3LNRA

Crystal structure of poly-hamp domains from the p. aeruginosa soluble receptor aer2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
160
structure length
160
Chain Sequence
GSHMGLFNAHAVAQQRADRIATLLQSFADGQLDTAVGEAPAPGYERLYDSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDQTIPAERLEGRAARIAKGVNELVAAHIAVKMKVVSVVTAYGQGNFEPLMDRLPGKKAQITEAIDGVRERLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aerotaxis transducer Aer2
publication title Structure of concatenated HAMP domains provides a mechanism for signal transduction.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
total genus 57
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2010-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18575 HAMP_N3 HAMP N-terminal domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3lnrA00
4I3MA 3LNRA 4I44A
chains in the Genus database with same CATH superfamily
3UGOA 5KYYB 4DXWA 2X0CA 2RSEB 4CBEA 1EQ1A 1T6UA 2Y69C 2H7BA 1A0BA 3EPVA 1QKRA 5KYWA 4KNWA 3O55A 2OCCC 2WVQA 2YL0A 3FVYA 3R2PA 3Q6NA 3RQGA 3ZTZA 1D0YA 3ABLC 3M1CB 3I4UA 2R7SA 5CIVA 3JRMO 5GPGB 1U6HA 2OKUA 4PFPA 1OKKA 2IXNA 3U2LA 2XS8A 3SP1A 4BJ5A 3HNJA 2PF4E 2E87A 1R5ID 3U9MA 3H2UA 5DQTA 4DVYP 4JW1A 4NY3A 3ZG1A 1NLXA 1JRAA 4IAQA 2R7RA 4BJ6A 2JX0A 1QZXA 3GWLA 2LFDA 3LEVA 2ZXWC 3ASOC 4PACA 4E0HA 2YKZA 4LDKA 2NSGA 4D4XA 1TWHA 3ZWIA 2J9WA 2EPLX 4ZLCA 5DS6A 5T3WA 1VMAA 4QDLA 4YL3A 1XWJA 2GDCA 3C62A 1JMWA 1LM3B 2DB4A 1FAPB 2HJMA 5E3AA 4NCQA 2HFIA 2BL2A 3EGXB 3LS1A 4Z9HA 4DVZA 3FMSA 2Q4FA 3ZDLA 2P61A 1TFOB 4FX5A 2XL6A 4YT8A 5A6KA 1E84A 4N4WA 5A6AA 2P7VA 2KW3C 3KPHA 3SNHA 4GEHA 2J45A 2OQMA 3T6GB 3HLZA 1QLEC 2MHRA 2QUPA 3ABKC 4NC3A 5F28E 3CEXA 5T3TA 2QE9A 3EFOA 3SXKA 3SYNA 3U5SA 3MYIA 3B0UX 3JT1A 3EH2A 3M15A 3BRJA 4YL0A 3MFNA 2NUTB 4LDQA 1M6TA 2YLDA 2ZXRA 2A1DD 3VAYA 5KYUB 2CYDA 2NG1A 2D4UA 2NPUA 2VCCA 4YT2A 3FOPA 1RXQA 5AGFA 1Q0MA 2Y3HA 5L0DA 3NMIA 1WTYA 4N06A 1MMNA 4C3DA 4HE8D 3FDQA 3U8PA 4JVSA 1NU7D 1T9KA 3S84A 1IZMA 4EKWA 2OOCA 1ORYA 3S27A 1SYQA 3S29A 4Z9JA 3W2WA 4U5DE 2IOQA 4ULWA 4G7ZF 1EI7A 2CCYA 2YEVA 1S7ZA 2KNHA 3QVYA 5TJ5E 3UNGC 3O10A 3PMRA 4MNDA 4MVQA 4DBRA 1ZZPA 3C63A 4MQ9F 3K33A 5COMA 3CZ6A 3UR3C 2NUPB 4LACB 4KNVA 2DI3A 2XLOA 2KSFA 3EGDA 3JZ0A 3K7DA 3HKKA 4C7OA 1HE9A 1OW8A 3EHMA 2FFHA 1ZVZA 4O79A 2Z15A 3WAQA 3WHNA 1YLMA 4MTOA 2IXPA 3JCUQ 4Q7CA 2ZXPA 2UUHA 3GEEA 1ZHXA 2Y3DA 3R7CA 4KI2A 1H9GA 2YL1A 2EILC 1VYKA 3GWNA 5COGA 5BUOA 2DYSC 1J8MF 2VCAA 1BR2A 2W4BA 2J0WA 3M4CA 4LERA 4QI0A 4N6CA 2WZLA 3UMKA 4Q4ZF 4G78A 2AWYA 3J06A 3FHDA 5B3SC 4C3EA 5DS4A 1QPUA 2L7AA 3O39A 2EPNA 1MMAA 3SXYA 4UDVA 4B6IA 1VTMP 5L3QA 3L1MA 5D92A 1YYJA 2GWWA 3LNMB 1HMOA 4E0IA 1FMWA 1ZHZA 3Q6MA 2M64A 4KC9A 256BA 3IHUA 3LAYA 3FOOA 3N0TA 4U9DA 3ZSUA 4EBKA 4AK9A 5JUAA 4K7BA 4N6HA 2KGOA 1OCCC 1WWPA 4O6YA 3TQOA 1ORJA 1TR2A 3AGTA 3U2MA 2HZ8A 4XEFA 4JKVA 4NQFA 4CS8C 2WZGA 2MWQA 1L3PA 3EQLF 4FESA 4JJFA 4U5FE 1SF8A 3POVA 2YL3A 5IY5C 1HW2A 3DKAA 3L0IA 5B3IA 4RD9A 1MNEA 3X1OA 3T9OA 2L6GA 1W2WA 3LLKA 4K1OA 1NZEA 3W8HA 2XXAA 3RW0A 3K6BA 3V5YA 1Q0DA 1CGNA 3W4YA 1BR4A 3EG9A 3DXJF 1Y4CA 2KC3A 3JSEO 1D1AA 2B0JA 2PNOA 4XPWA 2QY9A 4IB4A 4DRHB 3C8GD 4E7ZA 3C8GA 3MX3A 4U5BE 1M2VA 3HNIA 2OU6A 2WZFA 3G4XA 1NU9C 1K04A 5B1AC 2R7UA 1YZCA 4IJJA 3ZVRA 2WVNA 3JYYA 3DJUB 3GM1A 4XTKA 3M4BA 1Q0KA 1R4TA 3AQBA 3MLGA 4MTFA 3S9OA 5JLIA 5HSWA 3Q7GA 3RYLA 5JT4A 1Q0GA 3IQ6A 4H54A 1A41A 3TOLA 1ST6A 2LIGA 4A2NB 2L6HA 3O6XA 5L3VA 1LI5A 3NKEA 4J30B 3US6A 1PD0A 4XWJA 2MYSA 4DJ9A 1WATA 1XZQA 2HSQA 4ER9A 1SMYF 4C7OB 3L8JA 1WOLA 1WGWA 3DJNB 2EPMX 4YK5A 4C3BA 1Y6DA 3ZTMA 3MYFA 2DYRC 3N2ZB 3Q7LA 3QW0A 4JE9A 4JTAB 4O6NA 1OR2A 2M4EA 4L6RA 1KNYA 4XPYA 3W8IA 1T6QA 4I1MA 1DOWA 2AVKA 4MVMA 1ZHWA 4OD4A 3S28A 1LKXA 3S90A 2TMVP 4MVSA 3ZQVA 2A69F 3HNLA 5D91A 2OJQA 2Y3GA 1TWAA 1G4WR 3I5QA 3LJBA 4AL1A 3VM6A 3HJCA 2HMQA 5DVWA 3ECSA 3X2QC 2R7VA 3LNRA 1M56C 4I3MA 1MNDA 4KBLA 1APCA 4CS9A 3RKOF 1M2OA 4JZAA 1C03A 4JJGA 4OD5A 3U0CA 1YA9A 3DAGA 5KYXB 2LD6A 5AC4A 3K1IA 4AE4B 4CSAA 1QQ3A 2VH3A 3NMJA 4GYTA 2PX0A 2JPUA 3LS0A 1ZU5A 4DBQA 3B0VC 2CW0F 3ZIBA 5KYYA 3EJNA 1AUEA 1G5ZA 1JAFA 2G3KA 2Y3BA 4WGZA 2HJ3A 3B29A 5JSLA 3PDMP 1V74B 2KQ9A 3RIPA 4OIPF 1LS1A 2ZPAA 1MMGA 2GFHA 2J9UA 4MVRA 4JEAA 1RMVA 1VYIA 1H6GA 4EBJA 2FGYA 1UG7A 2QNLA 5COFA 4MVUA 1Z5ZA 2C03A 4OINF 4PR9A 4HEAJ 1J8YF 1YAUO 1XZPA 4CS9C 1CGOA 2I8BA 1V4AA 3TULA 2OG2A 1YARO 2PBEA 4I44A 1FFTC 3IEEA 3QW1A 4M63A 5E2QA 1RJ9B 5BQGA 2HV6A 3GM3A 2OJED 2B0HA 4IAOA 1I4YA 2HKVA 3AOUA 2CNWD 1RKCA 5L0CA 1OCZC 1HW1A 5JVEA 5DQZA 2ETSA 1G4US 1PCXA 3V5ZA 4LDRA 5JP7A 2R7QA 2YHSA 3WG7C 4WGYA 3RFYA 3B0PA 1I4ZA 4BJ5C 2XLWA 1VK5A 3VRCA 1H9TA 2QTVA 3E9VA 3T4RA 2UUIA 4DOZA 3NMKA 2Q00A 4PFOA 2Y39A 3OA1A 3EGXA 4J7TA 3UMIA 1FFHA 3CQZA 4BJ6C 5T1DB 4OIQF 1RKEB 4R32A 4PJMA 3ABMC 3ITFA 3QVZA 4HFFB 5KYNA 1KU2A 4XLNF 1L7CA 4BJTA 3LESA 2G3VA 2H7OA 3KMIA 1LE4A 4JTDB 2XS1A 4GQHA 2WVOA 3DZAA 1YJGA 2IYLD 3JRTA 4CX9A 5BQHA 4ZLDA 4P9FA 3AJMA 4O6MA 3C18A 5F5FA 1OXKA 3F47A 3SZRA 4OIOF 1B68A 1QVXA 2V26A 4I1OB 2XLVA 3GANA 2BC5A 4JRZA 4D4NA 5KYWB 1VOMA 2NUTA 1BZ4A 5DS5A 4CJOA 2YRFA 5KYUA 3DI5A 1YDIA 2XLEA 1U89A 2AU5A 3KYJA 4J32B 3RVZA 4G7HF 3V5XA 1CPRA 2EIKC 3E70C 2A6HF 1K40A 3DMDA 3GEHA 3SXZA 4ANJA 5L0IA 3ZQYA 2GA0A 3KH2A 3SXMA 1OW7A 2J0XA 2Q9BA 2L9JA 1NSGB 1ZW2A 2H8AA 3K1HA 2BE5F 2YQYA 3DM9B 3U3BA 3VF0A 2YZSA 3NG1A 3OWTA 1NG1A 2LK4A 1T5OA 2EPKX 2J7PD 3A11A 2J7PA 4Z9IA 1Z7Qc 5JS5A 2ASRA 1NFNA 3NYJA 1Q0FA 4JEBA 2AWCA 4U5HA 4BEJA 1T01A 1OCRC 4AX2A 1O5HA 4JURI 2NUPA 1VLSA 3NYLA 3IQTA 4G7OF 1N1CA 1QSPA 2CGEA 1WN0A 4YJWA 5B1BC 3W2VA 4DRIB 4P6IC 2Q9CA 3TOMA 2LCHA 2P6VA 2W45A 2J46A 1HY5A 4H4KC 1OQCA 1FTSA 3KL4A 4JCHA 4U5EE 2J8WA 3L8IA 3PCVA 4CDAA 2XLHA 1T6IA 2IM8A 4YT4A 3NYMA 5FZTA 3V7OA 1ZHTA 4XEKA 2YVKA 4EWCA 3PHF2 1Z23A 2Q3TA 5K0IA 1RCPA 4PJLA 1OCOC 4F4BA 1TWCA 2LFFA 2FAPB 3EFOB 2R05A 1MMDA 2YLIA 1Z6AA 4JCZA 4BG0A 4XQ1A 1TFKB 1BDJB 4MW8A 4OIRF 3LEOA 3QMKA 3GORA 1YA7O 4WJ0A 2R25A 4W8PA 2EINC 3IQ5A 1CGME 3TJ6A 1TWGA 3GODA 3WODF 5F5HA 1D1CA 3OEOA 3DD7A 4PK4A 4E18A 4E7SA 4CDVA 1M57C 1OKKD 2A0UA 3GM2A 3JYHA 1U0BB 3LLIA 3IQCA 2EPOA 3FAJA 3UGPA 1ZYRF 1AEPA 2V3CC 2PFDA 2Q7RA 4XPXA 4P9TA 4MTGA 2HSBA 2R7OA 4XLPF 2W9YA 4WABA 1E2XA 3F46A 1BBHA 1I5NA 2X51A 2ZXOA 1ORSC 3DAFA 4IRUA 4EHPA 2F22A 3EHNA 3RQEA 2D5RB 1A7VA 3QTHA 5CI8A 4BEMJ 2VC9A 4AL0A 2XM0A 2LP4A 1A7DA 1FMVA 3EGDB 5E3CA 4CIPA 1FNTc 2P0NA 4JIOA 2XSEA 3UMHA 4MVZA 2I15A 1D0XA 1UFBA 2KJGA 2L81A 2XRHA 5BQIA 1LI7A 5HV9A 1E85A 4JTCB 4U5GA 2NSFA 3VYWA 1WASA 4EBBA 1OW6A 1V54C 4CIHA 3NDBB 3ASNC 1FR0A 1TQGA 2R7WA 2YWAA 1YVIA 4DRJB 4NTFA 4JC7A 5AC5A 3SEOA 3H2VA 3CAXA 3DE8A 3GEIA 1NBBA 2H7VC 3FXHA 4IARA 4U5CE 2HV7A 4XEVA 4MVOA 5E33A 1A7EA 2PX3A 2LQGA 3EZHA 2WB7A 2XL4A 2EIMC 3AG4C 3HTKC 3HNKA 1DOVA 2CNWA 4IGGA 2XLMA 4CJGA 1GGQA 4CS8A 4E17A 1E86A 2YL7A 4RDAA 1Z3IX 4CDYA 3AG3C 2ZD9A 3DWWA 4W8KA 4NTBA 2XLDA 3H65A 3DE9A 3N24A 3RH3A 3C8ZA 1JOGA 5A69A 2W4MA 2WL8A 2A0BA 4Q5SF 4BPMA 3U9JA 4FWVA 5CI9A 2PP4A 1JPJA 2ICWG 3AG1C 3B71A 1F1MA 4YT5A 3ZC4A 5A6BA 2A6EF 5A6BD 5L0FA 2OEXA 3ATPA 1E83A 1C02A 2J9BA 1GQAA 3FAPB 3L34A 1LPEA 3M79A 1H7IA 2G62A 4PJJA 2R02A 2R7XA 1LS4A 3RVYA 4A4AA 5FCLA 3TD7A 4FAPB 1CPQA 4QI2A 1SZIA 3U3FA 5KYXA 2XXAB 4AE4A 3G4ZA 2EIJC 1NFOA 2RD9A 4PJNA 5JRAA 3JTLO 3NKDA 4G0HA 2R03A 4K0DA 1SR2A 3KYIA 2LSEA 4MW3A 1VLTA 3EG9B 4X0RA 3RQFA 2IXMA 3QZCA 4J7YA 3MBGA 1MQVA 1O87A 3C8GB 1C17M 1O3UA 3C7JA 1M2VB 1LIHA 3DM5A 1OR3A 3EH1A 3BEHA 1OXBA 1YZAA 4CSAC 3K1IC 2R9RB 1JR8A 3AQCA 1JPNA 3LUTB 3RF3A 1D1BA 2VASA 5L0JA 2AP3A 2VB6A 3AGUA 4LLEA 4ULVA 2R7TA 3A9CA 1D0ZA 1LVKA 1PD1A 2HMZA 2A68F 3K66A 4YN0B 2C04A 4YWQA 5L0GA 1RJ9A 4BJ1A 4EIYA 4IWBA 5A6JA 3G50A 1HE1A 1LE2A 1TKNA 2QLAA 3AG2C 3B9QA 2KK1A 3CSKA 2IXOA 3T6JA 1BR1A 1IW7F 1ZW3A 2HS5A 2CDQA 4RBNA 3IPMO 5EK0A 3TK0A 3KKBA 4U9EA 4EUKB 1G8XA 2L6FA 2KYHA 1EKYA 2XL8A 2Q9AA 2P1AA 1PV3A 2DGJA 1VB5A 1GM5A 1HMDA 1EA8A 5L0HA 3TJ5A 2HUJA 5EHHA 4NTAA 4MS2A 1YYXA 1AVOB 1GS9A 1S05A 2J9VA 1ZHYA 2O9XA 4ONSA 3NRHA 4YL1A 3U8VA 1K05A 1ZU4A 1RKEA 3JSZA 4HFKB 1Z63A 5DLJA 3T6BA 3EZIA 2GAQA 4CS7A 2JD3A 2YLGA 5EGYA 4LLCA 1KTMA 1V55C 2IBFA 3S0XA 4O7GA 2VCBA 2XM4A 3I5PA 2OEVA
chains in the Genus database with same CATH topology
3UGOA 5KYYB 4CBEA 2Y69C 2H7BA 3EPVA 5KYWA 4KNWA 2OCCC 2WVQA 3FVYA 3Q6NA 1D0YA 3ABLC 3M1CB 3I4UA 2R7SA 4PFPA 1OKKA 2IXNA 3SP1A 4BJ5A 2PF4E 2E87A 5DQTA 4DVYP 4JW1A 4NY3A 3ZG1A 2R7RA 4BJ6A 1QZXA 3LEVA 2ZXWC 3ASOC 1TWHA 2J9WA 4ZLCA 5DS6A 5T3WA 1VMAA 4QDLA 5E3AA 4DVZA 3EGXB 3LS1A 4FX5A 4YT8A 2P7VA 2KW3C 3SNHA 4GEHA 2J45A 3HLZA 1QLEC 3ABKC 5T3TA 3EFOA 3SYNA 3B0UX 3JT1A 3EH2A 2NUTB 5KYUB 2ZXRA 2A1DD 3VAYA 2NG1A 4YT2A 2Y3HA 4N06A 1MMNA 4C3DA 4HE8D 3FDQA 4JVSA 1NU7D 1IZMA 3S29A 3S27A 3W2WA 4U5DE 2IOQA 4ULWA 4G7ZF 2YEVA 1S7ZA 2KNHA 3UNGC 3PMRA 4MNDA 4DBRA 4MQ9F 3K33A 3CZ6A 3UR3C 2NUPB 4LACB 4KNVA 3EGDA 3K7DA 3EHMA 2FFHA 4O79A 2Z15A 2IXPA 3JCUQ 4Q7CA 2ZXPA 1ZHXA 2Y3DA 4KI2A 2EILC 1VYKA 5BUOA 2DYSC 1J8MF 1BR2A 2W4BA 2J0WA 4LERA 4QI0A 2WZLA 3UMKA 4Q4ZF 3FHDA 5B3SC 4C3EA 5DS4A 3O39A 1MMAA 4B6IA 5L3QA 5D92A 1FMWA 1ZHZA 3Q6MA 4KC9A 3LAYA 3N0TA 3ZSUA 4AK9A 4K7BA 2KGOA 1OCCC 4O6YA 1TR2A 4CS8C 2WZGA 2MWQA 3EQLF 4FESA 4JJFA 4U5FE 1SF8A 3POVA 5IY5C 3L0IA 4RD9A 1MNEA 3X1OA 3LLKA 1W2WA 3W8HA 1NZEA 2XXAA 3K6BA 1BR4A 3EG9A 3DXJF 1D1AA 2B0JA 2QY9A 4E7ZA 3MX3A 4U5BE 1M2VA 2WZFA 1NU9C 2R7UA 5B1AC 4IJJA 3ZVRA 2WVNA 3DJUB 4XTKA 3MLGA 3AQBA 3Q7GA 3RYLA 5L3VA 1ST6A 4A2NB 3O6XA 3NKEA 4J30B 1PD0A 4XWJA 2MYSA 1SMYF 4C7OB 4C3BA 1WGWA 3DJNB 2DYRC 3N2ZB 3Q7LA 4O6NA 5HSWA 2M4EA 3W8IA 4I1MA 1ZHWA 4OD4A 3S28A 1LKXA 2A69F 5D91A 2Y3GA 1TWAA 3I5QA 3LJBA 3HJCA 5DVWA 3ECSA 3X2QC 2R7VA 3LNRA 1M56C 4I3MA 1MNDA 4KBLA 3RKOF 1M2OA 4JZAA 4JJGA 4OD5A 3DAGA 5KYXB 4CSAA 4AE4B 2VH3A 4GYTA 2PX0A 3LS0A 1ZU5A 4DBQA 3B0VC 2CW0F 3ZIBA 5KYYA 3EJNA 2G3KA 2Y3BA 4OIPF 2KQ9A 3RIPA 1LS1A 2ZPAA 1MMGA 2GFHA 2J9UA 1VYIA 2FGYA 1Z5ZA 2C03A 4OINF 4HEAJ 1J8YF 4CS9C 2I8BA 2OG2A 5E2QA 4I44A 1FFTC 3IEEA 4M63A 1RJ9B 2HV6A 4IAOA 2CNWD 1OCZC 5DQZA 1PCXA 2R7QA 2YHSA 3WG7C 3RFYA 3B0PA 4BJ5C 1VK5A 2QTVA 3E9VA 3T4RA 4DOZA 4PFOA 2Y39A 3OA1A 3EGXA 3UMIA 1FFHA 3CQZA 4BJ6C 5T1DB 4OIQF 4PJMA 3ABMC 3ITFA 4HFFB 5KYNA 1KU2A 4XLNF 4BJTA 3LESA 2G3VA 2H7OA 3KMIA 2WVOA 3DZAA 2IYLD 4ZLDA 3JRTA 4O6MA 5F5FA 3F47A 4OIOF 3SZRA 2V26A 4I1OB 3GANA 5KYWB 1VOMA 2NUTA 5DS5A 5KYUA 4J32B 4G7HF 2EIKC 3E70C 2A6HF 3DMDA 4ANJA 3KH2A 2Q9BA 2J0XA 2L9JA 3K1HA 2BE5F 3DM9B 2YZSA 3NG1A 3OWTA 1NG1A 2J7PD 2J7PA 3NYJA 4U5HA 4BEJA 1OCRC 4AX2A 1O5HA 4JURI 2NUPA 3NYLA 4G7OF 1N1CA 2CGEA 3W2VA 5B1BC 4YJWA 4P6IC 2Q9CA 2P6VA 2W45A 2J46A 4H4KC 3KL4A 1FTSA 4JCHA 4U5EE 4YT4A 3NYMA 3V7OA 1ZHTA 4EWCA 3PHF2 1Z23A 2Q3TA 4PJLA 1OCOC 4F4BA 1TWCA 3EFOB 1MMDA 1Z6AA 4BG0A 4OIRF 3QMKA 4WJ0A 2EINC 1TWGA 3GODA 3WODF 5F5HA 1D1CA 3OEOA 3DD7A 4PK4A 4E7SA 1M57C 1OKKD 3JYHA 3LLIA 3FAJA 3UGPA 1ZYRF 2V3CC 2PFDA 2R7OA 4XLPF 2W9YA 3F46A 2X51A 3DAFA 2ZXOA 4IRUA 3EHNA 2D5RB 5CI8A 1FMVA 3EGDB 5E3CA 2XSEA 3UMHA 2KJGA 1D0XA 2L81A 2XRHA 4U5GA 3VYWA 4EBBA 1V54C 4CIHA 3NDBB 3ASNC 2R7WA 3SEOA 2H7VC 4U5CE 2HV7A 5E33A 2PX3A 3EZHA 2WB7A 2XL4A 2EIMC 3AG4C 3HTKC 4CS8A 4C7OA 2CNWA 4RDAA 1Z3IX 3AG3C 4W8KA 3H65A 3N24A 3RH3A 2W4MA 2WL8A 4Q5SF 4FWVA 5CI9A 2PP4A 1JPJA 3AG1C 3ZC4A 4YT5A 2A6EF 3L34A 4PJJA 2G62A 2R7XA 4QI2A 5FCLA 3TD7A 1SZIA 5KYXA 2XXAB 4AE4A 2EIJC 4PJNA 3NKDA 4G0HA 4K0DA 2LSEA 3EG9B 4X0RA 2IXMA 3QZCA 1O87A 1M2VB 3DM5A 3EH1A 4CSAC 3K1IC 3AQCA 1JPNA 1D1BA 2VASA 2VB6A 4LLEA 2R7TA 3K66A 1D0ZA 1LVKA 1PD1A 4YN0B 2A68F 4YWQA 2C04A 1RJ9A 4BJ1A 4IWBA 1TKNA 3AG2C 3B9QA 3CSKA 2IXOA 3T6JA 1BR1A 1IW7F 2CDQA 4RBNA 3KKBA 1G8XA 2Q9AA 2DGJA 5EHHA 2J9VA 1ZHYA 2O9XA 3NRHA 1ZU4A 3JSZA 1Z63A 4HFKB 5DLJA 3T6BA 3EZIA 4CS7A 2JD3A 5EGYA 4LLCA 1V55C 3S0XA 4O7GA 4CS9A 3I5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I3M A;  3LNR A;  4I44 A; 
#chains in the Genus database with same CATH topology
 3UGO A;  5KYY B;  4DXW A;  2X0C A;  2RSE B;  4CBE A;  1EQ1 A;  1T6U A;  2Y69 C;  2H7B A;  1A0B A;  3EPV A;  1QKR A;  5KYW A;  4KNW A;  3O55 A;  2OCC C;  2WVQ A;  2YL0 A;  3FVY A;  3R2P A;  3Q6N A;  3RQG A;  3ZTZ A;  1D0Y A;  3ABL C;  3M1C B;  3I4U A;  2R7S A;  5CIV A;  3JRM O;  5GPG B;  1U6H A;  2OKU A;  4PFP A;  1OKK A;  2IXN A;  3U2L A;  2XS8 A;  3SP1 A;  4BJ5 A;  3HNJ A;  2PF4 E;  2E87 A;  1R5I D;  3U9M A;  3H2U A;  5DQT A;  4DVY P;  4JW1 A;  4NY3 A;  3ZG1 A;  1NLX A;  1JRA A;  4IAQ A;  2R7R A;  4BJ6 A;  2JX0 A;  1QZX A;  3GWL A;  2LFD A;  3LEV A;  2ZXW C;  3ASO C;  4PAC A;  4E0H A;  2YKZ A;  4LDK A;  2NSG A;  4D4X A;  1TWH A;  3ZWI A;  2J9W A;  2EPL X;  4ZLC A;  5DS6 A;  5T3W A;  1VMA A;  4QDL A;  4YL3 A;  1XWJ A;  2GDC A;  3C62 A;  1JMW A;  1LM3 B;  2DB4 A;  1FAP B;  2HJM A;  5E3A A;  4NCQ A;  2HFI A;  2BL2 A;  3EGX B;  3LS1 A;  4Z9H A;  4DVZ A;  3FMS A;  2Q4F A;  3ZDL A;  2P61 A;  1TFO B;  4FX5 A;  2XL6 A;  4YT8 A;  5A6K A;  1E84 A;  4N4W A;  5A6A A;  2P7V A;  2KW3 C;  3KPH A;  3SNH A;  4GEH A;  2J45 A;  2OQM A;  3T6G B;  3HLZ A;  1QLE C;  2MHR A;  2QUP A;  3ABK C;  4NC3 A;  5F28 E;  3CEX A;  5T3T A;  2QE9 A;  3EFO A;  3SXK A;  3SYN A;  3U5S A;  3MYI A;  3B0U X;  3JT1 A;  3EH2 A;  3M15 A;  3BRJ A;  4YL0 A;  3MFN A;  2NUT B;  4LDQ A;  1M6T A;  2YLD A;  2ZXR A;  2A1D D;  3VAY A;  5KYU B;  2CYD A;  2NG1 A;  2D4U A;  2NPU A;  2VCC A;  4YT2 A;  3FOP A;  1RXQ A;  5AGF A;  1Q0M A;  2Y3H A;  5L0D A;  3NMI A;  1WTY A;  4N06 A;  1MMN A;  4C3D A;  4HE8 D;  3FDQ A;  3U8P A;  4JVS A;  1NU7 D;  1T9K A;  3S84 A;  1IZM A;  4EKW A;  2OOC A;  1ORY A;  3S27 A;  1SYQ A;  3S29 A;  4Z9J A;  3W2W A;  4U5D E;  2IOQ A;  4ULW A;  4G7Z F;  1EI7 A;  2CCY A;  2YEV A;  1S7Z A;  2KNH A;  3QVY A;  5TJ5 E;  3UNG C;  3O10 A;  3PMR A;  4MND A;  4MVQ A;  4DBR A;  1ZZP A;  3C63 A;  4MQ9 F;  3K33 A;  5COM A;  3CZ6 A;  3UR3 C;  2NUP B;  4LAC B;  4KNV A;  2DI3 A;  2XLO A;  2KSF A;  3EGD A;  3JZ0 A;  3K7D A;  3HKK A;  4C7O A;  1HE9 A;  1OW8 A;  3EHM A;  2FFH A;  1ZVZ A;  4O79 A;  2Z15 A;  3WAQ A;  3WHN A;  1YLM A;  4MTO A;  2IXP A;  3JCU Q;  4Q7C A;  2ZXP A;  2UUH A;  3GEE A;  1ZHX A;  2Y3D A;  3R7C A;  4KI2 A;  1H9G A;  2YL1 A;  2EIL C;  1VYK A;  3GWN A;  5COG A;  5BUO A;  2DYS C;  1J8M F;  2VCA A;  1BR2 A;  2W4B A;  2J0W A;  3M4C A;  4LER A;  4QI0 A;  4N6C A;  2WZL A;  3UMK A;  4Q4Z F;  4G78 A;  2AWY A;  3J06 A;  3FHD A;  5B3S C;  4C3E A;  5DS4 A;  1QPU A;  2L7A A;  3O39 A;  2EPN A;  1MMA A;  3SXY A;  4UDV A;  4B6I A;  1VTM P;  5L3Q A;  3L1M A;  5D92 A;  1YYJ A;  2GWW A;  3LNM B;  1HMO A;  4E0I A;  1FMW A;  1ZHZ A;  3Q6M A;  2M64 A;  4KC9 A;  256B A;  3IHU A;  3LAY A;  3FOO A;  3N0T A;  4U9D A;  3ZSU A;  4EBK A;  4AK9 A;  5JUA A;  4K7B A;  4N6H A;  2KGO A;  1OCC C;  1WWP A;  4O6Y A;  3TQO A;  1ORJ A;  1TR2 A;  3AGT A;  3U2M A;  2HZ8 A;  4XEF A;  4JKV A;  4NQF A;  4CS8 C;  2WZG A;  2MWQ A;  1L3P A;  3EQL F;  4FES A;  4JJF A;  4U5F E;  1SF8 A;  3POV A;  2YL3 A;  5IY5 C;  1HW2 A;  3DKA A;  3L0I A;  5B3I A;  4RD9 A;  1MNE A;  3X1O A;  3T9O A;  2L6G A;  1W2W A;  3LLK A;  4K1O A;  1NZE A;  3W8H A;  2XXA A;  3RW0 A;  3K6B A;  3V5Y A;  1Q0D A;  1CGN A;  3W4Y A;  1BR4 A;  3EG9 A;  3DXJ F;  1Y4C A;  2KC3 A;  3JSE O;  1D1A A;  2B0J A;  2PNO A;  4XPW A;  2QY9 A;  4IB4 A;  4DRH B;  3C8G D;  4E7Z A;  3C8G A;  3MX3 A;  4U5B E;  1M2V A;  3HNI A;  2OU6 A;  2WZF A;  3G4X A;  1NU9 C;  1K04 A;  5B1A C;  2R7U A;  1YZC A;  4IJJ A;  3ZVR A;  2WVN A;  3JYY A;  3DJU B;  3GM1 A;  4XTK A;  3M4B A;  1Q0K A;  1R4T A;  3AQB A;  3MLG A;  4MTF A;  3S9O A;  5JLI A;  5HSW A;  3Q7G A;  3RYL A;  5JT4 A;  1Q0G A;  3IQ6 A;  4H54 A;  1A41 A;  3TOL A;  1ST6 A;  2LIG A;  4A2N B;  2L6H A;  3O6X A;  5L3V A;  1LI5 A;  3NKE A;  4J30 B;  3US6 A;  1PD0 A;  4XWJ A;  2MYS A;  4DJ9 A;  1WAT A;  1XZQ A;  2HSQ A;  4ER9 A;  1SMY F;  4C7O B;  3L8J A;  1WOL A;  1WGW A;  3DJN B;  2EPM X;  4YK5 A;  4C3B A;  1Y6D A;  3ZTM A;  3MYF A;  2DYR C;  3N2Z B;  3Q7L A;  3QW0 A;  4JE9 A;  4JTA B;  4O6N A;  1OR2 A;  2M4E A;  4L6R A;  1KNY A;  4XPY A;  3W8I A;  1T6Q A;  4I1M A;  1DOW A;  2AVK A;  4MVM A;  1ZHW A;  4OD4 A;  3S28 A;  1LKX A;  3S90 A;  2TMV P;  4MVS A;  3ZQV A;  2A69 F;  3HNL A;  5D91 A;  2OJQ A;  2Y3G A;  1TWA A;  1G4W R;  3I5Q A;  3LJB A;  4AL1 A;  3VM6 A;  3HJC A;  2HMQ A;  5DVW A;  3ECS A;  3X2Q C;  2R7V A;  3LNR A;  1M56 C;  4I3M A;  1MND A;  4KBL A;  1APC A;  4CS9 A;  3RKO F;  1M2O A;  4JZA A;  1C03 A;  4JJG A;  4OD5 A;  3U0C A;  1YA9 A;  3DAG A;  5KYX B;  2LD6 A;  5AC4 A;  3K1I A;  4AE4 B;  4CSA A;  1QQ3 A;  2VH3 A;  3NMJ A;  4GYT A;  2PX0 A;  2JPU A;  3LS0 A;  1ZU5 A;  4DBQ A;  3B0V C;  2CW0 F;  3ZIB A;  5KYY A;  3EJN A;  1AUE A;  1G5Z A;  1JAF A;  2G3K A;  2Y3B A;  4WGZ A;  2HJ3 A;  3B29 A;  5JSL A;  3PDM P;  1V74 B;  2KQ9 A;  3RIP A;  4OIP F;  1LS1 A;  2ZPA A;  1MMG A;  2GFH A;  2J9U A;  4MVR A;  4JEA A;  1RMV A;  1VYI A;  1H6G A;  4EBJ A;  2FGY A;  1UG7 A;  2QNL A;  5COF A;  4MVU A;  1Z5Z A;  2C03 A;  4OIN F;  4PR9 A;  4HEA J;  1J8Y F;  1YAU O;  1XZP A;  4CS9 C;  1CGO A;  2I8B A;  1V4A A;  3TUL A;  2OG2 A;  1YAR O;  2PBE A;  4I44 A;  1FFT C;  3IEE A;  3QW1 A;  4M63 A;  5E2Q A;  1RJ9 B;  5BQG A;  2HV6 A;  3GM3 A;  2OJE D;  2B0H A;  4IAO A;  1I4Y A;  2HKV A;  3AOU A;  2CNW D;  1RKC A;  5L0C A;  1OCZ C;  1HW1 A;  5JVE A;  5DQZ A;  2ETS A;  1G4U S;  1PCX A;  3V5Z A;  4LDR A;  5JP7 A;  2R7Q A;  2YHS A;  3WG7 C;  4WGY A;  3RFY A;  3B0P A;  1I4Z A;  4BJ5 C;  2XLW A;  1VK5 A;  3VRC A;  1H9T A;  2QTV A;  3E9V A;  3T4R A;  2UUI A;  4DOZ A;  3NMK A;  2Q00 A;  4PFO A;  2Y39 A;  3OA1 A;  3EGX A;  4J7T A;  3UMI A;  1FFH A;  3CQZ A;  4BJ6 C;  5T1D B;  4OIQ F;  1RKE B;  4R32 A;  4PJM A;  3ABM C;  3ITF A;  3QVZ A;  4HFF B;  5KYN A;  1KU2 A;  4XLN F;  1L7C A;  4BJT A;  3LES A;  2G3V A;  2H7O A;  3KMI A;  1LE4 A;  4JTD B;  2XS1 A;  4GQH A;  2WVO A;  3DZA A;  1YJG A;  2IYL D;  3JRT A;  4CX9 A;  5BQH A;  4ZLD A;  4P9F A;  3AJM A;  4O6M A;  3C18 A;  5F5F A;  1OXK A;  3F47 A;  3SZR A;  4OIO F;  1B68 A;  1QVX A;  2V26 A;  4I1O B;  2XLV A;  3GAN A;  2BC5 A;  4JRZ A;  4D4N A;  5KYW B;  1VOM A;  2NUT A;  1BZ4 A;  5DS5 A;  4CJO A;  2YRF A;  5KYU A;  3DI5 A;  1YDI A;  2XLE A;  1U89 A;  2AU5 A;  3KYJ A;  4J32 B;  3RVZ A;  4G7H F;  3V5X A;  1CPR A;  2EIK C;  3E70 C;  2A6H F;  1K40 A;  3DMD A;  3GEH A;  3SXZ A;  4ANJ A;  5L0I A;  3ZQY A;  2GA0 A;  3KH2 A;  3SXM A;  1OW7 A;  2J0X A;  2Q9B A;  2L9J A;  1NSG B;  1ZW2 A;  2H8A A;  3K1H A;  2BE5 F;  2YQY A;  3DM9 B;  3U3B A;  3VF0 A;  2YZS A;  3NG1 A;  3OWT A;  1NG1 A;  2LK4 A;  1T5O A;  2EPK X;  2J7P D;  3A11 A;  2J7P A;  4Z9I A;  1Z7Q c;  5JS5 A;  2ASR A;  1NFN A;  3NYJ A;  1Q0F A;  4JEB A;  2AWC A;  4U5H A;  4BEJ A;  1T01 A;  1OCR C;  4AX2 A;  1O5H A;  4JUR I;  2NUP A;  1VLS A;  3NYL A;  3IQT A;  4G7O F;  1N1C A;  1QSP A;  2CGE A;  1WN0 A;  4YJW A;  5B1B C;  3W2V A;  4DRI B;  4P6I C;  2Q9C A;  3TOM A;  2LCH A;  2P6V A;  2W45 A;  2J46 A;  1HY5 A;  4H4K C;  1OQC A;  1FTS A;  3KL4 A;  4JCH A;  4U5E E;  2J8W A;  3L8I A;  3PCV A;  4CDA A;  2XLH A;  1T6I A;  2IM8 A;  4YT4 A;  3NYM A;  5FZT A;  3V7O A;  1ZHT A;  4XEK A;  2YVK A;  4EWC A;  3PHF 2;  1Z23 A;  2Q3T A;  5K0I A;  1RCP A;  4PJL A;  1OCO C;  4F4B A;  1TWC A;  2LFF A;  2FAP B;  3EFO B;  2R05 A;  1MMD A;  2YLI A;  1Z6A A;  4JCZ A;  4BG0 A;  4XQ1 A;  1TFK B;  1BDJ B;  4MW8 A;  4OIR F;  3LEO A;  3QMK A;  3GOR A;  1YA7 O;  4WJ0 A;  2R25 A;  4W8P A;  2EIN C;  3IQ5 A;  1CGM E;  3TJ6 A;  1TWG A;  3GOD A;  3WOD F;  5F5H A;  1D1C A;  3OEO A;  3DD7 A;  4PK4 A;  4E18 A;  4E7S A;  4CDV A;  1M57 C;  1OKK D;  2A0U A;  3GM2 A;  3JYH A;  1U0B B;  3LLI A;  3IQC A;  2EPO A;  3FAJ A;  3UGP A;  1ZYR F;  1AEP A;  2V3C C;  2PFD A;  2Q7R A;  4XPX A;  4P9T A;  4MTG A;  2HSB A;  2R7O A;  4XLP F;  2W9Y A;  4WAB A;  1E2X A;  3F46 A;  1BBH A;  1I5N A;  2X51 A;  2ZXO A;  1ORS C;  3DAF A;  4IRU A;  4EHP A;  2F22 A;  3EHN A;  3RQE A;  2D5R B;  1A7V A;  3QTH A;  5CI8 A;  4BEM J;  2VC9 A;  4AL0 A;  2XM0 A;  2LP4 A;  1A7D A;  1FMV A;  3EGD B;  5E3C A;  4CIP A;  1FNT c;  2P0N A;  4JIO A;  2XSE A;  3UMH A;  4MVZ A;  2I15 A;  1D0X A;  1UFB A;  2KJG A;  2L81 A;  2XRH A;  5BQI A;  1LI7 A;  5HV9 A;  1E85 A;  4JTC B;  4U5G A;  2NSF A;  3VYW A;  1WAS A;  4EBB A;  1OW6 A;  1V54 C;  4CIH A;  3NDB B;  3ASN C;  1FR0 A;  1TQG A;  2R7W A;  2YWA A;  1YVI A;  4DRJ B;  4NTF A;  4JC7 A;  5AC5 A;  3SEO A;  3H2V A;  3CAX A;  3DE8 A;  3GEI A;  1NBB A;  2H7V C;  3FXH A;  4IAR A;  4U5C E;  2HV7 A;  4XEV A;  4MVO A;  5E33 A;  1A7E A;  2PX3 A;  2LQG A;  3EZH A;  2WB7 A;  2XL4 A;  2EIM C;  3AG4 C;  3HTK C;  3HNK A;  1DOV A;  2CNW A;  4IGG A;  2XLM A;  4CJG A;  1GGQ A;  4CS8 A;  4E17 A;  1E86 A;  2YL7 A;  4RDA A;  1Z3I X;  4CDY A;  3AG3 C;  2ZD9 A;  3DWW A;  4W8K A;  4NTB A;  2XLD A;  3H65 A;  3DE9 A;  3N24 A;  3RH3 A;  3C8Z A;  1JOG A;  5A69 A;  2W4M A;  2WL8 A;  2A0B A;  4Q5S F;  4BPM A;  3U9J A;  4FWV A;  5CI9 A;  2PP4 A;  1JPJ A;  2ICW G;  3AG1 C;  3B71 A;  1F1M A;  4YT5 A;  3ZC4 A;  5A6B A;  2A6E F;  5A6B D;  5L0F A;  2OEX A;  3ATP A;  1E83 A;  1C02 A;  2J9B A;  1GQA A;  3FAP B;  3L34 A;  1LPE A;  3M79 A;  1H7I A;  2G62 A;  4PJJ A;  2R02 A;  2R7X A;  1LS4 A;  3RVY A;  4A4A A;  5FCL A;  3TD7 A;  4FAP B;  1CPQ A;  4QI2 A;  1SZI A;  3U3F A;  5KYX A;  2XXA B;  4AE4 A;  3G4Z A;  2EIJ C;  1NFO A;  2RD9 A;  4PJN A;  5JRA A;  3JTL O;  3NKD A;  4G0H A;  2R03 A;  4K0D A;  1SR2 A;  3KYI A;  2LSE A;  4MW3 A;  1VLT A;  3EG9 B;  4X0R A;  3RQF A;  2IXM A;  3QZC A;  4J7Y A;  3MBG A;  1MQV A;  1O87 A;  3C8G B;  1C17 M;  1O3U A;  3C7J A;  1M2V B;  1LIH A;  3DM5 A;  1OR3 A;  3EH1 A;  3BEH A;  1OXB A;  1YZA A;  4CSA C;  3K1I C;  2R9R B;  1JR8 A;  3AQC A;  1JPN A;  3LUT B;  3RF3 A;  1D1B A;  2VAS A;  5L0J A;  2AP3 A;  2VB6 A;  3AGU A;  4LLE A;  4ULV A;  2R7T A;  3A9C A;  1D0Z A;  1LVK A;  1PD1 A;  2HMZ A;  2A68 F;  3K66 A;  4YN0 B;  2C04 A;  4YWQ A;  5L0G A;  1RJ9 A;  4BJ1 A;  4EIY A;  4IWB A;  5A6J A;  3G50 A;  1HE1 A;  1LE2 A;  1TKN A;  2QLA A;  3AG2 C;  3B9Q A;  2KK1 A;  3CSK A;  2IXO A;  3T6J A;  1BR1 A;  1IW7 F;  1ZW3 A;  2HS5 A;  2CDQ A;  4RBN A;  3IPM O;  5EK0 A;  3TK0 A;  3KKB A;  4U9E A;  4EUK B;  1G8X A;  2L6F A;  2KYH A;  1EKY A;  2XL8 A;  2Q9A A;  2P1A A;  1PV3 A;  2DGJ A;  1VB5 A;  1GM5 A;  1HMD A;  1EA8 A;  5L0H A;  3TJ5 A;  2HUJ A;  5EHH A;  4NTA A;  4MS2 A;  1YYX A;  1AVO B;  1GS9 A;  1S05 A;  2J9V A;  1ZHY A;  2O9X A;  4ONS A;  3NRH A;  4YL1 A;  3U8V A;  1K05 A;  1ZU4 A;  1RKE A;  3JSZ A;  4HFK B;  1Z63 A;  5DLJ A;  3T6B A;  3EZI A;  2GAQ A;  4CS7 A;  2JD3 A;  2YLG A;  5EGY A;  4LLC A;  1KTM A;  1V55 C;  2IBF A;  3S0X A;  4O7G A;  2VCB A;  2XM4 A;  3I5P A;  2OEV A; 
#chains in the Genus database with same CATH homology
 3UGO A;  5KYY B;  4CBE A;  2Y69 C;  2H7B A;  3EPV A;  5KYW A;  4KNW A;  2OCC C;  2WVQ A;  3FVY A;  3Q6N A;  1D0Y A;  3ABL C;  3M1C B;  3I4U A;  2R7S A;  4PFP A;  1OKK A;  2IXN A;  3SP1 A;  4BJ5 A;  2PF4 E;  2E87 A;  5DQT A;  4DVY P;  4JW1 A;  4NY3 A;  3ZG1 A;  2R7R A;  4BJ6 A;  1QZX A;  3LEV A;  2ZXW C;  3ASO C;  1TWH A;  2J9W A;  4ZLC A;  5DS6 A;  5T3W A;  1VMA A;  4QDL A;  5E3A A;  4DVZ A;  3EGX B;  3LS1 A;  4FX5 A;  4YT8 A;  2P7V A;  2KW3 C;  3SNH A;  4GEH A;  2J45 A;  3HLZ A;  1QLE C;  3ABK C;  5T3T A;  3EFO A;  3SYN A;  3B0U X;  3JT1 A;  3EH2 A;  2NUT B;  5KYU B;  2ZXR A;  2A1D D;  3VAY A;  2NG1 A;  4YT2 A;  2Y3H A;  4N06 A;  1MMN A;  4C3D A;  4HE8 D;  3FDQ A;  4JVS A;  1NU7 D;  1IZM A;  3S29 A;  3S27 A;  3W2W A;  4U5D E;  2IOQ A;  4ULW A;  4G7Z F;  2YEV A;  1S7Z A;  2KNH A;  3UNG C;  3PMR A;  4MND A;  4DBR A;  4MQ9 F;  3K33 A;  3CZ6 A;  3UR3 C;  2NUP B;  4LAC B;  4KNV A;  3EGD A;  3K7D A;  3EHM A;  2FFH A;  4O79 A;  2Z15 A;  2IXP A;  3JCU Q;  4Q7C A;  2ZXP A;  1ZHX A;  2Y3D A;  4KI2 A;  2EIL C;  1VYK A;  5BUO A;  2DYS C;  1J8M F;  1BR2 A;  2W4B A;  2J0W A;  4LER A;  4QI0 A;  2WZL A;  3UMK A;  4Q4Z F;  3FHD A;  5B3S C;  4C3E A;  5DS4 A;  3O39 A;  1MMA A;  4B6I A;  5L3Q A;  5D92 A;  1FMW A;  1ZHZ A;  3Q6M A;  4KC9 A;  3LAY A;  3N0T A;  3ZSU A;  4AK9 A;  4K7B A;  2KGO A;  1OCC C;  4O6Y A;  1TR2 A;  4CS8 C;  2WZG A;  2MWQ A;  3EQL F;  4FES A;  4JJF A;  4U5F E;  1SF8 A;  3POV A;  5IY5 C;  3L0I A;  4RD9 A;  1MNE A;  3X1O A;  3LLK A;  1W2W A;  3W8H A;  1NZE A;  2XXA A;  3K6B A;  1BR4 A;  3EG9 A;  3DXJ F;  1D1A A;  2B0J A;  2QY9 A;  4E7Z A;  3MX3 A;  4U5B E;  1M2V A;  2WZF A;  1NU9 C;  2R7U A;  5B1A C;  4IJJ A;  3ZVR A;  2WVN A;  3DJU B;  4XTK A;  3MLG A;  3AQB A;  3Q7G A;  3RYL A;  5L3V A;  1ST6 A;  4A2N B;  3O6X A;  3NKE A;  4J30 B;  1PD0 A;  4XWJ A;  2MYS A;  1SMY F;  4C7O B;  4C3B A;  1WGW A;  3DJN B;  2DYR C;  3N2Z B;  3Q7L A;  4O6N A;  5HSW A;  2M4E A;  3W8I A;  4I1M A;  1ZHW A;  4OD4 A;  3S28 A;  1LKX A;  2A69 F;  5D91 A;  2Y3G A;  1TWA A;  3I5Q A;  3LJB A;  3HJC A;  5DVW A;  3ECS A;  3X2Q C;  2R7V A;  3LNR A;  1M56 C;  4I3M A;  1MND A;  4KBL A;  3RKO F;  1M2O A;  4JZA A;  4JJG A;  4OD5 A;  3DAG A;  5KYX B;  4CSA A;  4AE4 B;  2VH3 A;  4GYT A;  2PX0 A;  3LS0 A;  1ZU5 A;  4DBQ A;  3B0V C;  2CW0 F;  3ZIB A;  5KYY A;  3EJN A;  2G3K A;  2Y3B A;  4OIP F;  2KQ9 A;  3RIP A;  1LS1 A;  2ZPA A;  1MMG A;  2GFH A;  2J9U A;  1VYI A;  2FGY A;  1Z5Z A;  2C03 A;  4OIN F;  4HEA J;  1J8Y F;  4CS9 C;  2I8B A;  2OG2 A;  5E2Q A;  4I44 A;  1FFT C;  3IEE A;  4M63 A;  1RJ9 B;  2HV6 A;  4IAO A;  2CNW D;  1OCZ C;  5DQZ A;  1PCX A;  2R7Q A;  2YHS A;  3WG7 C;  3RFY A;  3B0P A;  4BJ5 C;  1VK5 A;  2QTV A;  3E9V A;  3T4R A;  4DOZ A;  4PFO A;  2Y39 A;  3OA1 A;  3EGX A;  3UMI A;  1FFH A;  3CQZ A;  4BJ6 C;  5T1D B;  4OIQ F;  4PJM A;  3ABM C;  3ITF A;  4HFF B;  5KYN A;  1KU2 A;  4XLN F;  4BJT A;  3LES A;  2G3V A;  2H7O A;  3KMI A;  2WVO A;  3DZA A;  2IYL D;  4ZLD A;  3JRT A;  4O6M A;  5F5F A;  3F47 A;  4OIO F;  3SZR A;  2V26 A;  4I1O B;  3GAN A;  5KYW B;  1VOM A;  2NUT A;  5DS5 A;  5KYU A;  4J32 B;  4G7H F;  2EIK C;  3E70 C;  2A6H F;  3DMD A;  4ANJ A;  3KH2 A;  2Q9B A;  2J0X A;  2L9J A;  3K1H A;  2BE5 F;  3DM9 B;  2YZS A;  3NG1 A;  3OWT A;  1NG1 A;  2J7P D;  2J7P A;  3NYJ A;  4U5H A;  4BEJ A;  1OCR C;  4AX2 A;  1O5H A;  4JUR I;  2NUP A;  3NYL A;  4G7O F;  1N1C A;  2CGE A;  3W2V A;  5B1B C;  4YJW A;  4P6I C;  2Q9C A;  2P6V A;  2W45 A;  2J46 A;  4H4K C;  3KL4 A;  1FTS A;  4JCH A;  4U5E E;  4YT4 A;  3NYM A;  3V7O A;  1ZHT A;  4EWC A;  3PHF 2;  1Z23 A;  2Q3T A;  4PJL A;  1OCO C;  4F4B A;  1TWC A;  3EFO B;  1MMD A;  1Z6A A;  4BG0 A;  4OIR F;  3QMK A;  4WJ0 A;  2EIN C;  1TWG A;  3GOD A;  3WOD F;  5F5H A;  1D1C A;  3OEO A;  3DD7 A;  4PK4 A;  4E7S A;  1M57 C;  1OKK D;  3JYH A;  3LLI A;  3FAJ A;  3UGP A;  1ZYR F;  2V3C C;  2PFD A;  2R7O A;  4XLP F;  2W9Y A;  3F46 A;  2X51 A;  3DAF A;  2ZXO A;  4IRU A;  3EHN A;  2D5R B;  5CI8 A;  1FMV A;  3EGD B;  5E3C A;  2XSE A;  3UMH A;  2KJG A;  1D0X A;  2L81 A;  2XRH A;  4U5G A;  3VYW A;  4EBB A;  1V54 C;  4CIH A;  3NDB B;  3ASN C;  2R7W A;  3SEO A;  2H7V C;  4U5C E;  2HV7 A;  5E33 A;  2PX3 A;  3EZH A;  2WB7 A;  2XL4 A;  2EIM C;  3AG4 C;  3HTK C;  4CS8 A;  4C7O A;  2CNW A;  4RDA A;  1Z3I X;  3AG3 C;  4W8K A;  3H65 A;  3N24 A;  3RH3 A;  2W4M A;  2WL8 A;  4Q5S F;  4FWV A;  5CI9 A;  2PP4 A;  1JPJ A;  3AG1 C;  3ZC4 A;  4YT5 A;  2A6E F;  3L34 A;  4PJJ A;  2G62 A;  2R7X A;  4QI2 A;  5FCL A;  3TD7 A;  1SZI A;  5KYX A;  2XXA B;  4AE4 A;  2EIJ C;  4PJN A;  3NKD A;  4G0H A;  4K0D A;  2LSE A;  3EG9 B;  4X0R A;  2IXM A;  3QZC A;  1O87 A;  1M2V B;  3DM5 A;  3EH1 A;  4CSA C;  3K1I C;  3AQC A;  1JPN A;  1D1B A;  2VAS A;  2VB6 A;  4LLE A;  2R7T A;  3K66 A;  1D0Z A;  1LVK A;  1PD1 A;  4YN0 B;  2A68 F;  4YWQ A;  2C04 A;  1RJ9 A;  4BJ1 A;  4IWB A;  1TKN A;  3AG2 C;  3B9Q A;  3CSK A;  2IXO A;  3T6J A;  1BR1 A;  1IW7 F;  2CDQ A;  4RBN A;  3KKB A;  1G8X A;  2Q9A A;  2DGJ A;  5EHH A;  2J9V A;  1ZHY A;  2O9X A;  3NRH A;  1ZU4 A;  3JSZ A;  1Z63 A;  4HFK B;  5DLJ A;  3T6B A;  3EZI A;  4CS7 A;  2JD3 A;  5EGY A;  4LLC A;  1V55 C;  3S0X A;  4O7G A;  4CS9 A;  3I5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...