2J9VA

2 angstrom x-ray structure of the yeast escrt-i vps28 c-terminus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
HHHMFNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVRINKLSIGDTLTETQIRELLFDLELAYKSFYALLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 28
publication title Structural Insight Into the Escrt-I/-II Link and its Role in Mvb Trafficking.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1130 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2j9vA00
2J9UA 2G3KA 2J9VA 2J9WA
chains in the Genus database with same CATH superfamily
2MHRA 4MTFA 3RIPA 5KYWA 1T6IA 3U5SA 3RQGA 3V5XA 3JYHA 3DM5A 4EKWA 1EKYA 4D4NA 1TWHA 3WHNA 1Q0DA 1Y4CA 2J9BA 1AUEA 1YAUO 3S90A 4IB4A 3S27A 4E18A 1FNTc 2XL6A 2R7TA 4PACA 1ZHTA 1T01A 3FAJA 4U5GA 4MQ9F 2RSEB 5D91A 5T1DB 1SZIA 4DBQA 4W8KA 4R32A 3ATPA 3K6BA 2JX0A 4KNVA 1ZYRF 4XPWA 4LERA 2GAQA 4MVRA 4N4WA 3UMHA 1YDIA 3DMDA 2NUTB 3KYJA 1TKNA 2HFIA 2OG2A 3U3BA 1Z3IX 4EBKA 1QKRA 3QZCA 4MS2A 4NTAA 3T6GB 3FDQA 2IXPA 1OCRC 1JR8A 3C7JA 4JVSA 4J7TA 3H2VA 1T5OA 2X51A 4JIOA 2XLDA 3QMKA 2VASA 2BC5A 1NBBA 1V55C 1ZU5A 2KYHA 3FAPB 3K1HA 3JT1A 4H54A 5KYYB 1TWCA 4YWQA 2QUPA 4U9DA 4XEKA 5K0IA 2UUHA 3DE8A 4HFKB 1HE1A 5CIVA 5CI9A 2KNHA 3M15A 4WJ0A 4HE8D 1GM5A 1CGME 4X0RA 1LI5A 3IPMO 1ORSC 2R03A 2L9JA 1S7ZA 3LJBA 1BR2A 3M4BA 4KBLA 4C3EA 3G4XA 1R5ID 3VF0A 4DXWA 1MMNA 3UMKA 4AE4B 3JZ0A 4JE9A 3U0CA 4MVOA 1LE4A 1LE2A 3DI5A 1WN0A 4I1MA 1BR4A 1QSPA 2YRFA 1C02A 1LM3B 2YL0A 4AK9A 2J9WA 2XLMA 3Q6MA 1GS9A 4DRHB 4XQ1A 5JUAA 5B3IA 5CI8A 4ANJA 1O3UA 4BJ5A 1Q0FA 2R05A 3L8JA 2AWCA 1Q0GA 2YQYA 3AQCA 4Z9JA 2OKUA 3GODA 1AEPA 2J8WA 2A1DD 1G8XA 2CCYA 1I4YA 2B0JA 4BJ6A 1E85A 3O55A 2XM4A 4MW8A 2EPKX 4YL1A 4MVZA 3NRHA 5E3AA 3OEOA 2VH3A 5L3QA 3HNIA 1O87A 1VTMP 2WVQA 2NG1A 3B0PA 1VLTA 4BJ5C 4NQFA 1NU9C 2Q9AA 3GANA 2EIMC 3GEIA 4JJFA 4JTAB 3F47A 2YL3A 4ONSA 1Z23A 4P6IC 4YL3A 4BJ6C 3EHMA 3WG7C 3BEHA 5D92A 4KI2A 1OR3A 3FVYA 3RH3A 3UNGC 3NYLA 4JZAA 3EGXA 2IXOA 3FXHA 2Y69C 4Z9IA 5JP7A 4YT4A 3V7OA 3EG9B 3GWNA 1M56C 2CNWD 4LACB 2J7PA 3JSEO 4CJOA 1V4AA 3UMIA 2KQ9A 1E84A 3BRJA 3W8IA 2KC3A 2F22A 1FFTC 2EPMX 3J06A 4J32B 3RYLA 4YT2A 2ZXWC 4BJ1A 3RVZA 5KYYA 4GEHA 4PK4A 3ZWIA 2OEVA 1PD0A 4U9EA 3V5YA 3EFOB 3IQ6A 3UR3C 5F28E 3AG1C 3HNJA 3U8PA 2HV7A 2YLIA 4N6HA 5L3VA 4RBNA 4UDVA 2D4UA 2CDQA 4I44A 4XEFA 2OCCC 4FESA 3RF3A 3GM2A 3T6BA 4E17A 1O5HA 5DVWA 3DKAA 3QW0A 5L0CA 3K33A 2GA0A 2Q3TA 4JEBA 1ZHWA 4NTFA 1W2WA 2XL4A 3ABKC 3N24A 3S9OA 2YL1A 1Z7Qc 2VCAA 2BL2A 2WVNA 2XS1A 3ABMC 2HJMA 2XLVA 4XPYA 3PDMP 4G7OF 1OCCC 1T6QA 2LFDA 1A7EA 4EIYA 4QI2A 2IXMA 4BG0A 2WVOA 3I5QA 5L0FA 1M6TA 2HZ8A 2P1AA 2P61A 1BZ4A 2Y3DA 3LNRA 3SXMA 4CS8A 3AQBA 2G3VA 1ORJA 3EGDB 3U9MA 4MVQA 4Q4ZF 3C18A 4AX2A 1A41A 3MYFA 2OOCA 1ZHXA 4N06A 1L3PA 1YJGA 5TJ5E 3LS0A 1ZZPA 2YZSA 3B29A 3X2QC 1OCZC 3RQFA 3B0UX 3CEXA 1JRAA 4E0HA 3CQZA 3NKDA 2XL8A 2Y3HA 4CS8C 3TOLA 3GORA 2XXAB 2MYSA 3H2UA 1JOGA 1MMAA 1VOMA 2MWQA 4U5CE 2PX3A 1UG7A 3EH2A 1PD1A 2J9VA 3US6A 2R7QA 3ZTMA 2HS5A 1ZHZA 3TD7A 1SMYF 5KYWB 3DZAA 3Q7LA 1NU7D 1MQVA 4DJ9A 5A69A 3TULA 2HMQA 1Q0KA 3KPHA 3NYMA 2QNLA 4G0HA 4JJGA 3N2ZB 3K1IA 2J0WA 2E87A 3OWTA 2V3CC 1C17M 2R7WA 2W4BA 4GYTA 4XEVA 2J9UA 1LI7A 5IY5C 1EQ1A 1S05A 4EBBA 4PFPA 1XZQA 2IXNA 1H7IA 1YYJA 2NSFA 3ASNC 4IJJA 2I8BA 3EJNA 1RCPA 3SP1A 1FFHA 3IHUA 3K1IC 4LLCA 2R7VA 3RFYA 3MLGA 1LS4A 5E3CA 2R7UA 1IZMA 4BEMJ 1YVIA 1E83A 4YK5A 4QI0A 3NMJA 4JCHA 1SF8A 1OCOC 3PHF2 3GEEA 2ZXRA 3K66A 1U6HA 5E33A 5GPGB 1LKXA 2Y39A 3C8GA 4Q5SF 3X1OA 3EPVA 5JSLA 3ABLC 3G50A 3KMIA 3KL4A 1VYKA 2A6HF 2P7VA 2UUIA 2W45A 2PBEA 1OW7A 4KNWA 5BQGA 1MMGA 4IGGA 4MVUA 3SXKA 2PP4A 2IOQA 1J8YF 4XWJA 4CS9A 1NSGB 4P9FA 2YL7A 4CJGA 1H9GA 1VMAA 2X0CA 1XWJA 1FR0A 1CPRA 3EH1A 2LQGA 1TFOB 3GM3A 3HNLA 3IEEA 2WZLA 3TJ5A 3DD7A 2GWWA 4CDVA 4A4AA 1G4WR 2DB4A 3E9VA 1YLMA 3QW1A 4J30B 3S28A 4PFOA 3SNHA 3JTLO 5JS5A 1TR2A 1CPQA 3N0TA 4PJLA 2P6VA 1ORYA 3RW0A 4CS9C 1Z6AA 4E7ZA 5BQIA 3K7DA 2L6FA 3CZ6A 3AOUA 3VM6A 3WODF 4IWBA 1V54C 4QDLA 4OIPF 3KYIA 5L0HA 3DE9A 4G78A 1I4ZA 2XSEA 1MNDA 2W9YA 1JMWA 4YJWA 1CGOA 1YYXA 1FTSA 3U9JA 1CGNA 3MBGA 4C7OA 2BE5F 2H7VC 4K0DA 3G4ZA 4JURI 3E70C 3DXJF 3LAYA 3DM9B 4YL0A 4JRZA 5HV9A 3DWWA 4XPXA 2AVKA 3TJ6A 4FAPB 4CX9A 2G3KA 2RD9A 1H6GA 3ZG1A 4U5DE 1B68A 2C03A 3LS1A 5AC4A 4MNDA 3NKEA 3EZHA 1K05A 2EPNA 2LSEA 2Z15A 4PR9A 1D1BA 3VRCA 2V26A 3HNKA 3JYYA 1R4TA 4IAQA 3UGPA 3FOOA 4BPMA 1H9TA 5KYUA 3EHNA 1JAFA 3EGXB 2I15A 5BQHA 1GQAA 3ASOC 2EIKC 2NSGA 4G7HF 1JPNA 5DS6A 1TFKB 5KYNA 1RXQA 5DS5A 5L0JA 4G7ZF 1J8MF 4JTDB 3LUTB 3Q6NA 3JCUQ 4P9TA 3S84A 4RDAA 3ZVRA 1BDJB 3LEOA 2EILC 2QY9A 2XLWA 4GQHA 1T6UA 2A0UA 3LLKA 4JC7A 4CIPA 5KYUB 3ZQVA 4IRUA 4ULWA 3LNMB 3FMSA 4XLNF 4B6IA 2R25A 1Y6DA 2NUPA 4O7GA 4DOZA 1EI7A 2R02A 1BBHA 1LS1A 4MW3A 2J7PD 2H7BA 3SYNA 5KYXA 1QZXA 1WATA 3JRTA 3ZSUA 4ER9A 2QTVA 2AU5A 1D0ZA 1NFNA 1RJ9A 2L6GA 3AJMA 4CIHA 2L7AA 3U3FA 1MMDA 4XTKA 3L0IA 3W2VA 1ST6A 2A0BA 3ZQYA 2XLOA 4N6CA 1U89A 2OU6A 3B71A 2R7RA 1WTYA 256BA 2C04A 2H7OA 4Q7CA 3T4RA 3ZTZA 5KYXB 3ZDLA 3T9OA 1M2OA 4WGYA 2EINC 1OKKA 4L6RA 3M1CB 4O79A 1YA7O 3ECSA 4LDRA 1C03A 1K40A 2KGOA 1I5NA 2DI3A 4A2NB 1ZU4A 1OXKA 2EPLX 3PCVA 4NY3A 3B0VC 1DOWA 3IQ5A 4I3MA 5A6AA 2Q9CA 3UGOA 2R7XA 2XS8A 4M63A 1G4US 4PJMA 4OD5A 1HE9A 2CW0F 1LPEA 2ETSA 2HSBA 2P0NA 2Q4FA 2R7OA 4FWVA 2W4MA 3WAQA 1KTMA 3I4UA 1QLEC 2WB7A 4HFFB 2KW3C 2HKVA 2Q00A 1SR2A 2YVKA 4U5FE 4JTCB 3U2LA 3O39A 1ZW2A 3B9QA 4BJTA 1U0BB 3KKBA 1NG1A 1KNYA 4CDAA 2Y3GA 4O6NA 3R2PA 4OINF 1JPJA 4U5EE 2FAPB 1D1AA 4C3DA 1MNEA 4E7SA 2XM0A 4LDQA 5B3SC 1RKCA 2J45A 2IM8A 2M4EA 3DAFA 4WGZA 3HLZA 1YZAA 1A7DA 2AP3A 2L6HA 5FZTA 2D5RB 1F1MA 2LK4A 3CAXA 3O10A 1TWGA 4J7YA 4FX5A 5DLJA 5AC5A 1RMVA 2ZD9A 3ZIBA 1UFBA 2YHSA 1DOVA 5EHHA 3HJCA 2DYRC 1LVKA 1A0BA 2NUTA 5JLIA 2CGEA 3PMRA 1NFOA 3S0XA 2VCBA 4MVSA 3AG2C 1VB5A 2A6EF 1T9KA 2J46A 3DAGA 5EGYA 1QQ3A 4CSAA 2G62A 3EQLF 2KK1A 4EWCA 3U8VA 3H65A 3SZRA 2LIGA 2L81A 1XZPA 3A11A 4E0IA 4HEAJ 1L7CA 1QPUA 4K7BA 4JCZA 5L0DA 5F5HA 3LESA 1VLSA 2XLHA 4JKVA 3W8HA 1OR2A 3JRMO 2QLAA 2PFDA 2TMVP 4ULVA 5COMA 2WZFA 1HMDA 2ZXOA 4CSAC 5EK0A 2HUJA 5L0GA 2YEVA 3SEOA 2J0XA 4O6YA 2DGJA 3OA1A 1K04A 5DS4A 1A7VA 2CYDA 2Q9BA 4AE4A 1Z63A 1OXBA 3O6XA 4PJNA 1G5ZA 3C8GB 1EA8A 5A6BA 2HMZA 1N1CA 2QE9A 3Q7GA 4OIOF 3MFNA 2WZGA 4OIQF 4D4XA 5B1AC 5FCLA 1SYQA 1M2VA 3SXZA 1PV3A 1HY5A 1WASA 3T6JA 4I1OB 3JSZA 4YT8A 5HSWA 1BR1A 4CS7A 1WGWA 1ZVZA 2YLGA 2R7SA 3C8GD 2ZPAA 3MYIA 3AGTA 5T3TA 1WWPA 4NC3A 4PJJA 3W4YA 1OQCA 3TK0A 2B0HA 4CBEA 2A68F 5DQTA 2O9XA 3TQOA 2XRHA 1M2VB 2R9RB 4EHPA 2M64A 1LIHA 2OJQA 3POVA 3NG1A 2HV6A 3RQEA 1OW6A 3FOPA 3QTHA 4IAOA 3S29A 1ZHYA 1GGQA 2KSFA 2XLEA 3IQCA 3NMKA 4DRJB 4DBRA 2DYSC 5JRAA 2CNWA 3FHDA 2ASRA 5A6BD 1TWAA 2LP4A 2VCCA 3R7CA 5A6KA 1QVXA 4AL0A 3EZIA 3A9CA 2FGYA 4RD9A 4U5HA 4C7OB 2WL8A 4MTGA 5F5FA 2LFFA 3DJNB 1M57C 5E2QA 5JVEA 2OJED 2H8AA 3SXYA 3EG9A 1YARO 3W2WA 1HW2A 4WABA 5B1BC 1Q0MA 5DQZA 4JW1A 1NZEA 3NYJA 4K1OA 3GM1A 1D0YA 3GWLA 1FMVA 1OW8A 2NPUA 1D1CA 2YKZA 3C8ZA 1HMOA 2HSQA 2VC9A 3EFOA 1E2XA 4NTBA 3HTKC 4LLEA 1IW7F 1Z5ZA 4DRIB 4XLPF 3VAYA 3CSKA 3M79A 1VYIA 3MX3A 3VYWA 4DVZA 2GFHA 4EUKB 2ICWG 3C63A 4U5BE 5BUOA 3AGUA 4JEAA 4AL1A 3LLIA 5T3WA 4ZLCA 1YA9A 3ZC4A 2EPOA 4CDYA 1ZW3A 2OQMA 2Q7RA 3U2MA 5AGFA 4O6MA 4YT5A 2OEXA 2LCHA 2HJ3A 3RVYA 2NUPB 1NLXA 5A6JA 2EIJC 1V74B 2KJGA 3AG4C 3NMIA 2FFHA 4MTOA 4W8PA 1D0XA 2PNOA 5L0IA 1RJ9B 1HW1A 3DJUB 3AG3C 3ITFA 3C62A 2JD3A 1E86A 4OIRF 3GEHA 4KC9A 3V5ZA 2PF4E 3IQTA 2PX0A 4ZLDA 3L8IA 4OD4A 2GDCA 3EGDA 3L1MA 4MVMA 1RKEA 1YZCA 2LD6A 2A69F 3QVYA 1PCXA 3RKOF 5JT4A 4C3BA 2IYLD 1KU2A 5COGA 1WOLA 3HKKA 4EBJA 2JPUA 3KH2A 1AVOB 3LEVA 4LDKA 3TOMA 4Z9HA 1FAPB 4H4KC 4NCQA 1FMWA 2AWYA 3M4CA 3L34A 5COFA 1RKEB 1VK5A 2IBFA 2VB6A 2Y3BA 1TQGA 3F46A 4BEJA 2XXAA 2YLDA 3NDBB 4F4BA 4IARA 3QVZA 4YN0B 4DVYP 1OKKD 2ZXPA 3I5PA 2YWAA 1APCA
chains in the Genus database with same CATH topology
3RIPA 5KYWA 3JYHA 3DM5A 1TWHA 3S27A 2R7TA 1ZHTA 3FAJA 4U5GA 4MQ9F 5T1DB 4DBQA 1SZIA 4W8KA 3K6BA 4KNVA 1ZYRF 4LERA 3UMHA 3DMDA 2NUTB 1TKNA 2OG2A 1Z3IX 3QZCA 3FDQA 2IXPA 1OCRC 4JVSA 2X51A 3QMKA 2VASA 1ZU5A 1V55C 3K1HA 3JT1A 1TWCA 4YWQA 4HFKB 5CI9A 2KNHA 4WJ0A 4HE8D 4X0RA 5D91A 3LJBA 4C3EA 4KBLA 2L9JA 1S7ZA 1BR2A 1MMNA 3UMKA 4AE4B 4I1MA 1BR4A 4AK9A 2J9WA 3Q6MA 5CI8A 4ANJA 4BJ5A 3AQCA 3GODA 2A1DD 1G8XA 4BJ6A 2B0JA 5E3AA 3NRHA 3OEOA 2VH3A 5L3QA 1O87A 2WVQA 2NG1A 3B0PA 4BJ5C 1NU9C 2Q9AA 3GANA 2EIMC 4JJFA 3F47A 1Z23A 4P6IC 4BJ6C 3EHMA 3WG7C 5D92A 4KI2A 3FVYA 3RH3A 3UNGC 3NYLA 4JZAA 3EGXA 2IXOA 4YT4A 2Y69C 3V7OA 3EG9B 1M56C 2CNWD 4LACB 2J7PA 3UMIA 2KQ9A 3W8IA 1FFTC 4J32B 3RYLA 4YT2A 2ZXWC 4BJ1A 5KYYA 4GEHA 4PK4A 1PD0A 3EFOB 3UR3C 3AG1C 2HV7A 5L3VA 4RBNA 2CDQA 4I44A 2OCCC 4FESA 3T6BA 1O5HA 5DVWA 3K33A 2Q3TA 1ZHWA 1W2WA 2XL4A 3ABKC 3N24A 2WVNA 3ABMC 4G7OF 1OCCC 4QI2A 2IXMA 4BG0A 2WVOA 3I5QA 2Y3DA 4CS8A 3LNRA 3AQBA 2G3VA 3EGDB 4Q4ZF 4AX2A 1ZHXA 4N06A 3LS0A 2YZSA 3X2QC 1OCZC 3B0UX 3CQZA 3NKDA 2Y3HA 4CS8C 2XXAB 2MYSA 1VOMA 1MMAA 2MWQA 4U5CE 2PX3A 3EH2A 1PD1A 2J9VA 2R7QA 1ZHZA 3TD7A 1SMYF 5KYWB 3DZAA 3Q7LA 1NU7D 3NYMA 4G0HA 4JJGA 3N2ZB 2J0WA 2E87A 3OWTA 2V3CC 2R7WA 2W4BA 4GYTA 2J9UA 5IY5C 4EBBA 4PFPA 2IXNA 3ASNC 4IJJA 2I8BA 3EJNA 3SP1A 1FFHA 3K1IC 4LLCA 3RFYA 3MLGA 5E3CA 2R7UA 1IZMA 4QI0A 4JCHA 1SF8A 1OCOC 3PHF2 2ZXRA 3K66A 5E33A 1LKXA 2Y39A 4Q5SF 3X1OA 3EPVA 3ABLC 3KMIA 3KL4A 1VYKA 2A6HF 2P7VA 2W45A 4KNWA 1MMGA 4CS9A 2PP4A 2IOQA 1J8YF 4XWJA 1VMAA 3EH1A 3IEEA 2WZLA 3DD7A 4E7ZA 3E9VA 4J30B 3S28A 3SNHA 4PFOA 1TR2A 3N0TA 4PJLA 2P6VA 4CS9C 1Z6AA 3K7DA 3CZ6A 3WODF 4IWBA 1V54C 4QDLA 2XSEA 1MNDA 2W9YA 4YJWA 1FTSA 4C7OA 2BE5F 2H7VC 4K0DA 4JURI 3E70C 3DXJF 3LAYA 3DM9B 2G3KA 3ZG1A 4U5DE 3LS1A 2C03A 4MNDA 3NKEA 3EZHA 2LSEA 2Z15A 3UGPA 1D1BA 4OIPF 2V26A 5KYUA 3EHNA 3EGXB 3ASOC 2EIKC 4G7HF 1JPNA 5DS6A 5KYNA 5DS5A 4G7ZF 1J8MF 3Q6NA 3JCUQ 4RDAA 3ZVRA 2EILC 2QY9A 3LLKA 5KYUB 5KYYB 4IRUA 4ULWA 4XLNF 4B6IA 2NUPA 4DOZA 4O7GA 1LS1A 2J7PD 2H7BA 3SYNA 5KYXA 1QZXA 3JRTA 3ZSUA 2QTVA 1D0ZA 1RJ9A 4CIHA 1MMDA 4XTKA 3L0IA 3W2VA 1ST6A 2R7RA 2C04A 2H7OA 4Q7CA 3T4RA 5KYXB 1M2OA 2EINC 1OKKA 4O79A 3M1CB 4U5HA 3ECSA 2KGOA 3B0VC 4A2NB 1ZU4A 4NY3A 4I3MA 2Q9CA 3UGOA 2R7XA 4M63A 4PJMA 4OD5A 2CW0F 2R7OA 4FWVA 2W4MA 3I4UA 1QLEC 2WB7A 4HFFB 2KW3C 4U5FE 4BJTA 3O39A 3B9QA 3KKBA 1NG1A 2Y3GA 4O6NA 4OINF 1JPJA 4U5EE 4C3DA 1D1AA 4E7SA 1MNEA 5B3SC 2J45A 2M4EA 3DAFA 2R7VA 3HLZA 2D5RB 1TWGA 5DLJA 4FX5A 3ZIBA 2YHSA 5EHHA 3HJCA 2DYRC 1LVKA 2NUTA 2CGEA 3PMRA 3S0XA 3AG2C 2A6EF 4CSAA 3DAGA 5EGYA 2G62A 3EQLF 4EWCA 3H65A 3SZRA 2L81A 4HEAJ 4K7BA 5F5HA 3LESA 3W8HA 2PFDA 2WZFA 2ZXOA 4CSAC 2YEVA 3SEOA 2J0XA 4O6YA 2DGJA 3OA1A 1Z63A 5DS4A 2Q9BA 4AE4A 3O6XA 4PJNA 1N1CA 4OIOF 3Q7GA 2WZGA 4OIQF 5FCLA 5B1AC 1M2VA 3T6JA 4I1OB 3JSZA 4YT8A 5HSWA 1BR1A 4CS7A 1WGWA 2R7SA 2ZPAA 5T3TA 4PJJA 4CBEA 2A68F 5DQTA 2O9XA 2XRHA 1M2VB 3POVA 3NG1A 2HV6A 3S29A 4IAOA 1ZHYA 4DBRA 2DYSC 2CNWA 3FHDA 1TWAA 3EZIA 2FGYA 4RD9A 4C7OB 5F5FA 2WL8A 3DJNB 1M57C 5E2QA 3EG9A 3W2WA 5B1BC 5DQZA 4JW1A 1NZEA 3NYJA 1D0YA 1FMVA 1D1CA 3EFOA 3HTKC 4LLEA 1IW7F 1Z5ZA 4XLPF 3VAYA 3CSKA 4DVZA 1VYIA 3MX3A 3VYWA 2GFHA 4U5BE 5BUOA 4ZLCA 3LLIA 5T3WA 3ZC4A 4O6MA 4YT5A 2NUPB 2EIJC 2KJGA 3AG4C 2FFHA 1D0XA 1RJ9B 3DJUB 3ITFA 3AG3C 2JD3A 4OIRF 4KC9A 2PF4E 2PX0A 4ZLDA 4OD4A 3EGDA 2A69F 1PCXA 3RKOF 4C3BA 2IYLD 1KU2A 3KH2A 3LEVA 4H4KC 1FMWA 3L34A 1VK5A 2VB6A 2Y3BA 3F46A 4BEJA 2XXAA 3NDBB 4F4BA 4YN0B 4DVYP 1OKKD 2ZXPA 3I5PA 2J46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9U A;  2G3K A;  2J9V A;  2J9W A; 
#chains in the Genus database with same CATH topology
 2MHR A;  4MTF A;  3RIP A;  5KYW A;  1T6I A;  3U5S A;  3RQG A;  3V5X A;  3JYH A;  3DM5 A;  4EKW A;  1EKY A;  4D4N A;  1TWH A;  3WHN A;  1Q0D A;  1Y4C A;  2J9B A;  1AUE A;  1YAU O;  3S90 A;  4IB4 A;  3S27 A;  4E18 A;  1FNT c;  2XL6 A;  2R7T A;  4PAC A;  1ZHT A;  1T01 A;  3FAJ A;  4U5G A;  4MQ9 F;  2RSE B;  5D91 A;  5T1D B;  1SZI A;  4DBQ A;  4W8K A;  4R32 A;  3ATP A;  3K6B A;  2JX0 A;  4KNV A;  1ZYR F;  4XPW A;  4LER A;  2GAQ A;  4MVR A;  4N4W A;  3UMH A;  1YDI A;  3DMD A;  2NUT B;  3KYJ A;  1TKN A;  2HFI A;  2OG2 A;  3U3B A;  1Z3I X;  4EBK A;  1QKR A;  3QZC A;  4MS2 A;  4NTA A;  3T6G B;  3FDQ A;  2IXP A;  1OCR C;  1JR8 A;  3C7J A;  4JVS A;  4J7T A;  3H2V A;  1T5O A;  2X51 A;  4JIO A;  2XLD A;  3QMK A;  2VAS A;  2BC5 A;  1NBB A;  1V55 C;  1ZU5 A;  2KYH A;  3FAP B;  3K1H A;  3JT1 A;  4H54 A;  5KYY B;  1TWC A;  4YWQ A;  2QUP A;  4U9D A;  4XEK A;  5K0I A;  2UUH A;  3DE8 A;  4HFK B;  1HE1 A;  5CIV A;  5CI9 A;  2KNH A;  3M15 A;  4WJ0 A;  4HE8 D;  1GM5 A;  1CGM E;  4X0R A;  1LI5 A;  3IPM O;  1ORS C;  2R03 A;  2L9J A;  1S7Z A;  3LJB A;  1BR2 A;  3M4B A;  4KBL A;  4C3E A;  3G4X A;  1R5I D;  3VF0 A;  4DXW A;  1MMN A;  3UMK A;  4AE4 B;  3JZ0 A;  4JE9 A;  3U0C A;  4MVO A;  1LE4 A;  1LE2 A;  3DI5 A;  1WN0 A;  4I1M A;  1BR4 A;  1QSP A;  2YRF A;  1C02 A;  1LM3 B;  2YL0 A;  4AK9 A;  2J9W A;  2XLM A;  3Q6M A;  1GS9 A;  4DRH B;  4XQ1 A;  5JUA A;  5B3I A;  5CI8 A;  4ANJ A;  1O3U A;  4BJ5 A;  1Q0F A;  2R05 A;  3L8J A;  2AWC A;  1Q0G A;  2YQY A;  3AQC A;  4Z9J A;  2OKU A;  3GOD A;  1AEP A;  2J8W A;  2A1D D;  1G8X A;  2CCY A;  1I4Y A;  2B0J A;  4BJ6 A;  1E85 A;  3O55 A;  2XM4 A;  4MW8 A;  2EPK X;  4YL1 A;  4MVZ A;  3NRH A;  5E3A A;  3OEO A;  2VH3 A;  5L3Q A;  3HNI A;  1O87 A;  1VTM P;  2WVQ A;  2NG1 A;  3B0P A;  1VLT A;  4BJ5 C;  4NQF A;  1NU9 C;  2Q9A A;  3GAN A;  2EIM C;  3GEI A;  4JJF A;  4JTA B;  3F47 A;  2YL3 A;  4ONS A;  1Z23 A;  4P6I C;  4YL3 A;  4BJ6 C;  3EHM A;  3WG7 C;  3BEH A;  5D92 A;  4KI2 A;  1OR3 A;  3FVY A;  3RH3 A;  3UNG C;  3NYL A;  4JZA A;  3EGX A;  2IXO A;  3FXH A;  2Y69 C;  4Z9I A;  5JP7 A;  4YT4 A;  3V7O A;  3EG9 B;  3GWN A;  1M56 C;  2CNW D;  4LAC B;  2J7P A;  3JSE O;  4CJO A;  1V4A A;  3UMI A;  2KQ9 A;  1E84 A;  3BRJ A;  3W8I A;  2KC3 A;  2F22 A;  1FFT C;  2EPM X;  3J06 A;  4J32 B;  3RYL A;  4YT2 A;  2ZXW C;  4BJ1 A;  3RVZ A;  5KYY A;  4GEH A;  4PK4 A;  3ZWI A;  2OEV A;  1PD0 A;  4U9E A;  3V5Y A;  3EFO B;  3IQ6 A;  3UR3 C;  5F28 E;  3AG1 C;  3HNJ A;  3U8P A;  2HV7 A;  2YLI A;  4N6H A;  5L3V A;  4RBN A;  4UDV A;  2D4U A;  2CDQ A;  4I44 A;  4XEF A;  2OCC C;  4FES A;  3RF3 A;  3GM2 A;  3T6B A;  4E17 A;  1O5H A;  5DVW A;  3DKA A;  3QW0 A;  5L0C A;  3K33 A;  2GA0 A;  2Q3T A;  4JEB A;  1ZHW A;  4NTF A;  1W2W A;  2XL4 A;  3ABK C;  3N24 A;  3S9O A;  2YL1 A;  1Z7Q c;  2VCA A;  2BL2 A;  2WVN A;  2XS1 A;  3ABM C;  2HJM A;  2XLV A;  4XPY A;  3PDM P;  4G7O F;  1OCC C;  1T6Q A;  2LFD A;  1A7E A;  4EIY A;  4QI2 A;  2IXM A;  4BG0 A;  2WVO A;  3I5Q A;  5L0F A;  1M6T A;  2HZ8 A;  2P1A A;  2P61 A;  1BZ4 A;  2Y3D A;  3LNR A;  3SXM A;  4CS8 A;  3AQB A;  2G3V A;  1ORJ A;  3EGD B;  3U9M A;  4MVQ A;  4Q4Z F;  3C18 A;  4AX2 A;  1A41 A;  3MYF A;  2OOC A;  1ZHX A;  4N06 A;  1L3P A;  1YJG A;  5TJ5 E;  3LS0 A;  1ZZP A;  2YZS A;  3B29 A;  3X2Q C;  1OCZ C;  3RQF A;  3B0U X;  3CEX A;  1JRA A;  4E0H A;  3CQZ A;  3NKD A;  2XL8 A;  2Y3H A;  4CS8 C;  3TOL A;  3GOR A;  2XXA B;  2MYS A;  3H2U A;  1JOG A;  1MMA A;  1VOM A;  2MWQ A;  4U5C E;  2PX3 A;  1UG7 A;  3EH2 A;  1PD1 A;  2J9V A;  3US6 A;  2R7Q A;  3ZTM A;  2HS5 A;  1ZHZ A;  3TD7 A;  1SMY F;  5KYW B;  3DZA A;  3Q7L A;  1NU7 D;  1MQV A;  4DJ9 A;  5A69 A;  3TUL A;  2HMQ A;  1Q0K A;  3KPH A;  3NYM A;  2QNL A;  4G0H A;  4JJG A;  3N2Z B;  3K1I A;  2J0W A;  2E87 A;  3OWT A;  2V3C C;  1C17 M;  2R7W A;  2W4B A;  4GYT A;  4XEV A;  2J9U A;  1LI7 A;  5IY5 C;  1EQ1 A;  1S05 A;  4EBB A;  4PFP A;  1XZQ A;  2IXN A;  1H7I A;  1YYJ A;  2NSF A;  3ASN C;  4IJJ A;  2I8B A;  3EJN A;  1RCP A;  3SP1 A;  1FFH A;  3IHU A;  3K1I C;  4LLC A;  2R7V A;  3RFY A;  3MLG A;  1LS4 A;  5E3C A;  2R7U A;  1IZM A;  4BEM J;  1YVI A;  1E83 A;  4YK5 A;  4QI0 A;  3NMJ A;  4JCH A;  1SF8 A;  1OCO C;  3PHF 2;  3GEE A;  2ZXR A;  3K66 A;  1U6H A;  5E33 A;  5GPG B;  1LKX A;  2Y39 A;  3C8G A;  4Q5S F;  3X1O A;  3EPV A;  5JSL A;  3ABL C;  3G50 A;  3KMI A;  3KL4 A;  1VYK A;  2A6H F;  2P7V A;  2UUI A;  2W45 A;  2PBE A;  1OW7 A;  4KNW A;  5BQG A;  1MMG A;  4IGG A;  4MVU A;  3SXK A;  2PP4 A;  2IOQ A;  1J8Y F;  4XWJ A;  4CS9 A;  1NSG B;  4P9F A;  2YL7 A;  4CJG A;  1H9G A;  1VMA A;  2X0C A;  1XWJ A;  1FR0 A;  1CPR A;  3EH1 A;  2LQG A;  1TFO B;  3GM3 A;  3HNL A;  3IEE A;  2WZL A;  3TJ5 A;  3DD7 A;  2GWW A;  4CDV A;  4A4A A;  1G4W R;  2DB4 A;  3E9V A;  1YLM A;  3QW1 A;  4J30 B;  3S28 A;  4PFO A;  3SNH A;  3JTL O;  5JS5 A;  1TR2 A;  1CPQ A;  3N0T A;  4PJL A;  2P6V A;  1ORY A;  3RW0 A;  4CS9 C;  1Z6A A;  4E7Z A;  5BQI A;  3K7D A;  2L6F A;  3CZ6 A;  3AOU A;  3VM6 A;  3WOD F;  4IWB A;  1V54 C;  4QDL A;  4OIP F;  3KYI A;  5L0H A;  3DE9 A;  4G78 A;  1I4Z A;  2XSE A;  1MND A;  2W9Y A;  1JMW A;  4YJW A;  1CGO A;  1YYX A;  1FTS A;  3U9J A;  1CGN A;  3MBG A;  4C7O A;  2BE5 F;  2H7V C;  4K0D A;  3G4Z A;  4JUR I;  3E70 C;  3DXJ F;  3LAY A;  3DM9 B;  4YL0 A;  4JRZ A;  5HV9 A;  3DWW A;  4XPX A;  2AVK A;  3TJ6 A;  4FAP B;  4CX9 A;  2G3K A;  2RD9 A;  1H6G A;  3ZG1 A;  4U5D E;  1B68 A;  2C03 A;  3LS1 A;  5AC4 A;  4MND A;  3NKE A;  3EZH A;  1K05 A;  2EPN A;  2LSE A;  2Z15 A;  4PR9 A;  1D1B A;  3VRC A;  2V26 A;  3HNK A;  3JYY A;  1R4T A;  4IAQ A;  3UGP A;  3FOO A;  4BPM A;  1H9T A;  5KYU A;  3EHN A;  1JAF A;  3EGX B;  2I15 A;  5BQH A;  1GQA A;  3ASO C;  2EIK C;  2NSG A;  4G7H F;  1JPN A;  5DS6 A;  1TFK B;  5KYN A;  1RXQ A;  5DS5 A;  5L0J A;  4G7Z F;  1J8M F;  4JTD B;  3LUT B;  3Q6N A;  3JCU Q;  4P9T A;  3S84 A;  4RDA A;  3ZVR A;  1BDJ B;  3LEO A;  2EIL C;  2QY9 A;  2XLW A;  4GQH A;  1T6U A;  2A0U A;  3LLK A;  4JC7 A;  4CIP A;  5KYU B;  3ZQV A;  4IRU A;  4ULW A;  3LNM B;  3FMS A;  4XLN F;  4B6I A;  2R25 A;  1Y6D A;  2NUP A;  4O7G A;  4DOZ A;  1EI7 A;  2R02 A;  1BBH A;  1LS1 A;  4MW3 A;  2J7P D;  2H7B A;  3SYN A;  5KYX A;  1QZX A;  1WAT A;  3JRT A;  3ZSU A;  4ER9 A;  2QTV A;  2AU5 A;  1D0Z A;  1NFN A;  1RJ9 A;  2L6G A;  3AJM A;  4CIH A;  2L7A A;  3U3F A;  1MMD A;  4XTK A;  3L0I A;  3W2V A;  1ST6 A;  2A0B A;  3ZQY A;  2XLO A;  4N6C A;  1U89 A;  2OU6 A;  3B71 A;  2R7R A;  1WTY A;  256B A;  2C04 A;  2H7O A;  4Q7C A;  3T4R A;  3ZTZ A;  5KYX B;  3ZDL A;  3T9O A;  1M2O A;  4WGY A;  2EIN C;  1OKK A;  4L6R A;  3M1C B;  4O79 A;  1YA7 O;  3ECS A;  4LDR A;  1C03 A;  1K40 A;  2KGO A;  1I5N A;  2DI3 A;  4A2N B;  1ZU4 A;  1OXK A;  2EPL X;  3PCV A;  4NY3 A;  3B0V C;  1DOW A;  3IQ5 A;  4I3M A;  5A6A A;  2Q9C A;  3UGO A;  2R7X A;  2XS8 A;  4M63 A;  1G4U S;  4PJM A;  4OD5 A;  1HE9 A;  2CW0 F;  1LPE A;  2ETS A;  2HSB A;  2P0N A;  2Q4F A;  2R7O A;  4FWV A;  2W4M A;  3WAQ A;  1KTM A;  3I4U A;  1QLE C;  2WB7 A;  4HFF B;  2KW3 C;  2HKV A;  2Q00 A;  1SR2 A;  2YVK A;  4U5F E;  4JTC B;  3U2L A;  3O39 A;  1ZW2 A;  3B9Q A;  4BJT A;  1U0B B;  3KKB A;  1NG1 A;  1KNY A;  4CDA A;  2Y3G A;  4O6N A;  3R2P A;  4OIN F;  1JPJ A;  4U5E E;  2FAP B;  1D1A A;  4C3D A;  1MNE A;  4E7S A;  2XM0 A;  4LDQ A;  5B3S C;  1RKC A;  2J45 A;  2IM8 A;  2M4E A;  3DAF A;  4WGZ A;  3HLZ A;  1YZA A;  1A7D A;  2AP3 A;  2L6H A;  5FZT A;  2D5R B;  1F1M A;  2LK4 A;  3CAX A;  3O10 A;  1TWG A;  4J7Y A;  4FX5 A;  5DLJ A;  5AC5 A;  1RMV A;  2ZD9 A;  3ZIB A;  1UFB A;  2YHS A;  1DOV A;  5EHH A;  3HJC A;  2DYR C;  1LVK A;  1A0B A;  2NUT A;  5JLI A;  2CGE A;  3PMR A;  1NFO A;  3S0X A;  2VCB A;  4MVS A;  3AG2 C;  1VB5 A;  2A6E F;  1T9K A;  2J46 A;  3DAG A;  5EGY A;  1QQ3 A;  4CSA A;  2G62 A;  3EQL F;  2KK1 A;  4EWC A;  3U8V A;  3H65 A;  3SZR A;  2LIG A;  2L81 A;  1XZP A;  3A11 A;  4E0I A;  4HEA J;  1L7C A;  1QPU A;  4K7B A;  4JCZ A;  5L0D A;  5F5H A;  3LES A;  1VLS A;  2XLH A;  4JKV A;  3W8H A;  1OR2 A;  3JRM O;  2QLA A;  2PFD A;  2TMV P;  4ULV A;  5COM A;  2WZF A;  1HMD A;  2ZXO A;  4CSA C;  5EK0 A;  2HUJ A;  5L0G A;  2YEV A;  3SEO A;  2J0X A;  4O6Y A;  2DGJ A;  3OA1 A;  1K04 A;  5DS4 A;  1A7V A;  2CYD A;  2Q9B A;  4AE4 A;  1Z63 A;  1OXB A;  3O6X A;  4PJN A;  1G5Z A;  3C8G B;  1EA8 A;  5A6B A;  2HMZ A;  1N1C A;  2QE9 A;  3Q7G A;  4OIO F;  3MFN A;  2WZG A;  4OIQ F;  4D4X A;  5B1A C;  5FCL A;  1SYQ A;  1M2V A;  3SXZ A;  1PV3 A;  1HY5 A;  1WAS A;  3T6J A;  4I1O B;  3JSZ A;  4YT8 A;  5HSW A;  1BR1 A;  4CS7 A;  1WGW A;  1ZVZ A;  2YLG A;  2R7S A;  3C8G D;  2ZPA A;  3MYI A;  3AGT A;  5T3T A;  1WWP A;  4NC3 A;  4PJJ A;  3W4Y A;  1OQC A;  3TK0 A;  2B0H A;  4CBE A;  2A68 F;  5DQT A;  2O9X A;  3TQO A;  2XRH A;  1M2V B;  2R9R B;  4EHP A;  2M64 A;  1LIH A;  2OJQ A;  3POV A;  3NG1 A;  2HV6 A;  3RQE A;  1OW6 A;  3FOP A;  3QTH A;  4IAO A;  3S29 A;  1ZHY A;  1GGQ A;  2KSF A;  2XLE A;  3IQC A;  3NMK A;  4DRJ B;  4DBR A;  2DYS C;  5JRA A;  2CNW A;  3FHD A;  2ASR A;  5A6B D;  1TWA A;  2LP4 A;  2VCC A;  3R7C A;  5A6K A;  1QVX A;  4AL0 A;  3EZI A;  3A9C A;  2FGY A;  4RD9 A;  4U5H A;  4C7O B;  2WL8 A;  4MTG A;  5F5F A;  2LFF A;  3DJN B;  1M57 C;  5E2Q A;  5JVE A;  2OJE D;  2H8A A;  3SXY A;  3EG9 A;  1YAR O;  3W2W A;  1HW2 A;  4WAB A;  5B1B C;  1Q0M A;  5DQZ A;  4JW1 A;  1NZE A;  3NYJ A;  4K1O A;  3GM1 A;  1D0Y A;  3GWL A;  1FMV A;  1OW8 A;  2NPU A;  1D1C A;  2YKZ A;  3C8Z A;  1HMO A;  2HSQ A;  2VC9 A;  3EFO A;  1E2X A;  4NTB A;  3HTK C;  4LLE A;  1IW7 F;  1Z5Z A;  4DRI B;  4XLP F;  3VAY A;  3CSK A;  3M79 A;  1VYI A;  3MX3 A;  3VYW A;  4DVZ A;  2GFH A;  4EUK B;  2ICW G;  3C63 A;  4U5B E;  5BUO A;  3AGU A;  4JEA A;  4AL1 A;  3LLI A;  5T3W A;  4ZLC A;  1YA9 A;  3ZC4 A;  2EPO A;  4CDY A;  1ZW3 A;  2OQM A;  2Q7R A;  3U2M A;  5AGF A;  4O6M A;  4YT5 A;  2OEX A;  2LCH A;  2HJ3 A;  3RVY A;  2NUP B;  1NLX A;  5A6J A;  2EIJ C;  1V74 B;  2KJG A;  3AG4 C;  3NMI A;  2FFH A;  4MTO A;  4W8P A;  1D0X A;  2PNO A;  5L0I A;  1RJ9 B;  1HW1 A;  3DJU B;  3AG3 C;  3ITF A;  3C62 A;  2JD3 A;  1E86 A;  4OIR F;  3GEH A;  4KC9 A;  3V5Z A;  2PF4 E;  3IQT A;  2PX0 A;  4ZLD A;  3L8I A;  4OD4 A;  2GDC A;  3EGD A;  3L1M A;  4MVM A;  1RKE A;  1YZC A;  2LD6 A;  2A69 F;  3QVY A;  1PCX A;  3RKO F;  5JT4 A;  4C3B A;  2IYL D;  1KU2 A;  5COG A;  1WOL A;  3HKK A;  4EBJ A;  2JPU A;  3KH2 A;  1AVO B;  3LEV A;  4LDK A;  3TOM A;  4Z9H A;  1FAP B;  4H4K C;  4NCQ A;  1FMW A;  2AWY A;  3M4C A;  3L34 A;  5COF A;  1RKE B;  1VK5 A;  2IBF A;  2VB6 A;  2Y3B A;  1TQG A;  3F46 A;  4BEJ A;  2XXA A;  2YLD A;  3NDB B;  4F4B A;  4IAR A;  3QVZ A;  4YN0 B;  4DVY P;  1OKK D;  2ZXP A;  3I5P A;  2YWA A;  1APC A; 
#chains in the Genus database with same CATH homology
 3RIP A;  5KYW A;  3JYH A;  3DM5 A;  1TWH A;  3S27 A;  2R7T A;  1ZHT A;  3FAJ A;  4U5G A;  4MQ9 F;  5T1D B;  4DBQ A;  1SZI A;  4W8K A;  3K6B A;  4KNV A;  1ZYR F;  4LER A;  3UMH A;  3DMD A;  2NUT B;  1TKN A;  2OG2 A;  1Z3I X;  3QZC A;  3FDQ A;  2IXP A;  1OCR C;  4JVS A;  2X51 A;  3QMK A;  2VAS A;  1ZU5 A;  1V55 C;  3K1H A;  3JT1 A;  1TWC A;  4YWQ A;  4HFK B;  5CI9 A;  2KNH A;  4WJ0 A;  4HE8 D;  4X0R A;  5D91 A;  3LJB A;  4C3E A;  4KBL A;  2L9J A;  1S7Z A;  1BR2 A;  1MMN A;  3UMK A;  4AE4 B;  4I1M A;  1BR4 A;  4AK9 A;  2J9W A;  3Q6M A;  5CI8 A;  4ANJ A;  4BJ5 A;  3AQC A;  3GOD A;  2A1D D;  1G8X A;  4BJ6 A;  2B0J A;  5E3A A;  3NRH A;  3OEO A;  2VH3 A;  5L3Q A;  1O87 A;  2WVQ A;  2NG1 A;  3B0P A;  4BJ5 C;  1NU9 C;  2Q9A A;  3GAN A;  2EIM C;  4JJF A;  3F47 A;  1Z23 A;  4P6I C;  4BJ6 C;  3EHM A;  3WG7 C;  5D92 A;  4KI2 A;  3FVY A;  3RH3 A;  3UNG C;  3NYL A;  4JZA A;  3EGX A;  2IXO A;  4YT4 A;  2Y69 C;  3V7O A;  3EG9 B;  1M56 C;  2CNW D;  4LAC B;  2J7P A;  3UMI A;  2KQ9 A;  3W8I A;  1FFT C;  4J32 B;  3RYL A;  4YT2 A;  2ZXW C;  4BJ1 A;  5KYY A;  4GEH A;  4PK4 A;  1PD0 A;  3EFO B;  3UR3 C;  3AG1 C;  2HV7 A;  5L3V A;  4RBN A;  2CDQ A;  4I44 A;  2OCC C;  4FES A;  3T6B A;  1O5H A;  5DVW A;  3K33 A;  2Q3T A;  1ZHW A;  1W2W A;  2XL4 A;  3ABK C;  3N24 A;  2WVN A;  3ABM C;  4G7O F;  1OCC C;  4QI2 A;  2IXM A;  4BG0 A;  2WVO A;  3I5Q A;  2Y3D A;  4CS8 A;  3LNR A;  3AQB A;  2G3V A;  3EGD B;  4Q4Z F;  4AX2 A;  1ZHX A;  4N06 A;  3LS0 A;  2YZS A;  3X2Q C;  1OCZ C;  3B0U X;  3CQZ A;  3NKD A;  2Y3H A;  4CS8 C;  2XXA B;  2MYS A;  1VOM A;  1MMA A;  2MWQ A;  4U5C E;  2PX3 A;  3EH2 A;  1PD1 A;  2J9V A;  2R7Q A;  1ZHZ A;  3TD7 A;  1SMY F;  5KYW B;  3DZA A;  3Q7L A;  1NU7 D;  3NYM A;  4G0H A;  4JJG A;  3N2Z B;  2J0W A;  2E87 A;  3OWT A;  2V3C C;  2R7W A;  2W4B A;  4GYT A;  2J9U A;  5IY5 C;  4EBB A;  4PFP A;  2IXN A;  3ASN C;  4IJJ A;  2I8B A;  3EJN A;  3SP1 A;  1FFH A;  3K1I C;  4LLC A;  3RFY A;  3MLG A;  5E3C A;  2R7U A;  1IZM A;  4QI0 A;  4JCH A;  1SF8 A;  1OCO C;  3PHF 2;  2ZXR A;  3K66 A;  5E33 A;  1LKX A;  2Y39 A;  4Q5S F;  3X1O A;  3EPV A;  3ABL C;  3KMI A;  3KL4 A;  1VYK A;  2A6H F;  2P7V A;  2W45 A;  4KNW A;  1MMG A;  4CS9 A;  2PP4 A;  2IOQ A;  1J8Y F;  4XWJ A;  1VMA A;  3EH1 A;  3IEE A;  2WZL A;  3DD7 A;  4E7Z A;  3E9V A;  4J30 B;  3S28 A;  3SNH A;  4PFO A;  1TR2 A;  3N0T A;  4PJL A;  2P6V A;  4CS9 C;  1Z6A A;  3K7D A;  3CZ6 A;  3WOD F;  4IWB A;  1V54 C;  4QDL A;  2XSE A;  1MND A;  2W9Y A;  4YJW A;  1FTS A;  4C7O A;  2BE5 F;  2H7V C;  4K0D A;  4JUR I;  3E70 C;  3DXJ F;  3LAY A;  3DM9 B;  2G3K A;  3ZG1 A;  4U5D E;  3LS1 A;  2C03 A;  4MND A;  3NKE A;  3EZH A;  2LSE A;  2Z15 A;  3UGP A;  1D1B A;  4OIP F;  2V26 A;  5KYU A;  3EHN A;  3EGX B;  3ASO C;  2EIK C;  4G7H F;  1JPN A;  5DS6 A;  5KYN A;  5DS5 A;  4G7Z F;  1J8M F;  3Q6N A;  3JCU Q;  4RDA A;  3ZVR A;  2EIL C;  2QY9 A;  3LLK A;  5KYU B;  5KYY B;  4IRU A;  4ULW A;  4XLN F;  4B6I A;  2NUP A;  4DOZ A;  4O7G A;  1LS1 A;  2J7P D;  2H7B A;  3SYN A;  5KYX A;  1QZX A;  3JRT A;  3ZSU A;  2QTV A;  1D0Z A;  1RJ9 A;  4CIH A;  1MMD A;  4XTK A;  3L0I A;  3W2V A;  1ST6 A;  2R7R A;  2C04 A;  2H7O A;  4Q7C A;  3T4R A;  5KYX B;  1M2O A;  2EIN C;  1OKK A;  4O79 A;  3M1C B;  4U5H A;  3ECS A;  2KGO A;  3B0V C;  4A2N B;  1ZU4 A;  4NY3 A;  4I3M A;  2Q9C A;  3UGO A;  2R7X A;  4M63 A;  4PJM A;  4OD5 A;  2CW0 F;  2R7O A;  4FWV A;  2W4M A;  3I4U A;  1QLE C;  2WB7 A;  4HFF B;  2KW3 C;  4U5F E;  4BJT A;  3O39 A;  3B9Q A;  3KKB A;  1NG1 A;  2Y3G A;  4O6N A;  4OIN F;  1JPJ A;  4U5E E;  4C3D A;  1D1A A;  4E7S A;  1MNE A;  5B3S C;  2J45 A;  2M4E A;  3DAF A;  2R7V A;  3HLZ A;  2D5R B;  1TWG A;  5DLJ A;  4FX5 A;  3ZIB A;  2YHS A;  5EHH A;  3HJC A;  2DYR C;  1LVK A;  2NUT A;  2CGE A;  3PMR A;  3S0X A;  3AG2 C;  2A6E F;  4CSA A;  3DAG A;  5EGY A;  2G62 A;  3EQL F;  4EWC A;  3H65 A;  3SZR A;  2L81 A;  4HEA J;  4K7B A;  5F5H A;  3LES A;  3W8H A;  2PFD A;  2WZF A;  2ZXO A;  4CSA C;  2YEV A;  3SEO A;  2J0X A;  4O6Y A;  2DGJ A;  3OA1 A;  1Z63 A;  5DS4 A;  2Q9B A;  4AE4 A;  3O6X A;  4PJN A;  1N1C A;  4OIO F;  3Q7G A;  2WZG A;  4OIQ F;  5FCL A;  5B1A C;  1M2V A;  3T6J A;  4I1O B;  3JSZ A;  4YT8 A;  5HSW A;  1BR1 A;  4CS7 A;  1WGW A;  2R7S A;  2ZPA A;  5T3T A;  4PJJ A;  4CBE A;  2A68 F;  5DQT A;  2O9X A;  2XRH A;  1M2V B;  3POV A;  3NG1 A;  2HV6 A;  3S29 A;  4IAO A;  1ZHY A;  4DBR A;  2DYS C;  2CNW A;  3FHD A;  1TWA A;  3EZI A;  2FGY A;  4RD9 A;  4C7O B;  5F5F A;  2WL8 A;  3DJN B;  1M57 C;  5E2Q A;  3EG9 A;  3W2W A;  5B1B C;  5DQZ A;  4JW1 A;  1NZE A;  3NYJ A;  1D0Y A;  1FMV A;  1D1C A;  3EFO A;  3HTK C;  4LLE A;  1IW7 F;  1Z5Z A;  4XLP F;  3VAY A;  3CSK A;  4DVZ A;  1VYI A;  3MX3 A;  3VYW A;  2GFH A;  4U5B E;  5BUO A;  4ZLC A;  3LLI A;  5T3W A;  3ZC4 A;  4O6M A;  4YT5 A;  2NUP B;  2EIJ C;  2KJG A;  3AG4 C;  2FFH A;  1D0X A;  1RJ9 B;  3DJU B;  3ITF A;  3AG3 C;  2JD3 A;  4OIR F;  4KC9 A;  2PF4 E;  2PX0 A;  4ZLD A;  4OD4 A;  3EGD A;  2A69 F;  1PCX A;  3RKO F;  4C3B A;  2IYL D;  1KU2 A;  3KH2 A;  3LEV A;  4H4K C;  1FMW A;  3L34 A;  1VK5 A;  2VB6 A;  2Y3B A;  3F46 A;  4BEJ A;  2XXA A;  3NDB B;  4F4B A;  4YN0 B;  4DVY P;  1OKK D;  2ZXP A;  3I5P A;  2J46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...