2J9VA

2 angstrom x-ray structure of the yeast escrt-i vps28 c-terminus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'HHHMFNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVRINKLSIGDTLTETQIRELLFDLELAYKSFYALLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 28
publication title Structural Insight Into the Escrt-I/-II Link and its Role in Mvb Trafficking.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1130 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2j9vA00
2G3KA 2J9UA 2J9WA 2J9VA
chains in the Genus database with same CATH superfamily
4KC9A 4KI2A 1FR0A 4NTAA 4AE4B 1ZVZA 2LK4A 3SYNA 2VCAA 4AE4A 5JVEA 3RW0A 1OR3A 3V7OA 3NYLA 4BJ1A 1VTMP 2C04A 1GQAA 3C8ZA 3M1CB 5AGFA 4I44A 2ICWG 2AP3A 4BJ5A 2CGEA 2EILC 2OJED 1OCCC 1FTSA 4J32B 3G50A 4DRJB 4AL0A 4G7HF 3KPHA 3LEOA 5JLIA 2YVKA 3TJ5A 2AU5A 4AL1A 1S7ZA 5BQIA 4PJNA 4G7ZF 2XLOA 3EHMA 1BR4A 1M56C 1OW6A 2HKVA 3QVYA 2GWWA 1RKEB 1ZHWA 3S9OA 2GA0A 1IW7F 1RKEA 2LQGA 3TULA 3ZTMA 1J8MF 1YZAA 4MTGA 4PJLA 4U5EE 1CGNA 2R7XA 3HKKA 1A7DA 4W8KA 3ATPA 3SXKA 4FWVA 4Q4ZF 3F47A 3T9OA 2KSFA 1ZU4A 1WASA 2HJ3A 2XSEA 4J30B 4XQ1A 2NUTB 3MX3A 2NUTA 4YT8A 2Q9BA 2CYDA 2LD6A 3AGTA 3SZRA 1VB5A 3DAGA 4O6YA 4XEVA 1YAUO 1LE4A 2WVOA 1VLSA 1D1CA 2QNLA 1YJGA 4N6HA 3SP1A 4O6NA 3AG1C 3HTKC 3LNMB 3AQBA 4GQHA 4MNDA 3S0XA 2Y3BA 1EA8A 1OKKD 4BJ6C 3LAYA 1NZEA 2EPLX 3I5PA 3NMKA 2WL8A 4OD5A 1T01A 2BE5F 2OOCA 3LS0A 1A0BA 3DAFA 3NMIA 4KNWA 4LERA 5CIVA 2HUJA 3L0IA 2J46A 4H54A 1S05A 1BZ4A 1VMAA 3RKOF 5A6KA 5K0IA 1OCOC 4B6IA 1D1AA 1LVKA 2P1AA 5E3AA 2G3KA 2Q7RA 3RQGA 1TWHA 1U0BB 2OEVA 3QMKA 2R7TA 4MVMA 1H7IA 3ECSA 2R7QA 3K1HA 4CDYA 4G7OF 2D5RB 1TFKB 1YVIA 3N0TA 4YL1A 5B3SC 1Q0DA 1Y4CA 2H8AA 2QE9A 3K1IC 4PFPA 3KH2A 3ZIBA 3GEEA 1T6UA 1DOWA 2W4MA 2R7SA 1I4YA 3T6GB 1H9TA 2PP4A 3G4ZA 1CPQA 4YWQA 3LS1A 1ZHXA 4DRIB 2KQ9A 4JC7A 4CSAC 1SF8A 2J7PA 1SZIA 4WABA 1Q0FA 3G4XA 3RYLA 3AG3C 3NG1A 3U9MA 1QZXA 3RFYA 4O7GA 4E18A 3Q7LA 2OG2A 4Z9HA 1K05A 2A0BA 1ZHYA 4MW8A 2YLGA 4MVSA 2A68F 2FGYA 1PV3A 3NYMA 4NQFA 2VH3A 1MMDA 4DJ9A 3U8VA 4QI2A 4G78A 4NCQA 2A69F 1NU7D 2VB6A 2Q9CA 3H65A 4BJ6A 4NC3A 3GWNA 3BRJA 4U5CE 2VCBA 1TWGA 1ZZPA 2L9JA 3E9VA 2H7VC 4HFFB 4N6CA 2CNWD 2YEVA 4MTOA 3EHNA 3K66A 1JR8A 5JRAA 1T9KA 1WTYA 1ZHTA 1V54C 1TKNA 1ZHZA 1Q0KA 2EIKC 2I15A 2PNOA 3KYJA 1YA9A 2L6GA 3Q6NA 4IAOA 2JD3A 4JJGA 5A6BA 1RKCA 3JTLO 3DMDA 2QLAA 1YYXA 5HSWA 4Z9IA 3ASNC 1E2XA 3K1IA 5A69A 3W8IA 1FFTC 5A6JA 1ORYA 3MBGA 2XL4A 3FAPB 4E7SA 3QTHA 3EZHA 3VAYA 3RQFA 4A2NB 3SNHA 3UNGC 4DRHB 4CSAA 1U89A 3LNRA 3JRTA 4P9TA 1Z7Qc 3UMKA 1G4US 3SEOA 2R7UA 2B0HA 3JSEO 2R7RA 2HSQA 3OEOA 5T3TA 2AWCA 3U3FA 2V26A 1VOMA 3DJNB 2FFHA 2PFDA 4YT5A 3OA1A 2KK1A 1TQGA 2NUPB 2EPOA 4CS8C 2R05A 2NUPA 5L0CA 1RJ9B 2P0NA 3QVZA 1M2VB 4UDVA 3R7CA 4XPXA 1M2VA 5KYWB 3EFOB 3ABKC 2Y69C 1KTMA 1PD1A 2HJMA 3DE9A 3EFOA 4HEAJ 5L3VA 5KYWA 2XS8A 1Z23A 3M4CA 3S90A 3JZ0A 2M4EA 4CDAA 1LS1A 1MNEA 256BA 3NRHA 4DOZA 2EINC 3WAQA 4MVQA 2HMZA 3C7JA 4DBQA 4BG0A 4YN0B 4EHPA 2ASRA 2PX3A 3CSKA 4A4AA 5B1AC 2X0CA 5KYUB 4YK5A 1H6GA 3B0UX 4CS9C 1EQ1A 2Q3TA 3NKDA 4U5GA 5KYUA 3GODA 1LM3B 1WGWA 2DB4A 4IAQA 1G4WR 3IHUA 3PCVA 5D92A 3SXMA 2FAPB 3M15A 5BQHA 4OIOF 1QPUA 3ZG1A 1W2WA 3V5YA 1F1MA 2Y3DA 2A0UA 3KMIA 3WG7C 1SYQA 3FDQA 2Y3GA 4IARA 2WZGA 3JYYA 4KBLA 3WODF 2IOQA 2GAQA 2L7AA 2XLEA 3AG2C 3JCUQ 1YLMA 3N24A 3EGXB 4EWCA 2XRHA 5HV9A 3UR3C 2NSFA 3HJCA 3EGXA 2YL7A 3S29A 3TOLA 4LLEA 2ZXOA 2HMQA 2IM8A 3KYIA 4GYTA 3FHDA 3JSZA 2E87A 1OCRC 3ZQYA 2LFDA 1MMGA 3LEVA 4CS8A 1JOGA 1N1CA 1O5HA 2AVKA 2XM0A 1Y6DA 4I1OB 4KNVA 3S84A 1RMVA 2MYSA 1MMNA 1E85A 4CJOA 4FAPB 2BL2A 5CI9A 4IGGA 1WATA 4PJMA 3B71A 3TK0A 1A7VA 1U6HA 2J8WA 1A7EA 1ZYRF 2JPUA 3ZQVA 2JX0A 5FCLA 1AEPA 1OXKA 2XXAB 3O6XA 3W2VA 2XXAA 2LIGA 3DM5A 5F5HA 3FOOA 3O39A 3HNJA 4AX2A 5L3QA 1FNTc 2UUIA 3AQCA 4N4WA 4ULWA 3Q6MA 3H2UA 1CGOA 2UUHA 4Q5SF 4CS9A 3PHF2 2DYSC 4JTCB 2LSEA 3EG9B 3U2MA 3WHNA 1HE1A 4JJFA 3K6BA 3EG9A 3O55A 1NG1A 2EPMX 2WVQA 2YQYA 1RXQA 2G62A 3IPMO 4XTKA 2OEXA 2R02A 3LUTB 1BBHA 4PK4A 2Y3HA 2CW0F 1APCA 2MHRA 1V4AA 3DJUB 4R32A 4U5BE 4DVYP 2V3CC 1NU9C 4JURI 5D91A 5EHHA 3FAJA 1I5NA 1CGME 3MFNA 3BEHA 1OXBA 5L0JA 1E86A 1J8YF 3B0VC 5EGYA 1D0ZA 3IQTA 3CAXA 3R2PA 4JZAA 5KYYB 1D1BA 1LS4A 2EPNA 1H9GA 1QVXA 3FOPA 5KYYA 1Z63A 2Q9AA 3EJNA 4JRZA 1AUEA 2J7PD 1LI7A 2YKZA 3VM6A 3IEEA 3NMJA 1PD0A 4YJWA 3HNIA 1D0XA 3C8GB 3W2WA 3C8GA 3IQ6A 1DOVA 4K0DA 3U8PA 2XLMA 2XLWA 3EZIA 4XWJA 1EKYA 1OW7A 2R7WA 2R03A 3EH2A 4U5HA 4U9EA 5L0GA 2Q4FA 5KYXB 4L6RA 5A6AA 4ZLDA 3NDBB 2YLDA 2ZD9A 5KYXA 2P61A 4LLCA 3TOMA 2L81A 2OKUA 4BJTA 3DWWA 2CNWA 2KC3A 4IJJA 5CI8A 3HNKA 3QW0A 1NFOA 4CDVA 4DBRA 4U9DA 5BQGA 2IXOA 3B9QA 3EGDA 2P6VA 3N2ZB 1M2OA 5EK0A 1M6TA 3W4YA 4C7OB 3IQCA 5JS5A 2ZXWC 1C03A 4C7OA 4YL0A 1HW2A 4PACA 4XLNF 4BPMA 5L0IA 2R7OA 3DM9B 3EH1A 3S28A 4PJJA 2OJQA 1LPEA 2X51A 3I4UA 4EKWA 1T6QA 2CCYA 3GWLA 4I3MA 3T4RA 4CIHA 4PR9A 1GM5A 2EPKX 5F28E 2NSGA 1HMOA 2Y39A 3L1MA 3MYFA 5DLJA 5A6BD 1V55C 2KW3C 1K04A 2DGJA 3PMRA 3T6BA 3PDMP 2M64A 4EBKA 4C3BA 4LDKA 2J0XA 2H7BA 2XL8A 2AWYA 3EQLF 2J9UA 2L6HA 3LLIA 5IY5C 1HY5A 4CJGA 4E0HA 1KNYA 1VLTA 2YHSA 1ORSC 3GANA 2NPUA 3TQOA 3X1OA 4OIQF 3TD7A 2R7VA 5F5FA 2IYLD 2YWAA 2YL3A 3AOUA 2IXNA 3DXJF 4NTFA 2YLIA 4D4NA 3AJMA 1MMAA 5E33A 2O9XA 3ABLC 4H4KC 3A9CA 1ZW3A 4NY3A 4WGZA 2ZXRA 3MYIA 1KU2A 1XZQA 4IB4A 5E3CA 3RVZA 2RD9A 3U9JA 4LDRA 4JKVA 5COFA 2ETSA 2HFIA 3K33A 2A6EF 3DI5A 2QY9A 1QSPA 1UFBA 2HZ8A 1M57C 2WVNA 2W45A 1T5OA 2XS1A 4MTFA 4F4BA 2VC9A 3HNLA 3SXZA 2EIMC 3UMHA 1VYKA 1GS9A 1SR2A 3O10A 2GDCA 5JT4A 5T3WA 3FMSA 3H2VA 3HLZA 4XPYA 2YZSA 3C62A 1JMWA 4D4XA 1E83A 1RCPA 4LACB 2CDQA 2F22A 4Q7CA 3POVA 4JVSA 1JPNA 5DQZA 1B68A 3U3BA 4RD9A 1O87A 3A11A 4HE8D 1WOLA 1R4TA 4IWBA 2KNHA 1WWPA 2WB7A 5GPGB 4OD4A 4U5FE 1LIHA 5L0HA 3VRCA 3U0CA 3RIPA 3GM2A 4OINF 2W9YA 1QQ3A 3AGUA 3ZWIA 4JCZA 5DQTA 3GEHA 4ER9A 5COGA 3ZVRA 4ANJA 1YA7O 5FZTA 5AC4A 4LDQA 3J06A 1VK5A 3FVYA 2VCCA 4DVZA 4JTAB 4JE9A 1NBBA 3U5SA 3K7DA 4K7BA 3UGOA 4GEHA 3ZC4A 3IQ5A 4FESA 1FMVA 1HMDA 3GORA 4CIPA 5JP7A 5T1DB 5B1BC 2NG1A 5COMA 2A1DD 4NTBA 4OIPF 2DI3A 1L7CA 1D0YA 3TJ6A 4E7ZA 1CPRA 2OU6A 1MQVA 2R9RB 2KYHA 1OKKA 2ZPAA 5BUOA 1QKRA 2L6FA 2J0WA 1YARO 4I1MA 4BEMJ 4MVOA 2OCCC 2WZFA 1FMWA 4IRUA 2YL1A 4MVZA 4N06A 4O6MA 3AG4C 2XL6A 4MS2A 1G5ZA 2Z15A 4Z9JA 1UG7A 1FAPB 4CBEA 3GM3A 3DKAA 2KGOA 1R5ID 2HS5A 2J9VA 4P6IC 4EBJA 3M79A 1BDJB 4HFKB 4RDAA 1OR2A 3EPVA 4BEJA 2J9WA 1ZU5A 2A6HF 4XEKA 1LKXA 2D4UA 3QW1A 2HV7A 2J45A 4U5DE 3S27A 4C3DA 4M63A 1LI5A 3E70C 3W8HA 3JRMO 1LE2A 1NSGB 1T6IA 1XWJA 1TWAA 2R25A 3JYHA 3NYJA 4QDLA 5DVWA 5E2QA 3VF0A 5KYNA 3MLGA 3ITFA 4YT4A 2VASA 3X2QC 4MQ9F 3LESA 3QZCA 1AVOB 1YDIA 1OQCA 2IXMA 1JRAA 4MW3A 4FX5A 1SMYF 3GEIA 1NLXA 4WGYA 5TJ5E 3LLKA 3L34A 4RBNA 3U2LA 3ZDLA 4ULVA 1C02A 4J7TA 2XLHA 4ZLCA 2XLVA 4MVRA 3UMIA 1Q0MA 1A41A 3OWTA 4JEBA 1TWCA 2DYRC 2XM4A 4EIYA 1YZCA 1OCZC 1G8XA 2G3VA 2YL0A 3DZAA 1E84A 2PF4E 3JT1A 2J9BA 3M4BA 3KL4A 4P9FA 4XPWA 3RVYA 2C03A 2MWQA 3ASOC 1ORJA 3CZ6A 4DXWA 4XLPF 3UGPA 2IXPA 3CQZA 4PFOA 5DS6A 1K40A 2YRFA 5AC5A 3EGDB 1Z3IX 4JTDB 3VYWA 3C63A 3C8GD 3ZSUA 4E0IA 1Q0GA 3KKBA 1GGQA 3US6A 5L0DA 2HSBA 2Q00A 3L8JA 4MVUA 5L0FA 1XZPA 3ABMC 2BC5A 2ZXPA 4JW1A 2KJGA 1V74B 2LP4A 5B3IA 2XLDA 1TFOB 3V5ZA 4BJ5C 1ST6A 3DD7A 3GM1A 3RF3A 4J7YA 4QI0A 2B0JA 1JAFA 2P7VA 2WZLA 4W8PA 4C3EA 4OIRF 1JPJA 1MNDA 4JEAA 4YL3A 4JIOA 3V5XA 4JCHA 3ZTZA 2H7OA 1HE9A 1Z5ZA 1L3PA 2GFHA 4G0HA 3T6JA 3C18A 1HW1A 2EIJC 2PX0A 4E17A 1BR1A 2QUPA 3L8IA 4K1OA 1BR2A 4CS7A 2I8BA 2TMVP 2IBFA 1OW8A 1EI7A 4EUKB 2HV6A 3CEXA 3F46A 3RH3A 5DS4A 4O79A 5JUAA 3NKEA 4EBBA 3I5QA 2W4BA 4XEFA 1Z6AA 5DS5A 3DE8A 3B0PA 3Q7GA 5JSLA 2LFFA 4X0RA 2OQMA 4YT2A 1NFNA 4WJ0A 2LCHA 3FXHA 1VYIA 2PBEA 1C17M 4CX9A 3SXYA 4AK9A 2RSEB 1WN0A 3B29A 1ZW2A 1TR2A 1YYJA 4ONSA 1PCXA 3RQEA 1I4ZA 1O3UA 2QTVA 1RJ9A 3LJBA 1FFHA 1IZMA 1QLEC
chains in the Genus database with same CATH topology
4KC9A 4KI2A 4AE4B 4AE4A 3V7OA 3NYLA 4BJ1A 2C04A 3M1CB 4I44A 4BJ5A 2CGEA 2EILC 1OCCC 1FTSA 4J32B 4G7HF 1S7ZA 4PJNA 4G7ZF 3EHMA 1BR4A 1M56C 1ZHWA 1IW7F 1J8MF 4U5EE 4PJLA 2R7XA 4W8KA 4FWVA 4Q4ZF 3F47A 1ZU4A 4J30B 2XSEA 2NUTB 3MX3A 2NUTA 4YT8A 2Q9BA 3SZRA 3DAGA 4O6YA 2WVOA 1D1CA 3SP1A 4O6NA 3AG1C 3HTKC 3AQBA 4MNDA 3S0XA 2Y3BA 1OKKD 4BJ6C 3LAYA 1NZEA 3I5PA 2WL8A 4OD5A 2BE5F 3LS0A 4KNWA 3DAFA 4LERA 3L0IA 2J46A 1VMAA 3RKOF 1OCOC 4B6IA 1D1AA 1LVKA 5E3AA 2G3KA 1TWHA 3QMKA 2R7TA 3ECSA 2R7QA 3K1HA 4G7OF 2D5RB 3N0TA 5B3SC 3K1IC 4PFPA 3KH2A 3ZIBA 2W4MA 2R7SA 2PP4A 4YWQA 3LS1A 1ZHXA 2KQ9A 4CSAC 1SF8A 2J7PA 1SZIA 3AG3C 3NG1A 1QZXA 3RFYA 4O7GA 3Q7LA 2OG2A 1ZHYA 2A68F 2FGYA 3NYMA 2VH3A 1MMDA 4QI2A 2A69F 1NU7D 2VB6A 2Q9CA 3H65A 4BJ6A 4U5CE 1TWGA 2L9JA 3E9VA 2H7VC 4HFFB 2CNWD 2YEVA 3EHNA 3K66A 1ZHTA 1V54C 1TKNA 1ZHZA 2EIKC 3SYNA 3Q6NA 4IAOA 2JD3A 4JJGA 3DMDA 5HSWA 3ASNC 3W8IA 1FFTC 2XL4A 4E7SA 3EZHA 3VAYA 4A2NB 3SNHA 3UNGC 4CSAA 3LNRA 3JRTA 3UMKA 3SEOA 2R7UA 2R7RA 3OEOA 5T3TA 2V26A 1VOMA 3DJNB 2FFHA 2PFDA 4YT5A 3OA1A 2NUPB 4CS8C 2NUPA 1RJ9B 1M2VB 1M2VA 5KYWB 3EFOB 3ABKC 2Y69C 1PD1A 5KYWA 3EFOA 4HEAJ 5L3VA 1Z23A 2M4EA 1LS1A 1MNEA 3NRHA 4DOZA 2EINC 4DBQA 4BG0A 4YN0B 2PX3A 3CSKA 5B1AC 5KYUB 3B0UX 4CS9C 2Q3TA 3NKDA 4U5GA 5KYUA 3GODA 1WGWA 5D92A 4OIOF 3ZG1A 1W2WA 3WG7C 2Y3DA 3KMIA 3FDQA 2Y3GA 2WZGA 4KBLA 3WODF 2IOQA 3AG2C 3JCUQ 3N24A 3EGXB 4EWCA 2XRHA 3UR3C 3HJCA 3EGXA 3S29A 4LLEA 2ZXOA 4GYTA 3FHDA 3JSZA 2E87A 1OCRC 4CS8A 3LEVA 1MMGA 1N1CA 1O5HA 4KNVA 4I1OB 2MYSA 1MMNA 5CI9A 4PJMA 1ZYRF 5FCLA 2XXAB 3O6XA 3W2VA 2XXAA 3DM5A 5L3QA 5F5HA 3O39A 4AX2A 3AQCA 4ULWA 3Q6MA 4Q5SF 4CS9A 3PHF2 2DYSC 2LSEA 3EG9B 4JJFA 3K6BA 3EG9A 1NG1A 2WVQA 2G62A 4XTKA 4PK4A 2Y3HA 2CW0F 4U5BE 4DVYP 3DJUB 2V3CC 1NU9C 4JURI 5D91A 5EHHA 3FAJA 1J8YF 3B0VC 5EGYA 1D0ZA 4JZAA 5KYYB 1D1BA 5KYYA 1Z63A 2Q9AA 3EJNA 2J7PD 3IEEA 4YJWA 1PD0A 3W2WA 1D0XA 4K0DA 3EZIA 4XWJA 2R7WA 3EH2A 4U5HA 5KYXB 4ZLDA 3NDBB 5KYXA 4LLCA 2L81A 4BJTA 2CNWA 4IJJA 5CI8A 4DBRA 2IXOA 3B9QA 3EGDA 2P6VA 3N2ZB 1M2OA 4C7OB 2ZXWC 4C7OA 4XLNF 2R7OA 3DM9B 3EH1A 3S28A 4PJJA 2X51A 3I4UA 4I3MA 3T4RA 4CIHA 2Y39A 5DLJA 1V55C 2KW3C 2DGJA 3PMRA 3T6BA 4C3BA 2J0XA 2H7BA 3EQLF 2J9UA 3LLIA 5IY5C 2YHSA 3GANA 3X1OA 4OIQF 2R7VA 3TD7A 5F5FA 2IYLD 3DXJF 2IXNA 5E33A 1MMAA 2O9XA 3ABLC 4H4KC 4NY3A 5E3CA 3RYLA 2ZXRA 1KU2A 3K33A 2A6EF 2QY9A 1M57C 2WVNA 2W45A 4F4BA 3UMHA 2EIMC 1VYKA 5T3WA 3HLZA 2YZSA 4LACB 2CDQA 4Q7CA 3POVA 4JVSA 1JPNA 5DQZA 4RD9A 1O87A 4HE8D 4IWBA 2KNHA 2WB7A 4OD4A 4U5FE 3RIPA 4OINF 2W9YA 5DQTA 3ZVRA 4ANJA 1VK5A 3FVYA 4DVZA 3K7DA 4K7BA 3UGOA 4GEHA 3ZC4A 4FESA 1FMVA 5T1DB 5B1BC 2NG1A 2A1DD 4OIPF 1D0YA 4E7ZA 2ZPAA 1OKKA 5BUOA 2J0WA 4I1MA 2OCCC 2WZFA 1FMWA 4IRUA 4N06A 4O6MA 3AG4C 2Z15A 4CBEA 2KGOA 2J9VA 4P6IC 4HFKB 4RDAA 4BEJA 3EPVA 2J9WA 1ZU5A 2A6HF 1LKXA 4U5DE 3S27A 2HV7A 2J45A 4C3DA 4M63A 3E70C 3W8HA 3JYHA 1TWAA 3NYJA 4QDLA 5DVWA 5E2QA 5KYNA 3MLGA 3ITFA 4YT4A 2VASA 3X2QC 4MQ9F 3LESA 3QZCA 2IXMA 4FX5A 1SMYF 3LLKA 3L34A 4RBNA 4ZLCA 3UMIA 3OWTA 1TWCA 2DYRC 1OCZC 1G8XA 2G3VA 3DZAA 2PF4E 3JT1A 3KL4A 2C03A 2MWQA 3ASOC 3CZ6A 4XLPF 3UGPA 2IXPA 3CQZA 4PFOA 5DS6A 3EGDB 1Z3IX 3VYWA 3ZSUA 3KKBA 3ABMC 2ZXPA 4JW1A 2KJGA 4BJ5C 1ST6A 3DD7A 4QI0A 2B0JA 2P7VA 2WZLA 4C3EA 4OIRF 1JPJA 1MNDA 4JCHA 2H7OA 1Z5ZA 2GFHA 4G0HA 3T6JA 2EIJC 2PX0A 1BR1A 1BR2A 4CS7A 2I8BA 2HV6A 3F46A 3RH3A 5DS4A 4O79A 3NKEA 4EBBA 3I5QA 2W4BA 1Z6AA 5DS5A 3B0PA 3Q7GA 4X0RA 4YT2A 4WJ0A 1VYIA 4AK9A 1TR2A 1PCXA 2QTVA 1RJ9A 3LJBA 1FFHA 1IZMA 1QLEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3K A;  2J9U A;  2J9W A;  2J9V A; 
#chains in the Genus database with same CATH topology
 4KC9 A;  4KI2 A;  1FR0 A;  4NTA A;  4AE4 B;  1ZVZ A;  2LK4 A;  3SYN A;  2VCA A;  4AE4 A;  5JVE A;  3RW0 A;  1OR3 A;  3V7O A;  3NYL A;  4BJ1 A;  1VTM P;  2C04 A;  1GQA A;  3C8Z A;  3M1C B;  5AGF A;  4I44 A;  2ICW G;  2AP3 A;  4BJ5 A;  2CGE A;  2EIL C;  2OJE D;  1OCC C;  1FTS A;  4J32 B;  3G50 A;  4DRJ B;  4AL0 A;  4G7H F;  3KPH A;  3LEO A;  5JLI A;  2YVK A;  3TJ5 A;  2AU5 A;  4AL1 A;  1S7Z A;  5BQI A;  4PJN A;  4G7Z F;  2XLO A;  3EHM A;  1BR4 A;  1M56 C;  1OW6 A;  2HKV A;  3QVY A;  2GWW A;  1RKE B;  1ZHW A;  3S9O A;  2GA0 A;  1IW7 F;  1RKE A;  2LQG A;  3TUL A;  3ZTM A;  1J8M F;  1YZA A;  4MTG A;  4PJL A;  4U5E E;  1CGN A;  2R7X A;  3HKK A;  1A7D A;  4W8K A;  3ATP A;  3SXK A;  4FWV A;  4Q4Z F;  3F47 A;  3T9O A;  2KSF A;  1ZU4 A;  1WAS A;  2HJ3 A;  2XSE A;  4J30 B;  4XQ1 A;  2NUT B;  3MX3 A;  2NUT A;  4YT8 A;  2Q9B A;  2CYD A;  2LD6 A;  3AGT A;  3SZR A;  1VB5 A;  3DAG A;  4O6Y A;  4XEV A;  1YAU O;  1LE4 A;  2WVO A;  1VLS A;  1D1C A;  2QNL A;  1YJG A;  4N6H A;  3SP1 A;  4O6N A;  3AG1 C;  3HTK C;  3LNM B;  3AQB A;  4GQH A;  4MND A;  3S0X A;  2Y3B A;  1EA8 A;  1OKK D;  4BJ6 C;  3LAY A;  1NZE A;  2EPL X;  3I5P A;  3NMK A;  2WL8 A;  4OD5 A;  1T01 A;  2BE5 F;  2OOC A;  3LS0 A;  1A0B A;  3DAF A;  3NMI A;  4KNW A;  4LER A;  5CIV A;  2HUJ A;  3L0I A;  2J46 A;  4H54 A;  1S05 A;  1BZ4 A;  1VMA A;  3RKO F;  5A6K A;  5K0I A;  1OCO C;  4B6I A;  1D1A A;  1LVK A;  2P1A A;  5E3A A;  2G3K A;  2Q7R A;  3RQG A;  1TWH A;  1U0B B;  2OEV A;  3QMK A;  2R7T A;  4MVM A;  1H7I A;  3ECS A;  2R7Q A;  3K1H A;  4CDY A;  4G7O F;  2D5R B;  1TFK B;  1YVI A;  3N0T A;  4YL1 A;  5B3S C;  1Q0D A;  1Y4C A;  2H8A A;  2QE9 A;  3K1I C;  4PFP A;  3KH2 A;  3ZIB A;  3GEE A;  1T6U A;  1DOW A;  2W4M A;  2R7S A;  1I4Y A;  3T6G B;  1H9T A;  2PP4 A;  3G4Z A;  1CPQ A;  4YWQ A;  3LS1 A;  1ZHX A;  4DRI B;  2KQ9 A;  4JC7 A;  4CSA C;  1SF8 A;  2J7P A;  1SZI A;  4WAB A;  1Q0F A;  3G4X A;  3RYL A;  3AG3 C;  3NG1 A;  3U9M A;  1QZX A;  3RFY A;  4O7G A;  4E18 A;  3Q7L A;  2OG2 A;  4Z9H A;  1K05 A;  2A0B A;  1ZHY A;  4MW8 A;  2YLG A;  4MVS A;  2A68 F;  2FGY A;  1PV3 A;  3NYM A;  4NQF A;  2VH3 A;  1MMD A;  4DJ9 A;  3U8V A;  4QI2 A;  4G78 A;  4NCQ A;  2A69 F;  1NU7 D;  2VB6 A;  2Q9C A;  3H65 A;  4BJ6 A;  4NC3 A;  3GWN A;  3BRJ A;  4U5C E;  2VCB A;  1TWG A;  1ZZP A;  2L9J A;  3E9V A;  2H7V C;  4HFF B;  4N6C A;  2CNW D;  2YEV A;  4MTO A;  3EHN A;  3K66 A;  1JR8 A;  5JRA A;  1T9K A;  1WTY A;  1ZHT A;  1V54 C;  1TKN A;  1ZHZ A;  1Q0K A;  2EIK C;  2I15 A;  2PNO A;  3KYJ A;  1YA9 A;  2L6G A;  3Q6N A;  4IAO A;  2JD3 A;  4JJG A;  5A6B A;  1RKC A;  3JTL O;  3DMD A;  2QLA A;  1YYX A;  5HSW A;  4Z9I A;  3ASN C;  1E2X A;  3K1I A;  5A69 A;  3W8I A;  1FFT C;  5A6J A;  1ORY A;  3MBG A;  2XL4 A;  3FAP B;  4E7S A;  3QTH A;  3EZH A;  3VAY A;  3RQF A;  4A2N B;  3SNH A;  3UNG C;  4DRH B;  4CSA A;  1U89 A;  3LNR A;  3JRT A;  4P9T A;  1Z7Q c;  3UMK A;  1G4U S;  3SEO A;  2R7U A;  2B0H A;  3JSE O;  2R7R A;  2HSQ A;  3OEO A;  5T3T A;  2AWC A;  3U3F A;  2V26 A;  1VOM A;  3DJN B;  2FFH A;  2PFD A;  4YT5 A;  3OA1 A;  2KK1 A;  1TQG A;  2NUP B;  2EPO A;  4CS8 C;  2R05 A;  2NUP A;  5L0C A;  1RJ9 B;  2P0N A;  3QVZ A;  1M2V B;  4UDV A;  3R7C A;  4XPX A;  1M2V A;  5KYW B;  3EFO B;  3ABK C;  2Y69 C;  1KTM A;  1PD1 A;  2HJM A;  3DE9 A;  3EFO A;  4HEA J;  5L3V A;  5KYW A;  2XS8 A;  1Z23 A;  3M4C A;  3S90 A;  3JZ0 A;  2M4E A;  4CDA A;  1LS1 A;  1MNE A;  256B A;  3NRH A;  4DOZ A;  2EIN C;  3WAQ A;  4MVQ A;  2HMZ A;  3C7J A;  4DBQ A;  4BG0 A;  4YN0 B;  4EHP A;  2ASR A;  2PX3 A;  3CSK A;  4A4A A;  5B1A C;  2X0C A;  5KYU B;  4YK5 A;  1H6G A;  3B0U X;  4CS9 C;  1EQ1 A;  2Q3T A;  3NKD A;  4U5G A;  5KYU A;  3GOD A;  1LM3 B;  1WGW A;  2DB4 A;  4IAQ A;  1G4W R;  3IHU A;  3PCV A;  5D92 A;  3SXM A;  2FAP B;  3M15 A;  5BQH A;  4OIO F;  1QPU A;  3ZG1 A;  1W2W A;  3V5Y A;  1F1M A;  2Y3D A;  2A0U A;  3KMI A;  3WG7 C;  1SYQ A;  3FDQ A;  2Y3G A;  4IAR A;  2WZG A;  3JYY A;  4KBL A;  3WOD F;  2IOQ A;  2GAQ A;  2L7A A;  2XLE A;  3AG2 C;  3JCU Q;  1YLM A;  3N24 A;  3EGX B;  4EWC A;  2XRH A;  5HV9 A;  3UR3 C;  2NSF A;  3HJC A;  3EGX A;  2YL7 A;  3S29 A;  3TOL A;  4LLE A;  2ZXO A;  2HMQ A;  2IM8 A;  3KYI A;  4GYT A;  3FHD A;  3JSZ A;  2E87 A;  1OCR C;  3ZQY A;  2LFD A;  1MMG A;  3LEV A;  4CS8 A;  1JOG A;  1N1C A;  1O5H A;  2AVK A;  2XM0 A;  1Y6D A;  4I1O B;  4KNV A;  3S84 A;  1RMV A;  2MYS A;  1MMN A;  1E85 A;  4CJO A;  4FAP B;  2BL2 A;  5CI9 A;  4IGG A;  1WAT A;  4PJM A;  3B71 A;  3TK0 A;  1A7V A;  1U6H A;  2J8W A;  1A7E A;  1ZYR F;  2JPU A;  3ZQV A;  2JX0 A;  5FCL A;  1AEP A;  1OXK A;  2XXA B;  3O6X A;  3W2V A;  2XXA A;  2LIG A;  3DM5 A;  5F5H A;  3FOO A;  3O39 A;  3HNJ A;  4AX2 A;  5L3Q A;  1FNT c;  2UUI A;  3AQC A;  4N4W A;  4ULW A;  3Q6M A;  3H2U A;  1CGO A;  2UUH A;  4Q5S F;  4CS9 A;  3PHF 2;  2DYS C;  4JTC B;  2LSE A;  3EG9 B;  3U2M A;  3WHN A;  1HE1 A;  4JJF A;  3K6B A;  3EG9 A;  3O55 A;  1NG1 A;  2EPM X;  2WVQ A;  2YQY A;  1RXQ A;  2G62 A;  3IPM O;  4XTK A;  2OEX A;  2R02 A;  3LUT B;  1BBH A;  4PK4 A;  2Y3H A;  2CW0 F;  1APC A;  2MHR A;  1V4A A;  3DJU B;  4R32 A;  4U5B E;  4DVY P;  2V3C C;  1NU9 C;  4JUR I;  5D91 A;  5EHH A;  3FAJ A;  1I5N A;  1CGM E;  3MFN A;  3BEH A;  1OXB A;  5L0J A;  1E86 A;  1J8Y F;  3B0V C;  5EGY A;  1D0Z A;  3IQT A;  3CAX A;  3R2P A;  4JZA A;  5KYY B;  1D1B A;  1LS4 A;  2EPN A;  1H9G A;  1QVX A;  3FOP A;  5KYY A;  1Z63 A;  2Q9A A;  3EJN A;  4JRZ A;  1AUE A;  2J7P D;  1LI7 A;  2YKZ A;  3VM6 A;  3IEE A;  3NMJ A;  1PD0 A;  4YJW A;  3HNI A;  1D0X A;  3C8G B;  3W2W A;  3C8G A;  3IQ6 A;  1DOV A;  4K0D A;  3U8P A;  2XLM A;  2XLW A;  3EZI A;  4XWJ A;  1EKY A;  1OW7 A;  2R7W A;  2R03 A;  3EH2 A;  4U5H A;  4U9E A;  5L0G A;  2Q4F A;  5KYX B;  4L6R A;  5A6A A;  4ZLD A;  3NDB B;  2YLD A;  2ZD9 A;  5KYX A;  2P61 A;  4LLC A;  3TOM A;  2L81 A;  2OKU A;  4BJT A;  3DWW A;  2CNW A;  2KC3 A;  4IJJ A;  5CI8 A;  3HNK A;  3QW0 A;  1NFO A;  4CDV A;  4DBR A;  4U9D A;  5BQG A;  2IXO A;  3B9Q A;  3EGD A;  2P6V A;  3N2Z B;  1M2O A;  5EK0 A;  1M6T A;  3W4Y A;  4C7O B;  3IQC A;  5JS5 A;  2ZXW C;  1C03 A;  4C7O A;  4YL0 A;  1HW2 A;  4PAC A;  4XLN F;  4BPM A;  5L0I A;  2R7O A;  3DM9 B;  3EH1 A;  3S28 A;  4PJJ A;  2OJQ A;  1LPE A;  2X51 A;  3I4U A;  4EKW A;  1T6Q A;  2CCY A;  3GWL A;  4I3M A;  3T4R A;  4CIH A;  4PR9 A;  1GM5 A;  2EPK X;  5F28 E;  2NSG A;  1HMO A;  2Y39 A;  3L1M A;  3MYF A;  5DLJ A;  5A6B D;  1V55 C;  2KW3 C;  1K04 A;  2DGJ A;  3PMR A;  3T6B A;  3PDM P;  2M64 A;  4EBK A;  4C3B A;  4LDK A;  2J0X A;  2H7B A;  2XL8 A;  2AWY A;  3EQL F;  2J9U A;  2L6H A;  3LLI A;  5IY5 C;  1HY5 A;  4CJG A;  4E0H A;  1KNY A;  1VLT A;  2YHS A;  1ORS C;  3GAN A;  2NPU A;  3TQO A;  3X1O A;  4OIQ F;  3TD7 A;  2R7V A;  5F5F A;  2IYL D;  2YWA A;  2YL3 A;  3AOU A;  2IXN A;  3DXJ F;  4NTF A;  2YLI A;  4D4N A;  3AJM A;  1MMA A;  5E33 A;  2O9X A;  3ABL C;  4H4K C;  3A9C A;  1ZW3 A;  4NY3 A;  4WGZ A;  2ZXR A;  3MYI A;  1KU2 A;  1XZQ A;  4IB4 A;  5E3C A;  3RVZ A;  2RD9 A;  3U9J A;  4LDR A;  4JKV A;  5COF A;  2ETS A;  2HFI A;  3K33 A;  2A6E F;  3DI5 A;  2QY9 A;  1QSP A;  1UFB A;  2HZ8 A;  1M57 C;  2WVN A;  2W45 A;  1T5O A;  2XS1 A;  4MTF A;  4F4B A;  2VC9 A;  3HNL A;  3SXZ A;  2EIM C;  3UMH A;  1VYK A;  1GS9 A;  1SR2 A;  3O10 A;  2GDC A;  5JT4 A;  5T3W A;  3FMS A;  3H2V A;  3HLZ A;  4XPY A;  2YZS A;  3C62 A;  1JMW A;  4D4X A;  1E83 A;  1RCP A;  4LAC B;  2CDQ A;  2F22 A;  4Q7C A;  3POV A;  4JVS A;  1JPN A;  5DQZ A;  1B68 A;  3U3B A;  4RD9 A;  1O87 A;  3A11 A;  4HE8 D;  1WOL A;  1R4T A;  4IWB A;  2KNH A;  1WWP A;  2WB7 A;  5GPG B;  4OD4 A;  4U5F E;  1LIH A;  5L0H A;  3VRC A;  3U0C A;  3RIP A;  3GM2 A;  4OIN F;  2W9Y A;  1QQ3 A;  3AGU A;  3ZWI A;  4JCZ A;  5DQT A;  3GEH A;  4ER9 A;  5COG A;  3ZVR A;  4ANJ A;  1YA7 O;  5FZT A;  5AC4 A;  4LDQ A;  3J06 A;  1VK5 A;  3FVY A;  2VCC A;  4DVZ A;  4JTA B;  4JE9 A;  1NBB A;  3U5S A;  3K7D A;  4K7B A;  3UGO A;  4GEH A;  3ZC4 A;  3IQ5 A;  4FES A;  1FMV A;  1HMD A;  3GOR A;  4CIP A;  5JP7 A;  5T1D B;  5B1B C;  2NG1 A;  5COM A;  2A1D D;  4NTB A;  4OIP F;  2DI3 A;  1L7C A;  1D0Y A;  3TJ6 A;  4E7Z A;  1CPR A;  2OU6 A;  1MQV A;  2R9R B;  2KYH A;  1OKK A;  2ZPA A;  5BUO A;  1QKR A;  2L6F A;  2J0W A;  1YAR O;  4I1M A;  4BEM J;  4MVO A;  2OCC C;  2WZF A;  1FMW A;  4IRU A;  2YL1 A;  4MVZ A;  4N06 A;  4O6M A;  3AG4 C;  2XL6 A;  4MS2 A;  1G5Z A;  2Z15 A;  4Z9J A;  1UG7 A;  1FAP B;  4CBE A;  3GM3 A;  3DKA A;  2KGO A;  1R5I D;  2HS5 A;  2J9V A;  4P6I C;  4EBJ A;  3M79 A;  1BDJ B;  4HFK B;  4RDA A;  1OR2 A;  3EPV A;  4BEJ A;  2J9W A;  1ZU5 A;  2A6H F;  4XEK A;  1LKX A;  2D4U A;  3QW1 A;  2HV7 A;  2J45 A;  4U5D E;  3S27 A;  4C3D A;  4M63 A;  1LI5 A;  3E70 C;  3W8H A;  3JRM O;  1LE2 A;  1NSG B;  1T6I A;  1XWJ A;  1TWA A;  2R25 A;  3JYH A;  3NYJ A;  4QDL A;  5DVW A;  5E2Q A;  3VF0 A;  5KYN A;  3MLG A;  3ITF A;  4YT4 A;  2VAS A;  3X2Q C;  4MQ9 F;  3LES A;  3QZC A;  1AVO B;  1YDI A;  1OQC A;  2IXM A;  1JRA A;  4MW3 A;  4FX5 A;  1SMY F;  3GEI A;  1NLX A;  4WGY A;  5TJ5 E;  3LLK A;  3L34 A;  4RBN A;  3U2L A;  3ZDL A;  4ULV A;  1C02 A;  4J7T A;  2XLH A;  4ZLC A;  2XLV A;  4MVR A;  3UMI A;  1Q0M A;  1A41 A;  3OWT A;  4JEB A;  1TWC A;  2DYR C;  2XM4 A;  4EIY A;  1YZC A;  1OCZ C;  1G8X A;  2G3V A;  2YL0 A;  3DZA A;  1E84 A;  2PF4 E;  3JT1 A;  2J9B A;  3M4B A;  3KL4 A;  4P9F A;  4XPW A;  3RVY A;  2C03 A;  2MWQ A;  3ASO C;  1ORJ A;  3CZ6 A;  4DXW A;  4XLP F;  3UGP A;  2IXP A;  3CQZ A;  4PFO A;  5DS6 A;  1K40 A;  2YRF A;  5AC5 A;  3EGD B;  1Z3I X;  4JTD B;  3VYW A;  3C63 A;  3C8G D;  3ZSU A;  4E0I A;  1Q0G A;  3KKB A;  1GGQ A;  3US6 A;  5L0D A;  2HSB A;  2Q00 A;  3L8J A;  4MVU A;  5L0F A;  1XZP A;  3ABM C;  2BC5 A;  2ZXP A;  4JW1 A;  2KJG A;  1V74 B;  2LP4 A;  5B3I A;  2XLD A;  1TFO B;  3V5Z A;  4BJ5 C;  1ST6 A;  3DD7 A;  3GM1 A;  3RF3 A;  4J7Y A;  4QI0 A;  2B0J A;  1JAF A;  2P7V A;  2WZL A;  4W8P A;  4C3E A;  4OIR F;  1JPJ A;  1MND A;  4JEA A;  4YL3 A;  4JIO A;  3V5X A;  4JCH A;  3ZTZ A;  2H7O A;  1HE9 A;  1Z5Z A;  1L3P A;  2GFH A;  4G0H A;  3T6J A;  3C18 A;  1HW1 A;  2EIJ C;  2PX0 A;  4E17 A;  1BR1 A;  2QUP A;  3L8I A;  4K1O A;  1BR2 A;  4CS7 A;  2I8B A;  2TMV P;  2IBF A;  1OW8 A;  1EI7 A;  4EUK B;  2HV6 A;  3CEX A;  3F46 A;  3RH3 A;  5DS4 A;  4O79 A;  5JUA A;  3NKE A;  4EBB A;  3I5Q A;  2W4B A;  4XEF A;  1Z6A A;  5DS5 A;  3DE8 A;  3B0P A;  3Q7G A;  5JSL A;  2LFF A;  4X0R A;  2OQM A;  4YT2 A;  1NFN A;  4WJ0 A;  2LCH A;  3FXH A;  1VYI A;  2PBE A;  1C17 M;  4CX9 A;  3SXY A;  4AK9 A;  2RSE B;  1WN0 A;  3B29 A;  1ZW2 A;  1TR2 A;  1YYJ A;  4ONS A;  1PCX A;  3RQE A;  1I4Z A;  1O3U A;  2QTV A;  1RJ9 A;  3LJB A;  1FFH A;  1IZM A;  1QLE C; 
#chains in the Genus database with same CATH homology
 4KC9 A;  4KI2 A;  4AE4 B;  4AE4 A;  3V7O A;  3NYL A;  4BJ1 A;  2C04 A;  3M1C B;  4I44 A;  4BJ5 A;  2CGE A;  2EIL C;  1OCC C;  1FTS A;  4J32 B;  4G7H F;  1S7Z A;  4PJN A;  4G7Z F;  3EHM A;  1BR4 A;  1M56 C;  1ZHW A;  1IW7 F;  1J8M F;  4U5E E;  4PJL A;  2R7X A;  4W8K A;  4FWV A;  4Q4Z F;  3F47 A;  1ZU4 A;  4J30 B;  2XSE A;  2NUT B;  3MX3 A;  2NUT A;  4YT8 A;  2Q9B A;  3SZR A;  3DAG A;  4O6Y A;  2WVO A;  1D1C A;  3SP1 A;  4O6N A;  3AG1 C;  3HTK C;  3AQB A;  4MND A;  3S0X A;  2Y3B A;  1OKK D;  4BJ6 C;  3LAY A;  1NZE A;  3I5P A;  2WL8 A;  4OD5 A;  2BE5 F;  3LS0 A;  4KNW A;  3DAF A;  4LER A;  3L0I A;  2J46 A;  1VMA A;  3RKO F;  1OCO C;  4B6I A;  1D1A A;  1LVK A;  5E3A A;  2G3K A;  1TWH A;  3QMK A;  2R7T A;  3ECS A;  2R7Q A;  3K1H A;  4G7O F;  2D5R B;  3N0T A;  5B3S C;  3K1I C;  4PFP A;  3KH2 A;  3ZIB A;  2W4M A;  2R7S A;  2PP4 A;  4YWQ A;  3LS1 A;  1ZHX A;  2KQ9 A;  4CSA C;  1SF8 A;  2J7P A;  1SZI A;  3AG3 C;  3NG1 A;  1QZX A;  3RFY A;  4O7G A;  3Q7L A;  2OG2 A;  1ZHY A;  2A68 F;  2FGY A;  3NYM A;  2VH3 A;  1MMD A;  4QI2 A;  2A69 F;  1NU7 D;  2VB6 A;  2Q9C A;  3H65 A;  4BJ6 A;  4U5C E;  1TWG A;  2L9J A;  3E9V A;  2H7V C;  4HFF B;  2CNW D;  2YEV A;  3EHN A;  3K66 A;  1ZHT A;  1V54 C;  1TKN A;  1ZHZ A;  2EIK C;  3SYN A;  3Q6N A;  4IAO A;  2JD3 A;  4JJG A;  3DMD A;  5HSW A;  3ASN C;  3W8I A;  1FFT C;  2XL4 A;  4E7S A;  3EZH A;  3VAY A;  4A2N B;  3SNH A;  3UNG C;  4CSA A;  3LNR A;  3JRT A;  3UMK A;  3SEO A;  2R7U A;  2R7R A;  3OEO A;  5T3T A;  2V26 A;  1VOM A;  3DJN B;  2FFH A;  2PFD A;  4YT5 A;  3OA1 A;  2NUP B;  4CS8 C;  2NUP A;  1RJ9 B;  1M2V B;  1M2V A;  5KYW B;  3EFO B;  3ABK C;  2Y69 C;  1PD1 A;  5KYW A;  3EFO A;  4HEA J;  5L3V A;  1Z23 A;  2M4E A;  1LS1 A;  1MNE A;  3NRH A;  4DOZ A;  2EIN C;  4DBQ A;  4BG0 A;  4YN0 B;  2PX3 A;  3CSK A;  5B1A C;  5KYU B;  3B0U X;  4CS9 C;  2Q3T A;  3NKD A;  4U5G A;  5KYU A;  3GOD A;  1WGW A;  5D92 A;  4OIO F;  3ZG1 A;  1W2W A;  3WG7 C;  2Y3D A;  3KMI A;  3FDQ A;  2Y3G A;  2WZG A;  4KBL A;  3WOD F;  2IOQ A;  3AG2 C;  3JCU Q;  3N24 A;  3EGX B;  4EWC A;  2XRH A;  3UR3 C;  3HJC A;  3EGX A;  3S29 A;  4LLE A;  2ZXO A;  4GYT A;  3FHD A;  3JSZ A;  2E87 A;  1OCR C;  4CS8 A;  3LEV A;  1MMG A;  1N1C A;  1O5H A;  4KNV A;  4I1O B;  2MYS A;  1MMN A;  5CI9 A;  4PJM A;  1ZYR F;  5FCL A;  2XXA B;  3O6X A;  3W2V A;  2XXA A;  3DM5 A;  5L3Q A;  5F5H A;  3O39 A;  4AX2 A;  3AQC A;  4ULW A;  3Q6M A;  4Q5S F;  4CS9 A;  3PHF 2;  2DYS C;  2LSE A;  3EG9 B;  4JJF A;  3K6B A;  3EG9 A;  1NG1 A;  2WVQ A;  2G62 A;  4XTK A;  4PK4 A;  2Y3H A;  2CW0 F;  4U5B E;  4DVY P;  3DJU B;  2V3C C;  1NU9 C;  4JUR I;  5D91 A;  5EHH A;  3FAJ A;  1J8Y F;  3B0V C;  5EGY A;  1D0Z A;  4JZA A;  5KYY B;  1D1B A;  5KYY A;  1Z63 A;  2Q9A A;  3EJN A;  2J7P D;  3IEE A;  4YJW A;  1PD0 A;  3W2W A;  1D0X A;  4K0D A;  3EZI A;  4XWJ A;  2R7W A;  3EH2 A;  4U5H A;  5KYX B;  4ZLD A;  3NDB B;  5KYX A;  4LLC A;  2L81 A;  4BJT A;  2CNW A;  4IJJ A;  5CI8 A;  4DBR A;  2IXO A;  3B9Q A;  3EGD A;  2P6V A;  3N2Z B;  1M2O A;  4C7O B;  2ZXW C;  4C7O A;  4XLN F;  2R7O A;  3DM9 B;  3EH1 A;  3S28 A;  4PJJ A;  2X51 A;  3I4U A;  4I3M A;  3T4R A;  4CIH A;  2Y39 A;  5DLJ A;  1V55 C;  2KW3 C;  2DGJ A;  3PMR A;  3T6B A;  4C3B A;  2J0X A;  2H7B A;  3EQL F;  2J9U A;  3LLI A;  5IY5 C;  2YHS A;  3GAN A;  3X1O A;  4OIQ F;  2R7V A;  3TD7 A;  5F5F A;  2IYL D;  3DXJ F;  2IXN A;  5E33 A;  1MMA A;  2O9X A;  3ABL C;  4H4K C;  4NY3 A;  5E3C A;  3RYL A;  2ZXR A;  1KU2 A;  3K33 A;  2A6E F;  2QY9 A;  1M57 C;  2WVN A;  2W45 A;  4F4B A;  3UMH A;  2EIM C;  1VYK A;  5T3W A;  3HLZ A;  2YZS A;  4LAC B;  2CDQ A;  4Q7C A;  3POV A;  4JVS A;  1JPN A;  5DQZ A;  4RD9 A;  1O87 A;  4HE8 D;  4IWB A;  2KNH A;  2WB7 A;  4OD4 A;  4U5F E;  3RIP A;  4OIN F;  2W9Y A;  5DQT A;  3ZVR A;  4ANJ A;  1VK5 A;  3FVY A;  4DVZ A;  3K7D A;  4K7B A;  3UGO A;  4GEH A;  3ZC4 A;  4FES A;  1FMV A;  5T1D B;  5B1B C;  2NG1 A;  2A1D D;  4OIP F;  1D0Y A;  4E7Z A;  2ZPA A;  1OKK A;  5BUO A;  2J0W A;  4I1M A;  2OCC C;  2WZF A;  1FMW A;  4IRU A;  4N06 A;  4O6M A;  3AG4 C;  2Z15 A;  4CBE A;  2KGO A;  2J9V A;  4P6I C;  4HFK B;  4RDA A;  4BEJ A;  3EPV A;  2J9W A;  1ZU5 A;  2A6H F;  1LKX A;  4U5D E;  3S27 A;  2HV7 A;  2J45 A;  4C3D A;  4M63 A;  3E70 C;  3W8H A;  3JYH A;  1TWA A;  3NYJ A;  4QDL A;  5DVW A;  5E2Q A;  5KYN A;  3MLG A;  3ITF A;  4YT4 A;  2VAS A;  3X2Q C;  4MQ9 F;  3LES A;  3QZC A;  2IXM A;  4FX5 A;  1SMY F;  3LLK A;  3L34 A;  4RBN A;  4ZLC A;  3UMI A;  3OWT A;  1TWC A;  2DYR C;  1OCZ C;  1G8X A;  2G3V A;  3DZA A;  2PF4 E;  3JT1 A;  3KL4 A;  2C03 A;  2MWQ A;  3ASO C;  3CZ6 A;  4XLP F;  3UGP A;  2IXP A;  3CQZ A;  4PFO A;  5DS6 A;  3EGD B;  1Z3I X;  3VYW A;  3ZSU A;  3KKB A;  3ABM C;  2ZXP A;  4JW1 A;  2KJG A;  4BJ5 C;  1ST6 A;  3DD7 A;  4QI0 A;  2B0J A;  2P7V A;  2WZL A;  4C3E A;  4OIR F;  1JPJ A;  1MND A;  4JCH A;  2H7O A;  1Z5Z A;  2GFH A;  4G0H A;  3T6J A;  2EIJ C;  2PX0 A;  1BR1 A;  1BR2 A;  4CS7 A;  2I8B A;  2HV6 A;  3F46 A;  3RH3 A;  5DS4 A;  4O79 A;  3NKE A;  4EBB A;  3I5Q A;  2W4B A;  1Z6A A;  5DS5 A;  3B0P A;  3Q7G A;  4X0R A;  4YT2 A;  4WJ0 A;  1VYI A;  4AK9 A;  1TR2 A;  1PCX A;  2QTV A;  1RJ9 A;  3LJB A;  1FFH A;  1IZM A;  1QLE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...