3VM6A

Crystal structure of ribose-1,5-bisphosphate isomerase from thermococcus kodakarensis kod1 in complex with alpha-d-ribose-1,5-bisphosphate
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
321
structure length
321
Chain Sequence
AVVKEVLEIAEKIKNMEIRGAGKIARSAAYALQLQAEKSKATNVDEFWKEMKQAAKILFETRPTAVSLPNALRYVMHRGKIAYSSGADLEQLRFVIINAAKEFIHNSEKALERIGEFGAKRIEDGDVIMTHSHSKAAISVMKTAWEQGKDIKVIVTETRPKWQGKITAKELASYGIPVIYVVDSAARHYMKMTDKVVMGADSITVNGAVINKIGTALIALTAKEHRVWTMIAAETYKFHPETMLGQLVEIEMRDPTEVIPEDELKTWPKNIEVWNPAFDVTPPEYVDVIITERGIIPPYAAIDILREEFGWALKYTEPWED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic, ligand-dependent conformational change triggers reaction of ribose-1,5-bisphosphate isomerase from Thermococcus kodakarensis KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Isomerase
molecule keywords Translation initiation factor eIF-2B, delta subunit
total genus 112
structure length 321
sequence length 321
chains with identical sequence B, C
ec nomenclature ec 5.3.1.29: Ribose 1,5-bisphosphate isomerase.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 3vm6A01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3vm6A02
1T9KA 3VM6A 3A9CA 4LDQA 3A11A 1T5OA 3ECSA 5DBOA 1VB5A 1W2WB 2A0UA 4LDRA 4ZEOA 4ZEMA 2YVKA 2YRFA
chains in the Genus database with same CATH superfamily
2ZYWX 3PPYA 5SZJA 5B5SA 1XPUA 1I5OA 5KPJA 2W37A 3GDOA 4MTCA 1RXEA 4DV7B 3E9CA 4FDAA 3W1WA 5EHZA 4Q7QA 3RS2A 4FNGA 1B76A 3GFGA 4KC0A 1UKZA 4MYSA 3G85A 1XDBA 5FI1B 1I36A 2WFAA 5K2MA 5HOEA 5CPFA 4EUFA 1NLZA 5G3YA 4IQ4A 4JKYA 1EFVB 1K88A 1M1YA 3IB6A 4WJ0A 3DONA 5D7BA 1YSCA 1H6CA 4LPSA 4DCCA 4KL8S 4EW1A 4F5ZA 1PHPA 2DPHA 2HUPA 5BSHA 4MR8A 4BY9E 3JD2A 1C0PA 4QYXA 1YYJA 3ND6A 3ETDA 1ISSA 1BO6A 4PYMA 2ZU0C 1PO7A 1XVAA 3DOJA 3QSGA 4RSMA 4IIJA 2LQGA 1H2HA 4OB7A 5KQGA 3C3PA 3QY9A 3FPEA 5K3FB 3QP9A 1O97C 1WLSA 2AIRA 4HTFB 4WL0A 4Z4HA 5I8WA 1SUSA 5CCXA 1GL6A 2L6FA 4OI2A 5BN3B 3AMVA 1A7JA 2C4VA 1OUMA 3M6UA 1R00A 4RH1A 1WJGA 5CDUA 2R02A 4IKPA 1MC1A 1DDGA 4P8RA 5IEJA 2GDCA 1DC5A 3B12A 5TLSA 3LS2A 5DEOA 5FEMA 1AQUA 3H65A 1KI2A 4JL6A 5EERA 5L53A 3O5AA 3SVZA 4OH1A 1B26A 1NPYA 3JZ0A 4F1JA 4J0CA 5EIBC 1M1YB 2O7RA 5K8CA 1NBBA 1IB0A 1UF9A 1O1YA 1V6CA 2XWSA 4MWBA 3BAZA 4KN8A 1NMEA 3G1UA 4HZGA 1FDIA 2ZJ7A 5A5DA 4BNYA 1JLMA 4PJJA 1NXQA 4IDBA 2OORA 2HHAA 3H8SA 1QPUA 4UPEA 4L07A 3KLMX 4DCSA 2BDEA 5CA0F 4H0FA 2ATVA 1PEDA 1F14A 5ALUA 4XLNF 3G79A 4IIJF 4MNDA 4F04A 3DAHA 3UC5A 3EE6A 4EHFA 1DTSA 5JD6A 5DBFA 1F9EA 1GGEA 3E2PA 3MTGA 4GOXA 2AG6A 4TL8A 4KIFA 1N8NA 2XH8A 4LS3A 2RHWA 5I7UA 1DXHA 3TZLA 1TT5B 5FNVF 1RADA 2QROA 3ZV6A 3B20A 2XAUA 3MG9A 1W94A 3GD7A 5E7IA 3R7WA 3IP8A 1QQ6A 1CV2A 3W2TA 4DAOA 1H2BA 3VUEA 4E70A 1CG6A 2R85A 3T6BA 2Z1DA 3MF4A 4MTLA 4P5EA 1BKDR 4YQYA 2WWIA 1U3DA 2ZIXA 2ZIUB 3GUYA 3U16A 1BA2A 1W9MA 1ESCA 2ZKLA 4Q3EA 3MS7A 1TLFA 3UHAA 3KQOA 1E4EB 4Q5IA 3KPHA 3TQQA 3NIBA 3QXCA 1PEYA 5FXMA 2VDUE 1R6TA 2V8BA 2JK0A 2PL3A 3G7SA 1F5SA 1OLXB 3HL4A 1UADA 2IITA 3SKYA 1QHSA 2PNFA 1RMVA 4MYTA 4ZXFA 1D5WA 1OC2A 3HEAA 4PM4A 2AC7A 1UL1X 5MN5A 3T5BA 4L6RA 4TL9A 4RVUA 4NTFA 2E1PA 1R1DA 3PNOA 2CMKA 2BV3A 1RWKA 3C24A 2J30A 4FMDB 4G4SO 4WKOA 3ASVA 5K4GA 1WVIA 5JRDS 1QWSA 2NTEA 4KXUA 3RW0A 3COWA 4KQMA 3WO1A 4GSLA 4B7XA 4F85A 2FZ4A 4MW3A 1A1SA 1UT8A 2I2BA 1EJ0A 3EZLA 3LYLA 3RD5A 5HKOA 3P2YA 2LR0A 4AMGA 4C3EA 4Q4LA 4UFNA 1JJBA 2PZEA 3DW3X 3WRWA 5E6UA 4G6ZA 2OK8A 3LOUA 5F2NA 1CRZA 3RF6A 5HJ5A 1SQ5A 4P58A 4M9XA 2XS1A 1FFSA 2P3LA 3VHXB 5COFA 1MB3A 1BE0A 4F2WA 2HRBA 2NMVA 4KWIA 2ZPAA 2FOXA 1TGYA 2GK6A 1RYHA 4GECA 5TXGA 2FP3A 2BGKA 4TLAA 2K4MA 1TMGE 3KT0A 1ZM4A 5FAKA 4GEKA 2UZ3A 4E12A 1C3OB 2PLRA 3TLAA 5G2OA 4YO8A 1U1CA 3VUFA 3W5UA 4IKEA 2YZNA 3UAGA 4MMXB 3NVMB 4LV8B 3TNDA 3M6IA 3BHJA 2F1JA 1LX6A 2LFFA 3F6BX 5FA5A 4Q4ZF 4QLOA 4CE6A 4CMAA 4EA9A 2XLBA 4CM4A 1JHUA 2OSBA 4KIUA 4R6XA 4LUCA 3G2PA 1M6TA 2WTXA 5F3RA 1EUDA 5FWXA 3UV3A 3BF8A 3SCZA 1EYZA 5L3QB 2I03A 3SOPA 1N5LA 3BWXA 3ILXA 5BV0A 3ZC4A 5C3MA 1ZI9A 2Q50A 2O7QA 2QTHA 4KACA 4RMGA 1Z6AA 1UMBA 1SC4A 3N7AA 4F3TA 2XTAA 3FNEA 4D4GA 2QORA 3A3YA 3O8QB 1Z6QA 3V8MA 3BTVA 1JEJA 4CM6A 1U2QA 3FCEA 3C43A 1UDRA 3OM1A 4PPYA 3AEKB 2B3TA 3WV5A 5DULA 5GVSA 1XRSB 4LDAA 3I5AA 1BQ3A 4WQMA 4XM0A 5AM1A 4C5CA 4FKBA 5CVUA 4JJFA 2DSTA 5KUTA 1CZHA 1P3DA 4JNCA 2XMPA 3THWA 2PL1A 1WXFA 1AVTA 1Y1LA 5KOHB 3JATB 4TT8A 5B2EA 1M66A 3HBAA 3RT7A 5BORA 2J5KA 1GPKA 1U2ZA 5E6RA 2ZCJA 4OLFA 2X1LA 1E8DA 5TMDA 1IRXA 4FMCF 3CKYA 1H1LA 1YS4A 3H97A 3T3GA 4O5OA 3TLXA 4L4XA 1EXNA 2HPHA 4MULA 2CNDA 3KZVA 1NX6A 2HRZA 2PGXA 3SZMA 3HR8A 4WFQA 1GAQA 4ZV9A 3VISA 2GFHA 4XAQA 2J4CA 4OIRF 1PWXA 2VLBA 3FW1A 4KIGA 4N0EA 3NYWA 4TKVB 3ROPA 2QZ4A 3LYUA 3V1TC 4E31A 5J5VA 4P53A 1BSVA 4ZP1A 3TTUA 3V5NA 3GNTA 4DA4A 3SQXA 3DF7A 4KXFB 4HDOB 1WVGA 3ZZMA 4FSDA 3ABZA 4F46A 5LXTA 4UM5A 2PUGA 3L8JA 4HQKA 1O96A 1HLGA 1Q6YA 2HBRA 2NSYA 1GITA 4NE2A 3P26A 1AHPA 2DB3A 2GCGA 3FZNA 4IEEA 1HFJA 2O8FA 3NT5A 5E4JA 2WWFA 4XJXA 2KE5A 2GF2A 3DZBA 4JJIA 4OOFA 1J07A 1YB2A 1JJFA 1KHHA 1KYWA 3JR7A 4FYWA 3ZPXA 5T4BA 1A9TA 3OT1B 3OWOA 1XJQA 2G3KA 2C9MA 2FPUA 2NZJA 4RY0A 3HM2A 2KSFA 4TYQA 5EIEA 1DOZA 3OY2A 1ODSA 2X19A 3QU4A 4DKXA 1Z28A 4MUNA 4CVNA 5JMWA 1USUA 1JLRA 1Q77A 3IAAA 5B1HA 3NMUF 4S0XA 4L8LA 5BQPA 1V1RA 1VLLA 2HFKA 3O39A 2MU1A 3DTYA 1DIAA 4R0MA 1KJJA 3NC0C 1ZGZA 2BTQB 5JD3A 1UQUA 3EDOA 5C8XA 1IATA 3HYRA 4TMTA 2VQ6A 3NJRA 4LSMA 5L4NA 2CJPA 5DYIA 5EE9A 3V1UA 5EWJA 1P2BA 1Q74A 1UAGA 1WIWA 3Q8WA 5CT5A 1BVHA 2HLDA 5DE3A 3Q8LA 1KARA 1NNSA 1ZXXA 3IBYA 4IDAA 2FUG6 4JYPA 4MGIR 3GN1A 2PKYX 3TBKA 2PUAA 1K7SN 1MORA 2XQFA 4BMXA 1JU9A 2C7VA 3HK2A 3PDUA 2L82A 3GUCA 4ND6A 2EEPA 2VFAA 3E2IA 4K87A 2WK1A 3VC1A 4F3RA 1YQTA 1X3SA 4JB8A 3IFSA 4O4LF 4REMA 1ADCA 2AWYA 4R9VA 1YIDA 3S7TA 4FN4A 4HWOA 2JGNA 3PCTA 4NFSA 3A9VA 4GEGA 1RABA 4QJ3A 4RBNA 1CFJA 1NUSA 1QAOA 2BFFB 4RJIA 5BYBA 3ELUA 4OK3A 4LV5B 2VRWA 3HI6A 4CUKA 2V59A 2IU4A 2XKAA 5DLJA 2R66A 4LX8A 1R8JA 3ZWNA 3DV0B 5IKXA 4X90A 3TRKA 4R1TA 4E4RA 2B69A 2J46A 5I3CA 1GKUB 3K16A 1P1IA 4ENQA 4K9KA 4TQ9A 4RTJA 4GLJA 3RS3A 1XPRA 5F23A 2RAVA 5IU6A 1EFPA 1RRGA 2HU2A 4CF3A 1QQ3A 1N0UA 3TG2A 1W8IA 1DCTA 3HKEA 4BJTA 1WDTA 1IHUA 2AX4A 2B37A 2R8PA 4O08A 5G4KB 1ARZA 4LRUA 5EFOA 4YDQA 2PKEA 1JS1X 3C6MA 2DWOA 4EFMA 2J0SA 3VSEA 2FW6A 3PNPA 5BO5A 4IRXA 4PZ9A 5IP5A 2COUA 2JFZA 3RAGA 1W19A 4H1HA 3FHOA 3G5MA 3JAWA 4Q3DA 2PLNA 4BWVA 2ADMA 4Q16A 3H11A 3DHEA 4ZYUA 2KBFA 3RC9A 3FVYA 4DLUA 4EY5A 1P1RA 1OKKD 1E1LA 1WHTB 1OW6A 3IHUA 1PJAA 3GLRA 2XOXA 4B2LA 1YVPA 3I6BA 4AG5A 2Y9MB 3CEPB 4P34A 5AW9A 5TJHA 5L7TA 1SBIA 5BQXA 1YK0A 3JRXA 2D0DA 3B3GA 4ARAA 2FCRA 2W5UA 4QFDA 5H82A 2WLSA 1DAIA 1G5QA 3QRWA 3NEJA 3NT4A 4L95C 1FYDA 3C3YA 3LFTA 3MGCA 3DTVD 5ALKA 1NP6A 2BKUA 4M0LA 1BU8A 5DPMA 1C1YA 1REQB 3LXXA 1JVSA 1XAJA 3OF2A 4TLBA 4DDVA 3TGLA 2OB1A 1RTKA 2QXTA 3CUKA 1EJ6A 3QYPA 4Z9YA 4BNZA 1FW6A 1DAFA 1HT1E 2FZWA 2Z0MA 4PZYA 3JYPA 4MA4A 4PU0A 3WLTA 5FLXA 4TYWA 2JFYA 3N8HA 4WK4B 3C6QA 4C9BA 2O5VA 2HCRA 2IV3A 1DLIA 4DY6A 1EM8B 2PKRA 1CWUA 5TMBA 2P68A 3W6NA 3DM5A 1RKXA 2AR7A 2J07A 3KK0A 3DYBA 3PT9A 2EGHA 4IXTA 4KE8A 2Q4RA 2II6A 3HR4A 4E3WA 2I2AA 4BQQA 1AN9A 2VXOA 4OVKA 3FTQA 1U9YA 5K99A 1RFLA 3AY7A 3RVBA 2WA2A 1P1FA 2BFEB 4XJTA 4ZRNA 4D26A 2O5CA 2C3PA 3ZZTA 2VWHA 4FEAA 2EWMA 1QHIA 3U31A 4ZYYA 3UW1A 2GETA 4H31A 1NW7A 4LCEA 5JASA 3M15A 3O10A 1VBFA 4BE4A 2IU6A 3A05A 4IQ0A 4TMXA 3WG9A 2MWQA 1J8VA 3RBAA 2XTZA 1EGMB 1JNXX 4KQFA 4I1SA 3V80A 1O94A 3VR6D 421PA 3F5QA 4A10A 4B6OA 5CTAA 2AZMA 2CFRA 2NZ8A 5JAQA 1VLVA 1J20A 4IDQA 221PA 4QDZA 1A9YA 3EZFA 2HK8A 3NHPA 3Q3EA 4LDPA 1JT2A 1QGED 1OF1A 4IIVA 4GI5A 1NU9C 3ZWXA 2CEKA 4KO4S 2QD5A 1KFBB 4Z86A 3F5MA 3NBUA 4HOYA 3UWDA 1YL6A 4X7RA 4AN4A 2OBLA 4P80A 4RV5A 3U5ZB 5L4SA 3UM9A 2A84A 4DCTA 4BO5A 2AE1A 3KKKA 3OECA 3WIDA 3DV2A 4CF6A 2GJ8A 4TYMA 4J9UE 1NF3A 1WL8A 1DWUA 2OESA 3Q72A 4EHIA 1LBSA 4QJBA 2PXXA 3NBKA 1AKYA 1MOQA 1LTKA 3AHIA 1PGOA 3QPWA 3TM5A 4RO0A 4BMCA 4N3CA 5AHXA 2HRQA 2VBFA 3EQ9A 4J1QA 4KRGA 1KP3A 1HOTA 1U99A 2JPDA 3LVQE 4JBHA 1FRFS 1OROA 5TEWA 4AJJA 4BU1A 3NBYC 1E2EA 4RW0A 3NXSA 4MHOA 1VIAA 2HSBA 1AUPA 4NTZA 3EXEA 3ZWPA 3V4ZA 5CAEA 4FOSA 1WHSB 4I55F 1DAGA 1AHIA 3GJ6A 4TMFA 3M6AA 4IV5A 3W2VA 5LQUA 3L41A 1BR4A 2GSDA 3ELWA 2F43B 3RVOA 2M32A 4EB3A 3EH1A 4B82A 1KSGA 1CUUA 2JLSA 2GEBA 3COPA 3DZIA 1QZ3A 2W4IA 1QANA 4RVNA 3WL7A 5JAOA 2MMCA 2X2EA 3FHLA 1CUWA 1OAAA 4PVDA 5LDDC 1KAGA 3K1AA 4QYWA 3PDMP 1KMHA 1QP0A 4G3XA 1OQCA 5THKA 2H1CA 5KNBA 5IVIA 1YR6A 1Z0ZA 3RGWS 5I9SA 4PJNA 1Z8HA 4DCNA 3WLSA 3TF5A 1R6DA 4ZYZA 1GTL1 4HFJA 3TDNA 1XHFA 2OYRA 2D5CA 4HTFA 1HEIA 2F8TA 3LCMA 5KINB 4BOYA 1M2OB 4ATNA 3LMKA 3LPCA 3CLHA 1B8OA 3GM2A 1ZRMA 1Y1QA 2ZB4A 1AF7A 4M7PA 3G2IA 1NA5A 2HSEA 3K2BA 1R6XA 4X93A 3ZJTA 2Q3FA 3HFSA 3PD0A 4F4UA 1UC8A 2WFMA 3DVQX 4B3CA 3U7EB 2GEUA 4KQKA 4GYKA 1WTCA 1CY8A 1Y5MA 1HLDA 2BTQA 3AC0A 4KH1A 4I3HA 2WYWA 1KNQA 5LQDA 2YIJA 3MRXA 1WP4A 3TKYA 1GT91 3WGZA 4JFAA 5KAPA 3ZWOA 1KO7A 1N2CB 1XCGB 1QQTA 5JH7B 1VG0B 2D7DA 5CAEB 3ZGVA 3WNBA 1COZA 4OF4A 3DCJA 4FGWA 3AEUA 5SY6A 4QU0A 4UBJA 1DE0A 3B0UX 1NQWA 2AG5A 2H8KA 5J2TF 4TMWA 4ESHA 1QGUA 3HGMA 4I7EA 3C3XA 2A2ZA 1EWTA 1MAAA 1CJMA 3MGGA 1IL0A 5HX7A 4NU0A 1IHOA 1KDZA 3EXIB 4J76A 2XLWA 2OGTA 3PT5A 2O14A 3JS5A 1RWBA 2PL9A 4AKHA 1K86A 3K0CC 2VP9A 1E60A 4XD2A 3T0IA 4BKPA 1R6VA 4RZQA 3K15A 4LJ6A 4L8YA 2QT9A 3PP8A 3VTZA 5ICCA 1E4YA 4Q1VA 2AF4C 4B6FA 4LQLA 3IT2A 5DBGA 1EE2A 2QG6A 3H1EA 1PR5A 1O94C 1GZ3A 2AYXA 2QX8A 4NPCA 5CA0B 2J08A 1BX3A 2AI3A 3V2GA 2RHTA 2NXCA 1YULA 1WCXA 4ER3A 1HNNA 1HGXA 1U0BB 1G2PA 3MT9A 4MUHA 1PVOA 1ULUA 5PNTA 3M2TA 2VDRB 4CDYA 2GDJA 1E7SA 2HMYB 3H5OA 4XDZA 2Y27A 4C20A 2CBZA 3MAAC 4WZAA 3WFZA 2YWAA 2Q1SA 3MUFA 3WXBA 3P1JA 1TAUA 1RLMA 1TZKA 3R41A 4OAQA 5JT4A 1MNQA 4UHEA 4URHA 5ALXA 3KALA 2BC9A 3FVRA 4ANJA 4MB0A 2GBLC 3KQKA 1XCPA 2QMOA 4PFSA 4OU4A 3U7RA 2F3UA 4JLNA 4DRXB 4EKGA 1UOEA 1ZJ6A 5KNDA 3FLAA 2QYSA 1KDOA 4S1WA 5ARDA 1L5YA 2R6HA 3EDMA 3REQA 5ADWA 1SHZA 2N47A 4HRVA 4KO1S 1FTSA 4NI5A 4NYMQ 1XU4A 4I08A 5EYPA 3WGYA 4Q9DA 4WOCA 4V39A 2ID4A 5IDQA 1F8YA 2JLRA 4QDOA 3M89A 4JUDX 4ZTBA 3ZVKA 2J3DA 2IPAB 2Y0EA 1GHTA 1IOWA 4WK0B 4BEWA 5JH7F 1HY3A 1NDQA 2FPPB 3BXHA 3QPUA 1SMYF 3ASOC 4KN6A 3CLTD 2L18A 2V4UA 4KLAA 4UDNA 4D9CA 3A6HA 4O33A 4XEVA 2EFCB 1YMQA 2P2ZA 3B85A 3CFYA 3EA4A 3M83A 3WISA 4ETIA 3WLOA 3GLGA 3MCTA 4WESB 4ZTZB 2H7XA 2XUIA 1HQKA 1H22A 1GKYA 1P6QA 1NPDA 3TDKA 1HE1C 3U3OA 5LR6A 2W6NA 1YC2A 3GFVA 5IUKC 4CDGA 3QW1A 1UMCB 2WFZA 2QRMA 2G09A 5IHPA 4LQCA 4MW9A 4BBJA 1OBCA 3QVLA 4GOLD 5EJMA 5FBZA 4MWGA 1DQPA 3Q12A 2GXSA 4L3VA 5DRYA 3C5VA 3OD5A 4QASA 5B7QA 3UMCA 5FJIA 1QO9A 3IDFA 3W2FA 2YL7A 3ZLTA 1KR5A 3KJNA 3PQ2A 5DTMA 2IS2A 1NVEA 2AN3A 4DLSA 1E86A 1GL7A 4XEKA 1U8CB 2HRDA 2PMCA 4RHXA 3JRTA 1NI5A 3TPCA 2CL5A 3LKVA 2P9YA 4MUFA 4TLCA 1A9XB 4G37A 1BW9A 1W4RA 4NYJQ 1PBTA 2V97A 2IZ0A 2XVAA 3U4CA 2ZUWA 3TJZA 3WLHA 1UJ5A 1R4MB 4MAFA 5ICFA 4EO9A 4EPRA 2XMZA 2F1OA 2MINB 4GPBA 4N12A 2HMQA 2C07A 3R5FA 1CR1A 4RJJA 2WJAA 1P39A 2MCFA 4L3OA 1Y8CA 3TG8A 3MYIA 1N9ZA 1P80A 3NCHA 5DVWA 4NMWA 4OJNA 4P0PB 1NN5A 5A3QA 3TINA 3WL4A 3KZ1E 4RCYA 3UPTA 1INLA 1RYYA 3GOHA 3PFBA 4P3XA 3W4IA 1KK0A 4YUZA 2J9XB 2B2XA 5FNVA 3T3IA 1ECPA 2Z4RA 2NYRA 2P6PA 1N8KA 1JMVA 1E6KA 3CX7A 3P2OA 5ALZA 4LNHA 2LD6A 4G9BA 1MHPA 4ENSA 4HNTA 5IULC 2CV1A 1ZS9A 2JFBA 4EKYA 3KKEA 4GC5A 1SBNE 3K1YA 4YN3A 1V3VA 1LFAA 2OAGA 5LYYA 1PF7E 1WU8A 4XTKA 5IDXA 2BSXA 1YYXA 1NUAA 3DPUA 1OOEA 2B5VA 4QGBA 4CKYA 4D4KA 5K0EA 1OFVA 1XEWY 2IPNA 2XNDD 2EC5A 1WMDA 2BGMA 2X13A 4MQEA 4AKIA 4LE1A 2N3ZA 1ZM2A 1XLTC 2ZVJA 4Q1BA 1T4CB 1GV0A 3ULKA 4I5DA 3OLZA 5EWJB 4QGSA 2L2QA 3NHLA 2Q2WA 4XOIA 2FSPA 3MMXA 1TAGA 2FMUA 1XA4A 3T1QA 4DW8A 2YVAA 5A0VA 1S3SA 1T8TA 1EWRA 1YZ3A 1M34A 2F7SA 1DL5A 1IOVA 2Q6LA 3DB1A 1NL3A 2NXEA 5FOXA 4LZWA 4LXUA 4YMUA 4L85A 4R1UA 4U2GA 1G21A 1ORYA 1FEZA 1F48A 2M98A 3G2KA 4EFKA 3ZWQA 3RUHA 1P5RA 2IXBA 3RDPA 5FFNA 2ZUBA 2EZ8A 3QIVA 4Z49A 5B57C 2NZWA 2ZAMA 1OB5A 2VRBA 2DHRA 1F8FA 2AOVA 3NTUA 5A03A 3GN2A 1GG8A 2GRJA 1MFZA 1FTWA 2J4FA 4K2AA 4JUBA 4RM3A 1WF6A 3H5VA 5SYMA 4C6TA 1M76A 1XIVA 4DCOA 2R97A 3O9MA 1Y3AA 2B34A 1IN5A 3I2JA 3OCCA 4CF7A 1RHUA 4PFOA 1TX4B 2J0UB 2OKGA 4ZA2A 4ZCIA 1FDRA 4GKVA 4M55A 3FMPB 2A1TS 1QR6A 4FOLA 1W581 1FQKA 4NNPA 4XDYA 4BHTA 4WUVA 3D8HA 3I9OA 3ZUPA 2KC3A 1N6PA 1SGWA 1XQ9A 3L6DA 1M0WA 4QAJA 3ZK8A 4EL5A 5GZ3A 1UK6A 3UO8B 3PTLA 1GIAA 4XWOA 3Q0TA 1Q0MA 1DARA 3IAEA 4KHPB 3CH6A 3ZDYB 4QL3A 2J9FA 2B0CA 1DQYA 4IMIB 5K1ZA 2H2FA 4KXYA 2PXCA 2D7JA 2JS7A 2RGYA 4WY5A 4D7AA 1G4AE 4G41A 4BJ6A 2ILTA 1NMZA 2QTFA 4LF4B 3AR9A 3OX2A 5KEIA 5K8UA 2REQB 3HO8A 2B25A 2BYTA 1OWLA 1WN0A 2XQGA 4I99A 3T7DA 4C0KA 3SYLA 2J0UA 3AUTA 3GJTA 3REGA 3ISTA 3QBDA 1Y4AE 4JEBA 3ZHZA 2HRCA 3G1WA 4M36A 3I32A 4XWTA 3QTHA 4KZKA 4MEJA 4QELA 4BNHA 4CQNA 5A2QA 1QAQA 3BRQA 4A1OA 5F9HA 2FUEA 5CLGA 3X1KA 5H4GA 3E35A 4Q47A 3KLPX 1XD9A 5I7OA 2CMGA 5TC4A 1Z45A 5B1SA 3KKZA 3QE2A 4RZHA 1WUJS 5KSYA 3OD1A 3N8IA 3SC4A 1P0FA 4I1OA 2Q1XA 3V8BA 2Y3GA 5IFLA 2DF8A 3ABLC 1E2QA 5ELLA 3IKMB 5EN4A 1L8LA 2SHKA 1XD8A 3EJNA 4JCZA 4BNUA 4F97A 2JJ1D 2Q07A 2WUFA 1XTBA 4OATA 5BR1A 4GEHA 1L4MA 2YDXA 3K5PA 2A8YA 2N42A 3TQOA 4KNVA 5G0VA 3T9EA 1OAOC 4BNNA 4DCJA 3CCFA 3B0PA 4RVGA 1IJKA 1YQ9A 2G04A 3SVLA 1W2WA 1D1QA 1WVMA 4UAUA 4FJ1A 2NO5A 4HDSB 3T54A 5JHHB 1I33A 2W2KB 3ANNA 5K6AA 3D31A 3P96A 3C3EA 3C70A 2WD8A 3JRMO 1MH1A 1U4SA 1H8ED 3NWBA 1GA1A 1XO1A 3I92A 1GVHA 4OQQA 3PD1A 4TS1A 5FR2A 4RTOA 1DUSA 1T0JB 1JQAA 2P0AA 2YN2A 3S2ZA 1IIRA 3NAZA 4NQFA 4IGIA 3H75A 3OICA 1G17A 2XYRA 4RDAA 1II8A 1KJ8A 1R5OA 3JARB 1WEHA 1JVNA 4FZRA 3F97A 3HDHA 3I0NA 4IFBA 5ECYA 3GCXA 4BTEA 4DXHA 4LOIA 3GLVA 5BPHA 4GICA 3UAZA 2AMLA 4FHGA 5ERXA 1I4DD 4HX5A 3QVJA 1H9AA 4MR7A 4PIPA 3TIIA 2F3RA 3AB8A 4HH1A 4BU0A 5CB6A 5IT0A 2YJNA 4M1OA 4O6VA 2Z56A 4UHJA 2R4QA 2ECKA 2XRYA 3FOBA 4PN7A 2I33A 5AHWA 1FK8A 1YOVA 4RACA 2TYSB 5AK3A 5KSPA 3CVXA 5E4YA 1YS7A 5AVOA 2PZ8A 1M2OA 1JW9B 3DDCA 5AK6A 3GUVA 2I54A 3ESBA 1BGVA 1OBHA 3UK2A 2DEUA 1HDZA 5AHRA 4LY0A 3A9WA 2G5GX 4AL4A 2R25B 3BGDA 2F1KA 1OV4A 1WAMA 1N9GA 3C8GD 1Z7BA 4RMHA 4ZQFA 3A1TA 4ILKA 1P73A 5E6RB 3FOPA 2B0JA 2W6MA 2HV8A 4A2QA 5A62A 1QK3A 3A3NA 3T7SA 5ADVA 2VJQA 1JHAA 3RWOA 1GTJ1 2CBGA 2X8AA 3JQQA 1NLMA 4GW3A 4MYRA 4REQB 4XCVA 3W5IA 3ZR4B 5JZSA 3O73A 2WB2A 1C30A 1QV7A 2WWHA 1NSTA 3MQFA 3K6BA 1TU0A 4RUKA 3U37A 4DKJA 4DBZA 3LOQA 5B53A 3R3HA 3VKVA 1HYHA 2IT1A 3KUCA 4RD4A 2AFIA 5F4BA 3JSEO 1K7YA 4URYR 4MRNA 2I34A 3GFBA 3FAZA 4IX1A 4OJKA 4R8RA 5EIHA 5C1PA 1QF6A 1WY5A 2HEGA 4IH4A 3GAZA 3DDWA 4Q82A 1MX5A 4ER7A 3HSKA 5JCXA 2AKEA 2GPBA 3CX3A 3U4AA 1F20A 2VCBA 4QOFA 3MJ4A 4URVR 3A1DA 3IAUA 3RFTA 1LZKA 2J9WA 2V5VA 4M1KA 4XIGS 4G5FA 4P3KA 4Z4CA 1S2OA 2XNHA 1G41A 1S4QA 4EB0A 1CDOA 2DBZA 1R64A 4U3JA 4XLTA 4WLEA 1EVLA 4XWYA 3TUJC 4AY3A 4DG8A 2QMQA 3SXKA 2WHRA 1HTWA 2VRCA 1G1MA 1H1TA 1YR3A 3HCFA 3KXPA 1L4HA 1QX4A 4KDEA 3N2LA 2PUJA 3AESA 4NEHB 3HS3A 1KOJA 2PRIA 3P2EA 4JBXA 3ZWVA 4BQNA 2UV8A 3X1OA 4L0MA 4MQMA 1WKVA 4AP6A 4BNFA 3OEOA 1NJFA 5IC5A 1XAGA 3L7JA 3HBLA 3W0LB 9MHTA 1M0SA 4CIVA 4FWBA 5AM0A 4IIXA 3S2GA 2MHRA 3B5EA 2CXUA 3EEOA 5BT8A 3BFPA 3ZEIA 2GZ2A 3L04A 4TWAA 1P0MA 3JYLA 1VG1A 5JLAA 5K20A 4Y2HA 5T4HA 4J8PA 3T9OA 1N2EA 2DHEA 4TYNA 2FEKA 3CZ5A 3VHLB 2CJWB 3VR5A 1R8YA 1IY8A 2W6ID 1SZDA 2JCGA 4E2ZA 3AIKA 3CPEA 1EQAA 2YUTA 4HN2A 3VA7A 3EDRA 5DBOA 4WADA 2Z95A 1JIVA 3U19A 1U0EA 2JFGA 1E3DA 2XQVA 2WQ6A 1DQNA 2JJ1A 4AAYA 4YJHA 2X2FA 4BKUA 4EI2A 3SMVA 1ULHA 1GTVA 3HU5A 4JQCA 4COKA 4G0VA 4N82A 2JRCA 2P1RA 2P6VA 4HQNA 4TYPA 1XZBA 1FB5A 3RASA 3ABKC 1MIHA 3GEMA 2OCXA 4DR4B 5LB4A 4E5KA 1DJMA 4IS2A 2YL3A 1R4AA 2FSIA 3GP5A 3WGQA 4RFSA 5DVZA 4ER6A 4GXTA 3DXYA 4XQ1A 3I9NA 3ZIBA 1BXZA 1E6MA 1TYCA 3K8QA 4J4TA 2A68F 1X2BA 2Q27A 3WDLA 5KNBD 2I2XB 2WAMA 1YR8A 3I5XA 2PSHA 3P0EA 3ZG6A 2HA6A 3DPIA 3AV0B 4DBLC 4MIKA 1NSYA 3EAQA 3DT6A 4G89A 2VP6A 3G68A 3RRMA 2EYQA 1QIIA 3V3TA 4D4XA 3BMNA 4D43A 2QDKA 2IZ6A 3NOXA 3OMXA 3R8CA 3UJ6A 5A1TA 1V3UA 1ZIXA 3FOAA 4KEAA 4IHQA 3DWGA 4KFTA 4B4KA 5JT1A 4FYHA 3CLTC 2FZLA 3LXMA 2WW8A 3T7EA 2JD3A 1HYEA 3SIRA 4FW9A 4N65A 4XX1A 1VSBA 3W9UA 2Z8ZA 3H3XA 4JJEA 3ZJVA 4Y2QA 2QGZA 2I78A 3QU5A 3OCYA 3CKLA 3PXDA 5A3JA 2JAHA 3U7FB 1OASA 4QZVA 1MJGM 2ECFA 3KPJA 3N58A 5EKUA 2NM0A 3DYIA 3M2PA 4B0OA 1FRNA 4OV6B 1W9HA 4UCFA 2CSXA 3D6AA 3BJRA 3H2ZA 4GZLA 4EP1A 4UEQA 2K2WA 3EJWA 3IOYA 2HWXA 3S1SA 4ZI7A 4CDAA 4UUNA 4BBAA 3MB5A 1G59A 2FFHA 2JARA 3RVQA 4Q4CA 2J32A 1ITZA 5DDIP 4V1CB 2IVZA 4Z4FA 1DBVO 2D7CA 3U60B 1UBEA 5A4AA 3G5UA 2RHJA 1HT0A 1AKQA 1N5IA 1OIVA 3HY6A 3PUVA 4O2AB 4TRMA 5E2QA 1T4GA 1M83A 2A5GA 1SBQA 2P9QA 2PUVA 4LMAA 4QNRA 5EKDA 1C02A 4M0DA 1WXIA 2Z57A 3QY0A 1G5ZA 5FO1A 3U6KA 3QKRB 1HFKA 2I1QA 1E7WA 2YHUA 3A6ZA 5K3DA 5FUMA 2EJTA 2L42A 1YA9A 1E2KA 2DB4A 1NN1A 1DCMA 1HORA 3HV2A 1GILA 4XIYA 5EXPA 3TAHA 5JEDA 2X2PA 1NVMB 4N03A 3MJDA 4N5NA 3B6IA 4WZBB 5ALJA 4YV0A 5A9SA 2OO7A 4FIZA 1GAWA 1M5UA 3W2HA 4LVCA 3TW0A 2XM0A 2VL7A 3ZWMA 1RPNA 2WPNA 3KWFA 4YRPA 4MHSA 2W8ZA 1W5FA 2VNHA 2N46A 4NK4A 1PK9A 4IDOA 4AI6A 2D5IA 2OM6A 5IANA 2ZREA 3N2YA 2R05A 4GZMA 3KSZO 4RMJA 3AQCA 1A76A 5KNBH 2H2WA 3A8TA 2MYSA 2Z6VA 4H4KC 3JYHA 1N2CA 3AR8A 4JOBA 4RWZA 3SF8A 2YKZA 4U1RA 2ACVA 2JHPA 2ZVQX 3D8UA 3E0QA 1EK5A 3JPYA 2VUSA 3PK0A 3K9BA 1T8RA 4R8MA 3CLUD 1ZHFA 3KPWA 3RAPR 4DC9A 4EOGA 3I9KA 1ABEA 4LJRA 5HQ3B 1JU3A 1F3OA 1D03A 4I4TA 1R4NA 4MS1A 3WLLA 1CDZA 1JQ5A 1PBNA 1NYTA 1SUAA 2FW1A 3SD7A 1ZUHA 3BKXA 5CGQB 5G40A 3HXQA 2Z1NA 4YNBA 3L0YA 2ZUDA 1J99A 1ZMTA 5JANA 3VKHA 2QS9A 2PM8A 3FYUB 1GQAA 4E5VA 4FFSA 1C3JA 4ROTA 1A04A 1AX9A 2EG9A 3LBNA 4HMQA 4UMEA 4YGXB 4RTKA 2IH2A 1P60A 4L5IA 4EA8A 3GJZA 3KJGA 3WK5A 4CR8A 1LE2A 4L0DA 1VKZA 3F6EX 1S3IA 1V9LA 2UDPA 1NM5C 1LJLA 4DCMA 1Z36A 3MPOA 3HBMA 3GK3A 5AM5A 4CKZA 1QTRA 1WABA 2EL9A 1R5NA 4JBLA 2O0JA 3FNRA 5JAPA 4KHZA 4GMXA 2GUGA 3OE7A 5B6JA 1CZKA 4IIHA 1GDTA 1U80A 4PGHA 1JE0A 1TYBE 4K9RA 2A0BA 3CE6A 2X14A 1ZUNB 3D0OA 2DR0A 4R2WA 4B40A 5BNZA 4H1UA 3UWOA 4H0CA 3I53A 4MP6A 2XVZA 1AGPA 1CF9A 4XWWA 3EFHA 3D2LA 1S2NA 4BNIA 5CXQA 3EX7C 1KFCB 4AJLA 5B3IA 1HG0A 5CB0A 4S04A 1BDIA 3OURA 5A0TA 1CBUA 5CA1A 5LQKA 1KC1A 3W2GA 3Q7GA 4WXEA 2PH7A 1IH8A 2NYVA 1EI7A 4EUKB 2CW0F 1OSNA 2VT2A 3EVNA 3EW7A 3N07A 4TV9B 4PSUA 3BD8A 4HR7A 4IMRA 3TXAA 4CKXA 2R4TA 1LBQA 4MKZA 1UANA 1J1IA 2C8VA 3JRWA 3LT1A 4PGAA 4UQPA 4D2IA 4F86A 2FE4A 1Z4MA 1I2AA 2M6RA 4YRCA 4B43A 4LY3A 1N2XA 1FCJA 3RJ5A 4MJXA 2CCGA 3E0XA 1GGMA 4Y2JA 4W6ZA 1IHDA 1BGXT 3LKDA 4GU5A 4MARA 4QVGA 1IEXA 4HLDA 2LPMA 1U7DA 4HGYA 3RYHB 4QEKA 5LYJA 2BFNA 3ZGYA 1Y8AA 3OLWA 1V7QA 1EAYA 5FAXA 2I4LA 1X14A 2Q4EA 3LHFA 5TY0A 5ER9A 3THRA 4XH9B 3EQZA 2AVNA 4DM7A 4GPEA 4ID3A 3SLRA 3SC3A 3AY3A 4CG0A 4ZC8A 3ZHQA 3RSFA 2OOSA 2WWTA 1F5NA 5EJGA 2HBYA 1Z37A 3QKRA 4GP6A 4WT7A 3D0RA 4X00A 1AXGA 1JEDA 4UUPA 3IA2A 4KPYA 3C8ZA 2ZTHA 3L6EA 4BP3A 3H0KA 1AB5A 4ZN6A 2HZ8A 4PHGA 4UU7A 1V39A 3IE1A 3D1LA 1W6RA 4BVJA 1WQ1R 1QYWA 1G9SA 1N1EA 1RYNA 3DHNA 1JX6A 3H8WA 3OZWA 4UATA 3TNYA 4F4HA 2GKOA 3KQYA 4ALKA 3D3WB 2DWUA 2EIKC 4PXSA 3DL7A 2PQMA 2Y66A 5L4LA 3I42A 1VPWA 2NSFA 2LE0A 1F3LA 4U00A 3GCGA 1VHTA 1VGQA 2QX4A 4QYIA 1NJ6A 1GGJA 3V6LA 3HG7A 3CEXA 4E32A 3SE0A 2KLBA 3DC7A 4WZAB 3WMRA 4M21A 4KQIA 3SZLA 4KXQA 1WPXA 3UAXA 2BZ1A 3OUTA 1PIWA 4RYDA 1R2QA 2PSSA 4RGVA 2ZBFA 3NYJA 3DNFA 1RKVA 2BHSA 3D6FA 4NAUA 3EB9A 4OU5A 1QVVA 3R7CA 1C3VA 1FMJA 1WW2A 2LCQA 2C7GA 3IUQA 4OLJA 4EARA 3ZE2B 5JNLA 2PX3A 1AS0A 1U9CA 3AHGA 3DCIA 4WY2A 1JEQA 3GBSA 4U6QA 3R4VA 4MKXA 4UCQA 1OW8A 3BGOS 2XEXA 3FPAA 3DAOA 2FEOA 5KHLB 3ZHOA 3QHPA 1JLSA 4QUHA 3TSOA 3FUXA 3BEHA 2B82A 2C04A 1NSFA 4UBNA 5GPGB 1T0UA 5IJ9A 5AGFA 1P33A 2GJKA 5KZMB 2A0XA 4QUEA 4HNSA 5A5GA 3AKYA 3DXFA 5HKLA 1E98A 3DDZX 2XLEA 1EJBA 2XIJA 4HVAA 3NHFA 4MRPA 4CF4A 1NTOA 2D8AA 2F64A 2Z08A 4ZALA 5BSEA 2ZT7A 3CEAA 1EB8A 3CSUA 3ENVA 3HXOA 1WV0A 1OZ0A 5HZGA 4PE5B 4QJ5A 1OIXA 2B5OA 4W4TA 4WJKB 4EBFA 2G6TA 2YJ3A 3P27A 4P82A 4EX6A 3FHJA 4JBWA 3RTDA 4CKBB 1E9RA 1G3MA 3L4BC 4BLSA 3HA5A 1IZ7A 1O58A 2QVGA 5C18A 1E79D 1NM5A 1I9CA 2QJOA 4YRLA 3ICWA 2O8CA 3E2MA 1V55C 4Z9BA 2BFMA 1YAHA 1BR1A 4DV4B 1QLJA 2H18A 1ETHA 5DOVA 3O9VA 1N34B 1DJLA 2OPHA 1SXJB 4M8LA 2DH6A 1JHYA 2C92A 2XAAA 1CSEE 5DI3A 3EVEA 4EUHA 4F2DA 5BR8B 5CCBA 3T1HB 3B6EA 3DP7A 2AWCA 3IBCA 1IZMA 1JHRA 1Y6ZA 2Q2VA 4ENPA 4RA9B 2P6NA 3JSZA 5B3LA 2XZPA 5CA1F 1KZ7B 2JGDA 1P61B 4YP7A 2CE7A 1QQAA 1JXQA 1VIYA 3AR2A 4I9GA 5A6VA 5FV4A 3KT8A 3QMVA 1EHCA 2XMBA 3OTOB 3D3KA 3RU9A 5AM2A 5LL6P 2RGDA 1GPH1 2B4AA 2G9UA 4K9DA 3SZRA 2UYOA 4L5JA 4MR7B 4QQNA 4DLZA 3VR0A 2X9VA 4FMDF 3P4UA 4DY4A 1PT7A 3KT6A 2AU5A 2HH9A 2VDMB 1Y82A 3A06A 3A1FA 1ZFNA 2EIXA 2A0UA 3LDGA 3E4CA 2Q1UA 4LVNA 5LMUB 2FP4B 3M3HA 1V1JA 2EL7A 2PGJA 3A1NA 4H7JA 1CY1A 4MUAA 4PBRA 3RRXA 3TQSA 1NBWB 2G82A 3BCRA 4E2WA 1C9KA 2R0QC 3EGVA 1PFKA 1UZMA 1W87A 4JA0A 3SC2A 4DIDA 2P9JA 2PGIA 3K0EA 1U3VA 3H5LA 4NZPA 1JQBA 1QAMA 2VH3A 2B4RO 4K28A 1JI0A 1Y1RA 4YLEA 3OLYA 1AZLA 3TTWA 1LNZA 1ZMBA 2GAQA 4FFVA 2I8BA 5T3TA 3H2SA 4BVEA 2JZOA 4CGYA 4FMPA 3E5MA 2OV8A 4JQZA 4P3YA 3C5CA 2R79A 3FLMA 3JZMA 4NV0A 4MTOA 3KZMA 4KKVA 3ROXA 3Q9NA 3IVRA 3EH2A 2GEJA 1GEEA 2GRUA 3EA5A 3FJYA 3RANA 2H1VA 2MR5A 3Q0IA 3SE7A 1YV9A 2GEKA 3B3QA 5DYWA 1IBCA 4TSFD 1YZKA 3R3ZA 3WK4A 4E88A 3QFSA 2XGJA 4OXKA 1EFRD 2M2IA 2YXLA 3LSYA 5IY5C 3NALA 3TX2A 2FPPA 3I30X 3GCZA 5DGIA 4CEJB 4M7OA 5DTRA 1P5ZB 1QVXA 1CT9A 2AOXA 3SEOA 4YMSA 1VDZA 4EYSA 2IEYA 4FHZA 3CJRA 5AIAA 3MLGA 2HSJA 3O84A 4JX9A 4IAOA 1K6JA 2Z5GA 1YTLA 2R7QA 2JGRA 4G0ZA 2ZE6A 1M72A 2XOKD 3BICA 1YA6A 1JI3A 2X9QA 1KAMA 2VAVA 1H4TA 1V35A 4YI3A 3TR5A 2RJ3A 3G9ZA 1N2IA 1HM5A 1U8EA 3U62A 2XLHA 4OTZA 2VHJA 3HLTA 4QU9A 1XQ1A 2RHHA 2O2EA 1TUEA 1COWD 1N1CA 4PF1A 3VHXA 5FH9A 2FSSA 2PMDA 4MPJA 4BN0A 4QLBA 3S8MA 5BRAA 2OBNA 1XTQA 4OLHA 1OXBA 1CJKC 1RPTA 4A1FA 1V74B 1ZUIA 1FPQA 1IHXA 2WSMA 2BFBB 4PYOA 4DBVO 3P8ZA 3GPLA 4OIFA 4V1CA 3FSEA 1SURA 1LDEA 4RGBA 3GY0A 4M7WA 2FPIB 4TX1A 5FIUA 1VHLA 3HZZA 4QU5A 3SXJA 1G8HA 1RWWA 4FE7A 2XZOA 1UPUA 5FWDA 4I6JA 3PNVA 2QRKA 4U9UA 5JAMA 4O4JA 1RQ2A 2LXNA 3R24A 5TPZD 1XXLA 2J3MA 1SQFA 4BN5A 4CM9D 3DOCA 3TTXA 3GLFA 2O1XA 1IPHA 1RI4A 4WRRA 2ZAGA 4LEIA 3ZZUA 1GRRA 4KH0A 3ETNA 1GYRA 2VQSA 4OIQF 3M79A 2EARA 2C5SA 3IA7A 5HRUA 1FA9A 2DFTA 2NO0A 3HR7A 3Q3VA 3KEOA 1TTQB 3AH8A 3RYFA 1ID8A 5CA0A 2VO1A 3UJHA 1KI6B 4YASA 2VTBB 2EF1A 2AHOA 1GPJA 3JD3A 3K9CA 2P9EA 2QPLA 2MYUA 4N3BA 2BSQA 2H59A 4XLLA 4BVBA 1U0JA 4KAFA 4C1NA 4KWTA 1V11A 1H23A 2HKIA 1QHGA 5LXTF 3SU8A 4XGRA 4C87A 1A8PA 4F9GA 2XB2A 3KOMA 1Q11A 2Q5IA 3TRFA 4RJTA 2O8BB 3HY4A 2GOYA 2RHDA 2H63A 3HP1A 2EBWA 2IPMA 1ZW6A 4TUYF 2PFGA 1QYDA 3PWKA 1H9BA 1BWRA 1PWZA 1QGDA 4HLQB 5DHRA 3HKCA 4MJLA 4AMYA 5CDTA 2I2DA 2FPSA 1FSFA 3BIFA 3QVKA 4ZYVA 4FWIB 4PRKA 5DX1A 3U4GA 4J0EA 1GG5A 2XZTA 3CPHA 4L0QA 3U3DA 3OPYA 1NG1A 1FFWA 2Y1CA 4EVSA 1Y6FA 4B3SB 4XTCS 4RVCA 2BR3A 2FGJA 1YQEA 3NBAA 4GLOA 1SBCA 4JOQA 4U2DA 1YI1A 3NWEA 3CVUA 4FWTA 1UWLA 3D6NB 2F3PA 3FDQA 1AOXA 4RIFA 4D79A 2I15A 5H16A 4HEHA 3U44A 3IILA 1XRRA 3HCAA 1VCHA 1LPPA 2AT1A 4YK7A 4Z2YA 2PBRA 2IZOA 2XDYA 3HCEA 3JWPA 3OUUA 4PC3A 4YMHA 3QKTA 1Z8DA 5BSUA 4G5SA 2RBGA 2YWCA 1NVUQ 3TEJA 1ZR2A 1C41A 2HIMA 4B33A 4NP6A 5E0KB 4JB3A 4L9RA 2CHQA 3N2NA 4BC0A 2V1UA 1AE1A 1TO2E 1LLQA 1YOBA 2FV8A 2J5BA 3KQLA 1YOVB 4Y9SA 3C1AA 3OQHA 2QLAA 2C96A 4XVUA 3WB2A 4W8GA 1IDOA 3W90A 2C7BA 3GJRA 5HM8A 4IIBA 5JSQA 2DR2A 3DA8A 4DCPA 4AURA 3AG2C 4DXAA 3LQFA 4QARA 4YS6A 3OE5A 4HT3B 3P9XA 3L43A 4OMUA 2ZWIA 4EECA 3OQIB 1LWNA 3IERA 5IF3A 2C7PA 3GDHA 5IYZA 5F73A 3X0DA 1OCRC 2QV0A 2GZ3A 3GLFE 1KRWA 4EPVA 1PD0A 4WK2B 2C77A 3AYXB 2IEZA 3K6JA 1I2BA 3C3DA 1PQYA 3C48A 2BGRA 3K4HA 4XEUA 5JRZA 3W06A 4J7XA 1Z7GA 2G80A 4QHSA 3KVOA 4OD0A 3GJ4A 3K0FA 4KUGA 4KXVA 3WYBA 4BMOB 2IW1A 4FYMA 4PRZA 1HV8A 4ALIA 5KTYA 3PNQA 4K03A 3N76A 4XEHA 3IQZA 2R6CA 3NC1C 2LD4A 3LW7A 1FE8A 4NMXB 5BWBA 2H1WA 1WTAA 2GERA 1JG2A 5EIOA 4CIAA 4BX8A 2F8SA 3EC1A 2V03A 4Q9IA 2QN1A 4YIKA 5E33A 5FV7A 3RVSA 4N3AA 3QOWA 3T06B 4ON9A 4LYAA 1RJ9A 2Y99A 3N8GA 1P2DA 1P62B 4JU9A 4YYZA 4JI8B 4BLWA 2AH5A 1TCAA 2UUOA 3QEBZ 3ZDBA 4FCCA 2YMLA 5JUWA 1G8XA 1NQ5A 1ZPDA 1GNPA 4KR7A 3TLGA 1O87A 5BPFA 5AW6A 5JAHA 4OJTA 4UOQA 4FILA 3EFOB 2G76A 2O0LA 3S44A 4WW0A 1C1XB 1CVRA 3GLIE 1P8JA 1G6OA 4DR7B 1DG3A 1M2GA 2CF5A 2VPYA 1ZOPA 3AY0A 3LPNA 4MS3A 3H6HA 4OHMA 5ARCA 5JQGB 1J0DA 4NXNB 5I7AA 1UZUA 4HX9A 4EHPA 4MJ3A 1FY2A 2IHUA 1PJLA 1JA1A 2G9ZA 1XD2A 2BMWA 3CX4A 1J2JA 3DLAA 3GGSA 3NGXA 4B3FX 5JY6A 1VHQA 5AW4A 1R8XA 1JJAA 5MFPA 3AVVA 2P2GA 4RSHA 2MSLA 5EIBD 1QLWA 1Q0RA 2WHPB 2PS3A 3M9LA 1HNWB 3L5KA 5DIZA 4G0PA 1RT9A 4M9UA 2HMUA 4G9GA 4Y2VA 1QG6A 3Q7SA 1OX4A 1I8TA 2VH5R 4DREA 1RI1A 2GB4A 4DLXA 1RJGA 5GOZA 4ZKDA 4LV6A 5LSAA 1HG1A 1E6CA 1T1JA 5SYNA 4XWKA 4DEYA 1NX9A 4Q39A 1UAYA 2AW3A 3SFZA 1Q95A 2DI3A 2ZJ3A 3MYYA 1MVOA 4L8VA 3FETA 4O79A 2HGSA 4J0HA 3T5TA 3UG6A 4DMUB 2QN6A 3HKDB 3AF5A 2GT1A 3H9GA 2H9AA 4KQ2A 1HQYE 4R8SA 4IUDS 2E5LB 1GPMA 2I7DA 5G1NA 3T1TA 3N6XA 1RRKA 2RGGA 2VPXA 3PDIA 3PL1A 2AMYA 2CDNA 2QL9A 4ZICA 1D0VA 1UJMA 1Z8NA 1MQSA 5TARA 5BV8A 1ZBDA 4RJLA 1EFTA 4X6UA 4E3ZA 2JBAA 7GPBA 3Q98A 2C9BA 4FBLA 4FESA 2Q6VA 2P3OA 3AG4C 4GYTA 1I4TD 1Q12A 3HZOA 2ZETA 4C7MA 4EQ6A 3OZDA 5F28E 4X1YA 3NP9A 2QP3A 1SUDA 3UHFA 3VKUA 1T8WA 1JEYB 3F74A 2OD7A 1NXOA 2X0CA 1KIAA 1UT6A 1Y7TA 2Z83A 2O9XA 3GELA 1KAQA 3NIWA 4G5RA 4M4SA 2JH3A 1R16A 2XA2A 1Y6RA 3CUVA 1A69A 4CM4B 5M04A 2M1XA 2JH8A 1EMDA 4MV5A 3I1JA 3ESDA 5IXJA 2ZJ8A 3LUBA 3RTAA 1ISGA 3WA6A 1OXSC 2GLTA 4RX1A 4ZO9A 5CEJA 3STXA 4N6CA 1GNSA 1HOXA 4U63A 4R9NA 2R62A 4X3PA 1QQ7A 2D5BA 4PY2A 1R10A 4H1TA 4MRSA 1BX0A 3FF1A 4K46A 1X86B 4PCVA 4CPDA 1NASA 4JYMA 2BJHA 2OOKA 4L2IB 3FCCA 2X3YA 2XGSA 3UFXA 3ZLJA 4AU1A 2PEYA 5CI8A 2JCBA 3CZCA 2I3ZA 4DTIA 4J4BA 5ANRB 2Z1MA 4BG0A 3LC7O 4CBEA 1XCJA 3NOQA 2O2CA 1E9SA 1YGYA 4GBMA 3LDFA 4KFSA 1YKFA 2V7PA 3DD5A 1QRDA 2A92A 5DGCA 4DVGA 2PR2A 4E94A 1XTKA 5FOWA 4MVJM 3S68A 1X9HA 1RD4A 2NN3C 1FNSA 2FMKA 5EZYB 2V9CA 3RJ9A 1JRAA 3TOZA 1RE0A 1S2MA 5SZHB 1UK7A 4YP1A 3ED5A 4A4DA 4DBQA 2XV1A 5HW0A 1C3EA 1PSDA 4G9EA 2HL6A 4DIBA 1TOAA 1J56A 5E0OA 1A3CA 5LQAA 2HFJA 1ICEA 4QRIA 1O54A 3QV1A 3A11A 1O3YA 4YT5A 1F12A 3CN7A 4M0PA 5JU6A 1KP2A 3MGAA 2YOFA 5CITA 3PCXA 4C7JA 1GTZA 4JI7B 2XF2A 4WV3A 1MO2A 1RFGE 3WODF 1NIPA 3LDHA 1P0CA 4TSRA 2VF5X 4R9UC 1MB9A 5C4MA 3DZCA 3AVUA 4R41A 1SG6A 1FFBA 3M4CA 3PQ5A 1EFAA 3UMYA 2R8BA 4O2BB 4PLFA 2O2YA 3ZCSA 3D3NA 3JASB 1UAAA 1QBGA 3UMKA 2D8MA 3V1NA 3BGVA 1R4ZA 3N59A 3CWQA 4X84A 4KITB 4NAHA 1W88B 3ZCUA 2PCLA 5DHQA 4B84A 3N2ZB 3KS9A 3AETA 1KTMA 1A88A 1YO6A 2Q3JA 1TT5A 1DU4A 2YYZA 1J33A 2QF7A 3JQDA 4J91A 5DSTA 2JIZA 4EMTA 4W82A 3NEYA 1PG2A 2F1RA 3GO4A 1WMEA 4F3KA 1XCOA 1RHRA 2CL7X 2HJRA 5ESWA 1P4JA 4RFLA 1SCIA 5CFQA 3I5QA 2JFXA 2QTCA 4OO3A 4YRSA 1T2EA 2YV1A 5I7FA 4LYFA 4YJDA 3U81A 4MQEB 1HC7A 1M6YA 1S8NA 1ODCA 3HCPA 1HSZA 3ZGXA 3L4KA 3KYIA 1QU2A 3HA7A 1L5NA 5LOVB 1VLSA 3HKBA 4DR2B 1GL3A 2EG5A 1MF7A 2PY6A 1SZIA 4O2LA 5EYPB 1CVLA 3S2IA 1XNQB 1YB5A 5BMVF 4ZDKA 1SXJC 4BX3A 4PICA 3OJOA 1SUIA 3PG5A 2KYRA 4YQFA 5COBA 2UUHA 5GJBA 5JECA 5K2OA 4UAVA 4HDRA 2VN8A 5FWAA 5JC8A 5I4BA 1PZHA 1ZINA 1VDMA 2GZMA 2V6GA 3D02A 3L8CA 4X62B 4M76B 2ZWMA 5FTNA 3WKBA 4RAQA 4HAUA 2DKOA 5HF5A 2OAQ1 3JSXA 5DSZA 3QSYA 2ZAOA 4NDAA 4TWJA 3NW9A 3SFVA 1CJVC 3OOEA 3M5PA 3O95A 3AXSA 2LCFA 2DLDA 1XVVA 4HQ6A 3QF4B 4PLGA 2EJWA 3EXHA 4PS0A 4ZAWA 3MJFA 1WKCA 5IKPA 1LDBA 2EW8A 1XQYA 4D0GA 2Q3DA 3H5IA 4ZDIA 1KPHA 1Y9ZA 1X9GA 1ZOSA 3D3WA 3M0EA 4H6XA 3ABRB 4CN8A 2WFLA 2ABWA 4LDQA 4IM7A 4GX0A 1SVIA 1NBME 3Q5GA 2WUVA 1FNMA 1P77A 3QGMA 3G49A 3AY6A 4ZEVA 4M63A 1T5SA 2PKQO 3EVBA 1FSGA 3IAS1 4RS4A 1KEPA 4CFSA 2VSOA 1NWCA 3NMJA 1LPMA 2P2SA 3D7RA 2QR2A 5A6KA 3AZPA 3K9HA 4J0KA 3ZQKA 1Z3CA 2XUKA 4Q9NA 3HYNA 5DHTA 2YCBA 3QUQA 3VPGA 1IUPA 4ENUA 1P72A 2HPZA 2NU7A 2QI9F 4ZD6A 2RHCA 2WWWA 5REQA 1NY6A 1XALA 3RTBA 1W25A 1CYDA 2V3CC 3UOAB 5FFMA 5JPIA 3BDIA 3B48A 4ZK2A 2TECE 4ZVMA 1WY7A 1I01A 1PJBA 1GPBA 2G63A 2Y8EA 2Z4SA 3NAQA 1Z47A 4WZBA 2KYHA 1GNVA 5ALQA 3H11B 3E5RA 4BB6A 1NP7A 1PX0A 4JYZA 4FR5A 5BQGA 1E3IA 4ZO4A 4FM9A 4Z9IA 3QMPA 4EGQA 4ZOLA 1PJ4A 3WWZA 5BXQC 3GJYA 3OPYI 1ONOA 1A9ZA 1WB4A 3KG2A 4X9XA 2VAXA 2NWQA 4WEQA 2BT4A 1JFVA 2VCHA 4C0LA 3R9WA 2M6KA 4ZU3A 1RWQA 1EEHA 2DT8A 1WUTA 4X6XA 3UY4A 2F8MA 3W1EA 4CSAA 3OESA 1NOKA 5A7FA 1N32B 2QZJA 3ITEA 1MO3A 1Z2DA 3LP5A 3WV4A 3R0XA 1RAFA 4FFOA 2E18A 4TV9A 3L1MA 2QXYA 2JHGA 3N8KA 2AJLI 4DM4A 4L9AA 3DLPX 2H29A 3PC6A 4DLNA 2IE8A 3DVRX 3KU4A 4GNKA 2ERCA 3D4LA 5C3UA 4L7VA 4URFA 3I61A 2P6OA 3PXUA 1PR0A 1QG4A 3RYCA 1FDTA 3CLRC 3M82A 3R9KA 4E17A 5ALIA 5HS6A 2CMDA 3DMHA 4MWOA 1ELOA 4C4XA 4Q9KA 1NBMA 2X8LA 2XYHA 3FUUA 1QGZA 5AMXA 5H70A 3A70A 5E7JA 2GN9A 3ANYB 2FP4A 4HWTA 2YNMD 3JWHA 2C58A 2G1KA 1P7ZA 2Q5JA 1ZSVA 3F6YA 3G2LA 4M1MA 5HMMA 1M5RA 4CV2A 3TIVA 2QXUA 1W52X 3FDJA 1GAJA 4YAUA 4N5IX 4GNRA 1NMXA 2PGLA 1XPJA 2Q00A 2C29D 2VZLA 1QH1A 1XL0A 3CCCA 3TLZA 2FF7A 3DDUA 2RHLA 4RXMA 4QREA 1WCYA 4A15A 2XCLA 2FKAA 1PDOA 4BFCA 2FW7A 2B9EA 2W42A 2R1TA 5KYXA 1YZTA 1L4FA 2HM7A 9LDTA 4DV0B 1TYDE 1V43A 2H4HA 1PZMA 4N4AA 4KO3S 4KOEC 3KYIB 1LX7A 4FD3A 3W7BA 5DTJA 4N48A 4EY6A 4U5DE 5DXAA 3QELB 2QSJA 5AW5A 3TSAA 4CIWA 1XFDA 1TNDA 4WACA 3RRBA 4K05A 1KZ9A 521PA 2ZR7A 1IK4A 5KWSA 2OKUA 4RIEA 3GFRA 1CTQA 3KUDA 1ES9A 3BYZA 4KZPA 2EJBA 2IPLA 3GXOA 4F7WA 1MA0A 2YASA 4JP1A 5EC8A 2P5TB 3O9ZA 3S2SA 2QSUA 3B70A 2A9RA 3T3EA 1TIBA 4IJ6A 3BJZA 2AFVA 4PPQA 3AJDA 1TM1E 4BNTA 1KAHA 3ZWYA 1FNCA 5EEHA 5JI2E 4AWXA 1UBNA 2OD2A 2P4EA 4KP7A 1JMWA 1D4ZA 2XUGA 4MB6A 2I1WA 3WQRA 4OUDA 1LPNA 3ZDQA 5DYYA 1C14A 1QYVA 5KYYA 3EXHC 2JBHA 4GRIA 1VBNA 3L05A 4C0QC 2GBCA 1EVEA 3DOIA 3OTWA 4G0NA 3HNLA 1VKNA 2Y2UA 3FYUC 3GORA 3OZEA 4H6VA 4EYGA 1JPUA 1RJDA 2PRSA 3NOVA 4UULA 5JNUA 4J3FA 1H8HA 3LQ2A 4CMHA 4V0ME 1L4UA 3F9RA 4XWAA 1J0AA 2FPWA 2WTBA 1OVGA 2HQRA 3CWZA 3KOWA 1YBFA 1EA8A 4ZLCA 3ACCA 1UQRA 4EYKA 5ER6A 4PZUA 3PDJA 2EFJA 3EXG1 2XXAB 1CY0A 1FP4B 2VHVA 4JEHA 2Q99A 3PLRA 1ZG3A 3IESA 4MW0A 4RADA 4E5PA 3UR3C 2C84A 1VCMA 1VJGA 2XL6A 1GGQA 2AGVA 3HRKA 3RUPA 3GROA 3NVKI 3Q9UA 3C45A 5TRTA 2A1DD 1HL7A 3F9IA 1YRAA 4QDUA 1ZXLA 3ILVA 3L7NA 4U7DA 5HUHA 4ENRA 3UOWA 2YWXA 4DDUA 2UUBB 2PUWA 1RZUA 3O38A 4Z3KA 5JZOA 4CL3A 3A27A 5CDYA 5CLJA 2NVBA 3QUTA 4MLCA 5COQA 1T5DX 2PVCA 1LGYA 3PC8C 5BQFA 4FGJA 1U2RA 1P7CA 3GA7A 4A23A 4QE3A 1PT9A 3RYLA 1OGYA 2R4UA 1G6KA 4OFWA 5BN5B 2LTAA 3NP7A 1D1AA 4NZZA 4BEJA 1PJ2A 3F3SA 3E1GA 2YYSA 3CPSA 1HE8B 3G2JA 3NU1A 2HCJB 3PI6A 4UAGA 3SKXA 2W7TA 4JJAA 4M7RA 1A8HA 1U0SY 2NQ8A 2ZTLA 1GQYA 3KYJB 1M73E 4Q00A 4RLFA 4AUKA 3ZHSA 4TQAA 4QFMA 3ZDFA 3FLBA 3FYCA 2CXNA 2E55A 1RWOA 2CKDA 2ES4A 3B51X 3OPNA 4GBGA 3VZRA 3IR7A 4YCLA 2PFSA 1ML3A 2XF8A 3CW9A 3LBIA 5CIQA 3AKCA 1I1NA 3J7AC 1F17A 3NKDA 1ULZA 2QG4A 3IMGA 2AKYA 4DFDA 4E5YA 3N3AC 3KB2A 3MT8A 4E15A 3N5CA 1BVYF 1NR1A 3MCWA 3CQ9A 2JEYA 4HUQB 4RQAA 2ZFUA 2BMEA 4X64B 1Q5PA 1SCUA 1SCNE 2J5XA 1DSSG 1QFSA 5ENDA 5NLLA 1ORHA 3W05A 3WJ7A 1RKEB 5BMVA 5TQ2A 4GOKA 3GJ8A 2QUBA 5IK2D 3AQBA 1H69A 2QVZX 4HGQA 5A4MS 3W5AA 2W22A 5CLIA 4JVSB 2IHJA 1P3Y1 3IQGX 3EVAA 4ZCLA 2C5HA 2BN4A 3COVA 3NFYA 2QZSA 4KSBA 5TQJA 3O6VA 2BKLA 3VI4B 1HDXA 5AI0A 5I51A 1EPUA 2FEAA 4X6LA 1D0SA 1Z2AA 2XGMA 1XLWA 2PX2A 3P0JA 1H65A 1I30A 2CLOB 2WJ4A 5EFZA 3WXMA 4UVDA 1R18A 2VF7A 8ATCA 2Q5OA 2IF2A 3RIMA 1U11A 2C97A 4II2A 4C0HA 1YBAA 4LLEA 1LBEA 2HWYA 1U31A 4O4HB 1ZOLA 4XDGA 4B3MB 4QBKA 1HUQA 4M1SA 4WH0A 3TULA 1K3UB 3PVSA 5EJ9A 4R3NA 5GZ1A 3AM1A 1QFYA 1YB4A 2V4ZA 3AI7A 4O2AF 4II3A 4XWGA 5T3WA 3IUYA 2GHIA 3LQYA 4HF7A 3TL2A 4IIDA 5H02A 2JAUA 3BRSA 4TVOA 4XIFA 3OZTA 3PXXA 1VG9B 3H5NA 3K0CA 3QPVA 1DUIA 3W6PA 5BVGA 4Y6PA 1M10A 1UWCA 5BSFA 1Q57A 3GHYA 3JD4A 3PTZA 4MITA 2YW2A 3G7UA 3V8NA 4CQMD 1V5EA 4YCSA 5FOQA 1A97A 3SDSA 2HIAA 1MTOA 5D00A 4BFYA 3G3EA 4QWWA 4FFRA 3DFMA 6Q21A 5JY1A 3SLKA 3L4JA 1I5RA 2GNAA 5CM2Z 4B3RB 4GP9A 1AKMA 2VJAA 3V00A 3UT6A 4Q0MA 5SZKB 1XU9A 2QSYA 3CLSC 3FYUA 3CLKA 5JS6A 3L1JA 1VKRA 1X74A 4DBLE 3L7MA 2JJ2A 3V4OA 4LI0A 1DX4A 2O59A 2R1VB 4Q9JA 5PGMA 3VVLA 2ATEA 2ZSUA 3T9CA 2QW0X 4KQCA 2Y4NA 1HLFA 2AUMA 2C8KA 3DF9A 3I8XA 4X1YB 1ZN9A 3IQHX 4A0HA 5A5EA 2WOOA 5TPWA 2WWGA 3ZTZA 2R3SA 2D2VA 4WVFA 1EWVA 5C35A 4C3DA 3M4NA 3MPUA 3E9YA 1JJVA 4G0OA 2OT3B 5C80A 2DYKA 1VRVA 3LRTA 2PZJA 3INYA 4RE5A 1SKYB 1AXRA 1JHVA 1Q0FA 4KYIB 2A67A 2NZVG 3CF2A 3KOXA 4X44A 2KB0A 1UZNA 1QC5B 3C5HA 2J9FB 4PNPA 4QOIA 5IAAA 2XB6A 621PA 3RQIA 4IG4A 3QEAZ 2HV9A 4CQMB 3TLJA 1ABFA 1V16A 3QLUA 4CDMA 2NTYC 4R84A 2ZXEA 4B09A 5HOQA 2I7CA 5HRCA 1LNQA 2WI8A 1GFSA 4YWJA 5ECGC 1KVQA 2R6FA 3NJ8A 1RSZA 2MINA 3PZRA 3LZDA 4PSKA 1KI1A 2YRWA 2J9GA 2C7RA 4KRYA 2XRMA 2Y0BA 1SMKA 2WPDD 3IVGA 2CXHA 1HE1A 4R2KA 4U8HA 4B45A 4B4OA 1UM9B 2H5LA 4ND1A 4E6EA 3I2IA 4FS8A 1SXHA 1ST3A 4DMGA 1ORIA 2C2XA 3A1EA 2EKBA 3RF3A 3HV0A 4G36A 4MUKA 3VO8A 5B2FA 2H9YA 4PHCA 2IF0A 3OKPA 4C7VA 4QBHA 2HJSA 3OFNA 4MVWA 3QWBA 3WQHA 1VKJA 2W2PA 4IEFB 3DWIA 1EFVA 2VZ0A 3HYCA 1QS0A 1PZFA 1Z4JA 1C4OA 2NU9A 3O4VA 2FWMX 2GJSA 5FUVA 1XZKA 1KMMA 2FNAA 3PYMA 3ENWA 4G1MB 4L75A 3AV3A 1CUIA 1UBSB 1UMDA 4G2TA 5IARA 4UEOA 4E30A 1EXMA 1WCV1 2C2ZA 3E3OA 4N8DA 1IG3A 1F51E 4XW2A 2DLNA 2R7XA 2WT9A 2Y1WA 1TUBA 5ALFA 5C1OA 5T57A 2E9SA 2GA9A 4LF9B 1F4PA 4P9NA 1N0IA 1Q3KA 4OP2A 3AFGA 4DSTA 3VJRA 1V2HE 2HDHA 3ZCXA 2ODPA 3FIJA 1YLMA 4KDCA 1VJTA 4I1RA 4EG4A 2GO7A 1XEWX 1NOIA 1DBRA 3OC6A 3BWYA 4J0DA 2GXQA 3V97A 2HA5A 3MFNA 4MV7A 3SC2B 3FH0A 3U3FA 2ZDQA 3FKSD 4CTKA 1CQIA 1F7VA 4C22A 3WOVA 4X20A 3W5SA 5KJ6A 2EPNA 1Z39A 3V1MA 1G20B 2YZMA 1QDEA 1JEYA 2JVJA 5IKMA 2AK3A 1JKJA 2R65A 3N2GA 1XRNA 3O4RA 4IGFA 1CJBA 2V8OA 4JS0A 2E6UX 4U2KA 5G02A 3T5GA 4BMZA 1DEKA 3BAFA 4BZPA 5IJZA 3EISA 4C3BA 2EGUA 2AI1A 2ILVA 5E1MA 3DFFA 1V8FA 2VRCD 2XB9A 4DNPA 1BKYA 1XLTA 3WLMA 1VA4A 5KWJA 1MC5A 3KR0A 1CYEA 5AKHA 4YJHB 3MINB 1LV8A 2VDWB 3A4VA 4J2TA 3EGXA 3C3MA 3KX2A 3CT6A 5AKXA 5TJ5E 3AHDA 2PN1A 2ZBQA 3MIIA 2IELA 4LPKA 2RSEB 2WM3A 2I99A 3JVVA 4K6FA 3P4YA 4R31A 4BP8A 2LNDA 5GVRA 2QN2A 4IV0A 5ALSA 4IARA 4YDSA 5A06A 4DL9A 1MOSA 2H0QA 3RUCA 1OJ7A 4EKNB 1YRWA 1N7JA 1WEKA 1IJEA 1YZLA 3A9TA 3QVOA 5LC1A 3R5HA 2HYIC 1C7ZA 1I13A 1K6IA 5LQSA 4DDMA 5JMTA 3K0AA 1Z68A 4KXWA 1RLTA 1W85A 4I66A 4YRNA 3BIXA 1GQ2A 5AESA 1TM3E 4QDLA 3BD7A 4IMJB 5ALRA 4KFCA 4ADSG 2VJBA 3M9WA 3W7AA 4DSUA 2FK7A 3B7GA 2CFOA 2I6GA 5CDFE 2DT5A 4V0OA 3A1WA 4L4SA 2J9YB 3QUSA 5I9IA 4G8BA 4DUPA 5BMVB 1JHQA 3CYFA 2YZGA 3IVCA 3GB9A 2XKBA 1FFYA 1RRFA 1RIFA 4OIPF 1XKTA 1QHHA 2R8XA 3BSYA 1O95C 2ZR0A 4M87A 1THGA 3HLZA 3FWHA 3ZVMA 3F78A 2R48A 4AJOA 2H16A 1TM5E 2ZIXB 3UF0A 2PPVA 2GKGA 1KYZA 4WI1A 5K03A 4UJ3A 4RV4A 4QOHA 4XB2A 2PZLA 2VCYA 4IGAA 1JR8A 1E9VA 3TEMA 4BJ6C 4QI0A 1BWQA 2ATXA 2OBXA 3AEUB 4B6EA 4CU2A 2QUAA 5EHQA 1ADYA 4I81A 4YMVA 2WMDA 3IEMA 1QPBA 4NFYA 1MGPA 3HUTA 4AUMA 2ZWVA 3DBLA 5M7EA 3QVTA 3IKTA 3NWJA 3T7IA 3IBTA 4QXPA 1L5GB 3QQPA 1XI2A 4B5KA 3MGBA 1NRJB 2UZ1A 3R40A 5SY4A 3LPDA 3WGMA 1HNXB 3RADC 1JWBB 2IEDA 1KJNA 1PS8A 1TM7E 4G81A 5H3HA 4D96A 1OFUX 2RAPA 2ORIA 3E3MA 2ZIEA 1R8SA 1QS0B 1JP7A 4UMDA 3S70A 1A8IA 5JFOA 3RQEA 1U2DC 1QO7A 1VLMA 3ECAA 3L8HA 3L8FA 4YRDA 2N0SA 3RS5A 1HMOA 4PR9A 3K0AB 3B1XA 3SZOA 5E6UB 3JALA 2ZI9A 4C76A 4PC1A 1T2UA 4IXDA 4U6NA 4HVLA 1JA0A 3QU2A 2IH5A 2GBFA 3BUSA 4UBLA 4HK4A 3HDTA 4TUYA 3V9PA 1QF9A 4Z8XA 3I0MA 1DLJA 2IHBA 4CX9A 1T0HB 2P40A 3OWHA 2XDQB 4WTOA 1DFGA 1OAOA 2P0YA 2P9HA 2VKTA 4GBJA 4H6PA 3EOBI 3S8YA 4IZIA 1RZRD 1VL6A 5DX0A 3ZBQA 1F1JA 1PHRA 2WHPA 1JYFA 5HQTA 5K6AC 1B16A 4NCAA 3T1NA 2V7VA 1QGOA 4DBRA 1DIBA 2ZTUA 3D6MA 4ZMBA 4XLPF 4HFMA 4NU5A 5ALEA 4QG3A 1HDEA 2UXCB 1KI4A 2ST1A 4E22A 1AM4D 3UCXA 1GSOA 3IVXA 4HN9A 1R4MA 4UEJA 1LM3B 1KNXA 5ALWA 1E66A 3FI0A 2FOLA 1AUXA 1XZGA 2AXPA 4TWZA 3UJDA 3WAQA 4IDCA 2L17A 2Y0CA 3N2GB 1ZSYA 3BL8A 5E9QA 2ONZA 4BLRA 1LW7A 3OZCA 4CMIB 5J2UA 4UU1A 4FR0A 1KIFA 4FGLA 1IN4A 4M9RA 2ECPA 2GAJA 1Y3FE 3JXEA 5J59A 4ENWA 5IT5A 5KYNA 4RV9A 1K1EA 2IYFA 2I4RA 4BE7B 4K8RB 5ALLA 1ZD9A 2IXOA 2XM4A 4YHBA 4AQYB 1N8TA 1WD5A 4UXIA 5IVHA 2QX9A 3WMFA 2Q4FA 1BD3A 4FKMA 1EUQA 1L6IA 1GG9A 1X19A 3E7DA 3JVUA 1EWQA 1UPXA 4HUJA 1LCIA 1UFRA 5JJCA 4OPMA 5CH3A 2W98A 3UB4A 3FB1A 1CUSA 4MCHA 1NDHA 1QWOA 1YZYA 5IABA 3PEYA 1JAYA 3AP2A 4XIJA 2BGUA 1F2TA 5JSHA 3ABOB 3GT3A 1NN3A 1R9NA 4JRZA 2ACEA 3LX4A 2WU3A 2LKDA 3GOQA 5DYGA 5EJIA 2HCFA 4TLDA 4JR0A 3VSCA 3J7TA 2J3HA 2O2DA 3DE3X 3ICPA 4IVNA 4YQEA 1I1OA 2VZ9A 2X58A 4PC6A 3LTNC 1J2EA 1YZVA 3G82C 4ZOLF 4I5IA 3GVIA 2AZ4A 2XDQA 5AYVA 1MQ9A 2ZSDA 1TU4A 2YHSA 3QPAA 3WHNA 3WNVA 2OHFA 2ZRAA 4HDRB 3PRKE 1FUKA 3E3AA 2RK4A 1Q92A 4KXLA 4NBRA 4EJMA 4S2EA 6CHYA 4N7MA 1XXHB 1NI4B 1WXXA 4RPGA 1C8VB 2AV6A 2XGGA 1X7YA 5JS5A 2VHTA 1TC1A 3AINA 2Q7XA 4YL0A 2PDAA 1GGFA 1O95A 2QIOA 5JJ5A 4ETWA 2F67A 2PBFA 1KZ4A 3QBJA 3OTIA 1AKTA 3KJFA 5INTA 3BZUA 4BJ1A 1R3UA 4FC7A 4K0RA 5FA8A 2Q6TA 3D5QA 1KMIY 3H19A 4EF4A 2FPGA 5J63A 4Y1FA 3CUUA 5CIYA 1NY5A 1QVZA 2J33A 3OEHA 2CBXA 1CD5A 4ZVVA 1OXBB 3LQ4A 4UM7A 3V3KA 3EEYA 2A7QA 1XD2B 4WKCA 3S28A 4ONSA 2ORED 3B3AA 3UMFA 2X0JA 5GONF 3LJBA 1EGHA 5FBRB 1U6KA 2YZ7A 2CL6X 4RQUA 4RL6A 1G5HA 1BXGB 4GL2A 1N5RA 1BMFD 4QG7A 2ZYHA 1N77A 1YD7A 3QVZA 1U2DA 1G7CA 1E4EA 2EZUA 4LNUB 1LKXA 4BNKA 4Q93A 2B61A 1HH4A 2GPYA 4J2HA 2XMQA 4H0NA 4KXNA 2BEVA 1Z23A 1Q19A 4LNAA 5SZIA 5BW5A 5IWCA 1L5ZA 2ZLBA 4RGQA 2OL4A 5D5QA 3QMKA 1J90A 2P3QA 2YXBA 3RHFA 1A9SA 2IL1A 3D6VA 3RVNA 4ZVKA 2P30A 1PWYE 1UBJS 1U7HA 3CH5A 2J1LA 4PQGA 5D1NA 2PGOA 1I4LD 4C43A 1DGQA 2GJ4A 3FTDA 3BHMA 4O4LA 3JY6A 5B58T 1JFFA 4DPLA 1D8AA 5EQDA 5K3SA 3MWDA 1GM5A 3CRZA 3OETA 3RW9A 4EEKA 3ZHVA 2X8JB 5JJLA 3EXFA 3AF6A 5P8WA 5GADl 3Q88A 2P8SA 4BBPA 3OQBA 4M0UA 5REQB 1TZJA 2YJTD 1EX9A 3D6TB 1EAMA 2DHQA 1CS0A 2G9VA 2H9IA 1U90A 3DTNA 3JWJA 3JWEA 4O4IF 4RK0A 1MJ5A 1T4CA 2XQJA 2NSGA 5TVGA 3UWPA 2WJJA 3V1LA 4A6DA 4AULA 1SPBS 4YRGA 4ID9A 1KI8A 2LVBA 1QRRA 2PV0A 3ADPA 3DYVA 1FJXA 1YC5A 2DC1A 3N0XA 4Z4EA 2O5RA 5CVVA 5GM2A 5DCLA 4KPEC 1KPGA 5B4VA 3SIPA 1A7EA 1WMFA 4LHEA 2CLKB 2Z58A 2GJAA 4QHYA 4AJ2A 1W49A 4K6KA 5JSFA 1GY8A 2D2XA 1JSXA 3PFHA 1WBBA 2A4MA 4YRZA 5JW6A 4YK5A 4ZC1A 5LWHA 2A5FA 2GD1O 4EKIA 1SQ0A 1MRNA 1O9HA 1Z4KA 1X39A 1BEUB 1RAIA 1USGA 1VOMA 2GXUA 2ISQA 3M6FA 4NZMA 5CM8B 2BZSA 5I9BA 5EZ5A 5IN4A 1MVLA 3GRRA 4QPDA 1LY1A 3GFPA 4DA0A 2GAOA 3JTLO 1VI2A 1IHPA 3N2EA 4AE4B 1K2WA 3D8NA 1G3UA 2M1ZA 1YZUA 3O2JA 1OJLA 3G6KA 2WYVA 5FQOA 1J00A 2F4NA 3UWSA 4FNOA 4JBYA 1FTGA 3FUWA 1KDTA 2BJVA 3GHHA 1UBHS 3QYFA 4RLSA 1CW2B 4ES6A 5JNVA 5ITZB 1FMCA 5GGYA 4BP9A 5DU2A 5KTMA 5D5HA 3GVHA 3PGLA 3RYHA 1WB5A 1TA0A 2BELA 2PSEA 1WHSA 4YAEA 3VNUA 4QUKA 1NTRA 1IDN1 2D3TA 1I3OA 4CNQA 5KWEA 4UDVA 1P75A 1W36B 5KC9A 3OTHA 3ICOA 1ESZA 5DI3B 1E9EA 4KE9A 4N0DA 5T8KC 2WIJA 2WUGA 3AIOA 4OGWA 2ONYA 2FEMA 2OCBA 3FAJA 1UP4A 2BVNA 1HQDA 4HRYA 1NKVA 4DVYP 3IDOA 4KN9S 5JYBA 1RRVA 3R75A 2Y3BA 1SUFA 2W6JA 1RKCA 3H1FA 5C52B 5EKSA 3TCXB 4OFZA 1LI5A 2PT7A 3G9UA 3F71A 3FD8A 3MAGA 3NH6A 5L8VA 1ZH8A 1ZMXA 3LLUA 4KTTE 1E2JA 2RGRA 1D1TA 2HHJA 1MPTA 3NHZA 1YHYA 3WYCA 4BFSA 1TVKA 3FBTA 3Q0EA 2H48A 1TFKB 1UFKA 4M0MA 4NK5A 2WA1A 2HJ3A 3G0DA 3SZGA 2QAGB 3OOWA 5E9AA 5LLDA 4HYQA 5D3MA 5C0OE 2W6ZA 1XE3A 1FC0A 3MM4A 2OUKA 4AECA 10MHA 1KVSA 5GP1A 5K3EA 3ZI4A 4C03A 1T0IA 3BRWA 3FMFA 4OQDA 3W8EA 4B3JA 4GMFA 1E32A 3KKBA 1CZUA 3DUFA 5KOJB 1E2LA 4UHHA 4HG2A 3PJRA 3KPVA 1XZEA 4DOMA 1U5BA 2FMXA 5CU7A 1K8XB 1V3QE 4ZCQA 1RLIA 5JCOC 4OXYA 2GK3A 2QMHA 3PIDA 3VU0A 4EJ6A 3E9ZA 5KPDA 1SRRA 3AF3A 2XXAA 5FCLA 3V4LA 2VKQA 2Z9CA 1G16A 4XXHA 4EJSC 1VPDA 2FH5B 3NT2A 2V58A 3CO0S 2BLLA 2J67A 2VCCA 3VZPA 2CK3D 4D3DA 1Y6JA 4Q6WA 4J3JA 3EQ8A 3I2YX 4TRJA 3UK7A 1GUYA 2ODNA 5TDHA 3W2EA 3KWLA 4D42A 4BKOA 1K4KA 3U8VA 1E5DA 1S05A 1T34A 2DPXA 1OVMA 3ZWIA 2PD6A 4KFRA 4QIHA 4RXUA 1ZISA 4HYTA 3OZFA 4EY8A 4D0RA 5FTKA 1FLVA 3K94A 4L9SA 5E2IA 1F2TB 4DVJA 4YPVA 2ID8A 3PFWO 3PHCA 4O3MA 4YJ3F 3CZ6A 2P77A 3LI2A 5DF1A 1QJ4A 5AW8A 3ZDLA 1XBTA 4JP8A 1TVKB 3CM0A 3E23A 4LJ4A 2BR5A 4Q7LA 1V96A 3QLVA 1G7SA 1C3LA 1ZM9A 3TJRA 2ZRBA 4P7FA 2X51A 1MEJA 1YQQA 3D8BA 1WKBA 4U2BA 3ND5A 1RQNA 3MCVA 2QUHA 4DV6B 3T3NA 1T5TA 4KO8A 1D2RA 1E2GA 1KDVA 5DX8A 3D6UA 3G8BA 2YJGA 2I55A 3CZ4A 3QW2A 4RKYA 5I8ZA 3PF9A 3UXEA 2VYVD 3PUZA 3S8EA 1QNFA 1KSFX 5KYVA 3JQAD 3AGTA 3BL5A 4NG5A 2MYTA 4M2LA 4I9HA 2E4AA 1LI7A 3EEBA 3UATA 2G83A 4BRUA 3A31A 1C3XA 2OZEA 2J6HA 2CZCA 4M86A 4OHCA 4YFVA 3SHVA 1W8DA 4C2TA 1FR0A 3T4RA 3AVYA 3BH6A 4MO9A 3MYFA 2R6AA 4PX3A 1S7ZA 5IDYA 1GZ5A 3EVZA 3N0WA 4DWJA 4MRMA 3EUWA 3JT1A 1Q1QA 3GF4A 3T9FA 2XODA 4FB5A 1ZONA 4LMRA 4FU0A 4YV2A 5AVSA 4WKNA 5K3OA 5H9WA 4RTPA 2VYNA 3TTTA 2GH1A 4TS3A 4F5WA 1B0ZA 2DGDA 2J3JA 3KUXA 4JX8A 3UJ7A 5JD4A 3P9NA 3S29A 3DBVO 5JTTA 2OLEA 5K0BA 4MQ9F 4IYJA 3GFQA 2ZT8A 3HQ4O 4RAOA 3W4YA 4DOZA 1OYVA 1GP2A 1G2QA 3QI2A 3WGJA 1FDOA 3E48A 3U7IA 2N1BA 1CC1S 5JNSA 2L9JA 2FRXA 3JQ7B 4UUAA 1T2AA 4AJ1A 1MT3A 1B1AA 2HZ7A 4DEVA 4DJFC 2ZQZA 1X8LA 2ZJBA 3ED1A 3I73A 1C2YA 1JLHA 3MWEA 2QQFA 3ZK7A 5IPFA 3QEKA 2J3EA 2R7RA 1XJWA 4P3PA 3HZHA 3ICCA 2O8DB 1Z22A 5JAIA 1PWEA 5BUQA 1ZD1A 1YFKA 4FHCA 1ZYRF 4JWTA 4PV7A 1NVAA 4XD7A 3WLJA 3T7CA 2LIPA 4ZEMA 3US6A 2EF0A 3U8PA 4O4LB 4TOIA 5C31A 1VGVA 3K0HA 1AU9A 2BMJA 1VSUA 5IX8A 3LNRA 3JZDA 5KYWB 3KVVA 4WMLA 1Z75A 4EM6A 3MA0A 1FFAA 4IIYA 4F8YA 1NJ5A 1Y4UA 1X92A 5AXAA 1CHNA 3BE5A 3IHLA 3NHMA 2C4MA 4UQOA 1DADA 3U3RA 2QLLA 4A7PA 1VLTA 3FDZB 2NSLA 5JCOA 1SIBE 1XYYA 1Z0JA 2GCIA 3SF8B 3KQUA 5J4LA 2DBYA 2HMZA 4GUDA 5K8JB 1ORJA 5K0TA 1FFCA 2ODQA 3C0KA 1PR1A 2IE0A 3OPVA 2OG1A 2AZTA 5G0SA 4JTDB 2GN1A 2DCUA 2QU7A 2AFRA 1E1RD 5ILGA 3V5ZA 4O0MA 3D5TA 1O0SA 1T91A