2JA 3EDOA 2O1WA 2C00A 2D3TA 4QECA 3HVUA 3CSKA 1NRJB 2LDXA 5CH8A 1K8ZB 4K9NA 4B6IA 4O6NA 1VIVA 3H6HA 5ES4B 1QQ7A 4NE2A 2IU3A 5HS4A 5ICMA 4YRNA 3HO8A 3CYFA 2E4XA 2P62A 3ZJVA 3CCFA 4FYIA 1KFJB 2CXPA 4X7MA 4FOLA 4ZYUA 5C7YA 1NPDA 2M4EA 3DSRA 1VB5A 5JDCA 1V1RB 4GQIA 5ICCA 2O2CA 3ZC4A 5T8KA 1U9IA 2WD7A 1G8XA 3NRCA 1PR9A 1SC3A 1CQPA 2AOXA 3R5JA 4LC1A 1HA3A 4GXNA 3SHWA 3TBKA 3M6LA 3KKNA 5KWIA 5EKXA 3KYCB 1NFOA 1T3GA 4DIMA 4JCZA 2WKPA 4REOA 4LNHA 3BRCA 2FMKA 1G18A 1IMJA 1XNJA 5EKDA 3ZWIA 3VHLB 3I61A 2N0SA 3BHJA 2IDZA 2OZVA 4B6GA 3VU0A 3VBCA 1J8MF 1JKXA 3Q85A 1IHPA 1FDWA 1NZDA 3UGJA 3QX3A 2IYXA 1FCJA 4FMDF 3JQAB 1MA3A 1BH2A 3H1EA 1LF0A 3KQPA 2CFRA 4TQUS 5TX7A 3RU3A 1XJ0A 3TOXA 2O5EA 3FI9A 1CVRA 3HR4A 1QFSA 2R1TA 1C7IA 1RQXA 2AJ8A 4B6QA 1DDGA 4AICA 2Q28A 1NVTA 4IHJB 3AKZA 1KZYC 3PC4A 3R6LA 3WTCA 4N12A 2AXEA 3VSEA 2VK1A 3H42B 3IBYA 1Q44A 1S7CA 3I76A 4IGEA 3RTDA 5HM8A 1KAHA 4GLBA 2YHAA 3ISJA 1WXDA 2UUCB 1QQAA 3G1WA 1VJ1A 1EZ4A 1VHLA 3LU1A 4NE9A 3KYDB 4C7BA 4Q9LA 3TCKA 3H8WA 4EZEA 1M67A 4RIIA 5CM8B 1VRWA 3S6JA 4OI0A 3ZHUA 5A9SA 3ENVA 4NQZA 4I9UA 4WESA 4BMXA 1XNHA 1ZDMA 3W9SA 2V96A 5IF9A 4NFLA 3DZDA 3RC8A 4PLFA 4EYGA 2WVJA 3V1LA 4E1VA 2AFRA 3ABMC 4EY4A 3GDFA 4DXAA 1E83A 5DN9A 4EUEA 4L9WA 5CI8A 1KQPA 1RFLA 3WIUA 4J6EA 1TO6A 3U3XA 3I9OA 1Q91A 1SMYF 1Z34A 3BTUA 2PGIA 3WKDA 4TS9A 2Z3WA 3N74A 4XM0A 3NPAA 1ONSA 5THKA 1YB6A 2WHPB 1QG0A 1IFXA 5GJBA 3VOSA 4EKYA 2Q3FA 2IZ1A 5DT2A 2WFMA 3NZEA 6AT1A 3CVVA 5JYBA 2YJ5A 1YASA 4FIZA 2H1WA 4H77A 1LPNA 3ANSA 3GRKA 1RYMA 5C51B 4JQOA 3UGPA 4ZGGA 2X3FA 3ER9A 5EZSA 3GRFA 3H04A 5DXFA 3STHA 4ZRDA 3H1PA 3G9XA 4EHDA 3DWWA 2BEUB 1ZRNA 2V9CA 5C53B 2X7JA 3WWZA 3HV2A 1Q77A 4W7HA 1JKFA 1OZ0A 4GPEA 5AVKA 3KZNA 2WTUA 1V7CA 4IEEA 2RG7A 4TZ0A 5HVNA 5ED4A 1HFJA 1CF9A 5EZYF 5T4BA 2QMQA 3DHEA 5KYYB 4H6PA 3D5TA 3VNVA 3HSKA 1A9RA 3HNOA 3IKTA 4E31A 1BDMA 1W2WB 3A11A 3CUKA 2W7TA 2VNKA 3CRQA 5T3YA 4EHNA 3FNHA 1CWUA 1OW8A 1T6UA 2HDWA 1HLGA 3RCBA 3MG9A 4JA0A 1CHDA 2KC3A 5ALNA 4LKOA 4O2BA 4IXDA 2CKDA 4QFDA 2D4UA 4KQXA 3HKBB 2Z15A 2F3QA 2OBBA 1JXQA 1V35A 4KR7A 1NJ5A 2IOFK 4UVGA 2ZRPA 1KZ9A 1GDDA 3Q12A 4L8YA 1O08A 1JH8A 4G2TA 4Q9KA 4XM1A 3O5AA 3DD1A 2A59A 4HWOA 2OLKA 2Z1NA 1LFDB 1Y1LA 4KW7A 1MIHA 4M63A 4DJDC 1QQ3A 1J00A 1E8DA 1QZ3A 4D4GA 3IHLA 3MA0A 1N2EA 2ATEA 5A0FA 4S1WA 2I2FA 2XA1A 5I7OA 2HJMA 5SYNA 1K04A 1YONA 4AJHA 4QSMA 4PN7A 2D8AA 3ZCVA 5TF0A 2ZG6A 2V6BA 1MEEA 2HSZA 3WYCA 2JHFA 2Q6LA 1HNNA 5DLDA 4O4HB 1I5OA 3S28A 4KPGA 4ZC1A 2VXCA 1E3MA 3CO5A 5IDVA 4BEWA 1CUXA 5DM0A 1U31A 4C4PA 3V1UA 4DZZA 4FFBB 5DX1A 1ICEA 4FDMA 5L3ZA 3G88A 4KU4A 3GGSA 5FNZA 1MABB 3L8HA 5EJ5A 1U9YA 4GZLA 1E7WA 1VFPA 2J9RA 5BORA 4WNYA 5BV1A 5K4HA 1ZNXA 2PKEA 1NG1A 4Q15A 5FOVA 5ULLA 2WJAA 2EFYA 1JPJA 3AK4A 3WQBA 2X23A 5SZIA 2ZJ1A 3BH6A 1WNTA 3GM1A 5C8VA 1VE1A 4HK4A 3D3WA 1NX6A 3UK0A 4H3VA 5CT6A 3PTZA 1AO3A 4ANFA 2CVFA 3IT2A 1UBHS 2CJFA 4B0OA 3D6TB 4QWWA 5CEJA 1RAIA 5D6NA 1TLFA 1ZH0A 2C7VA 4BAUA 5CBPA 3I04M 2HV9A 5A3RA 1MAHA 1ML3A 3SQNA 256BA 3T54A 2VB6A 1L5FA 3LUPA 1U99A 1E2DA 5FOWA 4ER5A 4F3CA 2R66A 3R4VA 3VGJA 3VZDA 3W7BA 1D2RA 1YI8A 2C5FA 3UWSA 3BRWA 4G5RA 1EJBA 5EN4A 1LQ2A 3WB0A 4KKVA 2BKLA 4CL0A 3I5PA 3NV7A 4N8SA 2DI3A 2ID9A 1J25A 4E1AA 1TT7A 1I3NA 4TTVA 3TOSA 2ORIA 3VTAA 3ZZTA 4US2R 2PR2A 4KG7A 5ALXA 3DOIA 3TMAA 4O5AA 1I0IA 4R0MA 4HQNA 3LQFA 3HUDA 5EWJA 1XZFA 2F4VB 3JQGA 2X40A 2GAFA 4B34A 1NHWA 4PW0A 4EG7A 4WE3A 1WB6A 2X9NA 3BERA 1R6VA 1SKBA 3KR2A 1BYIA 3DJUB 1NVWQ 1ZY2A 1K5GA 1OFVA 3SS8A 2CLMB 3EB9A 1BE6A 3IDSA 2G83A 1LVKA 1C30B 2AMLA 2R6CA 4QICA 4LTMA 1BXRA 4YROA 2YBDA 4QRDA 1ZIYA 4DDMA 3UTCA 1Z08A 3KSUA 3VYRB 3NETA 1VCNA 3W7VA 4NCHA 4RY2A 3CVWA 2O2XA 1O1YA 2Q41A 5PGMA 1LX7A 2YN0A 5IC5A 3VZPA 3Q2OA 3SIRA 2ZIXB 5A6BA 2CJXA 1J21A 4F6CA 1ZJWA 4GQHA 1FNSA 5AW6A 4WY5A 1XZEA 1UBUS 1QF6A 4Z9BA 5EJ7A 4XDGA 5LXTA 2ZRCA 4ZU1X 2IWHA 1LVUA 2FG5A 4C7VA 4KWTA 2JLAA 3TX6A 4HQ0A 3VPHA 4ZVKA 2IF2A 1QAQA 3OH8A 3HU1A 3DGFC 4MGYR 3LCUA 4ZOAA 4URUR 4Z4HA 2CNLA 2VDVE 2BEVB 1B0UA 1Z6QA 2V3VA 2G3KA 1U0OC 2WFZA 1KK3A 2XCLA 3O7WA 3MC1A 4AZ3A 5AR1A 3LXRA 3PFBA 1D0YA 3SFVA 2P0NA 4X92A 2ETXA 1F5NA 5CB8A 3Q8MA 2CJWB 1O2DA 3PQEA 1XUOA 4KYUA 1OIXA 1A8IA 3A9CA 4ZYVA 3C3EA 3JR7A 1SOMA 4J6FA 1JQKA 4CE6A 2ZIVB 4L78A 3AUJB 3E5HA 1QUFA 3ADBA 1DCTA 2HGZA 2QUHA 2I03A 3KUKA 3L41A 4ZEOA 2X6TA 2PUJA 4PLHA 3MCWA 3U8PA 3AJEA 1J2EA 4WZ6A 1K68A 3FOCA 2MWMA 4PPQA 2Y66A 3COZA 1M1ZA 1EFTA 3RFFA 3DE6X 3B1ZA 1E4EB 1Y8RA 5KKNB 1T91A 3NTUA 3QUCA 3RVZA 4PO3X 3SLKA 3WWYA 4LJ4A 1P5FA 5TS3A 1OXBB 3LI2A 1VECA 4K0KB 3FOAA 4IICA 1I2ZA 4MW4A 4JBNA 3E4CA 1HLFA 4KN9S 1U2DC 2GJAA 4CDMA 3HN2A 1MD9A 2AW5A 4I3HA 3UYLA 2HI0A 2F8TA 2B4KA 3ZX5A 2XRFA 1BU8A 2FP4B 3CEAA 5GOTA 4A91A 2I9PA 2QN8A 1TZ2A 1I13A 1S8FA 2VF2A 2W58A 1OFTA 3ZHVA 3QU4A 1JLLA 3DJNB 1TRHA 4MKZA 3OUTA 3GUVA 4MTLA 3OX1A 1M6HA 3S8MA 1JHVA 1E4VA 2BI8A 2QAGC 3MWGA 3SICE 3C7JA 3EEBA 4KGXA 2WYWA 5I51A 5AW3A 3WR5A 2GHTA 3FPFA 1DKRA 5AW9A 3MD9A 2ZRDA 4DIKA 3HCNA 3I05A 4LY3A 2QE7D 4Z4FA 1I4DD 3NJ8A 5HPYB 4JITA 1BH6A 1TCVA 4L9SA 3GCWA 3N0TA 3I34X 2A9VA 1HFKA 4DLYA 4B4VA 4OLJA 4XEUA 1UMKA 3C62A 4YJFB 1DT5A 5LPNA 4H15A 4L0MA 3VR4D 2ZITA 1JHUA 4GLFA 3WHIA 3OQNA 3PL5A 4WUTA 5ALPA 3SEZA 3L8IA 4B74A 1P5JA 1YBVA 4BZQA 3OCWA 3NTRA 1TFOB 4H3HB 1T3HA 2L17A 1VYHA 4DNPA 8AT1A 3AUYA 1SUDA 3SF8A 3NM5A 1YNSA 1CDOA 4ESEA 4U9DA 2GSWA 2QTBA 2CNDA 3G6WA 1IDN1 3GJZA 3B1JA 3GAMA 2H17A 5AUOB 3F90A 4DCPA 4OKSA 1KDPA 1AKMA 5EHXA 4O1HA 4AI6A 1DKLA 3Q3GE 5AJZA 2BYTA 3DKIA 2K2QB 4PQRA 4R2HA 3N39C 2Z6VA 1IEWA 4J0JA 5HF6A 4EF5A 3FLAA 3TEMA 2OAQ1 4J2OA 2LSEA 3ED5A 5FL7D 1ZOSA 2C78A 3UC5A 2J7PD 1UQTA 4PC7A 1OGIA 5D3MA 1L5OA 2B9EA 2XNCA 4WD3A 1U2TA 2Y77A 5L9AA 2G88A 5BQ5A 3QOXA 5HEKA 1QOQB 3RIGA 1V7QA 3VU9B 2GFIA 1JL3A 5JEDA 1XKTA 3A32A 4BB9A 2O8EA 4RA9B 4RL4A 1RKBA 3AV3A 2CXTA 4BGVA 5U4QA 3L05A 4DHWA 4BAZA 4FZ3A 4JHLA 4BMPB 5BN3A 1HYBA 3M34A 2PNJA 2WTNA 4JE9A 4OY3A 3PITA 4YJWA 2HW8A 4MICA 2KMLA 3FNRA 3OQJA 3D1VA 4XD7D 1XLWA 3EZYA 3FOBA 3DDOA 3FCEA 3LM8A 3MERA 4CLOA 3DO6A 2WJZB 5C8ZA 5CIWA 4NBNA 1MG0A 3K1TA 3WZMA 2GLXA 4ARUA 1KU0A 4IP0A 3PVSA 4CSAC 2O8FA 4W9NA 2QPLA 5EIFA 4EKNB 2DYKA 3WLIA 1DS6A 4Y6QA 3EGEA 1IUNA 3EIUA 2HK9A 3C6KA 3ZWYA 3LT2A 3BL8A 1DIOB 4WN3A 4I6GA 2JIQA 1UK8A 1T10A 1HMOA 5HIAA 4IL5A 4KO3S 3W3ZB 3PNMA 4YVFA 3BC1A 4FGUA 4TWAA 5TR9A 3K09C 3RH0A 1HEYA 5KQLA 1JHMA 5JYDA 5IULC 3VXKA 121PA 3OO1A 2Q9CA 4Q02A 2M9MA 1CP2A 1Y9AA 4E7SA 1FJGB 1V3UA 4WIAA 4FQ5A 2JGLA 5B6IA 1AO0A 1OTHA 1KSFX 3QWBA 3WX0A 3M1AA 1QIEA 3EXFA 3HJAA 1UC5B 3K1AA 4HE8D 4V24A 1YZFA 3S7ZA 5BW4A 2NPOA 2YN4A 4CLEA 4LVNA 4B8WA 3VMFA 5C8YA 1GZ4A 1RJ9B 4DV4B 2HJGA 2WFLB 2I6XA 4FEAA 4OJYA 4J0KA 4MEJA 3TQQA 3HPRA 4ML3A 2UZ0A 1PNVA 1PVDA 4NKRA 1QF7A 4R05A 1UDRA 4EL0A 1Z68A 4BDSA 1EP2B 3UFXA 1DAIA 4V0QA 4ODIA 1FX1A 1HSZA 3DKAA 1Y5MA 4M89A 4O79A 3TK0A 3KVVA 1L5KA 2C82A 1A2QA 4A6DA 2F3RA 3LAYA 5IKOA 1PR5A 4FT2A 1ONPA 5BQXA 3NM6B 1M7HA 1L1RA 4TMXA 2IEIA 2P9GA 3ETDA 4JVSA 2H2WA 5E6RA 1GN8A 1NFQA 4NZ9A 4GLJA 4J0HA 4C7KA 1IJBA 4MOWA 1H6GA 2Q4FA 3K1YA 4IV0A 2DYRC 2JF0A 4BUZA 1SXJB 4LK3A 2D13A 1TVEA 1L5NA 4E3ZA 3ME5A 1IN4A 5NULA 3DV9A 5K8CA 2L6HA 3VHXB 5JQGF 4CDRA 3QPCA 5F3WB 5KTMA 2VHEA 2VDJA 2O54A 3D0RA 3DBHA 3AQBA 2FAXA 2JA2A 5DCUA 3E81A 1LB1B 4NENA 2KE5A 4F1WA 3DOJA 3NWBA 5CT8A 4ESHA 4RGVA 3ICEA 2VPWA 4ILEA 2OE2A 1G20A 5B1DA 2JK1A 4AF6A 4HPWA 3I3OA 4JLNA 2QNLA 3HZZA 3L7LA 2C2KA 3S3TA 5L7YA 3M1YA 2E3JA 3E3MA 3C7KA 5JALA 4EUKA 4MVOA 3UJ6A 4MQBA 1A2KC 1CE8A 1UXIA 4ZAYA 3INNA 3AGTA 1B2RA 1P2BA 2H11A 2EYUA 2IUFA 5JR3A 5GVSA 5EXXA 2JFBA 2RI0A 1BWRA 1PZGA 3BMCA 1JEQB 4OB7A 1IU9A 1CY2A 3OESA 1T3SA 4ERNA 4N5HX 4MNDA 1XDWA 4RZ2A 3G59A 4EYEA 1IB0A 4DXWA 3AV0B 3BIOA 4DWVA 3ZWVA 4C4AA 3ZKWA 2P6MA 2WAOA 1NMQA 4LRXA 3RVJA 4LJ6A 1B8PA 1YE3A 1CD5A 3QYJA 4ARAA 1I2BA 3K16A 1A3CA 4RFSA 2JFYA 3TG8A 2RGRA 2WUEA 1AKTA 1JFFB 2BCEA 2NU9A 2NPFA 4JOCA 1G5PA 5JECA 1N8KA 3K72B 2WT8A 4GC9A 3OFNA 4JJZA 4YRJA 3F8WA 2FW6A 4CI0B 5GONA 1L8XA 4MVWA 2YMPA 1PQUA 1VFNA 2O06A 4KE9A 1S2GA 1OU4A 1RMVA 1V1JA 2O8VA 1P17A 1XU9A 3A4LA 4OH1A 4BVHA 4LTDA 1NTOA 3IAUA 3PXDA 3KWJA 2R6FA 1C1YA 3U3RA 1IYZA 1KWKA 1WPQA 2NTJA 3U6KA 4ITUA 5LN1A 3A1NA 2F4NA 1SKYB 1SXPA 5HUQA 3NMUF 3NHZA 3GU3A 2I33A 4ECEA 4IHJF 4IWBA 2H85A 4DA6A 2CYCA 4Q3BA 3COPA 1V11A 4ZCLA 2QMUA 1AV6A 3UOWA 1BEUB 3W6UA 2ZDGA 3W3AA 4A9AA 2Q8QA 1L5HB 1KY5A 3U3OA 1KI9A 2QK4A 1PHRA 2XX3A 2WZBA 2HUPA 3U9SA 3WDKA 4BE9A 2YFKA 3WGUA 3VYWA 2OORC 2O0LA 3T5CA 3CZCA 4OUDA 1T36A 3Q41A 1YO6A 5DHUA 1CDEA 3ZWBA 1Q21A 3L1VA 4WCDA 1P29A 4OIPF 4XTCS 4NV3A 2HHCA 2O1SA 4C0JA 3QH4A 1KEEB 1FJ2A 4DTIA 4OLHA 3NTVA 2PH5A 4XIFA 4TLBA 2LGJA 3I53A 5JXWA 5AYVA 2UVQA 4OA5A 2HLPA 3A9RA 1DIHA 4QUAA 1E2UA 4DDHA 4YTEA 2HSWA 1H5NA 2VRBA 3ZV3A 1QYDA 4LDAA 3IUSA 2ZQZA 1H8EA 4G9GA 3IQEA 4L85A 1IUOA 5JD5A 3ECAA 2NSGA 2C03A 1CJVC 3E9MA 5LZ8A 4AS3A 2CN1A 4G85A 1YZAA 3EWNA 1M6WA 3PNOA 4ND6A 2QMHA 2OZEA 2EFJA 4D0LB 1P5HA 3SOZA 4IWYA 3RBXA 1PJ2A 4ZCIA 2ZDQA 4JFAA 2PJDA 421PA 4GZ6A 4TKLA 3ZGOA 3E70C 2GAAA 2RHLA 4PCAA 4C07A 1TOAA 3AI1A 2CJYA 3ZV5A 4DIFA 1W30A 3GGOA 1UK9A 5E1MA 2E89A 2CF6A 2ATVA 2BL2A 3NXKA 2XAUA 3QVSA 5ALKA 2VWGA 2DLCX 3UCXA 2NYRA 4NXNB 4PZLA 4HLDA 1WEKA 4K03A 3IJPA 3S5UA 2W37A 2EPMX 2WWWA 3D0QA 4BPRA 4UHBA 1TM7E 5L3SA 4KQMA 2R7AA 4JMPA 1M74A 3CUUA 3TQTA 4AKEA 1AKUA 3E53A 2H5EA 2OV8A 3EXG1 4AJ2A 4JKVA 5HHTA 2PX5A 1U3CA 4TMWA 3U4GA 1ZSNA 4NWIA 2FE4A 2LIVA 1O9BA 4EFMA 3PF8A 3IBGA 3MCVA 3ANMA 3QLTA 1XMOB 4HRVA 5A69A 4HMPA 4JCCA 1RLIA 1U7PA 1CZOA 2PWYA 1FMFA 3O95A 4KRFA 1P1IA 3SFTA 2EVWX 2EF0A 5JIBA 3L6DA 1GDHA 1P0MA 3LFHA 5HWSA 3FGZA 2ZSJA 1I5RA 1MAVA 4DFDA 1E3IA 4O4HF 4EI8A 4INAA 1T0HB 4UZFA 1ETHA 3ETHA 4ALIA 2QX6A 3C3MA 2RGGA 4PWYA 1U81A 1Y3DE 2IXFA 2P6PA 5IMBA 3D6MA 4TZTA 3W5UA 4QYIA 2A57A 4WX2B 4ND8A 3ZWMA 2FEMA 4Q1BA 3RU9A 4A15A 3L6CA 3GQVA 4UAJA 4QG3A 3NDPA 1JNYA 4NOMA 4L95C 5C0OE 2ZE8A 5KX5A 1NBIA 5HCUA 3NC1C 3TRHA 4DILA 4HKTA 3AESA 3HBJA 5EGSA 1UJ5A 1EK5A 4Y2SA 2HSEA 1I0ZA 3DUFB 5D00A 6CHYA 3G9UA 3BMNB 1K8QA 2IP4A 2GZ1A 4GOKA 3MFNA 1UPAA 1Q5PA 3CPJB 5KQGA 1BHSA 3ZE8A 1H1DA 3DZIA 2QVZX 4Y9UA 3O2QB 3KZKA 2C7BA 1PLJA 4HAVA 3ZHQA 4D4MA 4OYYA 3RKOF 4HSGA 4AJ4A 2EGHA 1WXIA 1WB4A 2PGDA 3QG5A 5CVJA 1NHGA 3GJTA 4W6QA 2J85A 3AF2A 3DZKA 4NAHA 3HVKA 4BJ5A 2VT3A 1T6NA 1D4FA 2VEDA 4J1SA 2AG8A 1SBHA 5CLLA 3B8EA 3AEYA 4XJVA 4NJEB 2H7CA 2IHYA 1ISGA 3C85A 4DRXA 4HV4A 2PL9A 2EZ9A 4OLFA 2XQGA 9ABPA 3H3XA 4JX9A 3VX4A 2R00C 2OAGA 1JRAA 1VCMA 5BN5B 1RRVA 3KQLA 5DBHX 1JHPA 2PL1A 3Q15C 5FUBA 3HRKA 4DF3A 2PYDA 5EYPA 4BU1A 2ZXUA 2PRYA 5IAOA 4EHHA 4FSDA 1W52X 2J0SA 3QX9A 4YRKA 3QQ5A 4CMAA 4WZBB 2NNWB 2Y71A 4OM7A 2BH2A 5IEBA 5H7XA 4OAOA 3MQ2A 5KWSA 4MVRA 5BN4A 4IG9A 3Q9SA 3HYNA 4RH1A 4WW0A 5AC5A 1JAIA 5H70A 1DOZA 5BYJA 1S1MA 4F56A 3T5GA 4HDRA 1YR6A 3CWZA 3ZGVA 2I2AA 1I3LA 2QJWA 2PJUA 2EPOA 3UUEA 5IU6A 1JAFA 2IUSA 5AH0A 4RPIA 1Z06A 3OECA 1RYEA 1T2UA 3PPVA 2A30A 2JDIA 1FDTA 3I62A 1TUIA 2BHSA 5TEVA 2JKVA 1TMYA 1WAMA 1Z5OA 2NXJA 1C9KA 2XF8A 5JMWA 1BHJA 3NGMA 3OSZA 2QG4A 1N2XA 5DNWA 4C2BA 1X74A 4BVGA 4CBEA 2WU8A 1ADYA 1VL1A 3AMVA 2WUWE 4UTXA 1BROA 5KYGA 3OIVA 2ZSFA 3Q6MA 1NM5C 4F97A 4E0HA 2PRIA 4DB2A 4IZHA 3DEFA 2BZGA 3KT8A 4ZYZA 4FDTA 4X8HA 5CX1A 2VHVA 1W36D 4F4CA 3RG8A 1U3DA 2I3AA 3L6UA 3AVYA 1E1CA 1BC5A 2WRZA 2WJ4A 4K5QA 1Z3CA 4DR4B 5AC4A 3K9WA 1EK2A 4MHOA 1NNLA 3NBKA 2M6LA 3M9LA 4BB0A 4FWBA 3GLHA 1QBKC 4DBZA 4N18A 4IO1A 4HAOA 5FO1A 4KOAA 5H5JA 3HEBA 3S2IA 2X19A 1XNGA 1UPXA 3LBYA 3KR9A 3IAS1 2HHLA 1WW2A 1PWZA 1SB9A 3AYZB 4RACA 2PBZA 1YDMA 3THYA 3LTEA 4UBLA 3RC2A 1KI8A 3L4BC 5LOVB 5DX0A 3UOAB 2OV1A 2RG1A 1TK2A 4HB0A 3IS3A 4KLZA 1TB4A 4WZAE 1BZ4A 5AM1A 2CYDA 5JNWA 3FUVA 2Y0EA 2Y0PA 3MJTA 2IQIA 2FSUA 1AXGA 2XOKA 1EUCB 4BZWA 1XA4A 4B3MB 4IB4A 1GVNB 1GCIA 4URYR 3C6XA 3RSLA 5JMOA 4MEAA 1ANKA 4MUGA 4UTZA 4I4LA 3HJHA 3V4FA 3AKDA 5EJ6A 3QE9Y 3E22A 5KSWB 3WLEA 4WLEA 5KSOA 1H3FA 2V6GA 4B6EA 2PQ2A 4R9RA 3TG2A 1CZRA 1NJFA 2OHVA 5B3JA 3VDRA 3QUSA 2QW8A 2QX8A 4EPXA 5K8LA 4NMXB 4DKXA 1Z15A 4NV0A 1KQGA 1MVOA 4YAKA 1LK0A 2GB4A 1FP6A 3T99A 4LQ4A 4DRHB 4K6KA 3EJ6A 4NICA 5FKJA 2C2GA 3JZDA 3ESRA 5JD4A 1G8JA 4PM4A 3LQKA 3KX2A 1F1JA 2FGJA 3TTSA 3CTPA 3ZDCA 1KIMA 4MYUA 2NUBA 2ZIUB 1C9JA 3D6VA 3PUZA 3MELA 1DTWB 1S1CA 2WTEA 4EGQA 4QD3A 1WQ1R 2WICA 4BE4A 4A5SA 4PTLA 4DR5B 1R4NA 3BFPA 1SRQA 2MMGA 4XGNA 2IZ5A 1J8DA 5AW1A 1Z6PA 3DE2X 1KHHA 3ZIBA 2OT3B 3UWPA 1F2UB 1HT3A 2BGJA 5TVGA 2PCLA 1GGNA 1T6YA 4CHGA 2WB7A 2VLBA 4XUEA 2LCHA 3Q7QA 1WO8A 1XVAA 3KSBC 3I01A 4CODB 3M4BA 3GT3A 4CEHB 2JGNA 2ZU6A 1RPAA 3ZCTA 2EJTA 2XITA 4G0YA 1T13A 4HZUB 2BSAA 2FWBA 3IXMA 4U9HS 4ZI7A 1I51A 3IBCA 1F8YA 3MWDA 1DEHA 4FOOA 3FIJA 1RIFA 3PYMA 4ZQIA 1WS6A 2CL5A 2ZCJA 5TPWB 1D2MA 1OX6A 5FD8A 4HFKB 3FVQA 1ZN7A 1XTRA 2CSUA 1RQRA 2JCXA 2DVMA 4PC3A 4UD2A 5JBNA 2CXRA 3LLKA 4INJA 5JAHA 3O0TA 3K2BA 2AK3A 3L3BA 4BJ3A 1KEKA 2XUKA 3MQFA 5D01A 4KDFA 1Z7EA 3C3YA 2CHFA 3CBQA 2QSZA 1SHJA 5L3QA 1FDOA 4WLFA 4FAPB 2HA7A 4OUKX 1IPFA 3R3SA 4BXOA 1Q0GA 3A6JA 5BSUA 1BKSB 1PS8A 2AXQA 3KCQA 2ASEA 2W6IA 3E3LA 2G1UA 4LFCB 2OFPA 2H5IA 3NUZA 3H3JA 2WQ7A 1BQ3A 2PD3A 3L18A 4K1XA 1UEJA 2YJTD 3SQDA 1SKMA 1C9YA 3I2FA 4S1PA 1KI2A 1JTFA 4RPGA 2W4BA 4PNHA 4II3A 2ODWA 1BS1A 4YS6A 2GOYA 4EGCB 1X38A 1JXOA 3IQHX 5DULA 5KVSA 1LBHA 4B4DA 4DZTA 4ZTUB 2WG2A 3PENA 4MQ6A 4U7JA 1XLTA 5LMCA 1YUNA 2EDCA 1XDDA 4ZTBA 2P4EA 5EIEA 4UBJA 3EGDB 4YQZA 3S27A 1QP4A 4TKVA 1XHEA 4HQFA 3N2GB 5CLIA 2YZGA 3T61A 2H59A 4WWHA 1TF5A 3D5QA 2NLOA 2HLHA 3N8HA 3IQ5A 4LEIA 4H17A 4E14A 3DHNA 1XOIA 3OA0A 2X2OA 4NEGA 2H2IA 2XNDD 3AO0B 5CK5A 5CR9A 4CKBB 1JHQA 4BLVA 4EW2A 2I76A 3B6EA 4W82A 3EF0A 2GJSA 4OOFA 5EKTA 4JX8A 4RF3A 1Y4SA 4IDGA 3MJEA 3C8UA 3Q0EA 1ZK2A 5DNAA 1KJNA 2K4MA 2R7UA 5KVVA 5FPKA 3W5VA 2VI5A 2BGNA 2QG9A 5IJ0B 3PICA 1O6CA 3OT1B 2XLOA 4EUNA 3EVAA 2IXTA 5A5EA 5DJ5A 2PEZA 4BEMJ 3JW8A 4ABYA 3RC3A 1RBZA 3PDJA 1E6KA 2ABWA 4GI7A 4DY6A 3U3BA 2BFAA 1CDZA 5FFMA 5GTDA 2HIMA 5CJJA 2HGSA 1L1QA 1OR3A 4I4IA 3FMVA 3OX4A 4X7PA 1U0SY 3DAFA 4C4RA 2MSWA 2C4TA 1QHIA 4MVJF 5SYMA 3IQFA 1KK1A 5A9TA 1AMUA 2Y1KA 2TMDA 3HCCA 4FE7A 4WN9B 3ES9A 3BMOB 1RAAA 4ZXFA 1UOPA 5KQMA 1DQRA 3OKPA 3F78A 3UMGA 1XWJA 3M83A 3C8GB 4EF4A 3HKCA 4M6WB 1EFPA 4CTKA 5HOQA 2R4QA 1T1GA 1QONA 1HY3A 4Y2GA 1N2JA 2ZUVA 3WB2A 3EK2A 5J59A 2AMVA 3CNNA 1JR4A 1Z7Qc 2BD0A 3KBBA 3TJRA 1U5CA 3K0AA 4F0JA 2IKQA 3IVXA 3HKEB 1WF6A 1ECFA 4JR1A 4ATNA 1KJZA 3OJOA 4GM1A 4GX2A 3K05A 4YJGA 4BCCA 5LZ2A 4MCHA 3VYSB 4B6JA 1UIRA 2DB4A 3DMPA 2PGNA 3TZQA 4ZU6X 2GWHA 1A7UA 1S9HA 3N2YA 5ALVA 3HN7A 2PBFA 2XCQA 1KMIY 3O73A 4F12A 3LRPA 4BATA 3N6RA 4HAXA 2DFPA 2L42A 3GHYA 3K8QA 5JH7A 5A4FS 3GRPA 5FNVA 2AJCA 4J2TA 5G0WA 2I22A 2SKEA 3A2LA 3QSGA 2J3LA 1XRQA 1Y6FA 2RI6A 1ADGA 3LWDA 2UYGA 2HEIA 1N6IA 5B1BC 1XN4A 1YIOA 1JPNA 4UNQA 1ACMA 1XX6A 3EARA 4RV4A 1NBHA 5EJAA 1HNWB 4A27A 5L4SA 3DGEC 3W6NA 1WHSA 4LLEA 2O19A 4EB6A 4DR6B 5F5NA 1CEEA 3EAQA 4C5CA 1R66A 1OR2A 2QTWB 3VJMA 1UFQA 1XQ1A 4OJMX 4Z86A 3EULA 1GRQA 4RELA 1QVZA 3PR2B 3IEEA 1G8MA 2ZGVA 4M9SA 1G8PA 3NX4A 2PLFA 1IY8A 1PJ8A 2QVLA 4MUBA 5KINB 4RCVA 3ZQVA 5DWDA 5TGZA 3RYIA 1Y1QA 4Z7NB 3ZVLA 2CUZA 1G3IA 4TV8B 1XLUA 3RB8A 3UHJA 1XCLA 4CZ2A 1W4CA 5TXGA 3MGKA 4KVGA 3RYLA 4NESA 2IS6A 3BRWD 3VKWA 1FE8A 3PR3A 5HMMA 3FOZA 2GN4A 3QBTA 4NCXA 2IXNA 1UT6A 2UZIR 4B17A 3U8VA 1U9CA 4JQCA 5ALTA 5JAMA 1M76A 3LHFA 4JJEA 1GZSA 4LV6A 1FFEA 4F1JA 5K0FA 5JT4A 4KACA 2P9CA 2QUAA 3HGTA 1DAHA 4QPPA 4BV9A 5ALHA 1JDUA 3A1DA 1HE3A 1TYCA 3QLJA 5CVTA 1FXWF 1T01A 1URPA 2ZJ8A 2XZLA 1O77A 2XWSA 1FFAA 3MK31 3OIUA 2B5WA 3BDIA 3T52A 1XD9A 5HIMA 2GCPA 3ICVA 1Q7RA 4YCNA 1SKQA 4U2EA 3HCDA 2SECE 3LPAA 4NU5A 1DHTA 3GRRA 5K09A 3S8EA 4R5MA 2VP0A 5B6JA 3OE1A 4KAAA 2R3SA 3DVQX 1QFYA 4MVJH 3ISVA 3QENA 5IBQA 2VHXA 1JWLA 2OGTA 3DV0A 1DUIA 4Q03A 4IDEA 4O3FA 5G4LA 1MGPA 2V1XA 3B9BA 4IGGA 2D5IA 4U2CA 4X44A 3PKZA 4E5PA 3U44A 1V5WA 1WXGA 1NNEA 3TZHA 3EHDA 4EA8A 3GPDG 1G291 3MGCA 3E6AA 4PYIA 1FMJA 1P74A 2VHCA 2CNWA 2W2LA 2A9RA 2ECKA 1YGPA 5K3DA 4TTTS 2VWQA 3RJ9A 1U63A 1TKAA 2LVBA 1EVQA 5CCXA 2JIBA 5F5LA 2DTXA 1WABA 2FJPA 2OSBA 5TMEA 5FTLA 3TNYA 3M33A 9GPBA 3QMPA 2ONYA 1WVMA 2ACVA 4ZAVA 1JEYB 1EMDA 2H2DA 1E0DA 1RJGA 4E07A 2C04A 4HWRA 3U9LA 4JBWA 2WKSA 5SY4A 2XUZA 3GLFA 1IUKA 4XZ3A 3UF0A 3WYNA 2ZRQA 5DZSA 1TU3A 5LDHA 1WZ2A 2IXPA 2IH4A 4TXJA 3D4BA 4RCZA 1UT5A 3EGWA 4EW3A 4M0LA 3UJ3X 2VJAA 3DOFA 4D7AA 4OINF 5C37A 3WXBA 4GICA 1V41E 4RTSA 3OC0A 1KEPA 4MVJM 5BV2P 4YMSA 1ZL2A 1Y1RA 4U2KA 2Q0XA 4WOPA 1Q95A 3D4OA 4ER3A 4PO9A 1OZGA 1NWHA 4UFOA 3O10A 1JJ7A 4QUEA 2OZLB 1R4ZA 1UWCA 3D4NA 1PZFA 4UAUA 2QXYA 1OC2A 3AB7A 3GIDA 1AS3A 5LQUA 3D5EA 2A9QA 3RKUA 3LKZA 3K8OE 3VI3B 4FCTA 4FOTA 1MDFA 1Y9ZA 3BXZA 2PV0A 2PS1A 3OTQA 4N82A 5ETJA 2WIAA 3THOA 3NJ4A 3KOWA 4RD4A 4M98A 2RARA 1J8YF 4CN8A 2VSYA 3CJRA 2AFIE 4GZ5A 4AZ0A 3PC2A 1B68A 1RDFA 1TX4B 1W88B 3WA6A 2Q7RA 3M5PA 2M6RA 4U39A 5FTKA 4H7IA 1AURA 3QBVA 2OYCA 1YS6A 1XALA 1TUBA 1U9JA 1SF8A 2X14A 1I24A 4FYJA 3D6NB 2C0PA 3GDGA 4JGGA 4IBOA 2AS0A 2AUTA 3UCFA 4EY5A 3KKPA 4X24A 3BFJA 2GM4A 3I32A 4G7ZF 4R0NA 4KUHA 1WASA 1FPMA 3HVHA 2HF8A 4OYRA 1EQUA 1F8GA 5B53A 4UEKA 1U2SA 2Y1DA 4BFWA 4ZXPA 5D6OA 2R47A 4RKRA 3TQSA 4E32A 4Q7LA 2H3HA 2AEJA 5UKDA 4Z9AA 5KVQA 5F2EA 4CM6A 1KI3A 1CYEA 2OILA 5DWVA 4F06A 4YQFA 5F7JA 1XQ6A 3CH5A 2HMWA 1OCOC 1S6YA 5F7ZA 3FFXA 3IO5A 1K4MA 4ULWA 5L7WA 1O97C 4BEBA 4HB3A 1N9ZA 4D0NA 3HNJA 4I50A 5DTJA 1DNPA 3HCPA 2OP0A 3DDWA 1XYVA 3KEFA 1RC8A 3VKVA 2PX8A 5A0TA 2Z04A 4X6XA 4TLEA 5I47A 1UBGA 1K5DA 2ICWG 4TGLA 3BZWA 1RPZA 4Q9JA 2VK4A 4R40A 5HRCA 4JASB 3ODPA 4Q16A 1VDMA 4PO1A 4LMPA 3MCUA 2NAFA 1DARA 3AIOA 3OIGA 2QTNA 2VTKA 3ZVNA 1H9CA 2VDPB 2QRVA 4HX5A 3UAWA 3IB3A 1F4VA 1V54C 1KJWA 3F7OA 1YE5A 2XD9A 4RVNA 4NATA 4DV3B 1XTPA 2VH3A 1Q6YA 5JCJA 3WODF 2VH1A 4EELA 2PS3A 1YZNA 3MWEA 4Q3KA 3T6BA 3OBBA 3R7DA 2L69A 4G1VA 1AKQA 2J3EA 4ZO9A 4RCYA 2I2CA 2WLSA 4QM7A 2X4DA 1JDVA 1RM4A 3VH4A 4YX9A 4TTPA 2OHIA 4K9OA 3C5EA 3HXKA 1BA3A 3G89A 2QI9F 3JRTA 2QNBA 1CP3A 4KGDA 1R8XA 1EFDN 3HYSA 4QI2A 3PE6A 2IU6A 1QYCA 3KL4A 3G2QA 2YRXA 1E3WA 1T9HA 2HDNB 4LIPD 2N47A 4ZHQB 5H1YA 4URVR 4GC5A 3SYTA 3FJYA 3D3NA 4J0FA 4MJ3A 4Z7OB 3O3OB 4JYAB 4MEBA 2O20A 2ISQA 3PSHA 2Q21A 3ET4A 2RE8A 3H4VA 4E94A 3ELUA 1NW6A 4R5HA 5L4NA 3UW1A 2RAPA 2CY0A 3MEQA 4OJNA 4MWGA 4KFUA 1QUEA 4AF8A 4CCWA 4D4KA 1L4MA 2HU5A 4RGYA 3R0QA 2QUPA 4OTZA 3QRWA 3FGPA 1GY8A 1A8UA 5JY6A 3AUFA 4M88A 3SLRA 3T1HB 4JXKA 4GUDA 5HZHA 2ORED 2N42A 1M72A 2UYYA 3O4HA 4XX1A 2FYTA 5IUJC 1UDAA 2F2TA 2FFRA 5SZHB 2XXJA 2NNLD 2D2IA 2H51A 1WOYA 3DMHA 5H80A 1HTBA 3U4QB 1PGPA 2C2WA 3DZHA 2I4RA 2I4OA 3NCHA 2BFFA 3UBMA 1Z36A 4S05A 3CKYA 2ZAYA 5JCOC 3ULKA 2HO5A 2BL4A 4YUVA 4FT4A 3TLZA 3GGPA 1X19A 2UYOA 1LRKA 4W99A 3ZLTA 1XG5A 1KR2A 1LS1A 3PUWA 4IJVA 1XELA 4CKEB 4ZREA 1JLHA 3PX2A 3FPGA 1DZ3A 2BRUA 2JCYA 1E1KA 1C7EA 3VR6H 2J9WA 3ISTA 3L0CA 1EFHA 4F45A 2ZJAA 3I8OA 3KEMA 3L0BA 1SUSA 2OK7A 1HO3A 2F3PA 1T4CB 1ZESA 5DNDA 3EFOA 3PFFA 3RK1A 5LP1A 2ZYHA 5DHFA 2RGXA 4YCJA 4DLXA 1GG2A 4D96A 4RBNA 4D9NA 1E7QA 1XJ5A 1OHHD 2C0QA 1P2UA 1XXHB 5DOZA 3ZCSA 3GJRA 2NTNA 4F84A 1A7EA 5C52B 5JRJA 3M9WA 3JASB 4YN3A 5K7SA 1R6AA 2HQRA 4BGUA 1I8TA 1X1SA 1E2IA 5AW4A 4YNBA 3KEQA 3UWMA 5LLDA 4WXYB 4KITB 1G66A 3N7UA 4XQCA 1C9DB 4YP9A 2G28A 1A1VA 2Q49A 2P35A 4N9QA 1U90A 1ZW3A 1AD2A 2Y1WA 1L7CA 1CKEA 5LOVF 3GGJA 1MX9A 1AKVA 4Y2JA 4RVDA 2D06A 3NOQA 4UOQA 3WG9A 3LC0A 4WLNA 1KMHB 1WUIS 4WY2A 1IWBB 1X15A 2J6IA 4D46A 1Z25A 2H2AA 5IH3A 4C3VA 2J9GA 1PR0A 2R6AA 2H16A 4Y9TA 1DWPA 4ZQHA 1VBMA 4AJ9A 4L16A 3LUGA 3E1KA 5TSDA 4H1VA 1C3OB 1YVPA 4L5YA 4P8RA 3B70A 3J7TA 5K5EA 1CUUA 1GLVA 1UPBA 3DOEA 1MMGA 1U28A 2CK3A 3AEKA 5H3CA 3BGIA 1JE0A 3TIXB 3UH1A 3A4YA 3N59A 2FETA 1DWUA 3OKFA 1N8SA 2OQ2A 3STYA 1D1TA 4YH1A 2J9BA 4XFKA 2I29A 1CR4A 2QRUA 1C14A 3VISA 1T29A 2DSTA 2HKIA 3HQ4O 4W9RA 1NG9A 1YZ3A 2QXUA 3SNHA 2A0BA 3GH3A 1EK6A 1N1EA 2VPXA 3ACCA 3LSTA 5JATA 2P6VA 2I6FA 4PV7A 2KQ9A 4XUGB 2DPGA 4ZIRB 4KL8S 1ZJ6A 5FWAA 3EPRA 3G68A 2R7QA 1KVRA 3I52A 4U5DE 3E9ZA 4P98A 3ZNPA 2QEQA 2OBFA 1H22A 4IOLA 2WF8A 1SCUA 3UV7A 2VF7A 1KK0A 4G5XA 1M1YA 4BU0A 4LF6B 5JCZA 3U31A 3FTQA 4DV7B 8LDHA 3SQWA 2WPDD 2QVCA 4W1RA 1DX4A 4MPJA 1OYWA 3TBHA 1J0XO 1FS5A 2XLVA 3W6PA 1SOVA 2FZVA 2O2DA 1U4NA 2X0FA 3VKHA 3TFWA 1W75A 3DL2A 1NPYA 1TWAA 5AVZA 3CV3A 5MFZA 3ROTA 1Z6AA 2ISCA 3X2QC 5GV7A 4KVAA 3FZGA 3WJ2A 2IYLD 1WEHA 1RXIA 2PGAA 1PK8A 4DPLA 3K70D 5JO0A 1X0XA 4QRHA 1TJPB 1E1NA 2HCBA 1L3CA 4J3JA 5CH3A 3OFND 1AJEA 1ZLXA 4B45A 3E0XA 4QKQA 5F78A 2V9ZA 3DTVB 4IOJA 3I5MA 4TOIA 1IY2A 4XIGS 1KI6B 3B82A 4PBTA 3KL2A 2C8KA 3SYKA 4HAZA 4IXWA 2IWRA 3SVZA 3QGMA 4LZWA 2MHRA 4DADA 3A4VA 3NAQA 3CE9A 3CF4A 4B3TB 3KAQA 4JR2A 1V71A 3LQ4A 1N2BA 3I2GA 4H1HA 1R6XA 3TRIA 1ZIXA 1GLGA 2P1DA 4KXVA 3HZRA 2F1RA 2H1RA 4UOEA 4EMTA 3CF2A 4GYKA 1BCRA 1IXYA 1RIIA 1QGUB 5DOVA 2ORYA 1VL0A 2C9CA 2QAIA 1MJGM 1M7GA 4CUZA 3HB1A 1D1PA 2ZVDA 3TUZC 2GRJA 2Q3MA 5HQ3A 4GWKA 4ZLDA 2XLBA 1NOJA 5DNCA 5E95A 5JJKA 3PFKA 1MQVA 3V5XA 2H4WA 5JJBA 4MLDA 3DUWA 1E6EA 3LKDA 3ADPA 5C34B 1PS9A 2Y92A 1LNSA 3NAMA 4OEHA 4P5PA 4QODA 1VSUA 1AT1A 1H2WA 4MB0A 2CYAA 2Q1SA 3USZA 4K9SA 2I5PO 3NVAA 5DRYA 2OKCA 3ZHCA 4ENSA 1CF2O 1UC8A 4IDBA 4JP5A 2GD6A 4H3SA 3PDIB 2XE6A 4AVYA 3TSWA 4UMFA 1KDOA 1RQ2A 3JRNA 3LE8A 1P0IA 4UFNA 2X58A 5KYVA 4BWGA 2HTFA 3AFOA 3INRA 2CMHA 2A92A 1Z0KA 2OGWA 4EATA 1BKDR 3F6RA 3ST7A 1L6RA 3HDYA 2EJUA 3DO5A 5FORA 3UB4A 2BR5A 2XCIA 3DLPX 3TCNA 4QTYA 2XXAB 3K0CC 3PI6A 2I55A 3PFCA 1A97A 521PA 1EYZA 4O63O 3NNDA 3QPVA 2J4CA 3LUHA 4YWJA 4K88A 3KKBA 4YRQA 5FPSA 1O95C 4YV7A 5FBKA 5H81A 4GQBA 2JHAA 3ACBA 4KQWA 4UU7A 2BKXA 4F9GA 1MUUA 4UBNA 1ES9A 4MUNA 4DM3A 1QR6A 3MIZA 1W1WA 1GZ6A 5MF6A 2Q3LA 2JG3A 4Q9DA 3FKSA 3CRVA 3HY3A 5B7PA 3D3JA 3BIJA 1CUDA 3O55A 3QXSA 1LK5A 2JGDA 2PXHA 5F77A 3ROQA 2P2YA 1KVQA 1S02A 2WLTA 4YAEA 3SQOA 2CXXA 2NVBA 2NYUA 5DIFA 4DMLA 1TMGE 3LOQA 5IBPA 4CGYA 4MI3A 1ZIOA 1A71A 3LDHA 2UV8A 5K3AA 5B30A 2YFQA 3NHRA 4DN6A 1QFZA 5FUXA 3KT3A 2DE0X 3EDCA 3KQMA 3EDRA 4W7SA 2WIKA 3Q3HA 2HHHB 3JQDA 3CRMA 4MJ7A 2XI4A 4ZQFA 2ZLBA 2H7BA 4RDIA 1NI3A 5J2TA 3DEKA 1TE2A 3ESCA 3MCZA 1YH3A 5CLQA 2QRMA 2Q5FA 2DU8A 1NP3A 1W6UA 2ZJOA 3ZK7A 2Q0QA 2WYUA 3LESA 2C2MA 2EIXA 1XHLA 3WMRA 2WJ3A 3K9LA 2D1RA 2OXEA 3D2CA 3L0PA 3DBRB 3ROMA 1Q7CA 4ARIA 1DL5A 4GX5A 3JRXA 1MB0A 2WEKA 5T57A 4NEQA 3K0SA 3NIWA 4F6RB 3TRDA 1G5IA 4IEIA 2J09A 4JEHA 5KYXA 2JBWA 3H1GA 3DMNA 1UMDB 1WCYA 2WNSA 4H35A 4PS0A 1XMSA 4MVYA 4N3NA 1D4OA 3L1JA 1JTVA 1DDOA 4WADA 5CYOA 2VDWB 3POVA 3WZ2A 4JI7B 3BUSA 2AT1A 3NOOA 4PLVA 1H42A 2YL0A 4NG4A 2IEBA 4CLRA 1ZH6A 2QR2A 3VMMA 3C5CA 5BWMA 2P6OA 1TU4A 3GBVA 5LQSA 3M3DA 4INPA 1VSBA 2PZJA 4NECA 4REQA 4AURA 4M8SA 2LCQA 5B64A 1B14A 2IEDA 3TTTA 4I1OB 4RF5A 2Z1DA 2B8JA 4RSMA 4FKBA 1XPOA 4A2WA 4CGZA 1GPYA 1AX9A 4RA6A 3NHBA 4GYYA 4MW6A 2X0KA 5IUKC 2AB0A 4JC0A 1KEWA 1YRLA 1F60A 1TKNA 4IDOA 2GM5A 4MO9A 1PYOA 1GN9A 4KXYA 1GILA 2OHFA 2ZE5A 1VIDA 2WUGA 4Q6BA 2OCDA 1LPMA 4I1YA 3UEOA 4TV8F 2PE5A 1E2LA 1EAYA 3P9RA 5CAEB 3CX7A 2GX6A 2AUMA 4KPFC 4GBGA 1Y5IA 2AMJA 4DQLA 4Q1DA 2OXIA 3U3KA 2HUNA 4FFNA 3MT9A 4Q4HA 3ZE6A 4Y1RA 1U8ZA 4CCYB 1USKA 3JQ9C 3QE3A 3I3SR 1DV2A 4WJLA 2PF4E 5BNWA 1CY8A 3W8FA 1WUJS 1PX2A 4RFVA 4RK4A 3VDMA 3HK2A 7AT1A 1EHIA 5A1JA 2RJ3A 4AZWA 5JRZA 3U4DA 2IHUA 1YI0A 3MSXA 2XQIA 1P80A 1U7ZA 3CKLA 4U63A 1FDSA 4BVJA 7REQA 1ODFA 4WMLA 2Z2XA 1ZC3A 1Z6XA 2AEEA 4YRTA 5SV2A 4CPDA 3H5VA 3RBZA 4D8TA 2GILA 3CLVA 3T4RA 4BLWA 1YL5A 4DCOA 3EWSA 4MGEA 1XLVA 2XYVA 1Q0LA 2JFHA 3MAJA 2I3ZA 3IRVA 3LAWA 4G37A 2JDID 4XCVA 1JDTA 1FMVA 4DNXA 4CL8A 5BW6B 3WWCA 5JVDA 2R8RA 1K92A 2G72A 4EW6A 1ITZA 3NBYC 5J2UA 3IJ5A 4IM7A 3WL4A 5AJYA 3VO8A 4E70A 3ONEA 4EZBA 4ND4A 3JQFA 1FU4A 2IYSA 1ZMXA 1ZGBA 1U2ZA 2A6PA 4GNKA 2Z3ZA 4QYSA 1YSCA 3RF3A 4BUCA 2ZBGA 2IUYA 2XB6A 5F5FA 1VRVA 4EMBA 4X6UA 4DIBA 3FE2A 3ZXYA 1P73A 3IODA 1L5MA 1QIJA 4E1BA 4OGKA 1OI2A 3MAAC 1CJSA 2EBFX 3U56A 4P5EA 3INYA 4JBLA 3EMKA 3TWOA 5HJ7A 2PCJA 3IVGA 2DPYA 2H7XA 1ZEJA 4P08A 4JTCB 2DP4E 2YHUA 5KCZA 5CIYA 1YBMA 3WLFA 2IX9A 2EQBA 1Q7BA 2OM2A 2P5TB 4GD3Q 2EFCB 2HRCA 2XMGA 2NQTA 4OHKA 2B3DA 2WK1A 2DFNA 4MWCA 2X0RA 4AL4A 2F90A 4DLUA 3V6MA 2HWUA 3TIGA 2Q6VA 2O8NA 2XCUA 1JQ5A 3MILA 1KORA 2BTEA 4PX3A 5HG0A 4TQ9A 4IMPA 3LCMA 2IYYA 2NUPB 1KYQA 3THWB 1GFIA 1SVOA 3NHMA 4R2LA 1DJMA 4M86A 2Q4EA 2IRWA 3ML1A 4I5DA 4C0QC 4WGZA 3NOVA 1O3UA 3NHYA 4CS8A 4L7QA 1T1IA 1PWHA 1PVVA 2R25B 3L6OO 1MQAA 3VYUB 1OLUA 3AKCA 1BU5A 2FEWB 5FTJA 5I5EA 5D3QA 1ZN8A 4K9LA 4JUIA 3RKRA 2FSSA 2A0WA 4OSPA 1N78A 4X63A 4GP7A 4HUQA 2XOKD 2PHZA 1LSJA 5T64A 5IWAB 4CIBA 1EFRD 1H3EA 1Z6GA 1U02A 3ZBTA 4C06A 5JNVA 3QVGA 2YVKA 4ZZIA 1D8AA 2XS8A 4IGFA 1LI5A 1KERA 3ZG1A 4KYTA 4P3XA 2FPRA 1SURA 4XPIB 3X1XA 3RV4A 5B12A 4TTIA 4LBYA 4GOOD 1Q12A 2BLLA 3RSHA 3K4PA 1A88A 4FHFA 4PNEA 3KTOA 1NJ2A 3PHHA 5EIBD 3R7SA 2WI8A 2IXDA 2G07A 3QFFA 1YQGA 3PRYA 5EJIA 3SM9A 4WEQA 3KFXA 4KMSA 2QRJA 1GZDA 4U2DA 1A5ZA 2R4TA 2P6UA 3HVJA 4ECAA 3GPBA 1XJWA 2X8AA 2QPOA 5FADA 3M6VA 3RJ5A 4PSAA 1I1OA 5BUSA 1ADJA 3KB2A 5EGNA 4V3CA 3HHEA 4GKAA 2XRZA 4JSTA 5JFOA 3NV9A 4Y8VA 2O8DA 2XGJA 1W93A 2JLBA 4TTRA 1HE4A 3NONA 4RTPA 2PV7A 2OUKA 1DJQA 2GBIA 1YJGA 3FYHA 3UB3A 4NMLA 2I3GA 3L7BA 4IXNA 4CKCB 2BGIA 1K8YB 2HADA 3S2FA 3DD7A 1FTSA 2EIJC 3V5ZA 2FUNB 1KVTA 2FZWA 4BNDB 4JKIA 3QIAA 4BV8A 4KFSA 3Q8LA 4FKMA 3ZV4A 1M2VA 1JUDA 4HX2A 4R2MA 2B82A 3JTEA 3GLGB 1OUMA 5BWLA 3CKMA 4BFSA 3S2ZA 3T7DA 1E3SA 1ZAYA 1ZVZA 2D5RB 5GQSA 1HMPA 4PANA 3ND7A 1MB4A 5IKPA 1BCSA 4KNVA 2HK7A 1EQAA 2UXBB 3X3HA 2C1XA 2GVDC 4H59A 3QHPA 1OAOA 2ZUUA 2GFHA 3M1CB 5CPBA 2XUAA 4DQUA 3F5SA 5L0CA 1OLXB 3ZOKA 4P7KA 2W0MA 2WYIA 1QMPA 4M1SA 5BYBA 4HY3A 5CFLA 4RYLA 4AROA 1TD1A 4B3SB 4GKBA 3UHOA 5LQMA 3N07A 1K6IA 1QC5A 3W5SA 4IUYA 4AUKA 2BM1A 4ZHQF 3HA3A 3A7DA 3UGKA 2CHVA 5JAQA 4H1TA 1Z7GA 4O25A 4RLHA 5IXSA 2NSHA 3GFFA 4A8PA 1P61B 2DUNA 3X43A 2W6ID 2WSBA 4QU5A 3ROGA 4DREA 1RJFA 2WB2A 1TXGA 4HDQB 2ZZNA 1U0RA 1XHFA 3N0RA 4Z5XA 3IP7A 1QGZA 2VTBB 3RTCA 3FY4A 4KFCA 1EVLA 2ZAIA 3MN1A 4PHTA 2EFEB 3CLTD 5A02A 4Q93A 4A0HA 2C1ZA 1MAUA 3U3DA 5IC6A 1QCZA 3V8MA 2P5SA 3AQIA 5GZ1A 1ZUHA 2AOWA 4XXHA 4ZT6A 1NMXA 4YCLA 1IOZA 3O38A 5E3HA 3HWSA 3OJ0A 5LMNB 3C3JA 4NJMB 1D1SA 1TEVA 3B5JA 4ONEA 3OE4A 3AG4C 4P53A 4M9UA 4ZT7A 3KZMA 2RGUA 3FHJA 4Q1VA 1WSBA 2ORWA 1Q22A 4RUKA 1VA5A 4KEAA 1TR2A 3BXGA 3C3PA 1D7OA 4LOJA 3ABLC 4F4FA 5ESRA 5JJCA 5JSZA 3X1WA 1JG6A 2J0UA 3OQIB 3EIOA 1ZHWA 3ELBA 4PLGA 4O1MA 2CCJA 3B9RA 3GRUA 4F7DA 3ZNNA 3D8NA 5EUBA 5HIIA 4RS4A 1LV8A 1B8OA 3SBEA 3B0UX 1KO8A 2O2ZA 4US1R 5AXAA 1SJ9A 2P91A 4LJRA 3WL7A 2XQFA 4K1LA 4QPJC 4GO1A 2RBGA 4HTFB 2WMYA 1R8SA 5JI3E 4KPUB 1QTQA 2CT8A 3Q2IA 3EQLF 1EWTA 2B7LA 2QQ0A 3GRAA 5IDYA 2MJLA 1F4PA 1PNRA 1U1EA 2IYZA 1RE1A 1CPRA 1DBSA 4JBXA 4Q5IA 1AZSC 4KLCA 2FY8A 3HDHA 2BAGA 2H9YA 3E8XA 1C0KA 1O8CA 3W8EA 2CNOA 4CM9A 4M0MA 4UDNA 4R7TA 2VDLB 3AEQB 1ZG3A 2V7GA 3K0BA 1R4AA 1CEQA 1TYBE 5FR1A 3VM6A 3JWPA 4HNGA 2WP0A 4P83A 3SZ3A 1MO5A 4OFBA 1R50A 4MVJE 2XIQA 3PJFA 2DUWA 4D9FA 2VJOA 1II0A 4BN0A 1SR8A 1VLQA 3LFUA 4N3AA 2FNAA 4KO4S 4NPHA 4C6SA 2XYHA 3AEXA 1ESMA 5EJEA 4KR3A 4LSGA 3FVYA 1HQCA 2KX7A 3LT0A 2GZHA 1M34A 2M1ZA 3BWVA 1WW3A 3MW8A 3ECSA 1SUPA 4X71A 5E9AA 4LGMA 1K86A 5IJAA 1IQ0A 4LJAA 2H8KA 1ZRMA 3I9V1 2COUA 1KOGA 3RFYA 3MBKA