3LNRA

Crystal structure of poly-hamp domains from the p. aeruginosa soluble receptor aer2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
160
structure length
160
Chain Sequence
GSHMGLFNAHAVAQQRADRIATLLQSFADGQLDTAVGEAPAPGYERLYDSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDQTIPAERLEGRAARIAKGVNELVAAHIAVKMKVVSVVTAYGQGNFEPLMDRLPGKKAQITEAIDGVRERLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of concatenated HAMP domains provides a mechanism for signal transduction.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
molecule keywords Aerotaxis transducer Aer2
total genus 57
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2010-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18575 HAMP_N3 HAMP N-terminal domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3lnrA00
4I3MA 3LNRA 4I44A
chains in the Genus database with same CATH superfamily
4CS9C 4DBQA 5COGA 4E7SA 3FAJA 2ZXPA 3GORA 4C7OB 2Q00A 1D0YA 2OJQA 4JKVA 3S9OA 4N6CA 3LAYA 1A41A 4PJNA 3CAXA 4QDLA 5JT4A 1PCXA 1YVIA 4FESA 3ASNC 4C7OA 3PCVA 4I3MA 1G4WR 2Y69C 4Q5SF 1OR3A 3I5PA 1S05A 3TK0A 3V5YA 3KMIA 1UFBA 3VF0A 2L81A 1ZHWA 2Q9CA 1T6IA 3Q6NA 5L0IA 1BDJB 2ZXWC 2WZLA 2B0JA 2Y3BA 1NBBA 2XLMA 3GEHA 3U9JA 3AOUA 4PJLA 1JR8A 1T9KA 4BJ1A 3N0TA 1C03A 4FWVA 1G4US 4XEVA 1Z7Qc 1D1BA 1I5NA 4A2NB 4CIHA 1ST6A 3CZ6A 4JIOA 1OXKA 3ECSA 3HNKA 4MVOA 4XLNF 3ZWIA 1OCZC 1O87A 1NFOA 1C17M 2HSQA 1FTSA 4CS9A 2GA0A 2Q3TA 2VCAA 2NSGA 4DBRA 1WASA 2M64A 3ZVRA 3KPHA 2HFIA 2Y39A 1RMVA 2ETSA 3QW0A 1Q0MA 3HLZA 4CS7A 2ZD9A 3EJNA 3JT1A 1ZU5A 2P6VA 4XQ1A 2R7TA 3B0VC 3E9VA 1XZPA 1OW8A 5A6AA 3S90A 3R7CA 2EIMC 1RKCA 2WB7A 3IQ5A 3ZTZA 3N24A 1OR2A 1Z6AA 3FDQA 5KYWA 5KYYA 5CI9A 3TOMA 5F28E 1I4YA 2FAPB 4JW1A 3RVZA 4CJOA 2YQYA 1D0ZA 2P1AA 3C63A 3DM9B 3C8GB 1SZIA 1RKEB 1T6QA 3JSZA 3K7DA 4N4WA 5A69A 3EG9A 1YZAA 2BL2A 4NQFA 4YL1A 1NU9C 1YYXA 3K33A 4CS8A 3L8JA 2MHRA 3S27A 2QY9A 4BJ5A 5DS4A 4KBLA 2O9XA 4KNVA 3S29A 1D1AA 1L7CA 1AVOB 2P61A 1BBHA 1S7ZA 3C8GD 4OIRF 3SXYA 1K04A 1J8MF 3DXJF 4B6IA 2A68F 3VAYA 2CNWA 5E3AA 3ZQVA 2YLGA 5EK0A 3IEEA 2IOQA 3AGTA 2JPUA 3CSKA 3K1IC 2EILC 4FAPB 3BEHA 2WVOA 3QVYA 2Y3HA 3ZIBA 2EPLX 1LKXA 2A0BA 1KNYA 1GGQA 4U5GA 3C7JA 1LIHA 3GODA 2VH3A 1OW6A 2KNHA 2J9WA 3DMDA 3FMSA 4NC3A 4PR9A 1SMYF 5T1DB 3AQCA 4IWBA 2R7SA 3I5QA 2IXNA 3ZQYA 1Y4CA 3SXZA 2LFDA 4NY3A 3M15A 2DYSC 2R7RA 1JMWA 5BQGA 1M57C 4XWJA 5JRAA 1B68A 5CI8A 2R02A 3EHNA 4GYTA 1XZQA 3ZDLA 2OU6A 3EFOB 3NMJA 5D92A 3RQFA 2XLVA 4A4AA 3LUTB 1SYQA 3T6JA 3T9OA 3L8IA 3A11A 4L6RA 4E7ZA 4Z9IA 1TQGA 5KYYB 1CGNA 3FAPB 3M4BA 4HE8D 1V55C 2W9YA 3Q7LA 4DJ9A 3MFNA 3O10A 3US6A 2IXMA 2PNOA 2XLDA 3ZTMA 4XPYA 4OD5A 1V54C 2AWCA 2EINC 4C3EA 3UGPA 3W8HA 2YLDA 4DRHB 4YL0A 1NG1A 1U6HA 3JZ0A 2W4MA 4PACA 2YHSA 3A9CA 1OW7A 4U9DA 4EUKB 3MBGA 1LE2A 4JE9A 2NUTB 2L6FA 1I4ZA 2AVKA 4JC7A 4R32A 4E17A 1N1CA 1QLEC 1LVKA 1VMAA 2XLOA 3TD7A 2AP3A 1ZU4A 1ZW2A 2LQGA 3DD7A 3SXMA 4U5EE 5FCLA 3V5ZA 5EGYA 3TJ6A 3FXHA 1C02A 5COFA 4G78A 3MYFA 3JCUQ 1T5OA 2CW0F 2HUJA 5DS6A 2OQMA 3JRMO 2L9JA 1FR0A 2YRFA 4XEFA 1U89A 3RVYA 2F22A 1BZ4A 4MW8A 3X2QC 1L3PA 2PX3A 4RBNA 1A7VA 2RD9A 1H7IA 2A6HF 2EIKC 3NYLA 2YL1A 4PFPA 4Q7CA 2W4BA 4IRUA 1JPJA 1TR2A 2A69F 5L0GA 3UMKA 2R05A 3I4UA 3BRJA 2EPNA 4C3BA 4LDRA 1FAPB 4XLPF 1LS1A 2D4UA 1LS4A 1PD0A 4X0RA 1TKNA 5F5HA 1Q0FA 1R4TA 1ZZPA 2XLHA 2KSFA 1Q0GA 1Y6DA 2Q4FA 1AUEA 1FMVA 5DS5A 1G5ZA 2NUPB 1R5ID 3HTKC 4PFOA 1PD1A 3B0PA 3FOPA 5A6KA 5B3IA 3AJMA 3ASOC 2J0WA 4ULVA 1DOVA 3IPMO 4I1OB 1KU2A 1WTYA 2QUPA 3GM1A 1ORSC 2AU5A 4MW3A 2E87A 3O39A 1WATA 3EGXB 3LS1A 2J7PA 4W8PA 2G62A 3MLGA 2PFDA 1W2WA 1ZW3A 4UDVA 4MVMA 4OINF 4EWCA 3LESA 3AG1C 1HW2A 1YAUO 3ABMC 3EGDA 2XRHA 4DVYP 3C8ZA 4IAQA 2OOCA 1G8XA 2R03A 4P6IC 2R7VA 1OCOC 2I8BA 1OKKA 2LFFA 1E2XA 2YZSA 4O6MA 3NKEA 4Z9HA 4YWQA 3W2VA 1XWJA 4CDAA 3RF3A 4E18A 4AX2A 4MVUA 4O7GA 4MVSA 5E3CA 1BR1A 4LDQA 5L0CA 4O6NA 2EPOA 3LJBA 2NG1A 4MVRA 4DOZA 2DGJA 3AG3C 3M1CB 4K7BA 3SXKA 5B3SC 3QW1A 3UGOA 3K1HA 1OCCC 1D0XA 4U5DE 4U5BE 3L34A 2KC3A 3LNMB 4JTCB 3N2ZB 1VB5A 2WL8A 3ZSUA 2G3KA 1VYIA 3O55A 1VLSA 1EKYA 4LLEA 3T6GB 2DI3A 4YT4A 2FFHA 1FFHA 4NTBA 3LS0A 2J9UA 3ABKC 3NYMA 4YJWA 3TJ5A 4PK4A 3DE9A 4P9FA 2J45A 3KKBA 4PJJA 3AQBA 3DWWA 2MYSA 2VCCA 3H2UA 4JZAA 3DAFA 1K05A 2QTVA 3NMKA 3SZRA 3WHNA 2TMVP 4QI2A 2NSFA 2D5RB 2HZ8A 4PJMA 3NRHA 5JS5A 3DE8A 3VM6A 1TFOB 1E86A 3V5XA 5IY5C 4BG0A 1IW7F 3QTHA 4JURI 3UNGC 1QVXA 3RQGA 1H9GA 2QLAA 2HJ3A 1V4AA 1YA9A 1JPNA 2KQ9A 2HJMA 5K0IA 1WWPA 2Q9BA 3C18A 4J7YA 3G4ZA 2OKUA 5EHHA 2IM8A 5KYNA 4LACB 3ATPA 3RYLA 4XEKA 1OQCA 4JEAA 2HV7A 2XSEA 2Z15A 3RFYA 2YWAA 4IGGA 3V7OA 5A6JA 3PHF2 1NU7D 2PF4E 3LLIA 3IQCA 1T6UA 2OCCC 4MTGA 1FMWA 2LIGA 2B0HA 3U8PA 3B71A 4E0HA 2CYDA 5HV9A 2XS8A 4WGZA 4DXWA 4MVQA 2J0XA 4AL1A 2EPMX 4G7HF 1JAFA 2CNWD 2W45A 1M6TA 2J7PD 4YT5A 1MQVA 4N6HA 4WABA 5COMA 5A6BD 3KH2A 1J8YF 2EIJC 2HKVA 2QNLA 1YZCA 2KJGA 2Y3GA 3LEOA 1LI7A 1MMGA 5B1AC 5E2QA 1EQ1A 3WAQA 1LI5A 2YL7A 2XXAA 1WOLA 2ZXRA 3HJCA 3EH1A 2KGOA 1Z3IX 2P0NA 3DI5A 3EHMA 3DJUB 5JUAA 2QE9A 4JJGA 4YT2A 2Q9AA 2IBFA 3KYIA 4M63A 4CDYA 5KYWB 5B1BC 2IXPA 4C3DA 2R7UA 5CIVA 3M4CA 2WZGA 4N06A 2ASRA 2HMQA 3U5SA 2XM0A 4AE4B 4O79A 3JSEO 2PBEA 2WVNA 1OCRC 3AGUA 5E33A 3U9MA 3UMHA 1HY5A 4BEJA 3UMIA 2R7XA 5L0DA 3F46A 2H7OA 4NTFA 3OEOA 4WGYA 3RW0A 4H54A 3SNHA 4AL0A 3S0XA 3LNRA 3C62A 2P7VA 4I1MA 1SR2A 5KYXB 2Q7RA 1HMOA 3VRCA 3JRTA 5L0HA 3C8GA 3EH2A 5JSLA 2OEXA 3VYWA 4CDVA 2R7WA 5GPGB 4D4NA 4CSAC 2J46A 1MNDA 2YVKA 3AG4C 1MNEA 2HMZA 2L7AA 5JVEA 5KYXA 1RXQA 1JRAA 1ZVZA 3O6XA 1YA7O 1TWAA 1ZYRF 4JTDB 2V26A 4G7OF 5F5FA 2OG2A 2C03A 3FVYA 2ZXOA 1O3UA 2DB4A 4NTAA 4KC9A 2LCHA 3J06A 4HEAJ 2HSBA 2YL0A 3SP1A 3RH3A 4F4BA 4YL3A 3X1OA 5HSWA 4EBJA 4YK5A 1VTMP 3MYIA 4WJ0A 3B0UX 3NYJA 5AGFA 3W8IA 2XXAB 1YDIA 4JCHA 3ABLC 4EKWA 1YARO 4ULWA 1LE4A 4AK9A 1NFNA 4DVZA 1MMDA 4BJ6A 1FFTC 4CBEA 3HNLA 2HS5A 3U3FA 3K6BA 1HE9A 4HFKB 3SYNA 1SF8A 2A6EF 3GWLA 1LPEA 4LDKA 1MMAA 1QQ3A 5TJ5E 3PMRA 2EPKX 4U5HA 2LP4A 3QZCA 1UG7A 4KNWA 3DKAA 5T3WA 2PP4A 3OA1A 4CX9A 3OWTA 3ZG1A 2OJED 4W8KA 4CIPA 1ZHZA 1ORYA 1E85A 4ZLDA 2YEVA 2A0UA 3W2WA 5T3TA 4ZLCA 1CGME 1RKEA 2VB6A 3F47A 5L3QA 2MWQA 3FHDA 3EG9B 1OXBA 1PV3A 4G7ZF 1Q0KA 2M4EA 1HMDA 3PDMP 2LSEA 3EQLF 5L0FA 3H65A 1A7DA 4YT8A 3U0CA 3NDBB 3K66A 2NUTA 4E0IA 4CS8C 3RIPA 1T01A 1YLMA 1RJ9B 4EBKA 4G0HA 3U2MA 1NLXA 4EBBA 5A6BA 4JCZA 3AG2C 4Z9JA 3DZAA 1A0BA 2GDCA 4OD4A 1RJ9A 4BJTA 3B29A 1V74B 3Q7GA 3JTLO 3EZIA 3MX3A 4J30B 5L0JA 3SEOA 1F1MA 3EPVA 1WGWA 1ORJA 1K40A 1TWHA 2JX0A 2R7OA 3K1IA 3LLKA 4H4KC 2V3CC 5DVWA 4MTOA 2G3VA 4DRIB 2DYRC 3HNJA 3DJNB 2H7BA 3L0IA 4IB4A 1A7EA 1VLTA 2I15A 4YN0B 1VYKA 1Z23A 2IYLD 2KW3C 2ZPAA 2AWYA 1EA8A 4J32B 4U5FE 3KL4A 1VK5A 1VOMA 4JTAB 4KI2A 1H9TA 5DLJA 4K1OA 4LLCA 3CQZA 5BQHA 1Z5ZA 3GWNA 3U3BA 4ANJA 4BPMA 3T6BA 2UUHA 3EFOA 4IJJA 3GM3A 3Q6MA 4MS2A 2GFHA 3UR3C 3G4XA 1M56C 1MMNA 4J7TA 1QPUA 1CPRA 2X0CA 3IHUA 3QMKA 3RKOF 2VC9A 4CSAA 4CJGA 4K0DA 4OIOF 3G50A 4D4XA 4ER9A 1RCPA 4DRJB 1M2OA 2YLIA 3TULA 3H2VA 2KYHA 4MVZA 4O6YA 2Y3DA 5JLIA 2R9RB 2PX0A 5D91A 2R7QA 1DOWA 2XL8A 2JD3A 3IQTA 1QKRA 1NZEA 2YKZA 3IQ6A 3JYHA 5BUOA 4NCQA 1O5HA 2XS1A 1Z63A 2J9VA 5KYUA 5BQIA 1YYJA 2HV6A 3R2PA 4U9EA 3S28A 2CGEA 4HFFB 4FX5A 1D1CA 2ICWG 2OEVA 3T4RA 3EZHA 2NUPA 3HNIA 1M2VA 1Q0DA 2R25A 4IARA 3KYJA 1GS9A 3GEEA 3LEVA 4MNDA 2H8AA 5DQZA 4U5CE 2X51A 2XLWA 1TWCA 4JRZA 4Q4ZF 1M2VB 3GM2A 3POVA 1HE1A 4I44A 1BR4A 1WN0A 1KTMA 3U8VA 4BJ5C 2BC5A 2GAQA 1JOGA 3GEIA 1U0BB 1TWGA 2RSEB 4MTFA 4GQHA 5AC5A 5JP7A 2XLEA 4OIQF 1OKKD 1H6GA 4OIPF 4IAOA 4XTKA 1CPQA 2CCYA 4GEHA 2LD6A 2XL6A 4EIYA 2KK1A 1NSGB 1GM5A 4JVSA 5L3VA 3FOOA 1ZHYA 3JYYA 3NKDA 256BA 2J9BA 2L6GA 5DQTA 3L1MA 1HW1A 4ONSA 3ITFA 3DAGA 3WG7C 1E83A 2IXOA 3U2LA 3QVZA 1E84A 1CGOA 4EHPA 5AC4A 2XL4A 4JEBA 4LERA 2LK4A 4BJ6C 3NG1A 3B9QA 3DM5A 2H7VC 1QZXA 2C04A 2L6HA 2FGYA 2UUIA 1IZMA 2NPUA 2A1DD 3CEXA 4QI0A 2YL3A 3ZC4A 1FNTc 2J8WA 5KYUB 3NMIA 3TQOA 4P9TA 4RD9A 2WZFA 3GANA 4BEMJ 1ZHXA 2BE5F 3W4YA 3HKKA 1BR2A 1AEPA 1GQAA 1YJGA 2XM4A 4RDAA 3EGXA 3M79A 2WVQA 2CDQA 3S84A 1LM3B 1APCA 1QSPA 3TOLA 1ZHTA 4XPXA 5FZTA 4AE4A 3RQEA 3E70C 2VCBA 4MQ9F 4XPWA 2GWWA 3EGDB 1TFKB 2VASA 4JJFA 1EI7A 3WODF
chains in the Genus database with same CATH topology
4CS9C 4DBQA 4E7SA 3FAJA 2ZXPA 4C7OB 1D0YA 3LAYA 4PJNA 4QDLA 1PCXA 4FESA 3ASNC 4C7OA 4I3MA 2Y69C 4Q5SF 3I5PA 3KMIA 2L81A 1ZHWA 2Q9CA 3Q6NA 2ZXWC 2WZLA 2B0JA 2Y3BA 4PJLA 4BJ1A 3N0TA 4FWVA 1D1BA 4A2NB 4CIHA 1ST6A 3CZ6A 3ECSA 4XLNF 1OCZC 1O87A 1FTSA 4DBRA 4CS9A 2Q3TA 3ZVRA 2Y39A 3HLZA 4CS7A 3EJNA 3JT1A 1ZU5A 2P6VA 2R7TA 3B0VC 3E9VA 2EIMC 2WB7A 3N24A 1Z6AA 3FDQA 5KYWA 5KYYA 5CI9A 4JW1A 3DM9B 1SZIA 3K7DA 3JSZA 3EG9A 1NU9C 3K33A 4CS8A 3S27A 2QY9A 4BJ5A 5DS4A 4KBLA 2O9XA 4KNVA 3S29A 1D1AA 4OIRF 1S7ZA 1J8MF 3DXJF 4B6IA 2A68F 3VAYA 2CNWA 5E3AA 3IEEA 2IOQA 3CSKA 3K1IC 2EILC 2WVOA 2Y3HA 3ZIBA 1LKXA 4U5GA 3GODA 4YT5A 5B3SC 2VH3A 2KNHA 2J9WA 3DMDA 2R7SA 1SMYF 5T1DB 3AQCA 4IWBA 3I5QA 2IXNA 4NY3A 2DYSC 2R7RA 1M57C 4XWJA 5CI8A 3EHNA 4GYTA 3EFOB 3T6JA 4E7ZA 5KYYB 4HE8D 1V55C 2W9YA 3Q7LA 2IXMA 4OD5A 1V54C 2EINC 4C3EA 3UGPA 3W8HA 1NG1A 2W4MA 2YHSA 2NUTB 1N1CA 1QLEC 1LVKA 1VMAA 3TD7A 1ZU4A 3DD7A 4U5EE 5FCLA 5EGYA 3JCUQ 2CW0F 5DS6A 2L9JA 3X2QC 2PX3A 4RBNA 2A6HF 2EIKC 3NYLA 4PFPA 4Q7CA 2W4BA 4IRUA 1JPJA 1TR2A 2A69F 3UMKA 3I4UA 4C3BA 4XLPF 1LS1A 1PD0A 4X0RA 1TKNA 5F5HA 5DS5A 1FMVA 2NUPB 3HTKC 4PFOA 1PD1A 3B0PA 3ASOC 2J0WA 4I1OB 1KU2A 2E87A 3O39A 3EGXB 3LS1A 2J7PA 2G62A 3MLGA 2PFDA 1W2WA 4OINF 4EWCA 3LESA 3AG1C 3ABMC 3EGDA 2XRHA 4DVYP 1G8XA 4P6IC 2R7VA 1OCOC 2I8BA 1OKKA 2YZSA 4O6MA 3NKEA 4YWQA 3W2VA 4AX2A 4O7GA 5E3CA 1BR1A 4O6NA 3LJBA 4DOZA 2NG1A 2DGJA 3AG3C 3M1CB 4K7BA 3UGOA 3K1HA 1OCCC 1D0XA 4U5DE 4U5BE 3L34A 3N2ZB 2WL8A 3ZSUA 2G3KA 1VYIA 4LLEA 4YT4A 2FFHA 1FFHA 4YJWA 3LS0A 2J9UA 3ABKC 3NYMA 4PK4A 2J45A 3KKBA 4PJJA 3AQBA 2MYSA 4JZAA 3SZRA 3DAFA 2QTVA 4QI2A 2D5RB 4PJMA 3NRHA 5IY5C 4BG0A 1IW7F 4JURI 3UNGC 1JPNA 2KQ9A 2Q9BA 5EHHA 5KYNA 4LACB 3RYLA 2HV7A 2XSEA 2Z15A 3RFYA 3V7OA 3PHF2 1NU7D 2PF4E 3LLIA 2OCCC 1FMWA 2J0XA 4G7HF 2CNWD 2W45A 2J7PD 3KH2A 1J8YF 2EIJC 5L3VA 2KJGA 2Y3GA 1MMGA 5B1AC 5E2QA 2XXAA 2ZXRA 3HJCA 3EH1A 2KGOA 1Z3IX 3EHMA 3DJUB 4JJGA 4YT2A 2Q9AA 4M63A 5KYWB 5B1BC 2IXPA 4C3DA 2R7UA 2WZGA 4N06A 4AE4B 4O79A 5E33A 2WVNA 1OCRC 3UMHA 4BEJA 3UMIA 2R7XA 3F46A 2H7OA 3S0XA 3OEOA 3SNHA 3LNRA 4I1MA 2P7VA 5KYXB 3JRTA 3EH2A 3VYWA 2R7WA 4CSAC 2J46A 1MNDA 3AG4C 1MNEA 5KYXA 3O6XA 1ZYRF 1TWAA 4G7OF 5F5FA 2V26A 2OG2A 2C03A 3FVYA 2ZXOA 4KC9A 4HEAJ 3SP1A 3RH3A 4F4BA 3X1OA 5HSWA 4WJ0A 3B0UX 3NYJA 3W8IA 2XXAB 4JCHA 3ABLC 4ULWA 4AK9A 4DVZA 1MMDA 4BJ6A 1FFTC 4CBEA 3K6BA 3SYNA 4HFKB 1SF8A 2A6EF 1MMAA 3PMRA 4U5HA 3QZCA 4KNWA 5T3WA 2PP4A 3OA1A 3OWTA 3ZG1A 4W8KA 4ZLDA 1ZHZA 2YEVA 4ZLCA 3W2WA 5T3TA 2VB6A 3F47A 5L3QA 2MWQA 3FHDA 3EG9B 4G7ZF 2M4EA 2LSEA 3EQLF 3NDBB 3H65A 4YT8A 3K66A 2NUTA 4CS8C 3RIPA 1RJ9B 4G0HA 4EBBA 3AG2C 3DZAA 4OD4A 1RJ9A 4BJTA 4J30B 3Q7GA 3EZIA 3MX3A 3SEOA 3EPVA 5D92A 1WGWA 1TWHA 2R7OA 3LLKA 4H4KC 2V3CC 5DVWA 2G3VA 2DYRC 3DJNB 2H7BA 3L0IA 4YN0B 1VYKA 1Z23A 2IYLD 2KW3C 2ZPAA 4J32B 4U5FE 3KL4A 1VK5A 1VOMA 4KI2A 5DLJA 4LLCA 3CQZA 1Z5ZA 4ANJA 3T6BA 3EFOA 4IJJA 3Q6MA 2GFHA 3UR3C 1M56C 1MMNA 3RKOF 3QMKA 4CSAA 4K0DA 4OIOF 1M2OA 4O6YA 2Y3DA 2PX0A 5D91A 2R7QA 2JD3A 1NZEA 3JYHA 5BUOA 1Z63A 1O5HA 2J9VA 5KYUA 2HV6A 3S28A 4HFFB 2CGEA 4FX5A 1D1CA 3T4RA 3EZHA 2NUPA 1M2VA 4MNDA 3LEVA 5DQZA 4U5CE 2X51A 1TWCA 4Q4ZF 1M2VB 3POVA 4I44A 1BR4A 4BJ5C 1TWGA 4OIQF 1OKKD 4OIPF 4IAOA 4XTKA 4GEHA 4JVSA 1ZHYA 3NKDA 5DQTA 3ITFA 3DAGA 3WG7C 2IXOA 2XL4A 4LERA 3NG1A 3B9QA 3DM5A 2H7VC 1QZXA 2C04A 2FGYA 1IZMA 2A1DD 4QI0A 3ZC4A 5KYUB 4RD9A 2WZFA 3GANA 1ZHXA 2BE5F 1BR2A 4RDAA 3EGXA 2WVQA 2CDQA 1ZHTA 4AE4A 3E70C 4MQ9F 4BJ6C 3EGDB 1D0ZA 2VASA 4JJFA 3WODF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I3M A;  3LNR A;  4I44 A; 
#chains in the Genus database with same CATH topology
 4CS9 C;  4DBQ A;  5COG A;  4E7S A;  3FAJ A;  2ZXP A;  3GOR A;  4C7O B;  2Q00 A;  1D0Y A;  2OJQ A;  4JKV A;  3S9O A;  4N6C A;  3LAY A;  1A41 A;  4PJN A;  3CAX A;  4QDL A;  5JT4 A;  1PCX A;  1YVI A;  4FES A;  3ASN C;  4C7O A;  3PCV A;  4I3M A;  1G4W R;  2Y69 C;  4Q5S F;  1OR3 A;  3I5P A;  1S05 A;  3TK0 A;  3V5Y A;  3KMI A;  1UFB A;  3VF0 A;  2L81 A;  1ZHW A;  2Q9C A;  1T6I A;  3Q6N A;  5L0I A;  1BDJ B;  2ZXW C;  2WZL A;  2B0J A;  2Y3B A;  1NBB A;  2XLM A;  3GEH A;  3U9J A;  3AOU A;  4PJL A;  1JR8 A;  1T9K A;  4BJ1 A;  3N0T A;  1C03 A;  4FWV A;  1G4U S;  4XEV A;  1Z7Q c;  1D1B A;  1I5N A;  4A2N B;  4CIH A;  1ST6 A;  3CZ6 A;  4JIO A;  1OXK A;  3ECS A;  3HNK A;  4MVO A;  4XLN F;  3ZWI A;  1OCZ C;  1O87 A;  1NFO A;  1C17 M;  2HSQ A;  1FTS A;  4CS9 A;  2GA0 A;  2Q3T A;  2VCA A;  2NSG A;  4DBR A;  1WAS A;  2M64 A;  3ZVR A;  3KPH A;  2HFI A;  2Y39 A;  1RMV A;  2ETS A;  3QW0 A;  1Q0M A;  3HLZ A;  4CS7 A;  2ZD9 A;  3EJN A;  3JT1 A;  1ZU5 A;  2P6V A;  4XQ1 A;  2R7T A;  3B0V C;  3E9V A;  1XZP A;  1OW8 A;  5A6A A;  3S90 A;  3R7C A;  2EIM C;  1RKC A;  2WB7 A;  3IQ5 A;  3ZTZ A;  3N24 A;  1OR2 A;  1Z6A A;  3FDQ A;  5KYW A;  5KYY A;  5CI9 A;  3TOM A;  5F28 E;  1I4Y A;  2FAP B;  4JW1 A;  3RVZ A;  4CJO A;  2YQY A;  1D0Z A;  2P1A A;  3C63 A;  3DM9 B;  3C8G B;  1SZI A;  1RKE B;  1T6Q A;  3JSZ A;  3K7D A;  4N4W A;  5A69 A;  3EG9 A;  1YZA A;  2BL2 A;  4NQF A;  4YL1 A;  1NU9 C;  1YYX A;  3K33 A;  4CS8 A;  3L8J A;  2MHR A;  3S27 A;  2QY9 A;  4BJ5 A;  5DS4 A;  4KBL A;  2O9X A;  4KNV A;  3S29 A;  1D1A A;  1L7C A;  1AVO B;  2P61 A;  1BBH A;  1S7Z A;  3C8G D;  4OIR F;  3SXY A;  1K04 A;  1J8M F;  3DXJ F;  4B6I A;  2A68 F;  3VAY A;  2CNW A;  5E3A A;  3ZQV A;  2YLG A;  5EK0 A;  3IEE A;  2IOQ A;  3AGT A;  2JPU A;  3CSK A;  3K1I C;  2EIL C;  4FAP B;  3BEH A;  2WVO A;  3QVY A;  2Y3H A;  3ZIB A;  2EPL X;  1LKX A;  2A0B A;  1KNY A;  1GGQ A;  4U5G A;  3C7J A;  1LIH A;  3GOD A;  2VH3 A;  1OW6 A;  2KNH A;  2J9W A;  3DMD A;  3FMS A;  4NC3 A;  4PR9 A;  1SMY F;  5T1D B;  3AQC A;  4IWB A;  2R7S A;  3I5Q A;  2IXN A;  3ZQY A;  1Y4C A;  3SXZ A;  2LFD A;  4NY3 A;  3M15 A;  2DYS C;  2R7R A;  1JMW A;  5BQG A;  1M57 C;  4XWJ A;  5JRA A;  1B68 A;  5CI8 A;  2R02 A;  3EHN A;  4GYT A;  1XZQ A;  3ZDL A;  2OU6 A;  3EFO B;  3NMJ A;  5D92 A;  3RQF A;  2XLV A;  4A4A A;  3LUT B;  1SYQ A;  3T6J A;  3T9O A;  3L8I A;  3A11 A;  4L6R A;  4E7Z A;  4Z9I A;  1TQG A;  5KYY B;  1CGN A;  3FAP B;  3M4B A;  4HE8 D;  1V55 C;  2W9Y A;  3Q7L A;  4DJ9 A;  3MFN A;  3O10 A;  3US6 A;  2IXM A;  2PNO A;  2XLD A;  3ZTM A;  4XPY A;  4OD5 A;  1V54 C;  2AWC A;  2EIN C;  4C3E A;  3UGP A;  3W8H A;  2YLD A;  4DRH B;  4YL0 A;  1NG1 A;  1U6H A;  3JZ0 A;  2W4M A;  4PAC A;  2YHS A;  3A9C A;  1OW7 A;  4U9D A;  4EUK B;  3MBG A;  1LE2 A;  4JE9 A;  2NUT B;  2L6F A;  1I4Z A;  2AVK A;  4JC7 A;  4R32 A;  4E17 A;  1N1C A;  1QLE C;  1LVK A;  1VMA A;  2XLO A;  3TD7 A;  2AP3 A;  1ZU4 A;  1ZW2 A;  2LQG A;  3DD7 A;  3SXM A;  4U5E E;  5FCL A;  3V5Z A;  5EGY A;  3TJ6 A;  3FXH A;  1C02 A;  5COF A;  4G78 A;  3MYF A;  3JCU Q;  1T5O A;  2CW0 F;  2HUJ A;  5DS6 A;  2OQM A;  3JRM O;  2L9J A;  1FR0 A;  2YRF A;  4XEF A;  1U89 A;  3RVY A;  2F22 A;  1BZ4 A;  4MW8 A;  3X2Q C;  1L3P A;  2PX3 A;  4RBN A;  1A7V A;  2RD9 A;  1H7I A;  2A6H F;  2EIK C;  3NYL A;  2YL1 A;  4PFP A;  4Q7C A;  2W4B A;  4IRU A;  1JPJ A;  1TR2 A;  2A69 F;  5L0G A;  3UMK A;  2R05 A;  3I4U A;  3BRJ A;  2EPN A;  4C3B A;  4LDR A;  1FAP B;  4XLP F;  1LS1 A;  2D4U A;  1LS4 A;  1PD0 A;  4X0R A;  1TKN A;  5F5H A;  1Q0F A;  1R4T A;  1ZZP A;  2XLH A;  2KSF A;  1Q0G A;  1Y6D A;  2Q4F A;  1AUE A;  1FMV A;  5DS5 A;  1G5Z A;  2NUP B;  1R5I D;  3HTK C;  4PFO A;  1PD1 A;  3B0P A;  3FOP A;  5A6K A;  5B3I A;  3AJM A;  3ASO C;  2J0W A;  4ULV A;  1DOV A;  3IPM O;  4I1O B;  1KU2 A;  1WTY A;  2QUP A;  3GM1 A;  1ORS C;  2AU5 A;  4MW3 A;  2E87 A;  3O39 A;  1WAT A;  3EGX B;  3LS1 A;  2J7P A;  4W8P A;  2G62 A;  3MLG A;  2PFD A;  1W2W A;  1ZW3 A;  4UDV A;  4MVM A;  4OIN F;  4EWC A;  3LES A;  3AG1 C;  1HW2 A;  1YAU O;  3ABM C;  3EGD A;  2XRH A;  4DVY P;  3C8Z A;  4IAQ A;  2OOC A;  1G8X A;  2R03 A;  4P6I C;  2R7V A;  1OCO C;  2I8B A;  1OKK A;  2LFF A;  1E2X A;  2YZS A;  4O6M A;  3NKE A;  4Z9H A;  4YWQ A;  3W2V A;  1XWJ A;  4CDA A;  3RF3 A;  4E18 A;  4AX2 A;  4MVU A;  4O7G A;  4MVS A;  5E3C A;  1BR1 A;  4LDQ A;  5L0C A;  4O6N A;  2EPO A;  3LJB A;  2NG1 A;  4MVR A;  4DOZ A;  2DGJ A;  3AG3 C;  3M1C B;  4K7B A;  3SXK A;  5B3S C;  3QW1 A;  3UGO A;  3K1H A;  1OCC C;  1D0X A;  4U5D E;  4U5B E;  3L34 A;  2KC3 A;  3LNM B;  4JTC B;  3N2Z B;  1VB5 A;  2WL8 A;  3ZSU A;  2G3K A;  1VYI A;  3O55 A;  1VLS A;  1EKY A;  4LLE A;  3T6G B;  2DI3 A;  4YT4 A;  2FFH A;  1FFH A;  4NTB A;  3LS0 A;  2J9U A;  3ABK C;  3NYM A;  4YJW A;  3TJ5 A;  4PK4 A;  3DE9 A;  4P9F A;  2J45 A;  3KKB A;  4PJJ A;  3AQB A;  3DWW A;  2MYS A;  2VCC A;  3H2U A;  4JZA A;  3DAF A;  1K05 A;  2QTV A;  3NMK A;  3SZR A;  3WHN A;  2TMV P;  4QI2 A;  2NSF A;  2D5R B;  2HZ8 A;  4PJM A;  3NRH A;  5JS5 A;  3DE8 A;  3VM6 A;  1TFO B;  1E86 A;  3V5X A;  5IY5 C;  4BG0 A;  1IW7 F;  3QTH A;  4JUR I;  3UNG C;  1QVX A;  3RQG A;  1H9G A;  2QLA A;  2HJ3 A;  1V4A A;  1YA9 A;  1JPN A;  2KQ9 A;  2HJM A;  5K0I A;  1WWP A;  2Q9B A;  3C18 A;  4J7Y A;  3G4Z A;  2OKU A;  5EHH A;  2IM8 A;  5KYN A;  4LAC B;  3ATP A;  3RYL A;  4XEK A;  1OQC A;  4JEA A;  2HV7 A;  2XSE A;  2Z15 A;  3RFY A;  2YWA A;  4IGG A;  3V7O A;  5A6J A;  3PHF 2;  1NU7 D;  2PF4 E;  3LLI A;  3IQC A;  1T6U A;  2OCC C;  4MTG A;  1FMW A;  2LIG A;  2B0H A;  3U8P A;  3B71 A;  4E0H A;  2CYD A;  5HV9 A;  2XS8 A;  4WGZ A;  4DXW A;  4MVQ A;  2J0X A;  4AL1 A;  2EPM X;  4G7H F;  1JAF A;  2CNW D;  2W45 A;  1M6T A;  2J7P D;  4YT5 A;  1MQV A;  4N6H A;  4WAB A;  5COM A;  5A6B D;  3KH2 A;  1J8Y F;  2EIJ C;  2HKV A;  2QNL A;  1YZC A;  2KJG A;  2Y3G A;  3LEO A;  1LI7 A;  1MMG A;  5B1A C;  5E2Q A;  1EQ1 A;  3WAQ A;  1LI5 A;  2YL7 A;  2XXA A;  1WOL A;  2ZXR A;  3HJC A;  3EH1 A;  2KGO A;  1Z3I X;  2P0N A;  3DI5 A;  3EHM A;  3DJU B;  5JUA A;  2QE9 A;  4JJG A;  4YT2 A;  2Q9A A;  2IBF A;  3KYI A;  4M63 A;  4CDY A;  5KYW B;  5B1B C;  2IXP A;  4C3D A;  2R7U A;  5CIV A;  3M4C A;  2WZG A;  4N06 A;  2ASR A;  2HMQ A;  3U5S A;  2XM0 A;  4AE4 B;  4O79 A;  3JSE O;  2PBE A;  2WVN A;  1OCR C;  3AGU A;  5E33 A;  3U9M A;  3UMH A;  1HY5 A;  4BEJ A;  3UMI A;  2R7X A;  5L0D A;  3F46 A;  2H7O A;  4NTF A;  3OEO A;  4WGY A;  3RW0 A;  4H54 A;  3SNH A;  4AL0 A;  3S0X A;  3LNR A;  3C62 A;  2P7V A;  4I1M A;  1SR2 A;  5KYX B;  2Q7R A;  1HMO A;  3VRC A;  3JRT A;  5L0H A;  3C8G A;  3EH2 A;  5JSL A;  2OEX A;  3VYW A;  4CDV A;  2R7W A;  5GPG B;  4D4N A;  4CSA C;  2J46 A;  1MND A;  2YVK A;  3AG4 C;  1MNE A;  2HMZ A;  2L7A A;  5JVE A;  5KYX A;  1RXQ A;  1JRA A;  1ZVZ A;  3O6X A;  1YA7 O;  1TWA A;  1ZYR F;  4JTD B;  2V26 A;  4G7O F;  5F5F A;  2OG2 A;  2C03 A;  3FVY A;  2ZXO A;  1O3U A;  2DB4 A;  4NTA A;  4KC9 A;  2LCH A;  3J06 A;  4HEA J;  2HSB A;  2YL0 A;  3SP1 A;  3RH3 A;  4F4B A;  4YL3 A;  3X1O A;  5HSW A;  4EBJ A;  4YK5 A;  1VTM P;  3MYI A;  4WJ0 A;  3B0U X;  3NYJ A;  5AGF A;  3W8I A;  2XXA B;  1YDI A;  4JCH A;  3ABL C;  4EKW A;  1YAR O;  4ULW A;  1LE4 A;  4AK9 A;  1NFN A;  4DVZ A;  1MMD A;  4BJ6 A;  1FFT C;  4CBE A;  3HNL A;  2HS5 A;  3U3F A;  3K6B A;  1HE9 A;  4HFK B;  3SYN A;  1SF8 A;  2A6E F;  3GWL A;  1LPE A;  4LDK A;  1MMA A;  1QQ3 A;  5TJ5 E;  3PMR A;  2EPK X;  4U5H A;  2LP4 A;  3QZC A;  1UG7 A;  4KNW A;  3DKA A;  5T3W A;  2PP4 A;  3OA1 A;  4CX9 A;  3OWT A;  3ZG1 A;  2OJE D;  4W8K A;  4CIP A;  1ZHZ A;  1ORY A;  1E85 A;  4ZLD A;  2YEV A;  2A0U A;  3W2W A;  5T3T A;  4ZLC A;  1CGM E;  1RKE A;  2VB6 A;  3F47 A;  5L3Q A;  2MWQ A;  3FHD A;  3EG9 B;  1OXB A;  1PV3 A;  4G7Z F;  1Q0K A;  2M4E A;  1HMD A;  3PDM P;  2LSE A;  3EQL F;  5L0F A;  3H65 A;  1A7D A;  4YT8 A;  3U0C A;  3NDB B;  3K66 A;  2NUT A;  4E0I A;  4CS8 C;  3RIP A;  1T01 A;  1YLM A;  1RJ9 B;  4EBK A;  4G0H A;  3U2M A;  1NLX A;  4EBB A;  5A6B A;  4JCZ A;  3AG2 C;  4Z9J A;  3DZA A;  1A0B A;  2GDC A;  4OD4 A;  1RJ9 A;  4BJT A;  3B29 A;  1V74 B;  3Q7G A;  3JTL O;  3EZI A;  3MX3 A;  4J30 B;  5L0J A;  3SEO A;  1F1M A;  3EPV A;  1WGW A;  1ORJ A;  1K40 A;  1TWH A;  2JX0 A;  2R7O A;  3K1I A;  3LLK A;  4H4K C;  2V3C C;  5DVW A;  4MTO A;  2G3V A;  4DRI B;  2DYR C;  3HNJ A;  3DJN B;  2H7B A;  3L0I A;  4IB4 A;  1A7E A;  1VLT A;  2I15 A;  4YN0 B;  1VYK A;  1Z23 A;  2IYL D;  2KW3 C;  2ZPA A;  2AWY A;  1EA8 A;  4J32 B;  4U5F E;  3KL4 A;  1VK5 A;  1VOM A;  4JTA B;  4KI2 A;  1H9T A;  5DLJ A;  4K1O A;  4LLC A;  3CQZ A;  5BQH A;  1Z5Z A;  3GWN A;  3U3B A;  4ANJ A;  4BPM A;  3T6B A;  2UUH A;  3EFO A;  4IJJ A;  3GM3 A;  3Q6M A;  4MS2 A;  2GFH A;  3UR3 C;  3G4X A;  1M56 C;  1MMN A;  4J7T A;  1QPU A;  1CPR A;  2X0C A;  3IHU A;  3QMK A;  3RKO F;  2VC9 A;  4CSA A;  4CJG A;  4K0D A;  4OIO F;  3G50 A;  4D4X A;  4ER9 A;  1RCP A;  4DRJ B;  1M2O A;  2YLI A;  3TUL A;  3H2V A;  2KYH A;  4MVZ A;  4O6Y A;  2Y3D A;  5JLI A;  2R9R B;  2PX0 A;  5D91 A;  2R7Q A;  1DOW A;  2XL8 A;  2JD3 A;  3IQT A;  1QKR A;  1NZE A;  2YKZ A;  3IQ6 A;  3JYH A;  5BUO A;  4NCQ A;  1O5H A;  2XS1 A;  1Z63 A;  2J9V A;  5KYU A;  5BQI A;  1YYJ A;  2HV6 A;  3R2P A;  4U9E A;  3S28 A;  2CGE A;  4HFF B;  4FX5 A;  1D1C A;  2ICW G;  2OEV A;  3T4R A;  3EZH A;  2NUP A;  3HNI A;  1M2V A;  1Q0D A;  2R25 A;  4IAR A;  3KYJ A;  1GS9 A;  3GEE A;  3LEV A;  4MND A;  2H8A A;  5DQZ A;  4U5C E;  2X51 A;  2XLW A;  1TWC A;  4JRZ A;  4Q4Z F;  1M2V B;  3GM2 A;  3POV A;  1HE1 A;  4I44 A;  1BR4 A;  1WN0 A;  1KTM A;  3U8V A;  4BJ5 C;  2BC5 A;  2GAQ A;  1JOG A;  3GEI A;  1U0B B;  1TWG A;  2RSE B;  4MTF A;  4GQH A;  5AC5 A;  5JP7 A;  2XLE A;  4OIQ F;  1OKK D;  1H6G A;  4OIP F;  4IAO A;  4XTK A;  1CPQ A;  2CCY A;  4GEH A;  2LD6 A;  2XL6 A;  4EIY A;  2KK1 A;  1NSG B;  1GM5 A;  4JVS A;  5L3V A;  3FOO A;  1ZHY A;  3JYY A;  3NKD A;  256B A;  2J9B A;  2L6G A;  5DQT A;  3L1M A;  1HW1 A;  4ONS A;  3ITF A;  3DAG A;  3WG7 C;  1E83 A;  2IXO A;  3U2L A;  3QVZ A;  1E84 A;  1CGO A;  4EHP A;  5AC4 A;  2XL4 A;  4JEB A;  4LER A;  2LK4 A;  4BJ6 C;  3NG1 A;  3B9Q A;  3DM5 A;  2H7V C;  1QZX A;  2C04 A;  2L6H A;  2FGY A;  2UUI A;  1IZM A;  2NPU A;  2A1D D;  3CEX A;  4QI0 A;  2YL3 A;  3ZC4 A;  1FNT c;  2J8W A;  5KYU B;  3NMI A;  3TQO A;  4P9T A;  4RD9 A;  2WZF A;  3GAN A;  4BEM J;  1ZHX A;  2BE5 F;  3W4Y A;  3HKK A;  1BR2 A;  1AEP A;  1GQA A;  1YJG A;  2XM4 A;  4RDA A;  3EGX A;  3M79 A;  2WVQ A;  2CDQ A;  3S84 A;  1LM3 B;  1APC A;  1QSP A;  3TOL A;  1ZHT A;  4XPX A;  5FZT A;  4AE4 A;  3RQE A;  3E70 C;  2VCB A;  4MQ9 F;  4XPW A;  2GWW A;  3EGD B;  1TFK B;  2VAS A;  4JJF A;  1EI7 A;  3WOD F; 
#chains in the Genus database with same CATH homology
 4CS9 C;  4DBQ A;  4E7S A;  3FAJ A;  2ZXP A;  4C7O B;  1D0Y A;  3LAY A;  4PJN A;  4QDL A;  1PCX A;  4FES A;  3ASN C;  4C7O A;  4I3M A;  2Y69 C;  4Q5S F;  3I5P A;  3KMI A;  2L81 A;  1ZHW A;  2Q9C A;  3Q6N A;  2ZXW C;  2WZL A;  2B0J A;  2Y3B A;  4PJL A;  4BJ1 A;  3N0T A;  4FWV A;  1D1B A;  4A2N B;  4CIH A;  1ST6 A;  3CZ6 A;  3ECS A;  4XLN F;  1OCZ C;  1O87 A;  1FTS A;  4DBR A;  4CS9 A;  2Q3T A;  3ZVR A;  2Y39 A;  3HLZ A;  4CS7 A;  3EJN A;  3JT1 A;  1ZU5 A;  2P6V A;  2R7T A;  3B0V C;  3E9V A;  2EIM C;  2WB7 A;  3N24 A;  1Z6A A;  3FDQ A;  5KYW A;  5KYY A;  5CI9 A;  4JW1 A;  3DM9 B;  1SZI A;  3K7D A;  3JSZ A;  3EG9 A;  1NU9 C;  3K33 A;  4CS8 A;  3S27 A;  2QY9 A;  4BJ5 A;  5DS4 A;  4KBL A;  2O9X A;  4KNV A;  3S29 A;  1D1A A;  4OIR F;  1S7Z A;  1J8M F;  3DXJ F;  4B6I A;  2A68 F;  3VAY A;  2CNW A;  5E3A A;  3IEE A;  2IOQ A;  3CSK A;  3K1I C;  2EIL C;  2WVO A;  2Y3H A;  3ZIB A;  1LKX A;  4U5G A;  3GOD A;  4YT5 A;  5B3S C;  2VH3 A;  2KNH A;  2J9W A;  3DMD A;  2R7S A;  1SMY F;  5T1D B;  3AQC A;  4IWB A;  3I5Q A;  2IXN A;  4NY3 A;  2DYS C;  2R7R A;  1M57 C;  4XWJ A;  5CI8 A;  3EHN A;  4GYT A;  3EFO B;  3T6J A;  4E7Z A;  5KYY B;  4HE8 D;  1V55 C;  2W9Y A;  3Q7L A;  2IXM A;  4OD5 A;  1V54 C;  2EIN C;  4C3E A;  3UGP A;  3W8H A;  1NG1 A;  2W4M A;  2YHS A;  2NUT B;  1N1C A;  1QLE C;  1LVK A;  1VMA A;  3TD7 A;  1ZU4 A;  3DD7 A;  4U5E E;  5FCL A;  5EGY A;  3JCU Q;  2CW0 F;  5DS6 A;  2L9J A;  3X2Q C;  2PX3 A;  4RBN A;  2A6H F;  2EIK C;  3NYL A;  4PFP A;  4Q7C A;  2W4B A;  4IRU A;  1JPJ A;  1TR2 A;  2A69 F;  3UMK A;  3I4U A;  4C3B A;  4XLP F;  1LS1 A;  1PD0 A;  4X0R A;  1TKN A;  5F5H A;  5DS5 A;  1FMV A;  2NUP B;  3HTK C;  4PFO A;  1PD1 A;  3B0P A;  3ASO C;  2J0W A;  4I1O B;  1KU2 A;  2E87 A;  3O39 A;  3EGX B;  3LS1 A;  2J7P A;  2G62 A;  3MLG A;  2PFD A;  1W2W A;  4OIN F;  4EWC A;  3LES A;  3AG1 C;  3ABM C;  3EGD A;  2XRH A;  4DVY P;  1G8X A;  4P6I C;  2R7V A;  1OCO C;  2I8B A;  1OKK A;  2YZS A;  4O6M A;  3NKE A;  4YWQ A;  3W2V A;  4AX2 A;  4O7G A;  5E3C A;  1BR1 A;  4O6N A;  3LJB A;  4DOZ A;  2NG1 A;  2DGJ A;  3AG3 C;  3M1C B;  4K7B A;  3UGO A;  3K1H A;  1OCC C;  1D0X A;  4U5D E;  4U5B E;  3L34 A;  3N2Z B;  2WL8 A;  3ZSU A;  2G3K A;  1VYI A;  4LLE A;  4YT4 A;  2FFH A;  1FFH A;  4YJW A;  3LS0 A;  2J9U A;  3ABK C;  3NYM A;  4PK4 A;  2J45 A;  3KKB A;  4PJJ A;  3AQB A;  2MYS A;  4JZA A;  3SZR A;  3DAF A;  2QTV A;  4QI2 A;  2D5R B;  4PJM A;  3NRH A;  5IY5 C;  4BG0 A;  1IW7 F;  4JUR I;  3UNG C;  1JPN A;  2KQ9 A;  2Q9B A;  5EHH A;  5KYN A;  4LAC B;  3RYL A;  2HV7 A;  2XSE A;  2Z15 A;  3RFY A;  3V7O A;  3PHF 2;  1NU7 D;  2PF4 E;  3LLI A;  2OCC C;  1FMW A;  2J0X A;  4G7H F;  2CNW D;  2W45 A;  2J7P D;  3KH2 A;  1J8Y F;  2EIJ C;  5L3V A;  2KJG A;  2Y3G A;  1MMG A;  5B1A C;  5E2Q A;  2XXA A;  2ZXR A;  3HJC A;  3EH1 A;  2KGO A;  1Z3I X;  3EHM A;  3DJU B;  4JJG A;  4YT2 A;  2Q9A A;  4M63 A;  5KYW B;  5B1B C;  2IXP A;  4C3D A;  2R7U A;  2WZG A;  4N06 A;  4AE4 B;  4O79 A;  5E33 A;  2WVN A;  1OCR C;  3UMH A;  4BEJ A;  3UMI A;  2R7X A;  3F46 A;  2H7O A;  3S0X A;  3OEO A;  3SNH A;  3LNR A;  4I1M A;  2P7V A;  5KYX B;  3JRT A;  3EH2 A;  3VYW A;  2R7W A;  4CSA C;  2J46 A;  1MND A;  3AG4 C;  1MNE A;  5KYX A;  3O6X A;  1ZYR F;  1TWA A;  4G7O F;  5F5F A;  2V26 A;  2OG2 A;  2C03 A;  3FVY A;  2ZXO A;  4KC9 A;  4HEA J;  3SP1 A;  3RH3 A;  4F4B A;  3X1O A;  5HSW A;  4WJ0 A;  3B0U X;  3NYJ A;  3W8I A;  2XXA B;  4JCH A;  3ABL C;  4ULW A;  4AK9 A;  4DVZ A;  1MMD A;  4BJ6 A;  1FFT C;  4CBE A;  3K6B A;  3SYN A;  4HFK B;  1SF8 A;  2A6E F;  1MMA A;  3PMR A;  4U5H A;  3QZC A;  4KNW A;  5T3W A;  2PP4 A;  3OA1 A;  3OWT A;  3ZG1 A;  4W8K A;  4ZLD A;  1ZHZ A;  2YEV A;  4ZLC A;  3W2W A;  5T3T A;  2VB6 A;  3F47 A;  5L3Q A;  2MWQ A;  3FHD A;  3EG9 B;  4G7Z F;  2M4E A;  2LSE A;  3EQL F;  3NDB B;  3H65 A;  4YT8 A;  3K66 A;  2NUT A;  4CS8 C;  3RIP A;  1RJ9 B;  4G0H A;  4EBB A;  3AG2 C;  3DZA A;  4OD4 A;  1RJ9 A;  4BJT A;  4J30 B;  3Q7G A;  3EZI A;  3MX3 A;  3SEO A;  3EPV A;  5D92 A;  1WGW A;  1TWH A;  2R7O A;  3LLK A;  4H4K C;  2V3C C;  5DVW A;  2G3V A;  2DYR C;  3DJN B;  2H7B A;  3L0I A;  4YN0 B;  1VYK A;  1Z23 A;  2IYL D;  2KW3 C;  2ZPA A;  4J32 B;  4U5F E;  3KL4 A;  1VK5 A;  1VOM A;  4KI2 A;  5DLJ A;  4LLC A;  3CQZ A;  1Z5Z A;  4ANJ A;  3T6B A;  3EFO A;  4IJJ A;  3Q6M A;  2GFH A;  3UR3 C;  1M56 C;  1MMN A;  3RKO F;  3QMK A;  4CSA A;  4K0D A;  4OIO F;  1M2O A;  4O6Y A;  2Y3D A;  2PX0 A;  5D91 A;  2R7Q A;  2JD3 A;  1NZE A;  3JYH A;  5BUO A;  1Z63 A;  1O5H A;  2J9V A;  5KYU A;  2HV6 A;  3S28 A;  4HFF B;  2CGE A;  4FX5 A;  1D1C A;  3T4R A;  3EZH A;  2NUP A;  1M2V A;  4MND A;  3LEV A;  5DQZ A;  4U5C E;  2X51 A;  1TWC A;  4Q4Z F;  1M2V B;  3POV A;  4I44 A;  1BR4 A;  4BJ5 C;  1TWG A;  4OIQ F;  1OKK D;  4OIP F;  4IAO A;  4XTK A;  4GEH A;  4JVS A;  1ZHY A;  3NKD A;  5DQT A;  3ITF A;  3DAG A;  3WG7 C;  2IXO A;  2XL4 A;  4LER A;  3NG1 A;  3B9Q A;  3DM5 A;  2H7V C;  1QZX A;  2C04 A;  2FGY A;  1IZM A;  2A1D D;  4QI0 A;  3ZC4 A;  5KYU B;  4RD9 A;  2WZF A;  3GAN A;  1ZHX A;  2BE5 F;  1BR2 A;  4RDA A;  3EGX A;  2WVQ A;  2CDQ A;  1ZHT A;  4AE4 A;  3E70 C;  4MQ9 F;  4BJ6 C;  3EGD B;  1D0Z A;  2VAS A;  4JJF A;  3WOD F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...