3LNRA

Crystal structure of poly-hamp domains from the p. aeruginosa soluble receptor aer2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
160
structure length
160
Chain Sequence
GSHMGLFNAHAVAQQRADRIATLLQSFADGQLDTAVGEAPAPGYERLYDSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDQTIPAERLEGRAARIAKGVNELVAAHIAVKMKVVSVVTAYGQGNFEPLMDRLPGKKAQITEAIDGVRERLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aerotaxis transducer Aer2
publication title Structure of concatenated HAMP domains provides a mechanism for signal transduction.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
total genus 57
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2010-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18575 HAMP_N3 HAMP N-terminal domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3lnrA00
3LNRA 4I44A 4I3MA
chains in the Genus database with same CATH superfamily
3GEEA 4CDVA 2MWQA 4XWJA 2J45A 3EG9B 1Z7Qc 2R7OA 1CGNA 3RF3A 4KI2A 1SMYF 4Z9JA 3WHNA 3UMIA 1OW7A 5D92A 1WASA 2ZXOA 1YZCA 4G0HA 5KYXA 3GM1A 2EINC 1T01A 2LFFA 3FOPA 3LEOA 4AL1A 1NLXA 1NZEA 2H7BA 1H9TA 1A7EA 2R25A 2PX3A 3M4CA 4MTFA 2KNHA 1OW6A 1E84A 1KNYA 4I3MA 1GS9A 3DM9B 4D4XA 4B6IA 1FTSA 1ZHYA 2YLIA 1Q0FA 2LIGA 2UUHA 1ST6A 3EG9A 3K66A 1G4US 2GDCA 3FOOA 4BJ6C 4G7HF 2D4UA 5AGFA 3RQEA 5TJ5E 3C8GB 3LUTB 1AVOB 2A0BA 4AE4B 3HNJA 5KYUB 3OWTA 4J32B 5KYYA 3EJNA 2Y3GA 2EPKX 2YL3A 3I5PA 3L8JA 1JMWA 5L0IA 2XLOA 4J7TA 2ZXRA 2Y69C 4U5CE 4YK5A 4CDAA 4U9EA 2Q9AA 3ZQVA 4Z9HA 1Z5ZA 3RQGA 4RDAA 4BJ6A 2C03A 3QW0A 2ZXPA 3U9MA 3WODF 2PBEA 3S84A 1T6QA 4AE4A 4CS8C 1J8MF 3C8GA 2DGJA 1CGME 4MS2A 5KYUA 2BC5A 1D0ZA 2E87A 4IAQA 4U5FE 1LI7A 3LESA 3GWLA 2CCYA 1HW2A 3EHNA 4LLEA 5AC5A 1HE9A 4PJLA 2YRFA 3T6BA 3C18A 4XLPF 2J9UA 3FVYA 1EQ1A 5A6BD 4P9FA 1FNTc 3HKKA 3QW1A 2L6HA 5GPGB 1BDJB 2MHRA 3FMSA 1JPJA 2LD6A 3MX3A 3M79A 3NKDA 3VM6A 4CS8A 2VASA 4U5GA 5FZTA 2MYSA 4U5HA 2XM4A 3O6XA 4YJWA 3GM2A 3DWWA 1I4YA 5E33A 2HJ3A 5EHHA 4BJTA 4OIPF 4OD4A 2WB7A 4QI2A 1FR0A 4RBNA 1T6IA 4BPMA 1RKCA 2DI3A 2FFHA 1PD0A 1QPUA 2RD9A 2J7PD 3DAFA 1G5ZA 3GM3A 4LDKA 3RVYA 4DRIB 4IB4A 3UGPA 2DB4A 1OQCA 3KYJA 1FFTC 1VMAA 2A68F 5DS4A 2KYHA 4YN0B 1APCA 1OXBA 3QTHA 2P61A 2A1DD 3DI5A 4E0HA 4CJOA 2FGYA 1LE2A 2CW0F 2RSEB 3NYMA 2YL1A 1YDIA 1WTYA 5JT4A 2Y3HA 2IXOA 4MTGA 3A11A 1IZMA 3DD7A 1M2VB 1VYIA 3L0IA 4KC9A 3KL4A 2JD3A 4ULWA 3RIPA 1OCCC 1OW8A 3EHMA 5JRAA 2AU5A 2A6EF 5COMA 4DVZA 2ZD9A 2KJGA 2J9BA 2NUTB 1DOWA 2R02A 2YLGA 2BE5F 4AL0A 1VTMP 2KGOA 3HNIA 4JIOA 2DYSC 3B9QA 4JKVA 2AWCA 1SZIA 3W2VA 3EZIA 2NPUA 3CAXA 2XRHA 3IQ5A 1N1CA 1ZHTA 4IRUA 1M2VA 1J8YF 2QE9A 2J46A 4PFOA 4DJ9A 2R05A 3L1MA 1OXKA 2VC9A 5CIVA 2P1AA 3AOUA 5D91A 2IBFA 2HZ8A 2EPOA 4BEMJ 4G7OF 2NUTA 2I8BA 2D5RB 3ZQYA 3TJ6A 5DS6A 2P6VA 1RMVA 3W8IA 3VYWA 1T6UA 2R9RB 2R7RA 4LLCA 1LVKA 2NSGA 1QLEC 2QNLA 3DXJF 3RFYA 4PR9A 3K6BA 3TD7A 1JAFA 4UDVA 4C3BA 5E3AA 2L7AA 1LPEA 3K1IC 1A41A 4QDLA 2W9YA 3NKEA 3V5XA 2XLDA 5A6KA 4OIOF 1S7ZA 4X0RA 1Q0GA 2Y3BA 4DXWA 4N06A 3AG1C 1CPQA 2YL7A 4XTKA 2XLMA 1AEPA 2YL0A 2Q4FA 1K40A 2VCAA 3IQTA 1YJGA 1HMDA 2EPMX 2GA0A 3CEXA 4OINF 1O87A 2QTVA 1MMAA 3K1IA 1VB5A 4M63A 3W8HA 4CS9C 1M6TA 2J0WA 4JTAB 5JP7A 4DRHB 5L0CA 4OIQF 3B0PA 3GEHA 2A69F 5T3WA 3RQFA 4CIPA 2OCCC 4LERA 4J7YA 1NU9C 3ITFA 1Z63A 2Q00A 5A69A 4JJFA 3V5YA 1L7CA 4O6MA 3H65A 4NCQA 3BEHA 3ZTZA 2GAQA 5CI9A 5T3TA 4BJ1A 4DOZA 5K0IA 2M64A 3V5ZA 4IGGA 3K7DA 2ZPAA 2Q7RA 4C3EA 1ORJA 4CS9A 1Q0DA 1S05A 3ABLC 4XEVA 3SP1A 1LKXA 3KMIA 5L0HA 3J06A 3PMRA 5BQGA 2QUPA 3T6GB 3N0TA 1KU2A 5DS5A 1QZXA 2WL8A 1SF8A 3AJMA 4D4NA 4MNDA 4AK9A 2KQ9A 3M4BA 5L0JA 4NTFA 1MNDA 2J0XA 2VCCA 4JJGA 1CPRA 3JYHA 3JSEO 2YVKA 4IAOA 3C63A 2Q9BA 3VRCA 2VH3A 3ASNC 5JUAA 1C02A 1IW7F 3SZRA 1NSGB 5F5FA 1OCOC 1A7VA 4Z9IA 3EPVA 5L0GA 4QI0A 5A6BA 2R7WA 2IXNA 2P0NA 4MTOA 3EGXA 4JVSA 1YYJA 4A2NB 3B0UX 2G62A 1K04A 4EHPA 3US6A 2LK4A 3ZVRA 1B68A 3JRTA 1Z23A 3HLZA 1M57C 2VCBA 2XXAB 5BQIA 1K05A 2R03A 4CJGA 4EUKB 1BZ4A 2YHSA 4U5DE 3T9OA 1QVXA 1LM3B 3ASOC 1Y6DA 4W8KA 3R7CA 3POVA 3FAPB 3N2ZB 4KNVA 1TFKB 1E2XA 1A0BA 1Q0MA 3DZAA 2HV7A 3MYIA 4PACA 3IEEA 3GEIA 3TULA 1GGQA 1WGWA 2G3KA 2CGEA 1UFBA 2IOQA 2XXAA 3AG3C 1YARO 2HJMA 1TWCA 1D0YA 1GQAA 1LS1A 1RXQA 2OEXA 1R5ID 3KH2A 4CBEA 2Q9CA 2R7UA 3W2WA 3AG4C 1BR2A 2L81A 5F5HA 2IYLD 2NG1A 4CS7A 2EIJC 3X2QC 4E7ZA 5DLJA 4P6IC 1NU7D 5B1AC 1SR2A 1GM5A 3WG7C 2P7VA 2V26A 4GEHA 1YYXA 1M2OA 3TJ5A 4EWCA 5L0FA 2YZSA 5A6AA 4Q4ZF 1BR4A 1MMGA 5EGYA 3UGOA 4XPWA 1O5HA 4E0IA 2G3VA 4L6RA 3ZIBA 2J7PA 4DRJB 3HNLA 5E2QA 3N24A 4O79A 4RD9A 1FFHA 1KTMA 3QZCA 1V74B 3I5QA 4HEAJ 4WGZA 4E18A 1EI7A 2OG2A 1XZPA 1W2WA 1VOMA 2H8AA 2YQYA 2I15A 4EKWA 3SXMA 1OKKD 1YZAA 3Q7LA 3SXYA 3U3FA 4MVQA 1VK5A 1V55C 2KSFA 3H2VA 1VLSA 3ECSA 3JZ0A 2WVOA 3K33A 3QVZA 1Z6AA 5IY5C 2XS8A 4W8PA 1XZQA 3FXHA 3OA1A 3IQ6A 3UMHA 3UMKA 2CNWD 4A4AA 1RCPA 1BR1A 4I1MA 4EIYA 1Y4CA 3A9CA 4CX9A 5B1BC 4J30B 1C17M 4PFPA 2V3CC 3NYJA 4WABA 5CI8A 4NTBA 3T4RA 1TKNA 1LS4A 4FWVA 3C62A 3O10A 3RH3A 5KYYB 3ZC4A 2ZXWC 4XPXA 1U6HA 3E9VA 2PFDA 4NTAA 3QVYA 3T6JA 4N6HA 2OOCA 2HS5A 2NUPB 4LDRA 5AC4A 3S90A 3U8PA 5JVEA 2F22A 2PF4E 1E86A 2YEVA 1ORSC 4XEKA 2Q3TA 2XLWA 1QKRA 2YKZA 1D1BA 3EH1A 3GORA 2B0HA 2L6GA 1NG1A 3DAGA 2UUIA 1TWAA 1RJ9B 3S0XA 4DBQA 2OQMA 1MQVA 2W4MA 2XLHA 1O3UA 1YA7O 3TK0A 1SYQA 1VLTA 2NSFA 4JTCB 1TQGA 2AWYA 2CDQA 2J9VA 3MFNA 3NMJA 3BRJA 1A7DA 3GANA 3GWNA 4G78A 1JR8A 4WJ0A 1U0BB 2QLAA 2KC3A 4IARA 3SXKA 2BL2A 2NUPA 1T9KA 3FHDA 3G4ZA 1G4WR 2OU6A 3L8IA 1PCXA 2W45A 4JEAA 3KKBA 1OCZC 3JRMO 3S27A 3U8VA 1MMDA 1H7IA 2R7QA 5BUOA 3IPMO 1QSPA 3JTLO 1F1MA 1G8XA 4JEBA 1RJ9A 4IWBA 4KBLA 4OD5A 1WN0A 3WAQA 3DKAA 1T5OA 4IJJA 3W4YA 4C7OB 2R7XA 4WGYA 2ASRA 2EIMC 1DOVA 1PD1A 5L3QA 1UG7A 1YA9A 3RKOF 1FMVA 4LACB 256BA 1TWGA 1PV3A 3CZ6A 4G7ZF 4MVSA 4E17A 2QY9A 5E3CA 2R7VA 1I4ZA 3RW0A 2L9JA 4Q7CA 3MYFA 1WOLA 1YAUO 4FX5A 3ZDLA 2ICWG 3C8GD 2B0JA 4C7OA 3L34A 2J9WA 4E7SA 2WZGA 4MVMA 3EGXB 4MW3A 5JS5A 2XM0A 3EGDB 4PK4A 3ZSUA 3EH2A 2HUJA 3ZG1A 3JT1A 5COFA 1D1AA 2YLDA 2KW3C 2R7SA 3E70C 2IXMA 2PP4A 4KNWA 3VAYA 2HMZA 1YLMA 2Y3DA 3PCVA 3C7JA 1AUEA 3FAJA 4LDQA 3O55A 3Q6NA 4K7BA 3NDBB 4ONSA 3Q6MA 1LI5A 3EGDA 2Y39A 3LNRA 2EPLX 2WZFA 1YVIA 3R2PA 4O6YA 2L6FA 3DJNB 4U5EE 2IM8A 2YWAA 1RKEB 2OJQA 3NRHA 4YT5A 3S9OA 5B3SC 3GODA 1V4AA 4YL1A 4PJMA 4XEFA 4AX2A 5DQZA 4CDYA 5A6JA 1R4TA 2CYDA 2XLEA 4OIRF 4XPYA 2AVKA 2C04A 2HSBA 3LAYA 4MVOA 4XQ1A 3TOLA 3DE9A 4DVYP 2TMVP 1ZHWA 3AQBA 2OEVA 4MQ9F 3ZWIA 3QMKA 1ZZPA 4R32A 3ZTMA 4JCHA 4HFKB 4MVUA 1RKEA 3JYYA 3NMKA 1HE1A 1JPNA 1I5NA 1WATA 2Z15A 3F47A 2JPUA 3M15A 4NY3A 2OJED 4YWQA 4JCZA 3HTKC 1FAPB 4ZLDA 2H7OA 2HFIA 5T1DB 3AGTA 3EQLF 3PHF2 3PDMP 2X51A 1JOGA 1FMWA 1NBBA 1TWHA 4MVZA 4U9DA 3B0VC 4Q5SF 3LS1A 1WWPA 1L3PA 4EBKA 3CQZA 3NMIA 4ANJA 1Z3IX 1ZU4A 4JW1A 1ZHZA 4ULVA 4GYTA 4EBJA 3EFOB 1VYKA 3AGUA 2XL6A 2OKUA 3KYIA 3RYLA 3SYNA 5FCLA 3MLGA 2LFDA 3UR3C 4N4WA 2X0CA 4FAPB 2DYRC 2PNOA 3H2UA 1XWJA 1HW1A 2KK1A 2WVNA 5L3VA 4GQHA 2O9XA 3C8ZA 4ZLCA 1D1CA 3LS0A 5L0DA 3JSZA 4I1OB 2A0UA 3G50A 3Q7GA 1Q0KA 4HE8D 1H9GA 2EIKC 2XL8A 4NQFA 1NFOA 1LIHA 1ZVZA 2VB6A 4BG0A 1ZYRF 1TR2A 3MBGA 1OR3A 2H7VC 3SNHA 3F46A 3EFOA 4JRZA 2LCHA 2XL4A 2M4EA 2WVQA 1BBHA 4YL0A 3S28A 3U3BA 4CIHA 2A6HF 4H54A 4XLNF 3SXZA 4ER9A 5COGA 2R7TA 4JE9A 1U89A 2WZLA 3I4UA 4H4KC 4DBRA 5HV9A 1OR2A 1JRAA 2IXPA 3KPHA 1M56C 2JX0A 3VF0A 3DMDA 4P9TA 5JSLA 1TFOB 1MNEA 3U9JA 5DQTA 5KYNA 3DJUB 2J8WA 4JTDB 1C03A 5BQHA 1E83A 2XSEA 2HSQA 1ZW3A 1ZHXA 3IHUA 1ZU5A 3JCUQ 1D0XA 3HJCA 2LP4A 2FAPB 3AQCA 3DM5A 3CSKA 3DE8A 3SEOA 4MVRA 4BJ5C 4BEJA 3LEVA 3OEOA 4PJNA 4YT2A 5KYWB 3LJBA 3TQOA 2AP3A 4N6CA 2LSEA 1QQ3A 3ABMC 1CGOA 1H6GA 4O7GA 4O6NA 3K1HA 1HMOA 3LLKA 2XS1A 4JC7A 1E85A 4FESA 1OKKA 4K1OA 3U2MA 3U2LA 3EZHA 3ATPA 1NFNA 4EBBA 1ORYA 5HSWA 4CSAC 4JURI 1V54C 4I44A 3RVZA 1HY5A 4HFFB 3M1CB 4C3DA 1LE4A 3NG1A 5F28E 4BJ5A 3ABKC 4F4BA 5KYWA 3HNKA 2CNWA 4MW8A 2ETSA 2GWWA 2W4BA 3LNMB 1EA8A 4K0DA 2EPNA 1ZW2A 2PX0A 3G4XA 3O39A 3LLIA 4JZAA 4U5BE 3U5SA 3U0CA 3FDQA 3X1OA 2EILC 2HV6A 5B3IA 3B29A 3AG2C 4PJJA 3V7OA 5JLIA 5EK0A 4YT8A 5KYXB 4CSAA 1EKYA 3B71A 3TOMA 4YL3A 1OCRC 4YT4A 1MMNA 2LQGA 4NC3A 2GFHA 3NYLA 3S29A 3UNGC 5DVWA 3IQCA 2HMQA 2XLVA 2HKVA
chains in the Genus database with same CATH topology
2MWQA 4XWJA 2J45A 3EG9B 4KI2A 2R7OA 1SMYF 3UMIA 5D92A 2ZXOA 4G0HA 5KYXA 2EINC 1NZEA 2H7BA 2PX3A 2KNHA 4I3MA 3DM9B 4B6IA 1FTSA 1ZHYA 3K66A 4BJ6C 3EG9A 4BEJA 1ST6A 4G7HF 4AE4B 5KYUB 3OWTA 4J32B 3EJNA 2Y3GA 3I5PA 2ZXRA 2Y69C 4U5CE 2Q9AA 1Z5ZA 4RDAA 4BJ6A 2C03A 2ZXPA 3WODF 4AE4A 4CS8C 1J8MF 2DGJA 5KYUA 1D0ZA 2E87A 4U5FE 3LESA 3EHNA 4LLEA 4PJLA 3T6BA 4XLPF 2J9UA 3FVYA 1JPJA 3MX3A 3NKDA 4CS8A 2VASA 4U5GA 2MYSA 4U5HA 3O6XA 4YJWA 5E33A 5EHHA 4BJTA 4OIPF 4OD4A 2WB7A 4QI2A 4RBNA 2FFHA 1PD0A 2J7PD 3DAFA 2R7VA 3UGPA 1FFTC 1VMAA 2A68F 5DS4A 4YN0B 2A1DD 2FGYA 2CW0F 3NYMA 2Y3HA 2IXOA 1IZMA 3DD7A 1M2VB 1VYIA 3L0IA 4KC9A 3KL4A 2JD3A 4ULWA 3RIPA 1OCCC 3EHMA 2A6EF 4DVZA 2KJGA 2NUTB 2BE5F 2KGOA 2DYSC 3B9QA 1SZIA 3W2VA 3EZIA 2XRHA 1N1CA 1ZHTA 4IRUA 1M2VA 1J8YF 4PFOA 2J46A 5D91A 4G7OF 2NUTA 2I8BA 2D5RB 5DS6A 2P6VA 3W8IA 3VYWA 2R7RA 4LLCA 1LVKA 3DXJF 1QLEC 3RFYA 3TD7A 3K6BA 4C3BA 5E3AA 3K1IC 4QDLA 2W9YA 3NKEA 4OIOF 1S7ZA 4X0RA 2Y3BA 4N06A 3AG1C 4XTKA 4OINF 1O87A 2QTVA 1MMAA 4M63A 3W8HA 4CS9C 2J0WA 4OIQF 3B0PA 2A69F 5T3WA 2OCCC 4LERA 1NU9C 3ITFA 1Z63A 4JJFA 4O6MA 3H65A 5CI9A 5T3TA 4BJ1A 4DOZA 3K7DA 2ZPAA 4C3EA 4CS9A 3ABLC 3SP1A 1LKXA 3KMIA 3PMRA 3N0TA 1KU2A 5DS5A 1QZXA 2WL8A 1SF8A 4MNDA 4AK9A 2KQ9A 1MNDA 2J0XA 4JJGA 3JYHA 4IAOA 2Q9BA 2VH3A 3ASNC 1IW7F 3SZRA 5F5FA 1OCOC 3EPVA 2R7WA 4QI0A 2IXNA 3EGXA 4JVSA 3B0UX 4A2NB 2G62A 3ZVRA 3JRTA 1Z23A 3HLZA 1M57C 2XXAB 2YHSA 4U5DE 3ASOC 4W8KA 3POVA 3N2ZB 4KNVA 3DZAA 2HV7A 3IEEA 1WGWA 2G3KA 2CGEA 2IOQA 2XXAA 3AG3C 1TWCA 1D0YA 1LS1A 4CBEA 2R7UA 3KH2A 2Q9CA 3W2WA 3AG4C 2L81A 1BR2A 5F5HA 2IYLD 2NG1A 4CS7A 2EIJC 3X2QC 4E7ZA 5DLJA 4P6IC 1NU7D 5B1AC 3WG7C 2P7VA 2V26A 4GEHA 1M2OA 4EWCA 2YZSA 4Q4ZF 1BR4A 1MMGA 5EGYA 3UGOA 1O5HA 2G3VA 3ZIBA 2J7PA 5E2QA 3N24A 4O79A 4RD9A 1FFHA 3QZCA 3I5QA 4HEAJ 2OG2A 1W2WA 1VOMA 1OKKD 3Q7LA 1VK5A 1V55C 3K33A 3ECSA 2WVOA 1Z6AA 5IY5C 3OA1A 3UMHA 3UMKA 2CNWD 1BR1A 4I1MA 2V3CC 5B1BC 4J30B 4PFPA 3NYJA 5CI8A 3T4RA 1TKNA 4FWVA 3RH3A 5KYYB 3ZC4A 2ZXWC 3E9VA 2PFDA 3T6JA 2NUPB 2PF4E 2YEVA 2Q3TA 1D1BA 3EH1A 1NG1A 3DAGA 1TWAA 1RJ9B 3S0XA 4DBQA 2W4MA 5KYYA 2CDQA 2J9VA 4WJ0A 3GANA 2NUPA 3FHDA 1PCXA 2W45A 3KKBA 1OCZC 3S27A 1MMDA 2R7QA 5BUOA 1G8XA 1RJ9A 4IWBA 4KBLA 4OD5A 4C7OB 4IJJA 2R7XA 2EIMC 1PD1A 5L3QA 3RKOF 1FMVA 4LACB 1TWGA 3CZ6A 4G7ZF 2QY9A 5E3CA 2L9JA 4Q7CA 4FX5A 4C7OA 2B0JA 3L34A 2J9WA 4E7SA 2WZGA 3EGXB 4PK4A 3EGDB 3ZSUA 3EH2A 3ZG1A 3JT1A 1D1AA 2KW3C 2R7SA 3E70C 2IXMA 2PP4A 4KNWA 3VAYA 2Y3DA 3FAJA 3Q6NA 4K7BA 3NDBB 3Q6MA 3EGDA 2Y39A 3LNRA 2WZFA 4O6YA 4DVYP 4U5EE 3DJNB 5B3SC 3NRHA 4YT5A 3GODA 4AX2A 4PJMA 5DQZA 4OIRF 2C04A 3LAYA 1ZHWA 3AQBA 4MQ9F 3QMKA 4JCHA 4HFKB 1JPNA 2Z15A 3F47A 4YWQA 4NY3A 3HTKC 4ZLDA 2H7OA 5T1DB 3EQLF 3PHF2 2X51A 1FMWA 1TWHA 3B0VC 4Q5SF 3LS1A 3CQZA 4ANJA 1Z3IX 1ZU4A 4JW1A 1ZHZA 4GYTA 3EFOB 1VYKA 3SYNA 3RYLA 5FCLA 3MLGA 3UR3C 2DYRC 2WVNA 5L3VA 2O9XA 4ZLCA 1D1CA 3LS0A 3JSZA 4I1OB 3Q7GA 4HE8D 2EIKC 2VB6A 4BG0A 1ZYRF 1TR2A 3SNHA 2H7VC 3F46A 3EFOA 2XL4A 2M4EA 2WVQA 3S28A 4CIHA 2A6HF 4XLNF 2R7TA 2WZLA 3I4UA 4H4KC 4DBRA 2IXPA 1M56C 3DMDA 1MNEA 5DQTA 5KYNA 3DJUB 2XSEA 1ZHXA 1ZU5A 3JCUQ 1D0XA 3HJCA 3AQCA 3DM5A 3CSKA 3SEOA 4BJ5C 3LEVA 3OEOA 4PJNA 4YT2A 5KYWB 3LJBA 2LSEA 3ABMC 4O7GA 4O6NA 3K1HA 3LLKA 4FESA 1OKKA 4CSAC 3EZHA 4EBBA 5HSWA 4JURI 1V54C 4I44A 4C3DA 4HFFB 3M1CB 3NG1A 4BJ5A 3ABKC 4F4BA 5KYWA 2CNWA 2W4BA 4K0DA 2PX0A 3O39A 4U5BE 3FDQA 4JZAA 3LLIA 3X1OA 2EILC 2HV6A 3AG2C 4PJJA 3V7OA 4YT8A 5KYXB 4CSAA 1OCRC 4YT4A 1MMNA 2GFHA 3NYLA 3S29A 3UNGC 5DVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LNR A;  4I44 A;  4I3M A; 
#chains in the Genus database with same CATH topology
 3GEE A;  4CDV A;  2MWQ A;  4XWJ A;  2J45 A;  3EG9 B;  1Z7Q c;  2R7O A;  1CGN A;  3RF3 A;  4KI2 A;  1SMY F;  4Z9J A;  3WHN A;  3UMI A;  1OW7 A;  5D92 A;  1WAS A;  2ZXO A;  1YZC A;  4G0H A;  5KYX A;  3GM1 A;  2EIN C;  1T01 A;  2LFF A;  3FOP A;  3LEO A;  4AL1 A;  1NLX A;  1NZE A;  2H7B A;  1H9T A;  1A7E A;  2R25 A;  2PX3 A;  3M4C A;  4MTF A;  2KNH A;  1OW6 A;  1E84 A;  1KNY A;  4I3M A;  1GS9 A;  3DM9 B;  4D4X A;  4B6I A;  1FTS A;  1ZHY A;  2YLI A;  1Q0F A;  2LIG A;  2UUH A;  1ST6 A;  3EG9 A;  3K66 A;  1G4U S;  2GDC A;  3FOO A;  4BJ6 C;  4G7H F;  2D4U A;  5AGF A;  3RQE A;  5TJ5 E;  3C8G B;  3LUT B;  1AVO B;  2A0B A;  4AE4 B;  3HNJ A;  5KYU B;  3OWT A;  4J32 B;  5KYY A;  3EJN A;  2Y3G A;  2EPK X;  2YL3 A;  3I5P A;  3L8J A;  1JMW A;  5L0I A;  2XLO A;  4J7T A;  2ZXR A;  2Y69 C;  4U5C E;  4YK5 A;  4CDA A;  4U9E A;  2Q9A A;  3ZQV A;  4Z9H A;  1Z5Z A;  3RQG A;  4RDA A;  4BJ6 A;  2C03 A;  3QW0 A;  2ZXP A;  3U9M A;  3WOD F;  2PBE A;  3S84 A;  1T6Q A;  4AE4 A;  4CS8 C;  1J8M F;  3C8G A;  2DGJ A;  1CGM E;  4MS2 A;  5KYU A;  2BC5 A;  1D0Z A;  2E87 A;  4IAQ A;  4U5F E;  1LI7 A;  3LES A;  3GWL A;  2CCY A;  1HW2 A;  3EHN A;  4LLE A;  5AC5 A;  1HE9 A;  4PJL A;  2YRF A;  3T6B A;  3C18 A;  4XLP F;  2J9U A;  3FVY A;  1EQ1 A;  5A6B D;  4P9F A;  1FNT c;  3HKK A;  3QW1 A;  2L6H A;  5GPG B;  1BDJ B;  2MHR A;  3FMS A;  1JPJ A;  2LD6 A;  3MX3 A;  3M79 A;  3NKD A;  3VM6 A;  4CS8 A;  2VAS A;  4U5G A;  5FZT A;  2MYS A;  4U5H A;  2XM4 A;  3O6X A;  4YJW A;  3GM2 A;  3DWW A;  1I4Y A;  5E33 A;  2HJ3 A;  5EHH A;  4BJT A;  4OIP F;  4OD4 A;  2WB7 A;  4QI2 A;  1FR0 A;  4RBN A;  1T6I A;  4BPM A;  1RKC A;  2DI3 A;  2FFH A;  1PD0 A;  1QPU A;  2RD9 A;  2J7P D;  3DAF A;  1G5Z A;  3GM3 A;  4LDK A;  3RVY A;  4DRI B;  4IB4 A;  3UGP A;  2DB4 A;  1OQC A;  3KYJ A;  1FFT C;  1VMA A;  2A68 F;  5DS4 A;  2KYH A;  4YN0 B;  1APC A;  1OXB A;  3QTH A;  2P61 A;  2A1D D;  3DI5 A;  4E0H A;  4CJO A;  2FGY A;  1LE2 A;  2CW0 F;  2RSE B;  3NYM A;  2YL1 A;  1YDI A;  1WTY A;  5JT4 A;  2Y3H A;  2IXO A;  4MTG A;  3A11 A;  1IZM A;  3DD7 A;  1M2V B;  1VYI A;  3L0I A;  4KC9 A;  3KL4 A;  2JD3 A;  4ULW A;  3RIP A;  1OCC C;  1OW8 A;  3EHM A;  5JRA A;  2AU5 A;  2A6E F;  5COM A;  4DVZ A;  2ZD9 A;  2KJG A;  2J9B A;  2NUT B;  1DOW A;  2R02 A;  2YLG A;  2BE5 F;  4AL0 A;  1VTM P;  2KGO A;  3HNI A;  4JIO A;  2DYS C;  3B9Q A;  4JKV A;  2AWC A;  1SZI A;  3W2V A;  3EZI A;  2NPU A;  3CAX A;  2XRH A;  3IQ5 A;  1N1C A;  1ZHT A;  4IRU A;  1M2V A;  1J8Y F;  2QE9 A;  2J46 A;  4PFO A;  4DJ9 A;  2R05 A;  3L1M A;  1OXK A;  2VC9 A;  5CIV A;  2P1A A;  3AOU A;  5D91 A;  2IBF A;  2HZ8 A;  2EPO A;  4BEM J;  4G7O F;  2NUT A;  2I8B A;  2D5R B;  3ZQY A;  3TJ6 A;  5DS6 A;  2P6V A;  1RMV A;  3W8I A;  3VYW A;  1T6U A;  2R9R B;  2R7R A;  4LLC A;  1LVK A;  2NSG A;  1QLE C;  2QNL A;  3DXJ F;  3RFY A;  4PR9 A;  3K6B A;  3TD7 A;  1JAF A;  4UDV A;  4C3B A;  5E3A A;  2L7A A;  1LPE A;  3K1I C;  1A41 A;  4QDL A;  2W9Y A;  3NKE A;  3V5X A;  2XLD A;  5A6K A;  4OIO F;  1S7Z A;  4X0R A;  1Q0G A;  2Y3B A;  4DXW A;  4N06 A;  3AG1 C;  1CPQ A;  2YL7 A;  4XTK A;  2XLM A;  1AEP A;  2YL0 A;  2Q4F A;  1K40 A;  2VCA A;  3IQT A;  1YJG A;  1HMD A;  2EPM X;  2GA0 A;  3CEX A;  4OIN F;  1O87 A;  2QTV A;  1MMA A;  3K1I A;  1VB5 A;  4M63 A;  3W8H A;  4CS9 C;  1M6T A;  2J0W A;  4JTA B;  5JP7 A;  4DRH B;  5L0C A;  4OIQ F;  3B0P A;  3GEH A;  2A69 F;  5T3W A;  3RQF A;  4CIP A;  2OCC C;  4LER A;  4J7Y A;  1NU9 C;  3ITF A;  1Z63 A;  2Q00 A;  5A69 A;  4JJF A;  3V5Y A;  1L7C A;  4O6M A;  3H65 A;  4NCQ A;  3BEH A;  3ZTZ A;  2GAQ A;  5CI9 A;  5T3T A;  4BJ1 A;  4DOZ A;  5K0I A;  2M64 A;  3V5Z A;  4IGG A;  3K7D A;  2ZPA A;  2Q7R A;  4C3E A;  1ORJ A;  4CS9 A;  1Q0D A;  1S05 A;  3ABL C;  4XEV A;  3SP1 A;  1LKX A;  3KMI A;  5L0H A;  3J06 A;  3PMR A;  5BQG A;  2QUP A;  3T6G B;  3N0T A;  1KU2 A;  5DS5 A;  1QZX A;  2WL8 A;  1SF8 A;  3AJM A;  4D4N A;  4MND A;  4AK9 A;  2KQ9 A;  3M4B A;  5L0J A;  4NTF A;  1MND A;  2J0X A;  2VCC A;  4JJG A;  1CPR A;  3JYH A;  3JSE O;  2YVK A;  4IAO A;  3C63 A;  2Q9B A;  3VRC A;  2VH3 A;  3ASN C;  5JUA A;  1C02 A;  1IW7 F;  3SZR A;  1NSG B;  5F5F A;  1OCO C;  1A7V A;  4Z9I A;  3EPV A;  5L0G A;  4QI0 A;  5A6B A;  2R7W A;  2IXN A;  2P0N A;  4MTO A;  3EGX A;  4JVS A;  1YYJ A;  4A2N B;  3B0U X;  2G62 A;  1K04 A;  4EHP A;  3US6 A;  2LK4 A;  3ZVR A;  1B68 A;  3JRT A;  1Z23 A;  3HLZ A;  1M57 C;  2VCB A;  2XXA B;  5BQI A;  1K05 A;  2R03 A;  4CJG A;  4EUK B;  1BZ4 A;  2YHS A;  4U5D E;  3T9O A;  1QVX A;  1LM3 B;  3ASO C;  1Y6D A;  4W8K A;  3R7C A;  3POV A;  3FAP B;  3N2Z B;  4KNV A;  1TFK B;  1E2X A;  1A0B A;  1Q0M A;  3DZA A;  2HV7 A;  3MYI A;  4PAC A;  3IEE A;  3GEI A;  3TUL A;  1GGQ A;  1WGW A;  2G3K A;  2CGE A;  1UFB A;  2IOQ A;  2XXA A;  3AG3 C;  1YAR O;  2HJM A;  1TWC A;  1D0Y A;  1GQA A;  1LS1 A;  1RXQ A;  2OEX A;  1R5I D;  3KH2 A;  4CBE A;  2Q9C A;  2R7U A;  3W2W A;  3AG4 C;  1BR2 A;  2L81 A;  5F5H A;  2IYL D;  2NG1 A;  4CS7 A;  2EIJ C;  3X2Q C;  4E7Z A;  5DLJ A;  4P6I C;  1NU7 D;  5B1A C;  1SR2 A;  1GM5 A;  3WG7 C;  2P7V A;  2V26 A;  4GEH A;  1YYX A;  1M2O A;  3TJ5 A;  4EWC A;  5L0F A;  2YZS A;  5A6A A;  4Q4Z F;  1BR4 A;  1MMG A;  5EGY A;  3UGO A;  4XPW A;  1O5H A;  4E0I A;  2G3V A;  4L6R A;  3ZIB A;  2J7P A;  4DRJ B;  3HNL A;  5E2Q A;  3N24 A;  4O79 A;  4RD9 A;  1FFH A;  1KTM A;  3QZC A;  1V74 B;  3I5Q A;  4HEA J;  4WGZ A;  4E18 A;  1EI7 A;  2OG2 A;  1XZP A;  1W2W A;  1VOM A;  2H8A A;  2YQY A;  2I15 A;  4EKW A;  3SXM A;  1OKK D;  1YZA A;  3Q7L A;  3SXY A;  3U3F A;  4MVQ A;  1VK5 A;  1V55 C;  2KSF A;  3H2V A;  1VLS A;  3ECS A;  3JZ0 A;  2WVO A;  3K33 A;  3QVZ A;  1Z6A A;  5IY5 C;  2XS8 A;  4W8P A;  1XZQ A;  3FXH A;  3OA1 A;  3IQ6 A;  3UMH A;  3UMK A;  2CNW D;  4A4A A;  1RCP A;  1BR1 A;  4I1M A;  4EIY A;  1Y4C A;  3A9C A;  4CX9 A;  5B1B C;  4J30 B;  1C17 M;  4PFP A;  2V3C C;  3NYJ A;  4WAB A;  5CI8 A;  4NTB A;  3T4R A;  1TKN A;  1LS4 A;  4FWV A;  3C62 A;  3O10 A;  3RH3 A;  5KYY B;  3ZC4 A;  2ZXW C;  4XPX A;  1U6H A;  3E9V A;  2PFD A;  4NTA A;  3QVY A;  3T6J A;  4N6H A;  2OOC A;  2HS5 A;  2NUP B;  4LDR A;  5AC4 A;  3S90 A;  3U8P A;  5JVE A;  2F22 A;  2PF4 E;  1E86 A;  2YEV A;  1ORS C;  4XEK A;  2Q3T A;  2XLW A;  1QKR A;  2YKZ A;  1D1B A;  3EH1 A;  3GOR A;  2B0H A;  2L6G A;  1NG1 A;  3DAG A;  2UUI A;  1TWA A;  1RJ9 B;  3S0X A;  4DBQ A;  2OQM A;  1MQV A;  2W4M A;  2XLH A;  1O3U A;  1YA7 O;  3TK0 A;  1SYQ A;  1VLT A;  2NSF A;  4JTC B;  1TQG A;  2AWY A;  2CDQ A;  2J9V A;  3MFN A;  3NMJ A;  3BRJ A;  1A7D A;  3GAN A;  3GWN A;  4G78 A;  1JR8 A;  4WJ0 A;  1U0B B;  2QLA A;  2KC3 A;  4IAR A;  3SXK A;  2BL2 A;  2NUP A;  1T9K A;  3FHD A;  3G4Z A;  1G4W R;  2OU6 A;  3L8I A;  1PCX A;  2W45 A;  4JEA A;  3KKB A;  1OCZ C;  3JRM O;  3S27 A;  3U8V A;  1MMD A;  1H7I A;  2R7Q A;  5BUO A;  3IPM O;  1QSP A;  3JTL O;  1F1M A;  1G8X A;  4JEB A;  1RJ9 A;  4IWB A;  4KBL A;  4OD5 A;  1WN0 A;  3WAQ A;  3DKA A;  1T5O A;  4IJJ A;  3W4Y A;  4C7O B;  2R7X A;  4WGY A;  2ASR A;  2EIM C;  1DOV A;  1PD1 A;  5L3Q A;  1UG7 A;  1YA9 A;  3RKO F;  1FMV A;  4LAC B;  256B A;  1TWG A;  1PV3 A;  3CZ6 A;  4G7Z F;  4MVS A;  4E17 A;  2QY9 A;  5E3C A;  2R7V A;  1I4Z A;  3RW0 A;  2L9J A;  4Q7C A;  3MYF A;  1WOL A;  1YAU O;  4FX5 A;  3ZDL A;  2ICW G;  3C8G D;  2B0J A;  4C7O A;  3L34 A;  2J9W A;  4E7S A;  2WZG A;  4MVM A;  3EGX B;  4MW3 A;  5JS5 A;  2XM0 A;  3EGD B;  4PK4 A;  3ZSU A;  3EH2 A;  2HUJ A;  3ZG1 A;  3JT1 A;  5COF A;  1D1A A;  2YLD A;  2KW3 C;  2R7S A;  3E70 C;  2IXM A;  2PP4 A;  4KNW A;  3VAY A;  2HMZ A;  1YLM A;  2Y3D A;  3PCV A;  3C7J A;  1AUE A;  3FAJ A;  4LDQ A;  3O55 A;  3Q6N A;  4K7B A;  3NDB B;  4ONS A;  3Q6M A;  1LI5 A;  3EGD A;  2Y39 A;  3LNR A;  2EPL X;  2WZF A;  1YVI A;  3R2P A;  4O6Y A;  2L6F A;  3DJN B;  4U5E E;  2IM8 A;  2YWA A;  1RKE B;  2OJQ A;  3NRH A;  4YT5 A;  3S9O A;  5B3S C;  3GOD A;  1V4A A;  4YL1 A;  4PJM A;  4XEF A;  4AX2 A;  5DQZ A;  4CDY A;  5A6J A;  1R4T A;  2CYD A;  2XLE A;  4OIR F;  4XPY A;  2AVK A;  2C04 A;  2HSB A;  3LAY A;  4MVO A;  4XQ1 A;  3TOL A;  3DE9 A;  4DVY P;  2TMV P;  1ZHW A;  3AQB A;  2OEV A;  4MQ9 F;  3ZWI A;  3QMK A;  1ZZP A;  4R32 A;  3ZTM A;  4JCH A;  4HFK B;  4MVU A;  1RKE A;  3JYY A;  3NMK A;  1HE1 A;  1JPN A;  1I5N A;  1WAT A;  2Z15 A;  3F47 A;  2JPU A;  3M15 A;  4NY3 A;  2OJE D;  4YWQ A;  4JCZ A;  3HTK C;  1FAP B;  4ZLD A;  2H7O A;  2HFI A;  5T1D B;  3AGT A;  3EQL F;  3PHF 2;  3PDM P;  2X51 A;  1JOG A;  1FMW A;  1NBB A;  1TWH A;  4MVZ A;  4U9D A;  3B0V C;  4Q5S F;  3LS1 A;  1WWP A;  1L3P A;  4EBK A;  3CQZ A;  3NMI A;  4ANJ A;  1Z3I X;  1ZU4 A;  4JW1 A;  1ZHZ A;  4ULV A;  4GYT A;  4EBJ A;  3EFO B;  1VYK A;  3AGU A;  2XL6 A;  2OKU A;  3KYI A;  3RYL A;  3SYN A;  5FCL A;  3MLG A;  2LFD A;  3UR3 C;  4N4W A;  2X0C A;  4FAP B;  2DYR C;  2PNO A;  3H2U A;  1XWJ A;  1HW1 A;  2KK1 A;  2WVN A;  5L3V A;  4GQH A;  2O9X A;  3C8Z A;  4ZLC A;  1D1C A;  3LS0 A;  5L0D A;  3JSZ A;  4I1O B;  2A0U A;  3G50 A;  3Q7G A;  1Q0K A;  4HE8 D;  1H9G A;  2EIK C;  2XL8 A;  4NQF A;  1NFO A;  1LIH A;  1ZVZ A;  2VB6 A;  4BG0 A;  1ZYR F;  1TR2 A;  3MBG A;  1OR3 A;  2H7V C;  3SNH A;  3F46 A;  3EFO A;  4JRZ A;  2LCH A;  2XL4 A;  2M4E A;  2WVQ A;  1BBH A;  4YL0 A;  3S28 A;  3U3B A;  4CIH A;  2A6H F;  4H54 A;  4XLN F;  3SXZ A;  4ER9 A;  5COG A;  2R7T A;  4JE9 A;  1U89 A;  2WZL A;  3I4U A;  4H4K C;  4DBR A;  5HV9 A;  1OR2 A;  1JRA A;  2IXP A;  3KPH A;  1M56 C;  2JX0 A;  3VF0 A;  3DMD A;  4P9T A;  5JSL A;  1TFO B;  1MNE A;  3U9J A;  5DQT A;  5KYN A;  3DJU B;  2J8W A;  4JTD B;  1C03 A;  5BQH A;  1E83 A;  2XSE A;  2HSQ A;  1ZW3 A;  1ZHX A;  3IHU A;  1ZU5 A;  3JCU Q;  1D0X A;  3HJC A;  2LP4 A;  2FAP B;  3AQC A;  3DM5 A;  3CSK A;  3DE8 A;  3SEO A;  4MVR A;  4BJ5 C;  4BEJ A;  3LEV A;  3OEO A;  4PJN A;  4YT2 A;  5KYW B;  3LJB A;  3TQO A;  2AP3 A;  4N6C A;  2LSE A;  1QQ3 A;  3ABM C;  1CGO A;  1H6G A;  4O7G A;  4O6N A;  3K1H A;  1HMO A;  3LLK A;  2XS1 A;  4JC7 A;  1E85 A;  4FES A;  1OKK A;  4K1O A;  3U2M A;  3U2L A;  3EZH A;  3ATP A;  1NFN A;  4EBB A;  1ORY A;  5HSW A;  4CSA C;  4JUR I;  1V54 C;  4I44 A;  3RVZ A;  1HY5 A;  4HFF B;  3M1C B;  4C3D A;  1LE4 A;  3NG1 A;  5F28 E;  4BJ5 A;  3ABK C;  4F4B A;  5KYW A;  3HNK A;  2CNW A;  4MW8 A;  2ETS A;  2GWW A;  2W4B A;  3LNM B;  1EA8 A;  4K0D A;  2EPN A;  1ZW2 A;  2PX0 A;  3G4X A;  3O39 A;  3LLI A;  4JZA A;  4U5B E;  3U5S A;  3U0C A;  3FDQ A;  3X1O A;  2EIL C;  2HV6 A;  5B3I A;  3B29 A;  3AG2 C;  4PJJ A;  3V7O A;  5JLI A;  5EK0 A;  4YT8 A;  5KYX B;  4CSA A;  1EKY A;  3B71 A;  3TOM A;  4YL3 A;  1OCR C;  4YT4 A;  1MMN A;  2LQG A;  4NC3 A;  2GFH A;  3NYL A;  3S29 A;  3UNG C;  5DVW A;  3IQC A;  2HMQ A;  2XLV A;  2HKV A; 
#chains in the Genus database with same CATH homology
 2MWQ A;  4XWJ A;  2J45 A;  3EG9 B;  4KI2 A;  2R7O A;  1SMY F;  3UMI A;  5D92 A;  2ZXO A;  4G0H A;  5KYX A;  2EIN C;  1NZE A;  2H7B A;  2PX3 A;  2KNH A;  4I3M A;  3DM9 B;  4B6I A;  1FTS A;  1ZHY A;  3K66 A;  4BJ6 C;  3EG9 A;  4BEJ A;  1ST6 A;  4G7H F;  4AE4 B;  5KYU B;  3OWT A;  4J32 B;  3EJN A;  2Y3G A;  3I5P A;  2ZXR A;  2Y69 C;  4U5C E;  2Q9A A;  1Z5Z A;  4RDA A;  4BJ6 A;  2C03 A;  2ZXP A;  3WOD F;  4AE4 A;  4CS8 C;  1J8M F;  2DGJ A;  5KYU A;  1D0Z A;  2E87 A;  4U5F E;  3LES A;  3EHN A;  4LLE A;  4PJL A;  3T6B A;  4XLP F;  2J9U A;  3FVY A;  1JPJ A;  3MX3 A;  3NKD A;  4CS8 A;  2VAS A;  4U5G A;  2MYS A;  4U5H A;  3O6X A;  4YJW A;  5E33 A;  5EHH A;  4BJT A;  4OIP F;  4OD4 A;  2WB7 A;  4QI2 A;  4RBN A;  2FFH A;  1PD0 A;  2J7P D;  3DAF A;  2R7V A;  3UGP A;  1FFT C;  1VMA A;  2A68 F;  5DS4 A;  4YN0 B;  2A1D D;  2FGY A;  2CW0 F;  3NYM A;  2Y3H A;  2IXO A;  1IZM A;  3DD7 A;  1M2V B;  1VYI A;  3L0I A;  4KC9 A;  3KL4 A;  2JD3 A;  4ULW A;  3RIP A;  1OCC C;  3EHM A;  2A6E F;  4DVZ A;  2KJG A;  2NUT B;  2BE5 F;  2KGO A;  2DYS C;  3B9Q A;  1SZI A;  3W2V A;  3EZI A;  2XRH A;  1N1C A;  1ZHT A;  4IRU A;  1M2V A;  1J8Y F;  4PFO A;  2J46 A;  5D91 A;  4G7O F;  2NUT A;  2I8B A;  2D5R B;  5DS6 A;  2P6V A;  3W8I A;  3VYW A;  2R7R A;  4LLC A;  1LVK A;  3DXJ F;  1QLE C;  3RFY A;  3TD7 A;  3K6B A;  4C3B A;  5E3A A;  3K1I C;  4QDL A;  2W9Y A;  3NKE A;  4OIO F;  1S7Z A;  4X0R A;  2Y3B A;  4N06 A;  3AG1 C;  4XTK A;  4OIN F;  1O87 A;  2QTV A;  1MMA A;  4M63 A;  3W8H A;  4CS9 C;  2J0W A;  4OIQ F;  3B0P A;  2A69 F;  5T3W A;  2OCC C;  4LER A;  1NU9 C;  3ITF A;  1Z63 A;  4JJF A;  4O6M A;  3H65 A;  5CI9 A;  5T3T A;  4BJ1 A;  4DOZ A;  3K7D A;  2ZPA A;  4C3E A;  4CS9 A;  3ABL C;  3SP1 A;  1LKX A;  3KMI A;  3PMR A;  3N0T A;  1KU2 A;  5DS5 A;  1QZX A;  2WL8 A;  1SF8 A;  4MND A;  4AK9 A;  2KQ9 A;  1MND A;  2J0X A;  4JJG A;  3JYH A;  4IAO A;  2Q9B A;  2VH3 A;  3ASN C;  1IW7 F;  3SZR A;  5F5F A;  1OCO C;  3EPV A;  2R7W A;  4QI0 A;  2IXN A;  3EGX A;  4JVS A;  3B0U X;  4A2N B;  2G62 A;  3ZVR A;  3JRT A;  1Z23 A;  3HLZ A;  1M57 C;  2XXA B;  2YHS A;  4U5D E;  3ASO C;  4W8K A;  3POV A;  3N2Z B;  4KNV A;  3DZA A;  2HV7 A;  3IEE A;  1WGW A;  2G3K A;  2CGE A;  2IOQ A;  2XXA A;  3AG3 C;  1TWC A;  1D0Y A;  1LS1 A;  4CBE A;  2R7U A;  3KH2 A;  2Q9C A;  3W2W A;  3AG4 C;  2L81 A;  1BR2 A;  5F5H A;  2IYL D;  2NG1 A;  4CS7 A;  2EIJ C;  3X2Q C;  4E7Z A;  5DLJ A;  4P6I C;  1NU7 D;  5B1A C;  3WG7 C;  2P7V A;  2V26 A;  4GEH A;  1M2O A;  4EWC A;  2YZS A;  4Q4Z F;  1BR4 A;  1MMG A;  5EGY A;  3UGO A;  1O5H A;  2G3V A;  3ZIB A;  2J7P A;  5E2Q A;  3N24 A;  4O79 A;  4RD9 A;  1FFH A;  3QZC A;  3I5Q A;  4HEA J;  2OG2 A;  1W2W A;  1VOM A;  1OKK D;  3Q7L A;  1VK5 A;  1V55 C;  3K33 A;  3ECS A;  2WVO A;  1Z6A A;  5IY5 C;  3OA1 A;  3UMH A;  3UMK A;  2CNW D;  1BR1 A;  4I1M A;  2V3C C;  5B1B C;  4J30 B;  4PFP A;  3NYJ A;  5CI8 A;  3T4R A;  1TKN A;  4FWV A;  3RH3 A;  5KYY B;  3ZC4 A;  2ZXW C;  3E9V A;  2PFD A;  3T6J A;  2NUP B;  2PF4 E;  2YEV A;  2Q3T A;  1D1B A;  3EH1 A;  1NG1 A;  3DAG A;  1TWA A;  1RJ9 B;  3S0X A;  4DBQ A;  2W4M A;  5KYY A;  2CDQ A;  2J9V A;  4WJ0 A;  3GAN A;  2NUP A;  3FHD A;  1PCX A;  2W45 A;  3KKB A;  1OCZ C;  3S27 A;  1MMD A;  2R7Q A;  5BUO A;  1G8X A;  1RJ9 A;  4IWB A;  4KBL A;  4OD5 A;  4C7O B;  4IJJ A;  2R7X A;  2EIM C;  1PD1 A;  5L3Q A;  3RKO F;  1FMV A;  4LAC B;  1TWG A;  3CZ6 A;  4G7Z F;  2QY9 A;  5E3C A;  2L9J A;  4Q7C A;  4FX5 A;  4C7O A;  2B0J A;  3L34 A;  2J9W A;  4E7S A;  2WZG A;  3EGX B;  4PK4 A;  3EGD B;  3ZSU A;  3EH2 A;  3ZG1 A;  3JT1 A;  1D1A A;  2KW3 C;  2R7S A;  3E70 C;  2IXM A;  2PP4 A;  4KNW A;  3VAY A;  2Y3D A;  3FAJ A;  3Q6N A;  4K7B A;  3NDB B;  3Q6M A;  3EGD A;  2Y39 A;  3LNR A;  2WZF A;  4O6Y A;  4DVY P;  4U5E E;  3DJN B;  5B3S C;  3NRH A;  4YT5 A;  3GOD A;  4AX2 A;  4PJM A;  5DQZ A;  4OIR F;  2C04 A;  3LAY A;  1ZHW A;  3AQB A;  4MQ9 F;  3QMK A;  4JCH A;  4HFK B;  1JPN A;  2Z15 A;  3F47 A;  4YWQ A;  4NY3 A;  3HTK C;  4ZLD A;  2H7O A;  5T1D B;  3EQL F;  3PHF 2;  2X51 A;  1FMW A;  1TWH A;  3B0V C;  4Q5S F;  3LS1 A;  3CQZ A;  4ANJ A;  1Z3I X;  1ZU4 A;  4JW1 A;  1ZHZ A;  4GYT A;  3EFO B;  1VYK A;  3SYN A;  3RYL A;  5FCL A;  3MLG A;  3UR3 C;  2DYR C;  2WVN A;  5L3V A;  2O9X A;  4ZLC A;  1D1C A;  3LS0 A;  3JSZ A;  4I1O B;  3Q7G A;  4HE8 D;  2EIK C;  2VB6 A;  4BG0 A;  1ZYR F;  1TR2 A;  3SNH A;  2H7V C;  3F46 A;  3EFO A;  2XL4 A;  2M4E A;  2WVQ A;  3S28 A;  4CIH A;  2A6H F;  4XLN F;  2R7T A;  2WZL A;  3I4U A;  4H4K C;  4DBR A;  2IXP A;  1M56 C;  3DMD A;  1MNE A;  5DQT A;  5KYN A;  3DJU B;  2XSE A;  1ZHX A;  1ZU5 A;  3JCU Q;  1D0X A;  3HJC A;  3AQC A;  3DM5 A;  3CSK A;  3SEO A;  4BJ5 C;  3LEV A;  3OEO A;  4PJN A;  4YT2 A;  5KYW B;  3LJB A;  2LSE A;  3ABM C;  4O7G A;  4O6N A;  3K1H A;  3LLK A;  4FES A;  1OKK A;  4CSA C;  3EZH A;  4EBB A;  5HSW A;  4JUR I;  1V54 C;  4I44 A;  4C3D A;  4HFF B;  3M1C B;  3NG1 A;  4BJ5 A;  3ABK C;  4F4B A;  5KYW A;  2CNW A;  2W4B A;  4K0D A;  2PX0 A;  3O39 A;  4U5B E;  3FDQ A;  4JZA A;  3LLI A;  3X1O A;  2EIL C;  2HV6 A;  3AG2 C;  4PJJ A;  3V7O A;  4YT8 A;  5KYX B;  4CSA A;  1OCR C;  4YT4 A;  1MMN A;  2GFH A;  3NYL A;  3S29 A;  3UNG C;  5DVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...