2J9VA

2 angstrom x-ray structure of the yeast escrt-i vps28 c-terminus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'HHHMFNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVRINKLSIGDTLTETQIRELLFDLELAYKSFYALLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 28
molecule tags Protein transport
source organism Saccharomyces cerevisiae
publication title Structural Insight Into the Escrt-I/-II Link and its Role in Mvb Trafficking.
pubmed doi rcsb
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1130 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2j9vA00
2J9UA 2J9WA 2J9VA 2G3KA
chains in the Genus database with same CATH superfamily
4KNVA 4QI2A 3K1IC 2Q3TA 1RXQA 2ASRA 1BZ4A 2IXNA 3W2VA 1LE4A 5FZTA 4EIYA 4CX9A 5CIVA 3FHDA 1U89A 2YRFA 1PV3A 3Q7GA 2OCCC 1B68A 3DE8A 2LIGA 2XLDA 1NBBA 4P6IC 3DAGA 1TKNA 2KNHA 5L0CA 2QY9A 3EGXB 2AWCA 3S84A 1G5ZA 4U5EE 4O6NA 3EH1A 1WATA 4C3EA 2H8AA 2Y3GA 4E7SA 4GYTA 4DRIB 5JLIA 2HFIA 1YLMA 3FOPA 1E83A 4U5FE 4ZLDA 3MX3A 1GQAA 4E17A 2R7OA 3ZQYA 2KGOA 3F46A 4AE4A 3IEEA 4DOZA 2GA0A 5KYXA 1OCCC 1T6IA 2Q4FA 4CIPA 3EG9B 1TR2A 4DBQA 1TFKB 4U5DE 5KYUB 3PDMP 3GWNA 5DVWA 4LDRA 4XPYA 4PK4A 2J7PD 2WZFA 1NZEA 2PX0A 2XS1A 2W4BA 5DQTA 1FMVA 3V5ZA 5DQZA 3G50A 2HS5A 3H2VA 1JMWA 3DAFA 4CDVA 2VB6A 1ZHWA 2WVNA 2RSEB 1D1CA 2B0JA 4PJMA 3SXKA 2KC3A 4JE9A 1MMNA 2GFHA 1I5NA 1MNEA 5T3TA 3ZVRA 5COFA 4ONSA 2G3VA 1NSGB 4OD4A 4WABA 3K1IA 3N0TA 3RQGA 4G7ZF 1NU7D 3ECSA 3N24A 3K66A 5F28E 1J8YF 5B3SC 2OU6A 256BA 4XLNF 4C3DA 4JVSA 2V3CC 3KYJA 4G0HA 2ZXWC 4YT4A 5L0GA 2LFFA 4W8KA 3UR3C 4U5GA 1I4ZA 4CBEA 4MVSA 4XEVA 3LLIA 4N06A 3DWWA 3V5YA 4KC9A 2R9RB 3UMIA 3PMRA 2IOQA 2A0BA 3NMJA 2J9BA 3L8IA 2YQYA 3B71A 2M64A 1Q0DA 1C03A 1ZZPA 3UMKA 4DXWA 1A7DA 3K1HA 3K7DA 3NKEA 4O6MA 4XWJA 3RW0A 3C18A 3CAXA 3POVA 1ZU5A 1F1MA 1JPJA 2BC5A 2G62A 3G4ZA 4XEKA 1JPNA 3U8PA 1FFTC 3MFNA 1QSPA 1Z6AA 1ZU4A 2QTVA 4DBRA 3ITFA 3KMIA 3QW1A 1VYIA 4CSAA 3UMHA 2AVKA 2R7VA 1FTSA 2EPNA 2YEVA 3U3BA 1RKEA 3LNMB 5KYXB 3FXHA 3AJMA 4O79A 3DMDA 1PCXA 2G3KA 2FGYA 2VCCA 3CEXA 1U6HA 3MLGA 1D1AA 4U5CE 4DVZA 2FAPB 2PF4E 1YA9A 4PFPA 3TD7A 3U8VA 5L3VA 5HSWA 2J46A 4JC7A 3RYLA 1XZPA 2XL6A 2YLDA 4BEJA 2KJGA 3WAQA 3U2LA 3NYJA 4YN0B 3ABLC 1ZW3A 3KL4A 3LS1A 1WGWA 3NMIA 1ZHZA 3ABMC 4KNWA 5GPGB 3VYWA 4ULWA 4G7OF 3DE9A 2M4EA 2IXMA 2MYSA 4J30B 3PCVA 5A6BD 3NYLA 2XLVA 3VAYA 2R03A 3L8JA 3L0IA 5DS5A 1OXBA 2EIMC 1J8MF 1WN0A 3V7OA 2NPUA 2A68F 4L6RA 4N6HA 1A7VA 4AL0A 3B0VC 4YL1A 2OJED 1OXKA 3EGDB 2J0XA 3X2QC 2B0HA 3QZCA 4NC3A 3WHNA 5HV9A 1NFOA 4I3MA 3I5QA 3EQLF 1YZAA 1Y4CA 2HMQA 3ZTMA 2AP3A 2IXPA 1AUEA 4YL3A 3PHF2 2J9VA 3MYIA 3ATPA 1XZQA 2ICWG 3A11A 3O6XA 3RQFA 1FMWA 1OQCA 2XLOA 4J7YA 4LACB 5T1DB 2YLGA 4IAQA 1Q0GA 2OKUA 4PJNA 4BJ6A 4CS9A 5JUAA 3NDBB 4MVZA 2WL8A 2A1DD 4JTCB 2R05A 1Z3IX 1UG7A 2CNWA 2KQ9A 2PFDA 2Z15A 4JEBA 5F5HA 2VASA 3AG1C 3LJBA 3VRCA 5KYYB 1EKYA 2H7BA 2GDCA 1LI5A 4P9TA 2P61A 4NTAA 4PFOA 5JT4A 4WGYA 4Z9HA 2EPLX 4I1MA 4CIHA 1G4WR 2CNWD 2XXAA 2F22A 1C02A 3Q7LA 4Z9IA 4EBKA 4YWQA 1AVOB 5COMA 4DRHB 1TQGA 1YYJA 3H2UA 1LE2A 3KPHA 2GAQA 2GWWA 4Q4ZF 1VLTA 4IJJA 5L0HA 2J0WA 4MVMA 3C62A 3SP1A 5JRAA 1DOWA 3JRTA 2WZLA 4C7OB 4Q5SF 1QPUA 2P6VA 3K33A 3ZDLA 4U5BE 2XM4A 4CJOA 2Y3HA 2L7AA 4NTBA 3ZC4A 4FX5A 3DXJF 4RBNA 2EIJC 1YDIA 3M4CA 4AE4B 4LERA 2JX0A 2YWAA 2YL0A 3UNGC 2LCHA 4OIQF 1TFOB 1LM3B 3V5XA 5L0IA 1ST6A 2C03A 3GWLA 4GEHA 1MQVA 3W8HA 1JRAA 1KU2A 3S9OA 2BL2A 1D0XA 3AQCA 3GEIA 4A4AA 1Z23A 1SZIA 4JCZA 1M56C 3EHMA 1LPEA 4ER9A 5AGFA 1YARO 3DM9B 4A2NB 4CSAC 4JIOA 2ZXOA 2TMVP 4MTFA 1WOLA 1L3PA 1SYQA 4LLEA 3EPVA 4ZLCA 2PBEA 3FMSA 4XQ1A 3WG7C 3CSKA 2I15A 5KYYA 2NUTA 2VCAA 4X0RA 2XLMA 3L34A 1WASA 4NQFA 4C7OA 1DOVA 4BJ5C 3K6BA 4KI2A 3B0UX 4J7TA 2Y3BA 4PACA 3ZIBA 4WJ0A 1OCZC 4JKVA 1OR3A 5KYWA 3QVZA 5COGA 3ZTZA 2XSEA 3TULA 1H9GA 5F5FA 4E0HA 4CJGA 2L9JA 3DI5A 3N2ZB 1H7IA 4D4NA 3I5PA 4JCHA 4JZAA 1CGOA 3M79A 4RD9A 3KH2A 4FAPB 4EBBA 5IY5C 1CPQA 2D5RB 2DYSC 2O9XA 3GM2A 3TJ6A 2Q9CA 4N4WA 1Z7Qc 4EHPA 3DZAA 3G4XA 4PJJA 1A7EA 3LEVA 2R02A 3VF0A 1T6UA 2R7TA 3M15A 3OEOA 4I1OB 3QMKA 4JURI 1FNTc 2R7RA 1HE1A 1QZXA 4KBLA 3AQBA 3IQ6A 3HLZA 3JTLO 4IGGA 4ULVA 4XLPF 1MMGA 2HSBA 3AG3C 3CQZA 3S90A 4BPMA 3LS0A 1VOMA 4LLCA 3SXYA 4BJ6C 4CS9C 3L1MA 1EA8A 1K04A 1OW8A 5E2QA 4JEAA 2Y39A 1T6QA 4K1OA 1VB5A 1QKRA 1WWPA 2Q00A 2Y69C 1OKKD 4YK5A 2AWYA 2JD3A 2OJQA 1QVXA 3EJNA 4W8PA 2VH3A 4BJ1A 1NU9C 3NYMA 3HNJA 5BUOA 4P9FA 2NUPA 3DJUB 3W4YA 2LP4A 2R7XA 3JZ0A 2NUTB 1BBHA 1K05A 2A6EF 1ZW2A 1E84A 1OCOC 3E9VA 1L7CA 3EZHA 2HSQA 2OG2A 2W4MA 3GM3A 3IQTA 4FESA 4G7HF 4R32A 3S28A 1CGME 1HW2A 1RKEB 2R25A 1VK5A 5KYNA 3HNIA 3EG9A 2YL7A 2XL8A 2YHSA 4IWBA 2VCBA 4BJTA 1JOGA 2IXOA 2W45A 2CYDA 2P1AA 5DLJA 2ETSA 4JTDB 4ANJA 3AOUA 2A6HF 3C8GB 1PD1A 4DVYP 4YT8A 1N1CA 2EILC 2NSGA 4HFKB 4LDQA 1A0BA 2R7WA 1Y6DA 2EINC 2HJ3A 5A6KA 3CZ6A 1Q0FA 1G4US 1A41A 1RJ9B 2Q7RA 2LSEA 2XL4A 5AC4A 2KW3C 2OQMA 2QNLA 5TJ5E 3T4RA 4XPWA 2E87A 3OWTA 3O10A 1R5ID 3BEHA 4O7GA 3SXMA 1BDJB 5DS6A 1LKXA 1BR2A 1M2OA 3LEOA 1E2XA 2EPMX 1HE9A 3AG4C 4M63A 5KYUA 3GEEA 5BQGA 1YZCA 4O6YA 3SXZA 1WTYA 3B9QA 3C63A 4BG0A 1Z5ZA 1Q0MA 2DYRC 3E70C 4NCQA 3IPMO 4AX2A 4AL1A 2XRHA 3FDQA 4CDYA 3LESA 3NRHA 3W2WA 1EQ1A 2JPUA 4HE8D 4MS2A 4MTGA 3RVYA 2L6HA 1EI7A 3RH3A 1TWCA 1ORSC 5EHHA 3KYIA 3TOLA 5AC5A 1S05A 3GANA 1HW1A 2HV6A 4K7BA 2CGEA 5L0DA 3HNLA 4MTOA 3AGTA 3LAYA 2QLAA 3DD7A 4JRZA 1VYKA 3QVYA 1M57C 2W9YA 4EUKB 1V4AA 3C8GD 3EFOB 1D0YA 2Y3DA 2ZXRA 4I44A 2L6FA 1QLEC 3FOOA 4NY3A 4OD5A 3S0XA 3ZG1A 4JJFA 4C3BA 1D0ZA 2PNOA 2ZPAA 5JSLA 4JW1A 3X1OA 3UGOA 3NG1A 4DJ9A 1E85A 4NTFA 2HZ8A 2YLIA 3S29A 3FAJA 4MW8A 4E7ZA 4AK9A 3Q6NA 3QTHA 2IBFA 1VTMP 1MMAA 2NSFA 3RVZA 4JTAB 1OW6A 4OIOF 2HV7A 3DM5A 1V74B 2P7VA 3JCUQ 4MVRA 3TK0A 3WODF 5A6BA 2D4UA 5JVEA 1KTMA 1FAPB 3EZIA 2EPOA 4EWCA 1S7ZA 3T6GB 2NUPB 1YYXA 2P0NA 2Q9AA 4FWVA 1V55C 2HUJA 3GORA 1KNYA 3RF3A 2XLWA 4OIRF 4CS7A 1T9KA 1YA7O 2KYHA 3M1CB 1RMVA 2HKVA 2RD9A 1D1BA 4MW3A 1G8XA 4BEMJ 3FVYA 1MMDA 2YL3A 3U2MA 2R7UA 2H7VC 3ASOC 5L0FA 1K40A 4YT5A 3HNKA 4UDVA 3IHUA 1T01A 3B0PA 4BJ5A 2OEVA 2HMZA 5JP7A 1H6GA 1ZYRF 2LD6A 3JRMO 3DJNB 2XLEA 2X51A 3A9CA 5E3CA 3JT1A 4GQHA 4JJGA 4MVQA 4DRJB 5D92A 3ABKC 2CW0F 2LFDA 3C8GA 3EHNA 1TWGA 2YKZA 1OW7A 3JYYA 3OA1A 3LLKA 4J32B 3J06A 1FR0A 2EPKX 2BE5F 4CS8A 3ASNC 1TWAA 3U0CA 1ZHXA 4F4BA 3MYFA 3SYNA 1IW7F 1YVIA 4N6CA 5D91A 2Q9BA 3BRJA 3EFOA 1NG1A 4HEAJ 5BQIA 2KSFA 3Q6MA 5A6AA 2L81A 4G78A 3UGPA 3NMKA 4H4KC 3B29A 1O87A 1QQ3A 5B1AC 1ZHTA 3F47A 1SMYF 4B6IA 1NLXA 2YZSA 3U9JA 1BR4A 3RQEA 1MNDA 5FCLA 1H9TA 2XXAB 3QW0A 3HKKA 5KYWB 2X0CA 3H65A 3TJ5A 1IZMA 4IB4A 3RFYA 3T6JA 2HJMA 3FAPB 3R7CA 2EIKC 1HY5A 1O3UA 2KK1A 2WB7A 2WZGA 3R2PA 3U5SA 3KKBA 4WGZA 3TOMA 3O39A 1UFBA 2H7OA 1GS9A 4HFFB 3IQ5A 4QDLA 2PP4A 5B1BC 3EGXA 4IARA 3T6BA 5BQHA 4EBJA 1E86A 1RCPA 1OR2A 4U9EA 5K0IA 5B3IA 4IAOA 1Z63A 1SF8A 1YJGA 1LS1A 2PX3A 4D4XA 3JYHA 2I8BA 3AG2C 2J7PA 4H54A 2QE9A 2J8WA 3ZSUA 4QI0A 1GM5A 3RIPA 1CGNA 3LNRA 1HMOA 1ZHYA 1YAUO 3NKDA 1I4YA 2DI3A 3EGDA 3M4BA 4IRUA 4MNDA 3SZRA 2FFHA 1HMDA 2YL1A 2CCYA 1M6TA 2OOCA 3HJCA 2AU5A 3C7JA 1ORYA 4XTKA 4XPXA 1M2VB 5EK0A 1AEPA 1M2VA 2V26A 2UUHA 3ZWIA 2IM8A 4K0DA 1OKKA 1SR2A 1RJ9A 4EKWA 4YJWA 1PD0A 2UUIA 1GGQA 2DB4A 2QUPA 3ZQVA 4YT2A 2J45A 3JSZA 5EGYA 5A69A 2XLHA 1APCA 2VC9A 2ZXPA 5A6JA 1VLSA 1TWHA 4RDAA 1Q0KA 1V54C 4E0IA 4XEFA 1FFHA 3GODA 1BR1A 3C8ZA 4MVOA 3T9OA 3IQCA 2LQGA 2XM0A 1RKCA 3GM1A 4MQ9F 5T3WA 3TQOA 3AGUA 1R4TA 5DS4A 4PJLA 3RKOF 3MBGA 4CDAA 1ZVZA 3US6A 2WVOA 2A69F 3S27A 4Z9JA 1XWJA 4CS8C 4MVUA 1JR8A 1LS4A 2R7QA 2MHRA 3EH2A 4PR9A 5E33A 5JS5A 2XS8A 2LK4A 4E18A 2R7SA 5L3QA 2MWQA 5CI9A 1LIHA 3SEOA 1U0BB 4LDKA 1ORJA 1JAFA 1VMAA 1LVKA 2NG1A 3JSEO 2OEXA 4YL0A 4Q7CA 3U9MA 4OIPF 1C17M 2CDQA 4OINF 3O55A 5E3AA 3DKAA 1NFNA 2J9WA 2L6GA 1OCRC 3I4UA 1CPRA 2A0UA 2C04A 2J9UA 2IYLD 4U9DA 1LI7A 1T5OA 1W2WA 2DGJA 3GEHA 3VM6A 3W8IA 3LUTB 2WVQA 2ZD9A 5CI8A 5L0JA 4U5HA 1O5HA 3HTKC 2YVKA 3U3FA 3SNHA
chains in the Genus database with same CATH topology
4KNVA 4QI2A 3K1IC 2Q3TA 2IXNA 3W2VA 3FHDA 3Q7GA 2OCCC 4P6IC 3DAGA 1TKNA 2KNHA 2QY9A 3EGXB 4U5EE 4O6NA 3EH1A 4C3EA 2Y3GA 4E7SA 4GYTA 4U5FE 4ZLDA 3MX3A 2R7OA 2KGOA 3F46A 4AE4A 3IEEA 4DOZA 5KYXA 1OCCC 3EG9B 1TR2A 4DBQA 4U5DE 5DVWA 4PK4A 2J7PD 2WZFA 1NZEA 2PX0A 2W4BA 5DQTA 1FMVA 5DQZA 3DAFA 2VB6A 1ZHWA 2WVNA 4PJMA 1D1CA 2B0JA 1MMNA 2GFHA 1MNEA 5T3TA 3ZVRA 2G3VA 4G7ZF 4OD4A 3N0TA 1NU7D 3ECSA 3N24A 3K66A 1J8YF 5B3SC 4XLNF 4C3DA 4JVSA 2V3CC 4G0HA 2ZXWC 4YT4A 4W8KA 3UR3C 4U5GA 4CBEA 3LLIA 4N06A 4KC9A 3UMIA 3PMRA 2IOQA 3UMKA 3K1HA 3K7DA 3NKEA 4O6MA 4XWJA 3POVA 1ZU5A 1JPJA 2G62A 1JPNA 1FFTC 1Z6AA 1ZU4A 2QTVA 4DBRA 3ITFA 3KMIA 4CSAA 1VYIA 3UMHA 2R7VA 1FTSA 2YEVA 5KYXB 4O79A 3DMDA 1PCXA 2G3KA 2FGYA 2R7XA 3MLGA 4U5CE 4DVZA 1D1AA 2PF4E 4PFPA 3TD7A 5HSWA 5L3VA 2J46A 3RYLA 4BEJA 2KJGA 3NYJA 4YN0B 3ABLC 3VYWA 3KL4A 3LS1A 1WGWA 4KNWA 1ZHZA 3ABMC 4G7OF 4ULWA 2M4EA 2IXMA 2MYSA 4J30B 3NYLA 5DS5A 3VAYA 3L0IA 2EIMC 1J8MF 3V7OA 2A68F 3B0VC 3EGDB 2J0XA 3X2QC 3QZCA 4I3MA 3I5QA 3EQLF 2IXPA 3PHF2 2J9VA 3O6XA 1FMWA 4LACB 5T1DB 4PJNA 4BJ6A 4CS9A 3NDBB 2WL8A 2A1DD 1Z3IX 2CNWA 2KQ9A 2PFDA 2Z15A 5KYYB 5F5HA 2VASA 3AG1C 3LJBA 2H7BA 4PFOA 4I1MA 4CIHA 2CNWD 2XXAA 3Q7LA 4YWQA 4Q4ZF 4IJJA 2J0WA 3SP1A 3JRTA 2WZLA 4Q5SF 2P6VA 3K33A 4U5BE 2Y3HA 3ZC4A 4FX5A 3DXJF 4RBNA 2EIJC 4AE4B 4LERA 3UNGC 4OIQF 1ST6A 2C03A 4GEHA 3W8HA 1KU2A 1D0XA 3AQCA 1Z23A 1SZIA 1M56C 3EHMA 3DM9B 4A2NB 4CSAC 2ZXOA 4LLEA 3EPVA 4ZLCA 3WG7C 3CSKA 5KYYA 2NUTA 4X0RA 3L34A 4C7OA 4BJ5C 3K6BA 4KI2A 3B0UX 2Y3BA 3ZIBA 4WJ0A 1OCZC 5KYWA 2XSEA 5F5FA 2L9JA 3N2ZB 3I5PA 4JCHA 4JZAA 4RD9A 3KH2A 4EBBA 5IY5C 2DYSC 2D5RB 2O9XA 2Q9CA 3DZAA 4PJJA 3LEVA 2R7TA 3OEOA 4I1OB 3QMKA 4JURI 2R7RA 1QZXA 4KBLA 3AQBA 3HLZA 4XLPF 1MMGA 3AG3C 3CQZA 3LS0A 1VOMA 4LLCA 4BJ6C 4CS9C 5E2QA 2Y39A 2Y69C 1OKKD 2JD3A 3EJNA 2VH3A 4BJ1A 1NU9C 3NYMA 5BUOA 2NUPA 3DJUB 2NUTB 2A6EF 1OCOC 3E9VA 3EZHA 2OG2A 2W4MA 4FESA 4G7HF 3S28A 5KYNA 1VK5A 3EG9A 4IWBA 2YHSA 4BJTA 2IXOA 2W45A 5DLJA 4ANJA 2A6HF 1PD1A 4DVYP 4YT8A 1N1CA 2EILC 4HFKB 2R7WA 2EINC 3CZ6A 1RJ9B 2LSEA 2XL4A 2KW3C 3T4RA 2E87A 3OWTA 5DS6A 4C7OB 4O7GA 1LKXA 1BR2A 1M2OA 3AG4C 4M63A 5KYUA 4O6YA 4BG0A 3B9QA 5KYUB 1Z5ZA 2DYRC 3E70C 4AX2A 2XRHA 3FDQA 3LESA 3NRHA 3W2WA 4HE8D 3RH3A 1TWCA 5EHHA 3GANA 2HV6A 4K7BA 2CGEA 3LAYA 3DD7A 1VYKA 1M57C 2W9YA 3EFOB 1D0YA 2Y3DA 4I44A 2ZXRA 4OD5A 1QLEC 4NY3A 3S0XA 3ZG1A 4JJFA 4C3BA 1D0ZA 3X1OA 2ZPAA 3UGOA 4JW1A 3NG1A 3S29A 3FAJA 4E7ZA 4AK9A 3Q6NA 1MMAA 4OIOF 2HV7A 3DM5A 3WODF 2P7VA 3JCUQ 3EZIA 4EWCA 1S7ZA 2NUPB 2Q9AA 4FWVA 1V55C 4OIRF 4CS7A 3M1CB 1D1BA 1G8XA 3FVYA 1MMDA 2R7UA 2H7VC 3ASOC 4YT5A 3B0PA 4BJ5A 1ZYRF 3DJNB 2X51A 5E3CA 3JT1A 4JJGA 5D92A 3ABKC 2CW0F 3EHNA 1TWGA 4J32B 3OA1A 3LLKA 2BE5F 4CS8A 3ASNC 1TWAA 1ZHXA 4F4BA 3SYNA 1IW7F 5D91A 2Q9BA 4HEAJ 1NG1A 3EFOA 3Q6MA 3UGPA 2L81A 4H4KC 1O87A 5B1AC 1ZHTA 3F47A 1SMYF 4B6IA 5FCLA 2YZSA 1BR4A 1MNDA 2XXAB 5KYWB 3H65A 1IZMA 3RFYA 3T6JA 2EIKC 2WB7A 2WZGA 3KKBA 3O39A 2H7OA 4HFFB 4QDLA 5B1BC 2PP4A 3EGXA 3T6BA 4IAOA 1Z63A 1SF8A 1LS1A 2PX3A 3JYHA 2I8BA 3AG2C 2J7PA 3ZSUA 4QI0A 3RIPA 3LNRA 1ZHYA 3NKDA 4IRUA 3EGDA 4MNDA 3SZRA 2FFHA 3HJCA 4XTKA 1M2VB 1M2VA 2V26A 4K0DA 1OKKA 1RJ9A 4YJWA 1PD0A 4YT2A 2J45A 3JSZA 5EGYA 2ZXPA 1TWHA 4RDAA 1V54C 1FFHA 3GODA 1BR1A 4MQ9F 5T3WA 5DS4A 4PJLA 3RKOF 2WVOA 2A69F 3S27A 4CS8C 5E33A 2R7QA 3EH2A 2R7SA 5L3QA 2MWQA 5CI9A 3SEOA 1VMAA 1LVKA 2NG1A 4Q7CA 4OIPF 2CDQA 4OINF 5E3AA 2J9WA 1OCRC 3I4UA 2C04A 2J9UA 2IYLD 1W2WA 2DGJA 3W8IA 2WVQA 5CI8A 4U5HA 1O5HA 3HTKC 3SNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9U A;  2J9W A;  2J9V A;  2G3K A; 
#chains in the Genus database with same CATH topology
 4KNV A;  4QI2 A;  3K1I C;  2Q3T A;  1RXQ A;  2ASR A;  1BZ4 A;  2IXN A;  3W2V A;  1LE4 A;  5FZT A;  4EIY A;  4CX9 A;  5CIV A;  3FHD A;  1U89 A;  2YRF A;  1PV3 A;  3Q7G A;  2OCC C;  1B68 A;  3DE8 A;  2LIG A;  2XLD A;  1NBB A;  4P6I C;  3DAG A;  1TKN A;  2KNH A;  5L0C A;  2QY9 A;  3EGX B;  2AWC A;  3S84 A;  1G5Z A;  4U5E E;  4O6N A;  3EH1 A;  1WAT A;  4C3E A;  2H8A A;  2Y3G A;  4E7S A;  4GYT A;  4DRI B;  5JLI A;  2HFI A;  1YLM A;  3FOP A;  1E83 A;  4U5F E;  4ZLD A;  3MX3 A;  1GQA A;  4E17 A;  2R7O A;  3ZQY A;  2KGO A;  3F46 A;  4AE4 A;  3IEE A;  4DOZ A;  2GA0 A;  5KYX A;  1OCC C;  1T6I A;  2Q4F A;  4CIP A;  3EG9 B;  1TR2 A;  4DBQ A;  1TFK B;  4U5D E;  5KYU B;  3PDM P;  3GWN A;  5DVW A;  4LDR A;  4XPY A;  4PK4 A;  2J7P D;  2WZF A;  1NZE A;  2PX0 A;  2XS1 A;  2W4B A;  5DQT A;  1FMV A;  3V5Z A;  5DQZ A;  3G50 A;  2HS5 A;  3H2V A;  1JMW A;  3DAF A;  4CDV A;  2VB6 A;  1ZHW A;  2WVN A;  2RSE B;  1D1C A;  2B0J A;  4PJM A;  3SXK A;  2KC3 A;  4JE9 A;  1MMN A;  2GFH A;  1I5N A;  1MNE A;  5T3T A;  3ZVR A;  5COF A;  4ONS A;  2G3V A;  1NSG B;  4OD4 A;  4WAB A;  3K1I A;  3N0T A;  3RQG A;  4G7Z F;  1NU7 D;  3ECS A;  3N24 A;  3K66 A;  5F28 E;  1J8Y F;  5B3S C;  2OU6 A;  256B A;  4XLN F;  4C3D A;  4JVS A;  2V3C C;  3KYJ A;  4G0H A;  2ZXW C;  4YT4 A;  5L0G A;  2LFF A;  4W8K A;  3UR3 C;  4U5G A;  1I4Z A;  4CBE A;  4MVS A;  4XEV A;  3LLI A;  4N06 A;  3DWW A;  3V5Y A;  4KC9 A;  2R9R B;  3UMI A;  3PMR A;  2IOQ A;  2A0B A;  3NMJ A;  2J9B A;  3L8I A;  2YQY A;  3B71 A;  2M64 A;  1Q0D A;  1C03 A;  1ZZP A;  3UMK A;  4DXW A;  1A7D A;  3K1H A;  3K7D A;  3NKE A;  4O6M A;  4XWJ A;  3RW0 A;  3C18 A;  3CAX A;  3POV A;  1ZU5 A;  1F1M A;  1JPJ A;  2BC5 A;  2G62 A;  3G4Z A;  4XEK A;  1JPN A;  3U8P A;  1FFT C;  3MFN A;  1QSP A;  1Z6A A;  1ZU4 A;  2QTV A;  4DBR A;  3ITF A;  3KMI A;  3QW1 A;  1VYI A;  4CSA A;  3UMH A;  2AVK A;  2R7V A;  1FTS A;  2EPN A;  2YEV A;  3U3B A;  1RKE A;  3LNM B;  5KYX B;  3FXH A;  3AJM A;  4O79 A;  3DMD A;  1PCX A;  2G3K A;  2FGY A;  2VCC A;  3CEX A;  1U6H A;  3MLG A;  1D1A A;  4U5C E;  4DVZ A;  2FAP B;  2PF4 E;  1YA9 A;  4PFP A;  3TD7 A;  3U8V A;  5L3V A;  5HSW A;  2J46 A;  4JC7 A;  3RYL A;  1XZP A;  2XL6 A;  2YLD A;  4BEJ A;  2KJG A;  3WAQ A;  3U2L A;  3NYJ A;  4YN0 B;  3ABL C;  1ZW3 A;  3KL4 A;  3LS1 A;  1WGW A;  3NMI A;  1ZHZ A;  3ABM C;  4KNW A;  5GPG B;  3VYW A;  4ULW A;  4G7O F;  3DE9 A;  2M4E A;  2IXM A;  2MYS A;  4J30 B;  3PCV A;  5A6B D;  3NYL A;  2XLV A;  3VAY A;  2R03 A;  3L8J A;  3L0I A;  5DS5 A;  1OXB A;  2EIM C;  1J8M F;  1WN0 A;  3V7O A;  2NPU A;  2A68 F;  4L6R A;  4N6H A;  1A7V A;  4AL0 A;  3B0V C;  4YL1 A;  2OJE D;  1OXK A;  3EGD B;  2J0X A;  3X2Q C;  2B0H A;  3QZC A;  4NC3 A;  3WHN A;  5HV9 A;  1NFO A;  4I3M A;  3I5Q A;  3EQL F;  1YZA A;  1Y4C A;  2HMQ A;  3ZTM A;  2AP3 A;  2IXP A;  1AUE A;  4YL3 A;  3PHF 2;  2J9V A;  3MYI A;  3ATP A;  1XZQ A;  2ICW G;  3A11 A;  3O6X A;  3RQF A;  1FMW A;  1OQC A;  2XLO A;  4J7Y A;  4LAC B;  5T1D B;  2YLG A;  4IAQ A;  1Q0G A;  2OKU A;  4PJN A;  4BJ6 A;  4CS9 A;  5JUA A;  3NDB B;  4MVZ A;  2WL8 A;  2A1D D;  4JTC B;  2R05 A;  1Z3I X;  1UG7 A;  2CNW A;  2KQ9 A;  2PFD A;  2Z15 A;  4JEB A;  5F5H A;  2VAS A;  3AG1 C;  3LJB A;  3VRC A;  5KYY B;  1EKY A;  2H7B A;  2GDC A;  1LI5 A;  4P9T A;  2P61 A;  4NTA A;  4PFO A;  5JT4 A;  4WGY A;  4Z9H A;  2EPL X;  4I1M A;  4CIH A;  1G4W R;  2CNW D;  2XXA A;  2F22 A;  1C02 A;  3Q7L A;  4Z9I A;  4EBK A;  4YWQ A;  1AVO B;  5COM A;  4DRH B;  1TQG A;  1YYJ A;  3H2U A;  1LE2 A;  3KPH A;  2GAQ A;  2GWW A;  4Q4Z F;  1VLT A;  4IJJ A;  5L0H A;  2J0W A;  4MVM A;  3C62 A;  3SP1 A;  5JRA A;  1DOW A;  3JRT A;  2WZL A;  4C7O B;  4Q5S F;  1QPU A;  2P6V A;  3K33 A;  3ZDL A;  4U5B E;  2XM4 A;  4CJO A;  2Y3H A;  2L7A A;  4NTB A;  3ZC4 A;  4FX5 A;  3DXJ F;  4RBN A;  2EIJ C;  1YDI A;  3M4C A;  4AE4 B;  4LER A;  2JX0 A;  2YWA A;  2YL0 A;  3UNG C;  2LCH A;  4OIQ F;  1TFO B;  1LM3 B;  3V5X A;  5L0I A;  1ST6 A;  2C03 A;  3GWL A;  4GEH A;  1MQV A;  3W8H A;  1JRA A;  1KU2 A;  3S9O A;  2BL2 A;  1D0X A;  3AQC A;  3GEI A;  4A4A A;  1Z23 A;  1SZI A;  4JCZ A;  1M56 C;  3EHM A;  1LPE A;  4ER9 A;  5AGF A;  1YAR O;  3DM9 B;  4A2N B;  4CSA C;  4JIO A;  2ZXO A;  2TMV P;  4MTF A;  1WOL A;  1L3P A;  1SYQ A;  4LLE A;  3EPV A;  4ZLC A;  2PBE A;  3FMS A;  4XQ1 A;  3WG7 C;  3CSK A;  2I15 A;  5KYY A;  2NUT A;  2VCA A;  4X0R A;  2XLM A;  3L34 A;  1WAS A;  4NQF A;  4C7O A;  1DOV A;  4BJ5 C;  3K6B A;  4KI2 A;  3B0U X;  4J7T A;  2Y3B A;  4PAC A;  3ZIB A;  4WJ0 A;  1OCZ C;  4JKV A;  1OR3 A;  5KYW A;  3QVZ A;  5COG A;  3ZTZ A;  2XSE A;  3TUL A;  1H9G A;  5F5F A;  4E0H A;  4CJG A;  2L9J A;  3DI5 A;  3N2Z B;  1H7I A;  4D4N A;  3I5P A;  4JCH A;  4JZA A;  1CGO A;  3M79 A;  4RD9 A;  3KH2 A;  4FAP B;  4EBB A;  5IY5 C;  1CPQ A;  2D5R B;  2DYS C;  2O9X A;  3GM2 A;  3TJ6 A;  2Q9C A;  4N4W A;  1Z7Q c;  4EHP A;  3DZA A;  3G4X A;  4PJJ A;  1A7E A;  3LEV A;  2R02 A;  3VF0 A;  1T6U A;  2R7T A;  3M15 A;  3OEO A;  4I1O B;  3QMK A;  4JUR I;  1FNT c;  2R7R A;  1HE1 A;  1QZX A;  4KBL A;  3AQB A;  3IQ6 A;  3HLZ A;  3JTL O;  4IGG A;  4ULV A;  4XLP F;  1MMG A;  2HSB A;  3AG3 C;  3CQZ A;  3S90 A;  4BPM A;  3LS0 A;  1VOM A;  4LLC A;  3SXY A;  4BJ6 C;  4CS9 C;  3L1M A;  1EA8 A;  1K04 A;  1OW8 A;  5E2Q A;  4JEA A;  2Y39 A;  1T6Q A;  4K1O A;  1VB5 A;  1QKR A;  1WWP A;  2Q00 A;  2Y69 C;  1OKK D;  4YK5 A;  2AWY A;  2JD3 A;  2OJQ A;  1QVX A;  3EJN A;  4W8P A;  2VH3 A;  4BJ1 A;  1NU9 C;  3NYM A;  3HNJ A;  5BUO A;  4P9F A;  2NUP A;  3DJU B;  3W4Y A;  2LP4 A;  2R7X A;  3JZ0 A;  2NUT B;  1BBH A;  1K05 A;  2A6E F;  1ZW2 A;  1E84 A;  1OCO C;  3E9V A;  1L7C A;  3EZH A;  2HSQ A;  2OG2 A;  2W4M A;  3GM3 A;  3IQT A;  4FES A;  4G7H F;  4R32 A;  3S28 A;  1CGM E;  1HW2 A;  1RKE B;  2R25 A;  1VK5 A;  5KYN A;  3HNI A;  3EG9 A;  2YL7 A;  2XL8 A;  2YHS A;  4IWB A;  2VCB A;  4BJT A;  1JOG A;  2IXO A;  2W45 A;  2CYD A;  2P1A A;  5DLJ A;  2ETS A;  4JTD B;  4ANJ A;  3AOU A;  2A6H F;  3C8G B;  1PD1 A;  4DVY P;  4YT8 A;  1N1C A;  2EIL C;  2NSG A;  4HFK B;  4LDQ A;  1A0B A;  2R7W A;  1Y6D A;  2EIN C;  2HJ3 A;  5A6K A;  3CZ6 A;  1Q0F A;  1G4U S;  1A41 A;  1RJ9 B;  2Q7R A;  2LSE A;  2XL4 A;  5AC4 A;  2KW3 C;  2OQM A;  2QNL A;  5TJ5 E;  3T4R A;  4XPW A;  2E87 A;  3OWT A;  3O10 A;  1R5I D;  3BEH A;  4O7G A;  3SXM A;  1BDJ B;  5DS6 A;  1LKX A;  1BR2 A;  1M2O A;  3LEO A;  1E2X A;  2EPM X;  1HE9 A;  3AG4 C;  4M63 A;  5KYU A;  3GEE A;  5BQG A;  1YZC A;  4O6Y A;  3SXZ A;  1WTY A;  3B9Q A;  3C63 A;  4BG0 A;  1Z5Z A;  1Q0M A;  2DYR C;  3E70 C;  4NCQ A;  3IPM O;  4AX2 A;  4AL1 A;  2XRH A;  3FDQ A;  4CDY A;  3LES A;  3NRH A;  3W2W A;  1EQ1 A;  2JPU A;  4HE8 D;  4MS2 A;  4MTG A;  3RVY A;  2L6H A;  1EI7 A;  3RH3 A;  1TWC A;  1ORS C;  5EHH A;  3KYI A;  3TOL A;  5AC5 A;  1S05 A;  3GAN A;  1HW1 A;  2HV6 A;  4K7B A;  2CGE A;  5L0D A;  3HNL A;  4MTO A;  3AGT A;  3LAY A;  2QLA A;  3DD7 A;  4JRZ A;  1VYK A;  3QVY A;  1M57 C;  2W9Y A;  4EUK B;  1V4A A;  3C8G D;  3EFO B;  1D0Y A;  2Y3D A;  2ZXR A;  4I44 A;  2L6F A;  1QLE C;  3FOO A;  4NY3 A;  4OD5 A;  3S0X A;  3ZG1 A;  4JJF A;  4C3B A;  1D0Z A;  2PNO A;  2ZPA A;  5JSL A;  4JW1 A;  3X1O A;  3UGO A;  3NG1 A;  4DJ9 A;  1E85 A;  4NTF A;  2HZ8 A;  2YLI A;  3S29 A;  3FAJ A;  4MW8 A;  4E7Z A;  4AK9 A;  3Q6N A;  3QTH A;  2IBF A;  1VTM P;  1MMA A;  2NSF A;  3RVZ A;  4JTA B;  1OW6 A;  4OIO F;  2HV7 A;  3DM5 A;  1V74 B;  2P7V A;  3JCU Q;  4MVR A;  3TK0 A;  3WOD F;  5A6B A;  2D4U A;  5JVE A;  1KTM A;  1FAP B;  3EZI A;  2EPO A;  4EWC A;  1S7Z A;  3T6G B;  2NUP B;  1YYX A;  2P0N A;  2Q9A A;  4FWV A;  1V55 C;  2HUJ A;  3GOR A;  1KNY A;  3RF3 A;  2XLW A;  4OIR F;  4CS7 A;  1T9K A;  1YA7 O;  2KYH A;  3M1C B;  1RMV A;  2HKV A;  2RD9 A;  1D1B A;  4MW3 A;  1G8X A;  4BEM J;  3FVY A;  1MMD A;  2YL3 A;  3U2M A;  2R7U A;  2H7V C;  3ASO C;  5L0F A;  1K40 A;  4YT5 A;  3HNK A;  4UDV A;  3IHU A;  1T01 A;  3B0P A;  4BJ5 A;  2OEV A;  2HMZ A;  5JP7 A;  1H6G A;  1ZYR F;  2LD6 A;  3JRM O;  3DJN B;  2XLE A;  2X51 A;  3A9C A;  5E3C A;  3JT1 A;  4GQH A;  4JJG A;  4MVQ A;  4DRJ B;  5D92 A;  3ABK C;  2CW0 F;  2LFD A;  3C8G A;  3EHN A;  1TWG A;  2YKZ A;  1OW7 A;  3JYY A;  3OA1 A;  3LLK A;  4J32 B;  3J06 A;  1FR0 A;  2EPK X;  2BE5 F;  4CS8 A;  3ASN C;  1TWA A;  3U0C A;  1ZHX A;  4F4B A;  3MYF A;  3SYN A;  1IW7 F;  1YVI A;  4N6C A;  5D91 A;  2Q9B A;  3BRJ A;  3EFO A;  1NG1 A;  4HEA J;  5BQI A;  2KSF A;  3Q6M A;  5A6A A;  2L81 A;  4G78 A;  3UGP A;  3NMK A;  4H4K C;  3B29 A;  1O87 A;  1QQ3 A;  5B1A C;  1ZHT A;  3F47 A;  1SMY F;  4B6I A;  1NLX A;  2YZS A;  3U9J A;  1BR4 A;  3RQE A;  1MND A;  5FCL A;  1H9T A;  2XXA B;  3QW0 A;  3HKK A;  5KYW B;  2X0C A;  3H65 A;  3TJ5 A;  1IZM A;  4IB4 A;  3RFY A;  3T6J A;  2HJM A;  3FAP B;  3R7C A;  2EIK C;  1HY5 A;  1O3U A;  2KK1 A;  2WB7 A;  2WZG A;  3R2P A;  3U5S A;  3KKB A;  4WGZ A;  3TOM A;  3O39 A;  1UFB A;  2H7O A;  1GS9 A;  4HFF B;  3IQ5 A;  4QDL A;  2PP4 A;  5B1B C;  3EGX A;  4IAR A;  3T6B A;  5BQH A;  4EBJ A;  1E86 A;  1RCP A;  1OR2 A;  4U9E A;  5K0I A;  5B3I A;  4IAO A;  1Z63 A;  1SF8 A;  1YJG A;  1LS1 A;  2PX3 A;  4D4X A;  3JYH A;  2I8B A;  3AG2 C;  2J7P A;  4H54 A;  2QE9 A;  2J8W A;  3ZSU A;  4QI0 A;  1GM5 A;  3RIP A;  1CGN A;  3LNR A;  1HMO A;  1ZHY A;  1YAU O;  3NKD A;  1I4Y A;  2DI3 A;  3EGD A;  3M4B A;  4IRU A;  4MND A;  3SZR A;  2FFH A;  1HMD A;  2YL1 A;  2CCY A;  1M6T A;  2OOC A;  3HJC A;  2AU5 A;  3C7J A;  1ORY A;  4XTK A;  4XPX A;  1M2V B;  5EK0 A;  1AEP A;  1M2V A;  2V26 A;  2UUH A;  3ZWI A;  2IM8 A;  4K0D A;  1OKK A;  1SR2 A;  1RJ9 A;  4EKW A;  4YJW A;  1PD0 A;  2UUI A;  1GGQ A;  2DB4 A;  2QUP A;  3ZQV A;  4YT2 A;  2J45 A;  3JSZ A;  5EGY A;  5A69 A;  2XLH A;  1APC A;  2VC9 A;  2ZXP A;  5A6J A;  1VLS A;  1TWH A;  4RDA A;  1Q0K A;  1V54 C;  4E0I A;  4XEF A;  1FFH A;  3GOD A;  1BR1 A;  3C8Z A;  4MVO A;  3T9O A;  3IQC A;  2LQG A;  2XM0 A;  1RKC A;  3GM1 A;  4MQ9 F;  5T3W A;  3TQO A;  3AGU A;  1R4T A;  5DS4 A;  4PJL A;  3RKO F;  3MBG A;  4CDA A;  1ZVZ A;  3US6 A;  2WVO A;  2A69 F;  3S27 A;  4Z9J A;  1XWJ A;  4CS8 C;  4MVU A;  1JR8 A;  1LS4 A;  2R7Q A;  2MHR A;  3EH2 A;  4PR9 A;  5E33 A;  5JS5 A;  2XS8 A;  2LK4 A;  4E18 A;  2R7S A;  5L3Q A;  2MWQ A;  5CI9 A;  1LIH A;  3SEO A;  1U0B B;  4LDK A;  1ORJ A;  1JAF A;  1VMA A;  1LVK A;  2NG1 A;  3JSE O;  2OEX A;  4YL0 A;  4Q7C A;  3U9M A;  4OIP F;  1C17 M;  2CDQ A;  4OIN F;  3O55 A;  5E3A A;  3DKA A;  1NFN A;  2J9W A;  2L6G A;  1OCR C;  3I4U A;  1CPR A;  2A0U A;  2C04 A;  2J9U A;  2IYL D;  4U9D A;  1LI7 A;  1T5O A;  1W2W A;  2DGJ A;  3GEH A;  3VM6 A;  3W8I A;  3LUT B;  2WVQ A;  2ZD9 A;  5CI8 A;  5L0J A;  4U5H A;  1O5H A;  3HTK C;  2YVK A;  3U3F A;  3SNH A; 
#chains in the Genus database with same CATH homology
 4KNV A;  4QI2 A;  3K1I C;  2Q3T A;  2IXN A;  3W2V A;  3FHD A;  3Q7G A;  2OCC C;  4P6I C;  3DAG A;  1TKN A;  2KNH A;  2QY9 A;  3EGX B;  4U5E E;  4O6N A;  3EH1 A;  4C3E A;  2Y3G A;  4E7S A;  4GYT A;  4U5F E;  4ZLD A;  3MX3 A;  2R7O A;  2KGO A;  3F46 A;  4AE4 A;  3IEE A;  4DOZ A;  5KYX A;  1OCC C;  3EG9 B;  1TR2 A;  4DBQ A;  4U5D E;  5DVW A;  4PK4 A;  2J7P D;  2WZF A;  1NZE A;  2PX0 A;  2W4B A;  5DQT A;  1FMV A;  5DQZ A;  3DAF A;  2VB6 A;  1ZHW A;  2WVN A;  4PJM A;  1D1C A;  2B0J A;  1MMN A;  2GFH A;  1MNE A;  5T3T A;  3ZVR A;  2G3V A;  4G7Z F;  4OD4 A;  3N0T A;  1NU7 D;  3ECS A;  3N24 A;  3K66 A;  1J8Y F;  5B3S C;  4XLN F;  4C3D A;  4JVS A;  2V3C C;  4G0H A;  2ZXW C;  4YT4 A;  4W8K A;  3UR3 C;  4U5G A;  4CBE A;  3LLI A;  4N06 A;  4KC9 A;  3UMI A;  3PMR A;  2IOQ A;  3UMK A;  3K1H A;  3K7D A;  3NKE A;  4O6M A;  4XWJ A;  3POV A;  1ZU5 A;  1JPJ A;  2G62 A;  1JPN A;  1FFT C;  1Z6A A;  1ZU4 A;  2QTV A;  4DBR A;  3ITF A;  3KMI A;  4CSA A;  1VYI A;  3UMH A;  2R7V A;  1FTS A;  2YEV A;  5KYX B;  4O79 A;  3DMD A;  1PCX A;  2G3K A;  2FGY A;  2R7X A;  3MLG A;  4U5C E;  4DVZ A;  1D1A A;  2PF4 E;  4PFP A;  3TD7 A;  5HSW A;  5L3V A;  2J46 A;  3RYL A;  4BEJ A;  2KJG A;  3NYJ A;  4YN0 B;  3ABL C;  3VYW A;  3KL4 A;  3LS1 A;  1WGW A;  4KNW A;  1ZHZ A;  3ABM C;  4G7O F;  4ULW A;  2M4E A;  2IXM A;  2MYS A;  4J30 B;  3NYL A;  5DS5 A;  3VAY A;  3L0I A;  2EIM C;  1J8M F;  3V7O A;  2A68 F;  3B0V C;  3EGD B;  2J0X A;  3X2Q C;  3QZC A;  4I3M A;  3I5Q A;  3EQL F;  2IXP A;  3PHF 2;  2J9V A;  3O6X A;  1FMW A;  4LAC B;  5T1D B;  4PJN A;  4BJ6 A;  4CS9 A;  3NDB B;  2WL8 A;  2A1D D;  1Z3I X;  2CNW A;  2KQ9 A;  2PFD A;  2Z15 A;  5KYY B;  5F5H A;  2VAS A;  3AG1 C;  3LJB A;  2H7B A;  4PFO A;  4I1M A;  4CIH A;  2CNW D;  2XXA A;  3Q7L A;  4YWQ A;  4Q4Z F;  4IJJ A;  2J0W A;  3SP1 A;  3JRT A;  2WZL A;  4Q5S F;  2P6V A;  3K33 A;  4U5B E;  2Y3H A;  3ZC4 A;  4FX5 A;  3DXJ F;  4RBN A;  2EIJ C;  4AE4 B;  4LER A;  3UNG C;  4OIQ F;  1ST6 A;  2C03 A;  4GEH A;  3W8H A;  1KU2 A;  1D0X A;  3AQC A;  1Z23 A;  1SZI A;  1M56 C;  3EHM A;  3DM9 B;  4A2N B;  4CSA C;  2ZXO A;  4LLE A;  3EPV A;  4ZLC A;  3WG7 C;  3CSK A;  5KYY A;  2NUT A;  4X0R A;  3L34 A;  4C7O A;  4BJ5 C;  3K6B A;  4KI2 A;  3B0U X;  2Y3B A;  3ZIB A;  4WJ0 A;  1OCZ C;  5KYW A;  2XSE A;  5F5F A;  2L9J A;  3N2Z B;  3I5P A;  4JCH A;  4JZA A;  4RD9 A;  3KH2 A;  4EBB A;  5IY5 C;  2DYS C;  2D5R B;  2O9X A;  2Q9C A;  3DZA A;  4PJJ A;  3LEV A;  2R7T A;  3OEO A;  4I1O B;  3QMK A;  4JUR I;  2R7R A;  1QZX A;  4KBL A;  3AQB A;  3HLZ A;  4XLP F;  1MMG A;  3AG3 C;  3CQZ A;  3LS0 A;  1VOM A;  4LLC A;  4BJ6 C;  4CS9 C;  5E2Q A;  2Y39 A;  2Y69 C;  1OKK D;  2JD3 A;  3EJN A;  2VH3 A;  4BJ1 A;  1NU9 C;  3NYM A;  5BUO A;  2NUP A;  3DJU B;  2NUT B;  2A6E F;  1OCO C;  3E9V A;  3EZH A;  2OG2 A;  2W4M A;  4FES A;  4G7H F;  3S28 A;  5KYN A;  1VK5 A;  3EG9 A;  4IWB A;  2YHS A;  4BJT A;  2IXO A;  2W45 A;  5DLJ A;  4ANJ A;  2A6H F;  1PD1 A;  4DVY P;  4YT8 A;  1N1C A;  2EIL C;  4HFK B;  2R7W A;  2EIN C;  3CZ6 A;  1RJ9 B;  2LSE A;  2XL4 A;  2KW3 C;  3T4R A;  2E87 A;  3OWT A;  5DS6 A;  4C7O B;  4O7G A;  1LKX A;  1BR2 A;  1M2O A;  3AG4 C;  4M63 A;  5KYU A;  4O6Y A;  4BG0 A;  3B9Q A;  5KYU B;  1Z5Z A;  2DYR C;  3E70 C;  4AX2 A;  2XRH A;  3FDQ A;  3LES A;  3NRH A;  3W2W A;  4HE8 D;  3RH3 A;  1TWC A;  5EHH A;  3GAN A;  2HV6 A;  4K7B A;  2CGE A;  3LAY A;  3DD7 A;  1VYK A;  1M57 C;  2W9Y A;  3EFO B;  1D0Y A;  2Y3D A;  4I44 A;  2ZXR A;  4OD5 A;  1QLE C;  4NY3 A;  3S0X A;  3ZG1 A;  4JJF A;  4C3B A;  1D0Z A;  3X1O A;  2ZPA A;  3UGO A;  4JW1 A;  3NG1 A;  3S29 A;  3FAJ A;  4E7Z A;  4AK9 A;  3Q6N A;  1MMA A;  4OIO F;  2HV7 A;  3DM5 A;  3WOD F;  2P7V A;  3JCU Q;  3EZI A;  4EWC A;  1S7Z A;  2NUP B;  2Q9A A;  4FWV A;  1V55 C;  4OIR F;  4CS7 A;  3M1C B;  1D1B A;  1G8X A;  3FVY A;  1MMD A;  2R7U A;  2H7V C;  3ASO C;  4YT5 A;  3B0P A;  4BJ5 A;  1ZYR F;  3DJN B;  2X51 A;  5E3C A;  3JT1 A;  4JJG A;  5D92 A;  3ABK C;  2CW0 F;  3EHN A;  1TWG A;  4J32 B;  3OA1 A;  3LLK A;  2BE5 F;  4CS8 A;  3ASN C;  1TWA A;  1ZHX A;  4F4B A;  3SYN A;  1IW7 F;  5D91 A;  2Q9B A;  4HEA J;  1NG1 A;  3EFO A;  3Q6M A;  3UGP A;  2L81 A;  4H4K C;  1O87 A;  5B1A C;  1ZHT A;  3F47 A;  1SMY F;  4B6I A;  5FCL A;  2YZS A;  1BR4 A;  1MND A;  2XXA B;  5KYW B;  3H65 A;  1IZM A;  3RFY A;  3T6J A;  2EIK C;  2WB7 A;  2WZG A;  3KKB A;  3O39 A;  2H7O A;  4HFF B;  4QDL A;  5B1B C;  2PP4 A;  3EGX A;  3T6B A;  4IAO A;  1Z63 A;  1SF8 A;  1LS1 A;  2PX3 A;  3JYH A;  2I8B A;  3AG2 C;  2J7P A;  3ZSU A;  4QI0 A;  3RIP A;  3LNR A;  1ZHY A;  3NKD A;  4IRU A;  3EGD A;  4MND A;  3SZR A;  2FFH A;  3HJC A;  4XTK A;  1M2V B;  1M2V A;  2V26 A;  4K0D A;  1OKK A;  1RJ9 A;  4YJW A;  1PD0 A;  4YT2 A;  2J45 A;  3JSZ A;  5EGY A;  2ZXP A;  1TWH A;  4RDA A;  1V54 C;  1FFH A;  3GOD A;  1BR1 A;  4MQ9 F;  5T3W A;  5DS4 A;  4PJL A;  3RKO F;  2WVO A;  2A69 F;  3S27 A;  4CS8 C;  5E33 A;  2R7Q A;  3EH2 A;  2R7S A;  5L3Q A;  2MWQ A;  5CI9 A;  3SEO A;  1VMA A;  1LVK A;  2NG1 A;  4Q7C A;  4OIP F;  2CDQ A;  4OIN F;  5E3A A;  2J9W A;  1OCR C;  3I4U A;  2C04 A;  2J9U A;  2IYL D;  1W2W A;  2DGJ A;  3W8I A;  2WVQ A;  5CI8 A;  4U5H A;  1O5H A;  3HTK C;  3SNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...