2J9VA

2 angstrom x-ray structure of the yeast escrt-i vps28 c-terminus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
HHHMFNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVRINKLSIGDTLTETQIRELLFDLELAYKSFYALLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 28
publication title Structural Insight Into the Escrt-I/-II Link and its Role in Mvb Trafficking.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2006-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1130 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2j9vA00
2J9VA 2J9UA 2G3KA 2J9WA
chains in the Genus database with same CATH superfamily
4JCHA 1V54C 2L9JA 3LAYA 3EGXB 2XLEA 1Y4CA 2Y3GA 1VYIA 3F47A 3R2PA 4MVMA 3U8VA 2LIGA 2W4BA 3K1IC 4G7HF 1QPUA 2P6VA 2EPKX 3MFNA 3T6BA 1CGOA 5DS4A 4BJ5C 5B3SC 2R25A 3OA1A 4WJ0A 4EWCA 2HJMA 3PMRA 4CS7A 4CX9A 4XEFA 5KYUB 3C63A 2BL2A 2EPLX 3AG3C 3A9CA 2EIJC 2W4MA 5L3VA 3W8HA 2CNWA 2LFFA 5COMA 1EA8A 3ZTZA 4DRHB 4ZLDA 2MHRA 3U5SA 3B29A 4NQFA 4IWBA 1YYJA 3Q6MA 3LEVA 1RKCA 4F4BA 5L0GA 1QSPA 4AX2A 4KNWA 2L7AA 5JSLA 2JX0A 2R7OA 2KC3A 2G3VA 1OW7A 4G78A 2WZGA 1NBBA 3EZIA 4PJNA 1H9TA 5DS5A 1LE2A 1I5NA 3HKKA 1J8YF 3K1HA 2Q00A 2QNLA 3EHMA 2FGYA 1NU9C 2IXPA 4I3MA 1MMNA 2WZFA 1T01A 3NYLA 4O6MA 3VF0A 1H9GA 3EHNA 3Q6NA 2A68F 3TD7A 1U6HA 2EILC 1Z5ZA 3V5ZA 5FCLA 2H7VC 2Q3TA 1Q0GA 3CEXA 1OXKA 3HTKC 2D4UA 5JRAA 3LLKA 3U0CA 1Q0KA 4N06A 2X0CA 1JAFA 4YN0B 2XLWA 3B71A 4I44A 4G7OF 1XZQA 3O39A 1LI7A 4CSAA 3AG2C 2L6GA 3O55A 2PBEA 3HNJA 3IQ6A 5EK0A 3RW0A 1YARO 3UMHA 2YVKA 2GA0A 1WOLA 1JMWA 1CGME 1D1BA 5K0IA 3L34A 4CS9C 1R4TA 1E84A 3LESA 3POVA 1LIHA 2J7PA 3OEOA 5D91A 2CNWD 4XPYA 4MTOA 2IXMA 4ANJA 1VMAA 5COGA 3FDQA 1Z63A 3UNGC 1MMDA 2YL0A 4OINF 3JCUQ 2GDCA 2J45A 3Q7GA 1VLTA 1HMDA 5DS6A 4E7SA 1ZVZA 2EPMX 2L6FA 2Y3DA 4MTGA 4EBKA 3EJNA 2LP4A 4KNVA 3DD7A 4JC7A 2P7VA 4J30B 2CW0F 1B68A 3ZWIA 4OIPF 2QTVA 3G4ZA 4CS8A 1RCPA 3RVZA 1J8MF 3W2WA 1LVKA 3GWLA 1AUEA 3QVYA 1PD0A 3IEEA 1YZAA 2WVNA 4AK9A 1M6TA 3AQCA 4MVQA 1Z7Qc 1D0XA 2XLOA 3GEHA 3RIPA 4A2NB 1MQVA 4JJFA 3TOLA 3MLGA 4C3DA 4E0IA 4QI2A 1NLXA 4JE9A 2IYLD 1TR2A 4XEKA 3ABMC 1C02A 1Q0MA 2RD9A 3K7DA 4YT5A 1SR2A 3ZIBA 5AC5A 5A6BA 3S90A 4XLPF 1QQ3A 2GFHA 2Y69C 3GEIA 3RH3A 4MS2A 4QDLA 3ZG1A 3MBGA 2CYDA 4DBRA 1VOMA 3GEEA 1HW1A 2B0JA 3Q7LA 5A69A 4CSAC 4LERA 1F1MA 4ONSA 4BJ6A 4KBLA 2A69F 3KKBA 1G4US 2YLDA 2J7PD 4O6YA 3G50A 1S7ZA 2WL8A 5HSWA 1ZHYA 4YL1A 4KC9A 2LK4A 1OW8A 1ST6A 4LLEA 4CIPA 1H6GA 4EKWA 1M2OA 2KYHA 2OKUA 3V7OA 2EPOA 3JT1A 2VCCA 2AP3A 2XLHA 3TK0A 2CDQA 1FMVA 1H7IA 1JPJA 4B6IA 5B3IA 3EH1A 3JSEO 5L0DA 3GORA 4BG0A 2C03A 3BEHA 4AE4A 3I4UA 4YL0A 1IW7F 5JT4A 1JRAA 4EBBA 5L0HA 2IXOA 3CAXA 4O6NA 3QW1A 4HEAJ 3SXMA 2ZXOA 4MW3A 2R7SA 2XLVA 3VM6A 2J9WA 4CS8C 1V55C 3UMIA 1GS9A 2ICWG 3DJNB 1EQ1A 2PX0A 1ZYRF 3PDMP 1LI5A 2J9UA 2KK1A 3C7JA 3FHDA 4IAQA 1GQAA 3C8ZA 3U3FA 3U3BA 5JUAA 4LDRA 3FXHA 3SYNA 4JIOA 1YVIA 5JLIA 4HFKB 2XS1A 5A6BD 2V3CC 1NFOA 1V74B 3HNIA 2FFHA 3NYJA 3KYJA 3M79A 3S84A 3E70C 2EIMC 2LSEA 3LLIA 4XEVA 3SEOA 2YL7A 1ZW2A 2NG1A 1E85A 3UGOA 3B0PA 2R03A 1FR0A 1SF8A 3S27A 3QW0A 4W8KA 1AVOB 2HUJA 3FMSA 3S29A 4W8PA 5JP7A 3DMDA 3J06A 4AE4B 1UG7A 4EBJA 4LLCA 2PX3A 2ZPAA 3NKEA 1TWHA 4DOZA 4DXWA 4BJ6C 3RKOF 3F46A 1Z23A 4KI2A 2I8BA 2UUIA 3FOOA 3GM3A 1OR3A 2J46A 1OCZC 2F22A 4DVZA 3EH2A 4Q5SF 1LM3B 3PCVA 2KW3C 2Z15A 3X2QC 3ZQYA 3M4BA 2HV6A 3WAQA 4N6CA 3ABLC 1OR2A 4NY3A 4JVSA 2EIKC 1Z3IX 2OOCA 3EZHA 3AG4C 3N24A 2J9BA 4C7OA 3ASOC 4NC3A 2YL3A 4XPWA 3JYHA 3ZC4A 4HFFB 3RFYA 1QZXA 1XZPA 3SXKA 2XSEA 4Q4ZF 2G3KA 2LQGA 4QI0A 4JKVA 2LCHA 4RBNA 2CGEA 2XM4A 2AU5A 3AGUA 3DM9B 4NCQA 2XXAA 3UR3C 1OCCC 4WGZA 4CJOA 2JPUA 5JVEA 3GODA 4K1OA 4U5DE 5KYYA 4ER9A 3K66A 3L8JA 2H7BA 2OJQA 3LJBA 3SNHA 2VASA 3MYFA 3ZQVA 3S28A 1C03A 5L0IA 2VCBA 1E2XA 1YZCA 2EPNA 2IM8A 1ZW3A 1XWJA 3IQCA 4JEAA 2HZ8A 1TWAA 1DOWA 1MMAA 1TFOB 2XLMA 5T3TA 2NUTA 4GEHA 1A7EA 3NDBB 2TMVP 2I15A 3E9VA 1LE4A 4C7OB 5FZTA 1MNEA 2A6EF 3JRMO 4NTBA 5A6AA 2Q9CA 3EGDA 2HV7A 1E86A 4LDQA 4OD5A 3ASNC 2XM0A 2R7RA 3WG7C 1JOGA 4BEJA 3WHNA 3O6XA 2R7WA 1VTMP 2QLAA 4Z9HA 4AL1A 3U2LA 2P61A 4O7GA 1A0BA 3JSZA 1T9KA 4AL0A 4H4KC 4DBQA 4WGYA 2Q4FA 2MYSA 1KU2A 3NMJA 4Z9JA 2ZD9A 1AEPA 1BR2A 3RQGA 5KYYB 3N0TA 4JTCB 5CI8A 2YLIA 1ZU5A 3ABKC 2WVOA 2Y3HA 3L1MA 3LUTB 2QE9A 2PFDA 4JZAA 1GM5A 1WN0A 3W2VA 1U0BB 1WWPA 4JRZA 1M2VA 2Q7RA 4CDYA 2WVQA 4DJ9A 1QKRA 2O9XA 4MVRA 1ZU4A 256BA 5DLJA 2A0BA 4IJJA 1EI7A 1M57C 2GAQA 3HNKA 3ZTMA 3EGDB 1YA9A 4JURI 3L8IA 3ZSUA 2RSEB 3IQ5A 3VRCA 2V26A 4MW8A 2VH3A 3NRHA 1YA7O 4C3BA 3I5QA 2XRHA 1WGWA 2AVKA 1LKXA 4GQHA 4I1MA 3T9OA 3IPMO 4JTDB 4YT2A 3RQEA 4U5EE 1CPRA 4G0HA 4OIRF 2AWYA 2YEVA 4OIOF 3U8PA 5GPGB 2HSBA 1A7DA 3V5XA 1T5OA 5A6KA 5COFA 3FOPA 2R7QA 3EQLF 4JEBA 1NSGB 1TQGA 2NPUA 3K1IA 1VB5A 4K7BA 1T6UA 2XL4A 3H2UA 4Z9IA 4BJ5A 1VYKA 5TJ5E 3SXZA 2G62A 2D5RB 3TQOA 3EPVA 1M56C 1YJGA 4N4WA 3X1OA 2DYRC 3DWWA 4PFPA 1FFHA 2H8AA 2KQ9A 5A6JA 4YK5A 2VC9A 1M2VB 3GWNA 4JW1A 1T6IA 2XXAB 3HJCA 3LNRA 3U9JA 1HE1A 1ZHXA 2WZLA 4D4XA 5JS5A 2Q9AA 4A4AA 4J7TA 4O79A 3ZVRA 4DVYP 3TULA 4MTFA 3MYIA 4MQ9F 4PJMA 1PD1A 4U5FE 3T6GB 2OQMA 1LS4A 4L6RA 1BDJB 3U9MA 1LPEA 1TWGA 3VAYA 2Y3BA 1QLEC 3JRTA 5F28E 1BR4A 3SZRA 2L81A 2J9VA 3S9OA 2OG2A 1TWCA 3W4YA 1VK5A 1FTSA 4XTKA 2DB4A 1MNDA 2BC5A 1SZIA 4BJTA 4ZLCA 1KTMA 4FWVA 2HMZA 2PP4A 2J0XA 2PF4E 1IZMA 3M4CA 4NTAA 5L0FA 3A11A 3HLZA 4UDVA 1MMGA 1NFNA 1G8XA 3KMIA 4P9FA 4ULWA 1OKKA 3ATPA 1OW6A 4PACA 1L3PA 3O10A 1YDIA 3QVZA 3RQFA 3FAPB 3DKAA 3H65A 3S0XA 2KNHA 3HNLA 3JZ0A 3TOMA 1L7CA 1TKNA 3G4XA 2E87A 3T6JA 4WABA 3KYIA 2LD6A 4XWJA 4G7ZF 4CIHA 2UUHA 1RKEA 2NSGA 4NTFA 4ULVA 4EHPA 4CS9A 3AOUA 3DI5A 4YJWA 1LS1A 1WTYA 3EG9A 2YLGA 4PFOA 2GWWA 1WATA 2IXNA 1BBHA 1ORSC 3FAJA 3SXYA 1EKYA 4D4NA 2NSFA 3NMIA 2R7VA 2YL1A 4FAPB 2C04A 5AC4A 3V5YA 2XL8A 1I4ZA 3ECSA 2OCCC 4OD4A 1FNTc 2AWCA 2B0HA 4CJGA 2IBFA 3NKDA 5T1DB 3DZAA 4YWQA 2R7UA 2W9YA 1ZHTA 4FESA 4J7YA 1O87A 3MX3A 4P6IC 1ZZPA 2A0UA 2YQYA 3AQBA 3JTLO 2VCAA 5DVWA 2BE5F 3DE8A 2JD3A 1T6QA 5T3WA 3QTHA 4PJJA 3LEOA 4MVZA 4DRJB 2ASRA 5KYXA 1K04A 3DXJF 5L0JA 5DQZA 2YRFA 2FAPB 1SYQA 4FX5A 2J0WA 1RKEB 4U9DA 1DOVA 1D0ZA 1E83A 2M64A 2YHSA 3AJMA 1KNYA 2OU6A 3EG9B 2HSQA 1PV3A 4MNDA 5B1BC 5KYNA 1CPQA 1OKKD 4LDKA 3IHUA 5F5FA 3DAGA 1O3UA 2R7XA 3AG1C 3UGPA 5BQHA 3EFOA 2HKVA 3K6BA 3KPHA 1D1CA 1N1CA 4BPMA 3QZCA 1RJ9A 5BQGA 4DRIB 1ORJA 4LACB 5CI9A 3IQTA 2X51A 3CZ6A 3NYMA 3WODF 1BR1A 3B0VC 3CQZA 3T4RA 5IY5C 3GM2A 4P9TA 1G4WR 4IGGA 2W45A 4U5HA 2QUPA 4BJ1A 5L0CA 5CIVA 2DGJA 2XS8A 4U5GA 3SP1A 2HS5A 1ORYA 2KJGA 2MWQA 4J32B 1OQCA 4X0RA 3RF3A 3TJ5A 3LNMB 3NG1A 2Q9BA 1A41A 3LS0A 4M63A 4XLNF 3TJ6A 3B0UX 1K05A 4IRUA 5KYXB 4OIQF 2XL6A 1OCRC 3L0IA 3N2ZB 3ZDLA 2NUTB 1K40A 1TFKB 3QMKA 4IARA 4JCZA 4PJLA 4XPXA 1HMOA 1O5HA 1V4AA 3DE9A 3M1CB 4E7ZA 1FMWA 2EINC 5HV9A 2KSFA 4R32A 1VLSA 3RYLA 1ZHWA 3KH2A 3B9QA 5KYWA 3GM1A 1Z6AA 2L6HA 5BQIA 1OXBA 2DYSC 2YWAA 3EFOB 3GANA 4JTAB 4RDAA 5D92A 1HW2A 4HE8D 1RJ9B 1FAPB 1HY5A 1NZEA 3DJUB 2P0NA 4U5BE 3I5PA 4XQ1A 1YLMA 2Y39A 4E18A 1U89A 1Y6DA 4U5CE 3C8GA 2YZSA 4CBEA 4N6HA 1WASA 2ZXWC 3C18A 2H7OA 5L3QA 3JYYA 1JPNA 5B1AC 2R7TA 5EHHA 1APCA 4EIYA 1G5ZA 1D0YA 2KGOA 5E3CA 2PNOA 1S05A 2XLDA 1NG1A 2NUPA 1QVXA 1YAUO 1C17M 4PK4A 3AGTA 5BUOA 4JJGA 3ITFA 3OWTA 1NU7D 4MVSA 4MVUA 3R7CA 5F5HA 2HMQA 4EUKB 2LFDA 2CCYA 2HFIA 2OJED 1PCXA 3K33A 5E33A 1RMVA 4YL3A 3LS1A 2OEXA 2DI3A 4MVOA 5KYWB 3EGXA 2QY9A 4E0HA 4E17A 4RD9A 1I4YA 5E2QA 1GGQA 1SMYF 3RVYA 2J8WA 4YT4A 3DM5A 3US6A 2WB7A 1JR8A 2OEVA 4C3EA 3KL4A 1OCOC 4IB4A 5AGFA 2R05A 4H54A 3W8IA 4CDAA 3PHF2 5DQTA 5E3AA 4BEMJ 2A6HF 4GYTA 1ZHZA 3C8GB 1RXQA 1R5ID 2R9RB 4IAOA 5KYUA 1CGNA 2M4EA 2ZXRA 1D1AA 2R02A 1YYXA 2ZXPA 2IOQA 2HJ3A 3BRJA 3VYWA 3UMKA 4K0DA 1FFTC 3C62A 4YT8A 2P1AA 2YKZA 2ETSA 5EGYA 3DAFA 2NUPB 1BZ4A 1W2WA 1A7VA 3NMKA 1Q0DA 4Q7CA 3C8GD 1HE9A 2VB6A 4CDVA 3CSKA 1UFBA 2A1DD 4I1OB 3U2MA 3M15A 4U9EA 4PR9A 3H2VA 1Q0FA 3FVYA
chains in the Genus database with same CATH topology
4JCHA 1V54C 2L9JA 3LAYA 3EGXB 2Y3GA 1VYIA 3F47A 4G7HF 2W4BA 3K1IC 2P6VA 3T6BA 5DS4A 4BJ5C 5B3SC 3OA1A 4WJ0A 4EWCA 4CS7A 3PMRA 5KYUB 3AG3C 2EIJC 2W4MA 5L3VA 3W8HA 2CNWA 4ZLDA 4IWBA 4F4BA 3Q6MA 3LEVA 4AX2A 4KNWA 2R7OA 2G3VA 2WZGA 3EZIA 4PJNA 5DS5A 1J8YF 3K1HA 3EHMA 2FGYA 1NU9C 2IXPA 4I3MA 1MMNA 2WZFA 3NYLA 4O6MA 3EHNA 3Q6NA 2A68F 3TD7A 2EILC 5FCLA 1Z5ZA 2H7VC 2Q3TA 3HTKC 3LLKA 4N06A 4YN0B 4I44A 4G7OF 3O39A 4CSAA 3AG2C 3UMHA 1D1BA 3L34A 4CS9C 3LESA 3POVA 2J7PA 3OEOA 5D91A 2CNWD 2IXMA 4ANJA 1VMAA 3FDQA 1Z63A 3UNGC 1MMDA 4OINF 3JCUQ 2J45A 3Q7GA 5DS6A 4E7SA 2Y3DA 3EJNA 4KNVA 3DD7A 2P7VA 4J30B 2CW0F 4OIPF 2QTVA 4CS8A 1J8MF 3W2WA 1LVKA 1PD0A 3IEEA 2WVNA 4AK9A 3AQCA 4A2NB 1D0XA 3RIPA 4C3DA 4QI2A 4JJFA 3MLGA 2IYLD 1TR2A 3ABMC 4YT5A 3K7DA 3ZIBA 4XLPF 2Y69C 2GFHA 3RH3A 4QDLA 3ZG1A 4DBRA 1VOMA 2B0JA 3Q7LA 4CSAC 4LERA 4BJ6A 4KBLA 2A69F 3KKBA 2J7PD 4O6YA 5HSWA 1S7ZA 2WL8A 1ZHYA 4KC9A 1ST6A 4LLEA 1M2OA 3V7OA 3JT1A 4B6IA 2CDQA 1FMVA 1JPJA 3EH1A 4BG0A 2C03A 4AE4A 3I4UA 1IW7F 4EBBA 2IXOA 4O6NA 4HEAJ 2ZXOA 2R7SA 2J9WA 4CS8C 1V55C 3DJNB 2PX0A 1ZYRF 2J9UA 3FHDA 3SYNA 4HFKB 2V3CC 2FFHA 3NYJA 3E70C 2EIMC 2LSEA 3LLIA 3SEOA 2NG1A 3UGOA 3B0PA 1SF8A 3S27A 4W8KA 3S29A 3DMDA 4AE4B 4LLCA 2PX3A 2ZPAA 3NKEA 1TWHA 4DOZA 4BJ6C 3RKOF 3F46A 1Z23A 4KI2A 2I8BA 2J46A 1OCZC 4DVZA 3EH2A 4Q5SF 3X2QC 2KW3C 2Z15A 2HV6A 3ABLC 4NY3A 4JVSA 3N24A 1Z3IX 2EIKC 3EZHA 3AG4C 4C7OA 3ASOC 3JYHA 3ZC4A 4HFFB 3RFYA 1QZXA 2XSEA 4Q4ZF 2G3KA 4QI0A 4RBNA 2CGEA 3DM9B 3UR3C 1OCCC 3GODA 4U5DE 5KYYA 3K66A 3SNHA 2H7BA 3LJBA 2VASA 3S28A 3WG7C 1TWAA 1MMAA 5T3TA 2NUTA 3NDBB 4GEHA 3E9VA 4C7OB 1MNEA 2A6EF 2Q9CA 3EGDA 2HV7A 4OD5A 3ASNC 2R7RA 4BEJA 3O6XA 2R7WA 4O7GA 3JSZA 4H4KC 4DBQA 2MYSA 1KU2A 1BR2A 5KYYB 3N0TA 5CI8A 1ZU5A 3ABKC 2WVOA 2Y3HA 2PFDA 4JZAA 3W2VA 1M2VA 2WVQA 2XXAA 2O9XA 1ZU4A 5DLJA 4IJJA 1M57C 3ZSUA 3EGDB 4JURI 2V26A 2VH3A 3NRHA 4C3BA 3I5QA 2XRHA 1WGWA 4I1MA 1LKXA 4YT2A 4U5EE 4G0HA 4OIRF 2YEVA 4OIOF 2R7QA 3EQLF 4K7BA 2XL4A 4BJ5A 1VYKA 2G62A 2D5RB 3EPVA 1M56C 3X1OA 2DYRC 4PFPA 1FFHA 2KQ9A 1M2VB 4JW1A 2XXAB 3HJCA 3LNRA 1ZHXA 2WZLA 2Q9AA 4DVYP 4O79A 3ZVRA 4MQ9F 4PJMA 1PD1A 4U5FE 1TWGA 3VAYA 2Y3BA 1QLEC 3JRTA 3SZRA 1BR4A 2L81A 2J9VA 2OG2A 1TWCA 1VK5A 1FTSA 4XTKA 1MNDA 4ZLCA 1SZIA 4BJTA 4FWVA 2PP4A 2J0XA 2PF4E 1IZMA 3HLZA 1MMGA 1G8XA 3KMIA 4ULWA 1OKKA 3H65A 3S0XA 2KNHA 1TKNA 2E87A 3T6JA 4XWJA 4G7ZF 4CIHA 4CS9A 4YJWA 1LS1A 3EG9A 4PFOA 2IXNA 3FAJA 2R7VA 2C04A 3ECSA 2OCCC 4OD4A 5T1DB 3NKDA 3DZAA 4YWQA 2R7UA 2W9YA 1ZHTA 4FESA 1O87A 3MX3A 4P6IC 3AQBA 5DVWA 2BE5F 2JD3A 5T3WA 5KYXA 4PJJA 3DXJF 5DQZA 4FX5A 2J0WA 1D0ZA 2YHSA 3EG9B 4MNDA 5B1BC 5KYNA 5F5FA 1OKKD 3DAGA 2R7XA 3AG1C 3UGPA 3EFOA 3K6BA 1D1CA 1N1CA 3QZCA 1RJ9A 4LACB 5CI9A 2X51A 3CZ6A 3NYMA 3WODF 1BR1A 3B0VC 3CQZA 3T4RA 5IY5C 4U5HA 2W45A 4BJ1A 2DGJA 4U5GA 3SP1A 2KJGA 2MWQA 4J32B 4X0RA 3NG1A 2Q9BA 4XLNF 3LS0A 4M63A 3B0UX 4IRUA 5KYXB 4OIQF 3L0IA 1OCRC 3N2ZB 2NUTB 3QMKA 4PJLA 1O5HA 3M1CB 4E7ZA 1FMWA 2EINC 3RYLA 1ZHWA 3KH2A 3B9QA 5KYWA 1Z6AA 2DYSC 3EFOB 3GANA 4RDAA 5D92A 4HE8D 1RJ9B 1NZEA 3DJUB 4U5BE 3I5PA 2Y39A 4U5CE 2YZSA 4CBEA 2ZXWC 5L3QA 2H7OA 1JPNA 5B1AC 2R7TA 5EHHA 2KGOA 1D0YA 5E3CA 1NG1A 2NUPA 4PK4A 5BUOA 4JJGA 3ITFA 3OWTA 1NU7D 5F5HA 5E33A 1PCXA 3K33A 3LS1A 5KYWB 3EGXA 2QY9A 4RD9A 5E2QA 1SMYF 4YT4A 3DM5A 2WB7A 4C3EA 3KL4A 1OCOC 3W8IA 3PHF2 5DQTA 5E3AA 2A6HF 4GYTA 1ZHZA 5KYUA 4IAOA 2M4EA 2ZXRA 1D1AA 2ZXPA 2IOQA 3VYWA 3UMKA 4K0DA 1FFTC 4YT8A 5EGYA 3DAFA 2NUPB 1W2WA 4Q7CA 2VB6A 3CSKA 4I1OB 2A1DD 3UMIA 3FVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9V A;  2J9U A;  2G3K A;  2J9W A; 
#chains in the Genus database with same CATH topology
 4JCH A;  1V54 C;  2L9J A;  3LAY A;  3EGX B;  2XLE A;  1Y4C A;  2Y3G A;  1VYI A;  3F47 A;  3R2P A;  4MVM A;  3U8V A;  2LIG A;  2W4B A;  3K1I C;  4G7H F;  1QPU A;  2P6V A;  2EPK X;  3MFN A;  3T6B A;  1CGO A;  5DS4 A;  4BJ5 C;  5B3S C;  2R25 A;  3OA1 A;  4WJ0 A;  4EWC A;  2HJM A;  3PMR A;  4CS7 A;  4CX9 A;  4XEF A;  5KYU B;  3C63 A;  2BL2 A;  2EPL X;  3AG3 C;  3A9C A;  2EIJ C;  2W4M A;  5L3V A;  3W8H A;  2CNW A;  2LFF A;  5COM A;  1EA8 A;  3ZTZ A;  4DRH B;  4ZLD A;  2MHR A;  3U5S A;  3B29 A;  4NQF A;  4IWB A;  1YYJ A;  3Q6M A;  3LEV A;  1RKC A;  4F4B A;  5L0G A;  1QSP A;  4AX2 A;  4KNW A;  2L7A A;  5JSL A;  2JX0 A;  2R7O A;  2KC3 A;  2G3V A;  1OW7 A;  4G78 A;  2WZG A;  1NBB A;  3EZI A;  4PJN A;  1H9T A;  5DS5 A;  1LE2 A;  1I5N A;  3HKK A;  1J8Y F;  3K1H A;  2Q00 A;  2QNL A;  3EHM A;  2FGY A;  1NU9 C;  2IXP A;  4I3M A;  1MMN A;  2WZF A;  1T01 A;  3NYL A;  4O6M A;  3VF0 A;  1H9G A;  3EHN A;  3Q6N A;  2A68 F;  3TD7 A;  1U6H A;  2EIL C;  1Z5Z A;  3V5Z A;  5FCL A;  2H7V C;  2Q3T A;  1Q0G A;  3CEX A;  1OXK A;  3HTK C;  2D4U A;  5JRA A;  3LLK A;  3U0C A;  1Q0K A;  4N06 A;  2X0C A;  1JAF A;  4YN0 B;  2XLW A;  3B71 A;  4I44 A;  4G7O F;  1XZQ A;  3O39 A;  1LI7 A;  4CSA A;  3AG2 C;  2L6G A;  3O55 A;  2PBE A;  3HNJ A;  3IQ6 A;  5EK0 A;  3RW0 A;  1YAR O;  3UMH A;  2YVK A;  2GA0 A;  1WOL A;  1JMW A;  1CGM E;  1D1B A;  5K0I A;  3L34 A;  4CS9 C;  1R4T A;  1E84 A;  3LES A;  3POV A;  1LIH A;  2J7P A;  3OEO A;  5D91 A;  2CNW D;  4XPY A;  4MTO A;  2IXM A;  4ANJ A;  1VMA A;  5COG A;  3FDQ A;  1Z63 A;  3UNG C;  1MMD A;  2YL0 A;  4OIN F;  3JCU Q;  2GDC A;  2J45 A;  3Q7G A;  1VLT A;  1HMD A;  5DS6 A;  4E7S A;  1ZVZ A;  2EPM X;  2L6F A;  2Y3D A;  4MTG A;  4EBK A;  3EJN A;  2LP4 A;  4KNV A;  3DD7 A;  4JC7 A;  2P7V A;  4J30 B;  2CW0 F;  1B68 A;  3ZWI A;  4OIP F;  2QTV A;  3G4Z A;  4CS8 A;  1RCP A;  3RVZ A;  1J8M F;  3W2W A;  1LVK A;  3GWL A;  1AUE A;  3QVY A;  1PD0 A;  3IEE A;  1YZA A;  2WVN A;  4AK9 A;  1M6T A;  3AQC A;  4MVQ A;  1Z7Q c;  1D0X A;  2XLO A;  3GEH A;  3RIP A;  4A2N B;  1MQV A;  4JJF A;  3TOL A;  3MLG A;  4C3D A;  4E0I A;  4QI2 A;  1NLX A;  4JE9 A;  2IYL D;  1TR2 A;  4XEK A;  3ABM C;  1C02 A;  1Q0M A;  2RD9 A;  3K7D A;  4YT5 A;  1SR2 A;  3ZIB A;  5AC5 A;  5A6B A;  3S90 A;  4XLP F;  1QQ3 A;  2GFH A;  2Y69 C;  3GEI A;  3RH3 A;  4MS2 A;  4QDL A;  3ZG1 A;  3MBG A;  2CYD A;  4DBR A;  1VOM A;  3GEE A;  1HW1 A;  2B0J A;  3Q7L A;  5A69 A;  4CSA C;  4LER A;  1F1M A;  4ONS A;  4BJ6 A;  4KBL A;  2A69 F;  3KKB A;  1G4U S;  2YLD A;  2J7P D;  4O6Y A;  3G50 A;  1S7Z A;  2WL8 A;  5HSW A;  1ZHY A;  4YL1 A;  4KC9 A;  2LK4 A;  1OW8 A;  1ST6 A;  4LLE A;  4CIP A;  1H6G A;  4EKW A;  1M2O A;  2KYH A;  2OKU A;  3V7O A;  2EPO A;  3JT1 A;  2VCC A;  2AP3 A;  2XLH A;  3TK0 A;  2CDQ A;  1FMV A;  1H7I A;  1JPJ A;  4B6I A;  5B3I A;  3EH1 A;  3JSE O;  5L0D A;  3GOR A;  4BG0 A;  2C03 A;  3BEH A;  4AE4 A;  3I4U A;  4YL0 A;  1IW7 F;  5JT4 A;  1JRA A;  4EBB A;  5L0H A;  2IXO A;  3CAX A;  4O6N A;  3QW1 A;  4HEA J;  3SXM A;  2ZXO A;  4MW3 A;  2R7S A;  2XLV A;  3VM6 A;  2J9W A;  4CS8 C;  1V55 C;  3UMI A;  1GS9 A;  2ICW G;  3DJN B;  1EQ1 A;  2PX0 A;  1ZYR F;  3PDM P;  1LI5 A;  2J9U A;  2KK1 A;  3C7J A;  3FHD A;  4IAQ A;  1GQA A;  3C8Z A;  3U3F A;  3U3B A;  5JUA A;  4LDR A;  3FXH A;  3SYN A;  4JIO A;  1YVI A;  5JLI A;  4HFK B;  2XS1 A;  5A6B D;  2V3C C;  1NFO A;  1V74 B;  3HNI A;  2FFH A;  3NYJ A;  3KYJ A;  3M79 A;  3S84 A;  3E70 C;  2EIM C;  2LSE A;  3LLI A;  4XEV A;  3SEO A;  2YL7 A;  1ZW2 A;  2NG1 A;  1E85 A;  3UGO A;  3B0P A;  2R03 A;  1FR0 A;  1SF8 A;  3S27 A;  3QW0 A;  4W8K A;  1AVO B;  2HUJ A;  3FMS A;  3S29 A;  4W8P A;  5JP7 A;  3DMD A;  3J06 A;  4AE4 B;  1UG7 A;  4EBJ A;  4LLC A;  2PX3 A;  2ZPA A;  3NKE A;  1TWH A;  4DOZ A;  4DXW A;  4BJ6 C;  3RKO F;  3F46 A;  1Z23 A;  4KI2 A;  2I8B A;  2UUI A;  3FOO A;  3GM3 A;  1OR3 A;  2J46 A;  1OCZ C;  2F22 A;  4DVZ A;  3EH2 A;  4Q5S F;  1LM3 B;  3PCV A;  2KW3 C;  2Z15 A;  3X2Q C;  3ZQY A;  3M4B A;  2HV6 A;  3WAQ A;  4N6C A;  3ABL C;  1OR2 A;  4NY3 A;  4JVS A;  2EIK C;  1Z3I X;  2OOC A;  3EZH A;  3AG4 C;  3N24 A;  2J9B A;  4C7O A;  3ASO C;  4NC3 A;  2YL3 A;  4XPW A;  3JYH A;  3ZC4 A;  4HFF B;  3RFY A;  1QZX A;  1XZP A;  3SXK A;  2XSE A;  4Q4Z F;  2G3K A;  2LQG A;  4QI0 A;  4JKV A;  2LCH A;  4RBN A;  2CGE A;  2XM4 A;  2AU5 A;  3AGU A;  3DM9 B;  4NCQ A;  2XXA A;  3UR3 C;  1OCC C;  4WGZ A;  4CJO A;  2JPU A;  5JVE A;  3GOD A;  4K1O A;  4U5D E;  5KYY A;  4ER9 A;  3K66 A;  3L8J A;  2H7B A;  2OJQ A;  3LJB A;  3SNH A;  2VAS A;  3MYF A;  3ZQV A;  3S28 A;  1C03 A;  5L0I A;  2VCB A;  1E2X A;  1YZC A;  2EPN A;  2IM8 A;  1ZW3 A;  1XWJ A;  3IQC A;  4JEA A;  2HZ8 A;  1TWA A;  1DOW A;  1MMA A;  1TFO B;  2XLM A;  5T3T A;  2NUT A;  4GEH A;  1A7E A;  3NDB B;  2TMV P;  2I15 A;  3E9V A;  1LE4 A;  4C7O B;  5FZT A;  1MNE A;  2A6E F;  3JRM O;  4NTB A;  5A6A A;  2Q9C A;  3EGD A;  2HV7 A;  1E86 A;  4LDQ A;  4OD5 A;  3ASN C;  2XM0 A;  2R7R A;  3WG7 C;  1JOG A;  4BEJ A;  3WHN A;  3O6X A;  2R7W A;  1VTM P;  2QLA A;  4Z9H A;  4AL1 A;  3U2L A;  2P61 A;  4O7G A;  1A0B A;  3JSZ A;  1T9K A;  4AL0 A;  4H4K C;  4DBQ A;  4WGY A;  2Q4F A;  2MYS A;  1KU2 A;  3NMJ A;  4Z9J A;  2ZD9 A;  1AEP A;  1BR2 A;  3RQG A;  5KYY B;  3N0T A;  4JTC B;  5CI8 A;  2YLI A;  1ZU5 A;  3ABK C;  2WVO A;  2Y3H A;  3L1M A;  3LUT B;  2QE9 A;  2PFD A;  4JZA A;  1GM5 A;  1WN0 A;  3W2V A;  1U0B B;  1WWP A;  4JRZ A;  1M2V A;  2Q7R A;  4CDY A;  2WVQ A;  4DJ9 A;  1QKR A;  2O9X A;  4MVR A;  1ZU4 A;  256B A;  5DLJ A;  2A0B A;  4IJJ A;  1EI7 A;  1M57 C;  2GAQ A;  3HNK A;  3ZTM A;  3EGD B;  1YA9 A;  4JUR I;  3L8I A;  3ZSU A;  2RSE B;  3IQ5 A;  3VRC A;  2V26 A;  4MW8 A;  2VH3 A;  3NRH A;  1YA7 O;  4C3B A;  3I5Q A;  2XRH A;  1WGW A;  2AVK A;  1LKX A;  4GQH A;  4I1M A;  3T9O A;  3IPM O;  4JTD B;  4YT2 A;  3RQE A;  4U5E E;  1CPR A;  4G0H A;  4OIR F;  2AWY A;  2YEV A;  4OIO F;  3U8P A;  5GPG B;  2HSB A;  1A7D A;  3V5X A;  1T5O A;  5A6K A;  5COF A;  3FOP A;  2R7Q A;  3EQL F;  4JEB A;  1NSG B;  1TQG A;  2NPU A;  3K1I A;  1VB5 A;  4K7B A;  1T6U A;  2XL4 A;  3H2U A;  4Z9I A;  4BJ5 A;  1VYK A;  5TJ5 E;  3SXZ A;  2G62 A;  2D5R B;  3TQO A;  3EPV A;  1M56 C;  1YJG A;  4N4W A;  3X1O A;  2DYR C;  3DWW A;  4PFP A;  1FFH A;  2H8A A;  2KQ9 A;  5A6J A;  4YK5 A;  2VC9 A;  1M2V B;  3GWN A;  4JW1 A;  1T6I A;  2XXA B;  3HJC A;  3LNR A;  3U9J A;  1HE1 A;  1ZHX A;  2WZL A;  4D4X A;  5JS5 A;  2Q9A A;  4A4A A;  4J7T A;  4O79 A;  3ZVR A;  4DVY P;  3TUL A;  4MTF A;  3MYI A;  4MQ9 F;  4PJM A;  1PD1 A;  4U5F E;  3T6G B;  2OQM A;  1LS4 A;  4L6R A;  1BDJ B;  3U9M A;  1LPE A;  1TWG A;  3VAY A;  2Y3B A;  1QLE C;  3JRT A;  5F28 E;  1BR4 A;  3SZR A;  2L81 A;  2J9V A;  3S9O A;  2OG2 A;  1TWC A;  3W4Y A;  1VK5 A;  1FTS A;  4XTK A;  2DB4 A;  1MND A;  2BC5 A;  1SZI A;  4BJT A;  4ZLC A;  1KTM A;  4FWV A;  2HMZ A;  2PP4 A;  2J0X A;  2PF4 E;  1IZM A;  3M4C A;  4NTA A;  5L0F A;  3A11 A;  3HLZ A;  4UDV A;  1MMG A;  1NFN A;  1G8X A;  3KMI A;  4P9F A;  4ULW A;  1OKK A;  3ATP A;  1OW6 A;  4PAC A;  1L3P A;  3O10 A;  1YDI A;  3QVZ A;  3RQF A;  3FAP B;  3DKA A;  3H65 A;  3S0X A;  2KNH A;  3HNL A;  3JZ0 A;  3TOM A;  1L7C A;  1TKN A;  3G4X A;  2E87 A;  3T6J A;  4WAB A;  3KYI A;  2LD6 A;  4XWJ A;  4G7Z F;  4CIH A;  2UUH A;  1RKE A;  2NSG A;  4NTF A;  4ULV A;  4EHP A;  4CS9 A;  3AOU A;  3DI5 A;  4YJW A;  1LS1 A;  1WTY A;  3EG9 A;  2YLG A;  4PFO A;  2GWW A;  1WAT A;  2IXN A;  1BBH A;  1ORS C;  3FAJ A;  3SXY A;  1EKY A;  4D4N A;  2NSF A;  3NMI A;  2R7V A;  2YL1 A;  4FAP B;  2C04 A;  5AC4 A;  3V5Y A;  2XL8 A;  1I4Z A;  3ECS A;  2OCC C;  4OD4 A;  1FNT c;  2AWC A;  2B0H A;  4CJG A;  2IBF A;  3NKD A;  5T1D B;  3DZA A;  4YWQ A;  2R7U A;  2W9Y A;  1ZHT A;  4FES A;  4J7Y A;  1O87 A;  3MX3 A;  4P6I C;  1ZZP A;  2A0U A;  2YQY A;  3AQB A;  3JTL O;  2VCA A;  5DVW A;  2BE5 F;  3DE8 A;  2JD3 A;  1T6Q A;  5T3W A;  3QTH A;  4PJJ A;  3LEO A;  4MVZ A;  4DRJ B;  2ASR A;  5KYX A;  1K04 A;  3DXJ F;  5L0J A;  5DQZ A;  2YRF A;  2FAP B;  1SYQ A;  4FX5 A;  2J0W A;  1RKE B;  4U9D A;  1DOV A;  1D0Z A;  1E83 A;  2M64 A;  2YHS A;  3AJM A;  1KNY A;  2OU6 A;  3EG9 B;  2HSQ A;  1PV3 A;  4MND A;  5B1B C;  5KYN A;  1CPQ A;  1OKK D;  4LDK A;  3IHU A;  5F5F A;  3DAG A;  1O3U A;  2R7X A;  3AG1 C;  3UGP A;  5BQH A;  3EFO A;  2HKV A;  3K6B A;  3KPH A;  1D1C A;  1N1C A;  4BPM A;  3QZC A;  1RJ9 A;  5BQG A;  4DRI B;  1ORJ A;  4LAC B;  5CI9 A;  3IQT A;  2X51 A;  3CZ6 A;  3NYM A;  3WOD F;  1BR1 A;  3B0V C;  3CQZ A;  3T4R A;  5IY5 C;  3GM2 A;  4P9T A;  1G4W R;  4IGG A;  2W45 A;  4U5H A;  2QUP A;  4BJ1 A;  5L0C A;  5CIV A;  2DGJ A;  2XS8 A;  4U5G A;  3SP1 A;  2HS5 A;  1ORY A;  2KJG A;  2MWQ A;  4J32 B;  1OQC A;  4X0R A;  3RF3 A;  3TJ5 A;  3LNM B;  3NG1 A;  2Q9B A;  1A41 A;  3LS0 A;  4M63 A;  4XLN F;  3TJ6 A;  3B0U X;  1K05 A;  4IRU A;  5KYX B;  4OIQ F;  2XL6 A;  1OCR C;  3L0I A;  3N2Z B;  3ZDL A;  2NUT B;  1K40 A;  1TFK B;  3QMK A;  4IAR A;  4JCZ A;  4PJL A;  4XPX A;  1HMO A;  1O5H A;  1V4A A;  3DE9 A;  3M1C B;  4E7Z A;  1FMW A;  2EIN C;  5HV9 A;  2KSF A;  4R32 A;  1VLS A;  3RYL A;  1ZHW A;  3KH2 A;  3B9Q A;  5KYW A;  3GM1 A;  1Z6A A;  2L6H A;  5BQI A;  1OXB A;  2DYS C;  2YWA A;  3EFO B;  3GAN A;  4JTA B;  4RDA A;  5D92 A;  1HW2 A;  4HE8 D;  1RJ9 B;  1FAP B;  1HY5 A;  1NZE A;  3DJU B;  2P0N A;  4U5B E;  3I5P A;  4XQ1 A;  1YLM A;  2Y39 A;  4E18 A;  1U89 A;  1Y6D A;  4U5C E;  3C8G A;  2YZS A;  4CBE A;  4N6H A;  1WAS A;  2ZXW C;  3C18 A;  2H7O A;  5L3Q A;  3JYY A;  1JPN A;  5B1A C;  2R7T A;  5EHH A;  1APC A;  4EIY A;  1G5Z A;  1D0Y A;  2KGO A;  5E3C A;  2PNO A;  1S05 A;  2XLD A;  1NG1 A;  2NUP A;  1QVX A;  1YAU O;  1C17 M;  4PK4 A;  3AGT A;  5BUO A;  4JJG A;  3ITF A;  3OWT A;  1NU7 D;  4MVS A;  4MVU A;  3R7C A;  5F5H A;  2HMQ A;  4EUK B;  2LFD A;  2CCY A;  2HFI A;  2OJE D;  1PCX A;  3K33 A;  5E33 A;  1RMV A;  4YL3 A;  3LS1 A;  2OEX A;  2DI3 A;  4MVO A;  5KYW B;  3EGX A;  2QY9 A;  4E0H A;  4E17 A;  4RD9 A;  1I4Y A;  5E2Q A;  1GGQ A;  1SMY F;  3RVY A;  2J8W A;  4YT4 A;  3DM5 A;  3US6 A;  2WB7 A;  1JR8 A;  2OEV A;  4C3E A;  3KL4 A;  1OCO C;  4IB4 A;  5AGF A;  2R05 A;  4H54 A;  3W8I A;  4CDA A;  3PHF 2;  5DQT A;  5E3A A;  4BEM J;  2A6H F;  4GYT A;  1ZHZ A;  3C8G B;  1RXQ A;  1R5I D;  2R9R B;  4IAO A;  5KYU A;  1CGN A;  2M4E A;  2ZXR A;  1D1A A;  2R02 A;  1YYX A;  2ZXP A;  2IOQ A;  2HJ3 A;  3BRJ A;  3VYW A;  3UMK A;  4K0D A;  1FFT C;  3C62 A;  4YT8 A;  2P1A A;  2YKZ A;  2ETS A;  5EGY A;  3DAF A;  2NUP B;  1BZ4 A;  1W2W A;  1A7V A;  3NMK A;  1Q0D A;  4Q7C A;  3C8G D;  1HE9 A;  2VB6 A;  4CDV A;  3CSK A;  1UFB A;  2A1D D;  4I1O B;  3U2M A;  3M15 A;  4U9E A;  4PR9 A;  3H2V A;  1Q0F A;  3FVY A; 
#chains in the Genus database with same CATH homology
 4JCH A;  1V54 C;  2L9J A;  3LAY A;  3EGX B;  2Y3G A;  1VYI A;  3F47 A;  4G7H F;  2W4B A;  3K1I C;  2P6V A;  3T6B A;  5DS4 A;  4BJ5 C;  5B3S C;  3OA1 A;  4WJ0 A;  4EWC A;  4CS7 A;  3PMR A;  5KYU B;  3AG3 C;  2EIJ C;  2W4M A;  5L3V A;  3W8H A;  2CNW A;  4ZLD A;  4IWB A;  4F4B A;  3Q6M A;  3LEV A;  4AX2 A;  4KNW A;  2R7O A;  2G3V A;  2WZG A;  3EZI A;  4PJN A;  5DS5 A;  1J8Y F;  3K1H A;  3EHM A;  2FGY A;  1NU9 C;  2IXP A;  4I3M A;  1MMN A;  2WZF A;  3NYL A;  4O6M A;  3EHN A;  3Q6N A;  2A68 F;  3TD7 A;  2EIL C;  5FCL A;  1Z5Z A;  2H7V C;  2Q3T A;  3HTK C;  3LLK A;  4N06 A;  4YN0 B;  4I44 A;  4G7O F;  3O39 A;  4CSA A;  3AG2 C;  3UMH A;  1D1B A;  3L34 A;  4CS9 C;  3LES A;  3POV A;  2J7P A;  3OEO A;  5D91 A;  2CNW D;  2IXM A;  4ANJ A;  1VMA A;  3FDQ A;  1Z63 A;  3UNG C;  1MMD A;  4OIN F;  3JCU Q;  2J45 A;  3Q7G A;  5DS6 A;  4E7S A;  2Y3D A;  3EJN A;  4KNV A;  3DD7 A;  2P7V A;  4J30 B;  2CW0 F;  4OIP F;  2QTV A;  4CS8 A;  1J8M F;  3W2W A;  1LVK A;  1PD0 A;  3IEE A;  2WVN A;  4AK9 A;  3AQC A;  4A2N B;  1D0X A;  3RIP A;  4C3D A;  4QI2 A;  4JJF A;  3MLG A;  2IYL D;  1TR2 A;  3ABM C;  4YT5 A;  3K7D A;  3ZIB A;  4XLP F;  2Y69 C;  2GFH A;  3RH3 A;  4QDL A;  3ZG1 A;  4DBR A;  1VOM A;  2B0J A;  3Q7L A;  4CSA C;  4LER A;  4BJ6 A;  4KBL A;  2A69 F;  3KKB A;  2J7P D;  4O6Y A;  5HSW A;  1S7Z A;  2WL8 A;  1ZHY A;  4KC9 A;  1ST6 A;  4LLE A;  1M2O A;  3V7O A;  3JT1 A;  4B6I A;  2CDQ A;  1FMV A;  1JPJ A;  3EH1 A;  4BG0 A;  2C03 A;  4AE4 A;  3I4U A;  1IW7 F;  4EBB A;  2IXO A;  4O6N A;  4HEA J;  2ZXO A;  2R7S A;  2J9W A;  4CS8 C;  1V55 C;  3DJN B;  2PX0 A;  1ZYR F;  2J9U A;  3FHD A;  3SYN A;  4HFK B;  2V3C C;  2FFH A;  3NYJ A;  3E70 C;  2EIM C;  2LSE A;  3LLI A;  3SEO A;  2NG1 A;  3UGO A;  3B0P A;  1SF8 A;  3S27 A;  4W8K A;  3S29 A;  3DMD A;  4AE4 B;  4LLC A;  2PX3 A;  2ZPA A;  3NKE A;  1TWH A;  4DOZ A;  4BJ6 C;  3RKO F;  3F46 A;  1Z23 A;  4KI2 A;  2I8B A;  2J46 A;  1OCZ C;  4DVZ A;  3EH2 A;  4Q5S F;  3X2Q C;  2KW3 C;  2Z15 A;  2HV6 A;  3ABL C;  4NY3 A;  4JVS A;  3N24 A;  1Z3I X;  2EIK C;  3EZH A;  3AG4 C;  4C7O A;  3ASO C;  3JYH A;  3ZC4 A;  4HFF B;  3RFY A;  1QZX A;  2XSE A;  4Q4Z F;  2G3K A;  4QI0 A;  4RBN A;  2CGE A;  3DM9 B;  3UR3 C;  1OCC C;  3GOD A;  4U5D E;  5KYY A;  3K66 A;  3SNH A;  2H7B A;  3LJB A;  2VAS A;  3S28 A;  3WG7 C;  1TWA A;  1MMA A;  5T3T A;  2NUT A;  3NDB B;  4GEH A;  3E9V A;  4C7O B;  1MNE A;  2A6E F;  2Q9C A;  3EGD A;  2HV7 A;  4OD5 A;  3ASN C;  2R7R A;  4BEJ A;  3O6X A;  2R7W A;  4O7G A;  3JSZ A;  4H4K C;  4DBQ A;  2MYS A;  1KU2 A;  1BR2 A;  5KYY B;  3N0T A;  5CI8 A;  1ZU5 A;  3ABK C;  2WVO A;  2Y3H A;  2PFD A;  4JZA A;  3W2V A;  1M2V A;  2WVQ A;  2XXA A;  2O9X A;  1ZU4 A;  5DLJ A;  4IJJ A;  1M57 C;  3ZSU A;  3EGD B;  4JUR I;  2V26 A;  2VH3 A;  3NRH A;  4C3B A;  3I5Q A;  2XRH A;  1WGW A;  4I1M A;  1LKX A;  4YT2 A;  4U5E E;  4G0H A;  4OIR F;  2YEV A;  4OIO F;  2R7Q A;  3EQL F;  4K7B A;  2XL4 A;  4BJ5 A;  1VYK A;  2G62 A;  2D5R B;  3EPV A;  1M56 C;  3X1O A;  2DYR C;  4PFP A;  1FFH A;  2KQ9 A;  1M2V B;  4JW1 A;  2XXA B;  3HJC A;  3LNR A;  1ZHX A;  2WZL A;  2Q9A A;  4DVY P;  4O79 A;  3ZVR A;  4MQ9 F;  4PJM A;  1PD1 A;  4U5F E;  1TWG A;  3VAY A;  2Y3B A;  1QLE C;  3JRT A;  3SZR A;  1BR4 A;  2L81 A;  2J9V A;  2OG2 A;  1TWC A;  1VK5 A;  1FTS A;  4XTK A;  1MND A;  4ZLC A;  1SZI A;  4BJT A;  4FWV A;  2PP4 A;  2J0X A;  2PF4 E;  1IZM A;  3HLZ A;  1MMG A;  1G8X A;  3KMI A;  4ULW A;  1OKK A;  3H65 A;  3S0X A;  2KNH A;  1TKN A;  2E87 A;  3T6J A;  4XWJ A;  4G7Z F;  4CIH A;  4CS9 A;  4YJW A;  1LS1 A;  3EG9 A;  4PFO A;  2IXN A;  3FAJ A;  2R7V A;  2C04 A;  3ECS A;  2OCC C;  4OD4 A;  5T1D B;  3NKD A;  3DZA A;  4YWQ A;  2R7U A;  2W9Y A;  1ZHT A;  4FES A;  1O87 A;  3MX3 A;  4P6I C;  3AQB A;  5DVW A;  2BE5 F;  2JD3 A;  5T3W A;  5KYX A;  4PJJ A;  3DXJ F;  5DQZ A;  4FX5 A;  2J0W A;  1D0Z A;  2YHS A;  3EG9 B;  4MND A;  5B1B C;  5KYN A;  5F5F A;  1OKK D;  3DAG A;  2R7X A;  3AG1 C;  3UGP A;  3EFO A;  3K6B A;  1D1C A;  1N1C A;  3QZC A;  1RJ9 A;  4LAC B;  5CI9 A;  2X51 A;  3CZ6 A;  3NYM A;  3WOD F;  1BR1 A;  3B0V C;  3CQZ A;  3T4R A;  5IY5 C;  4U5H A;  2W45 A;  4BJ1 A;  2DGJ A;  4U5G A;  3SP1 A;  2KJG A;  2MWQ A;  4J32 B;  4X0R A;  3NG1 A;  2Q9B A;  4XLN F;  3LS0 A;  4M63 A;  3B0U X;  4IRU A;  5KYX B;  4OIQ F;  3L0I A;  1OCR C;  3N2Z B;  2NUT B;  3QMK A;  4PJL A;  1O5H A;  3M1C B;  4E7Z A;  1FMW A;  2EIN C;  3RYL A;  1ZHW A;  3KH2 A;  3B9Q A;  5KYW A;  1Z6A A;  2DYS C;  3EFO B;  3GAN A;  4RDA A;  5D92 A;  4HE8 D;  1RJ9 B;  1NZE A;  3DJU B;  4U5B E;  3I5P A;  2Y39 A;  4U5C E;  2YZS A;  4CBE A;  2ZXW C;  5L3Q A;  2H7O A;  1JPN A;  5B1A C;  2R7T A;  5EHH A;  2KGO A;  1D0Y A;  5E3C A;  1NG1 A;  2NUP A;  4PK4 A;  5BUO A;  4JJG A;  3ITF A;  3OWT A;  1NU7 D;  5F5H A;  5E33 A;  1PCX A;  3K33 A;  3LS1 A;  5KYW B;  3EGX A;  2QY9 A;  4RD9 A;  5E2Q A;  1SMY F;  4YT4 A;  3DM5 A;  2WB7 A;  4C3E A;  3KL4 A;  1OCO C;  3W8I A;  3PHF 2;  5DQT A;  5E3A A;  2A6H F;  4GYT A;  1ZHZ A;  5KYU A;  4IAO A;  2M4E A;  2ZXR A;  1D1A A;  2ZXP A;  2IOQ A;  3VYW A;  3UMK A;  4K0D A;  1FFT C;  4YT8 A;  5EGY A;  3DAF A;  2NUP B;  1W2W A;  4Q7C A;  2VB6 A;  3CSK A;  4I1O B;  2A1D D;  3UMI A;  3FVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...