3LNRA

Crystal structure of poly-hamp domains from the p. aeruginosa soluble receptor aer2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
160
structure length
160
Chain Sequence
GSHMGLFNAHAVAQQRADRIATLLQSFADGQLDTAVGEAPAPGYERLYDSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDQTIPAERLEGRAARIAKGVNELVAAHIAVKMKVVSVVTAYGQGNFEPLMDRLPGKKAQITEAIDGVRERLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Aerotaxis transducer Aer2
publication title Structure of concatenated HAMP domains provides a mechanism for signal transduction.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 57
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2010-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18575 HAMP_N3 HAMP N-terminal domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3lnrA00
4I3MA 4I44A 3LNRA
chains in the Genus database with same CATH superfamily
3CEXA 3U2LA 5T1DB 2L9JA 2LK4A 3NMKA 1F1MA 4YL3A 2KC3A 4CDAA 1XWJA 2YQYA 3QZCA 4AK9A 1JMWA 2P6VA 5COFA 1LS4A 1NFOA 2ZXPA 5KYUB 2EINC 3CZ6A 4BG0A 2QE9A 3GANA 4WJ0A 4N4WA 1U6HA 2EPLX 2J7PA 1KNYA 2P7VA 1NU7D 3RQFA 3SXMA 4DVZA 2MWQA 1D1CA 1RCPA 4CDVA 1NSGB 1T6IA 3A11A 5T3TA 4DBRA 2L7AA 4E0IA 4OINF 2EPKX 2V26A 4YL1A 4JRZA 2YLIA 1OW7A 1WN0A 2HJMA 3M1CB 3NMIA 4ULWA 5BQIA 1Q0DA 2AWCA 3SXZA 3DZAA 3AJMA 2IBFA 1AVOB 3GM3A 3TJ5A 4BEMJ 2FFHA 4DOZA 4CIHA 2R7SA 5D92A 5CIVA 4M63A 1BBHA 1VK5A 3W8HA 1HW1A 4CS8A 4CS8C 1WASA 1VTMP 4XPWA 2J45A 1PCXA 4NTAA 3U2MA 1V4AA 2FGYA 4U5BE 4XEFA 4FAPB 1H9TA 2A0UA 2H8AA 3Q6MA 4I1MA 3N2ZB 1VMAA 4MTFA 4NCQA 3AGTA 3TOLA 2OJQA 3GODA 2WZLA 3IHUA 4H4KC 4AL0A 1YA7O 2W4BA 2J0XA 1N1CA 2R9RB 1YARO 3NRHA 4XTKA 4EBKA 2P1AA 2ICWG 3K6BA 2HMQA 2HS5A 2MYSA 3MFNA 5E3CA 4LDKA 3EHNA 3ZWIA 4R32A 5KYNA 1M57C 3VM6A 4OIQF 3LS1A 1OCOC 1YYXA 5E3AA 3U9MA 1T5OA 1CGME 3JYHA 1QSPA 3C8GD 2KGOA 3RIPA 4GYTA 2NSFA 3OEOA 3W8IA 3W4YA 2XLOA 1CGOA 3U3FA 3V5XA 2J0WA 5DS5A 3LEVA 4U5GA 3UMIA 4ZLCA 1WTYA 2Q9BA 3FAJA 4MTGA 1GGQA 3ZSUA 3L1MA 1WGWA 4WGZA 2QUPA 2Y3HA 2PFDA 3T4RA 1G4US 2Q3TA 4XEVA 3WAQA 4JIOA 1B68A 3T9OA 3JRTA 5K0IA 1MMAA 2CYDA 3K33A 3S29A 4IGGA 1FFTC 5T3WA 3W2VA 2IXNA 1SF8A 4E7SA 1HMDA 3JSEO 1K04A 2Y3DA 4NQFA 2LQGA 1H9GA 2XS8A 4U5DE 2J9VA 1SR2A 1LPEA 3EJNA 2WVQA 1YYJA 1T6UA 2XLVA 1YVIA 3EZHA 1R4TA 1M6TA 2AVKA 3HNLA 2F22A 3SP1A 5KYYB 4PFPA 2QTVA 3GEHA 3M4BA 1FAPB 1ZW2A 4EIYA 3PCVA 4QI0A 1TWHA 2UUIA 2YVKA 1RKEA 4ULVA 4EBBA 4MQ9F 2XLMA 2GA0A 5D91A 3MYFA 1GM5A 2J46A 3NDBB 1C17M 3GEIA 1BR1A 3ECSA 4K7BA 4PJJA 3S0XA 2OQMA 2J9WA 1HE9A 2LFDA 4J7YA 4MTOA 2HFIA 4X0RA 3U5SA 1RKEB 4JJGA 3H65A 4EKWA 1FMWA 3GM1A 2HJ3A 4MVMA 1YJGA 3B0UX 4DXWA 1WOLA 1NZEA 3S90A 4BPMA 1ZHTA 1PV3A 2EPMX 1E86A 4IAQA 5KYXA 3KL4A 4KNWA 3JCUQ 3EHMA 4C3EA 4JVSA 3TOMA 1HW2A 1XZQA 1MQVA 3R2PA 3M4CA 2VCAA 1LM3B 2R7QA 4C3BA 1OCZC 3C63A 1LI5A 3AG1C 2I15A 3FVYA 4PJNA 4YT5A 2D5RB 2ETSA 4JTAB 1O87A 2XL4A 4RBNA 5HSWA 2A69F 5B1BC 5KYXB 5L0FA 4EUKB 4PACA 1QLEC 1L3PA 2NUPA 4JJFA 2YL0A 3EPVA 2P0NA 3QW1A 3O10A 3QVYA 1EI7A 2XLHA 2G3KA 3ZTMA 1VLTA 1XZPA 4YWQA 3EG9A 4PR9A 1E84A 2E87A 2NSGA 2OEVA 1UG7A 1QPUA 1TQGA 4CJOA 1BDJB 3LJBA 3MBGA 1Q0KA 3DKAA 3DAGA 4MVOA 3ZVRA 1FNTc 3GORA 3T6JA 2LFFA 2R7RA 4J32B 4I1OB 2NUPB 3HKKA 2YZSA 1MMGA 2OCCC 3RVYA 2J9BA 3U9JA 4MS2A 3EG9B 4JURI 2KK1A 2YHSA 1RMVA 4U5EE 4O79A 4JKVA 5CI8A 1OXBA 2Y69C 2WVNA 2YL7A 1OCRC 1ZHZA 2IXMA 3B29A 4MVRA 4N6CA 4EHPA 2CDQA 4HEAJ 3S9OA 3SZRA 2IM8A 3U8VA 4JEAA 5BQGA 1ORJA 1U89A 4LERA 4OIRF 2IXPA 4DJ9A 1TFKB 4EBJA 3QTHA 2VC9A 4AX2A 5L0CA 4P6IC 3Q7LA 2Q4FA 2VASA 2OEXA 4H54A 4L6RA 4MVSA 3JRMO 5F5FA 1DOWA 5TJ5E 3GM2A 2CGEA 2IXOA 2VB6A 2WVOA 2ZXWC 2BC5A 3AG2C 3E9VA 2A68F 1Z3IX 4IB4A 3S28A 4CDYA 1QVXA 4G7OF 2B0HA 4U5CE 2Q7RA 4ONSA 3U0CA 3CAXA 3AG4C 4YK5A 5EHHA 2NPUA 2OOCA 4XEKA 1YZCA 4JC7A 3ABKC 2HMZA 4DBQA 2RD9A 4KI2A 3DD7A 4PJLA 2OG2A 3VYWA 5JT4A 1LVKA 3IQTA 5B3IA 3ZQYA 3EH1A 4MNDA 4O6MA 3I5PA 2KJGA 2YRFA 2ZPAA 3JZ0A 2R7OA 3G4ZA 5CI9A 5JUAA 4IAOA 3M79A 2PNOA 2KQ9A 4AL1A 2OKUA 5DVWA 4BJTA 3V7OA 3TQOA 3G50A 1DOVA 1FTSA 2WZGA 2XRHA 2AP3A 3SXKA 1A7EA 1S05A 3EH2A 1O5HA 3C62A 4D4NA 4XLNF 3L0IA 3ABMC 4CJGA 2EPNA 3JSZA 5L0IA 3ITFA 1E83A 1UFBA 2XL8A 3JYYA 1EKYA 3O6XA 1ORYA 2W45A 3CQZA 3JTLO 3UR3C 1G8XA 5FCLA 3ZG1A 3GWLA 1D0YA 4A4AA 1BZ4A 4CX9A 3A9CA 2BE5F 1D1AA 3DM9B 1ZZPA 3HNKA 5JRAA 3VF0A 1E85A 1MNEA 1YA9A 2PX0A 1IW7F 1OW8A 2HV6A 2R7XA 1NU9C 1VLSA 1TR2A 3B0PA 3SXYA 2L81A 2J8WA 4KNVA 1JR8A 1V54C 2DGJA 5DS6A 2LSEA 1L7CA 3ATPA 3Q6NA 4HFKB 3LAYA 1K05A 2IYLD 3DXJF 5KYYA 2YKZA 2VCBA 5COMA 4AE4A 4BJ5C 4BJ5A 1ORSC 2Q00A 4HFFB 3MX3A 1C03A 4CIPA 2RSEB 4O7GA 1O3UA 1RKCA 5EK0A 4J7TA 4E7ZA 5B3SC 2I8BA 2FAPB 3EFOA 4F4BA 4XPYA 3FDQA 1LE2A 5F5HA 2OU6A 2YEVA 4EWCA 4AE4B 1OXKA 2DI3A 3K1HA 4NC3A 3DWWA 1CPQA 1OKKD 3MYIA 3NYMA 1PD1A 1Z5ZA 4MW8A 2QNLA 2R05A 3LNRA 1ZVZA 2XLWA 3F47A 4G78A 4IARA 4LDQA 3EFOB 4ANJA 1JPNA 1KU2A 4CSAA 4CSAC 4YL0A 4MW3A 2Y3GA 4MVUA 3NG1A 4RDAA 4DRIB 3UGOA 4Q5SF 2KW3C 2ZD9A 3ZQVA 4BJ6A 4BJ6C 3H2UA 4WGYA 1ZHXA 4BJ1A 5HV9A 1GS9A 1HY5A 4NTFA 1A41A 4DRJB 3W2WA 4OIOF 3H2VA 2IOQA 2PF4E 2GAQA 2O9XA 1EQ1A 1HE1A 3MLGA 4Z9HA 2CNWD 3ASOC 2ASRA 1KTMA 3C18A 3DJNB 2R7VA 3X1OA 1QKRA 1SYQA 4FWVA 1TKNA 3UMKA 5A6KA 1ZU4A 2H7OA 5DQZA 3BEHA 3R7CA 4YT4A 4P9FA 1V74B 3IEEA 1MMNA 3O55A 4JE9A 1D1BA 4GQHA 3POVA 1YDIA 1K40A 1S7ZA 5KYWA 3AGUA 4N06A 3UNGC 2QY9A 4IRUA 3RVZA 1H7IA 1MMDA 4GEHA 5L0JA 1V55C 4P9TA 3QW0A 2L6GA 4O6NA 2XS1A 1YLMA 1Q0FA 1J8MF 3SNHA 3RQEA 5JVEA 4UDVA 3PDMP 3S27A 5KYWB 3GWNA 3L8JA 4J30B 2D4UA 4JZAA 3LESA 2YL1A 5A6BD 4CS9A 1I4ZA 1WWPA 4CS9C 5JLIA 4OD4A 3DE8A 3V5ZA 4ZLDA 4LDRA 1H6GA 4Q4ZF 4LACB 4U9DA 4YN0B 1ZHWA 4PK4A 3RH3A 3NKDA 2HV7A 2VCCA 2WZFA 3QVZA 4MVQA 4XWJA 4K0DA 4XLPF 3N0TA 3DI5A 3L8IA 2EPOA 4C3DA 5DS4A 4I44A 1I4YA 4YJWA 3ZDLA 3T6GB 1QQ3A 2YL3A 1LIHA 1TWCA 3E70C 2Z15A 3RKOF 2R7TA 5B1AC 2L6HA 1JRAA 3DJUB 4RD9A 2TMVP 2LP4A 3UGPA 1NLXA 1T01A 1T6QA 2NG1A 3ABLC 3EZIA 5E33A 5A6AA 2G62A 1C02A 5L3QA 2ZXOA 3HJCA 1LS1A 1SMYF 1OKKA 1W2WA 3JT1A 1R5ID 2Y39A 3J06A 2CCYA 4CBEA 1D0ZA 2DYRC 1JOGA 2V3CC 1APCA 1ZU5A 2JD3A 3LNMB 3B71A 4HE8D 4K1OA 4Q7CA 2X0CA 4LLEA 3LS0A 4JTDB 3SEOA 2XL6A 1U0BB 4YT2A 2A0BA 2A6HF 1LE4A 5DQTA 4E18A 3V5YA 2AWYA 1T9KA 3AOUA 3FHDA 3DAFA 1J8YF 4JW1A 4W8PA 2G3VA 2LIGA 3FMSA 4OD5A 5F28E 1CPRA 1NBBA 1YAUO 2GDCA 4OIPF 2WL8A 5COGA 1VYIA 2CNWA 2H7VC 3IQ5A 3KPHA 3ASNC 5DLJA 4QDLA 4G7HF 4JTCB 1G5ZA 3EGXA 3ZC4A 1QZXA 4E0HA 2L6FA 1Y6DA 1Q0GA 4W8KA 1M56C 5IY5C 3I4UA 3M15A 1YZAA 2JX0A 4IJJA 4IWBA 5JS5A 5AC4A 2QLAA 4G0HA 4JEBA 1CGNA 3C8ZA 2MHRA 3EQLF 2C04A 2Q9CA 3Q7GA 4U5FE 3FAPB 4O6YA 2LD6A 2P61A 3EGXB 3LEOA 1LI7A 2R03A 3N24A 4JCZA 1ZW3A 3NYLA 2LCHA 2EIMC 5FZTA 3U3BA 2W4MA 3U8PA 2ZXRA 1SZIA 2R25A 2XM4A 2W9YA 1Z63A 1PD0A 4D4XA 1FR0A 4LLCA 1BR4A 1FFHA 1MNDA 2A1DD 3NKEA 5A6BA 2C03A 3LLKA 5L0HA 4G7ZF 1E2XA 3IQ6A 4WABA 5L3VA 4NY3A 1OQCA 3PHF2 3T6BA 1VYKA 3SYNA 2J9UA 1OR3A 2GFHA 4CS7A 3X2QC 1JAFA 2GWWA 3FOPA 3AQCA 2DB4A 3OA1A 2HSBA 1D0XA 1NG1A 1TWAA 1FMVA 1LKXA 3B9QA 2A6EF 3HNIA 3WHNA 1A7DA 4I3MA 4DVYP 2R7WA 2VH3A 4YT8A 3FOOA 1AEPA 3HNJA 3KMIA 2NUTA 4E17A 1Z6AA 3ZIBA 2HUJA 3F46A 4FESA 5EGYA 1IZMA 2WB7A 3DMDA 1G4WR 5A6JA 256BA 4XPXA 1WATA 4FX5A 3AG3C 3TJ6A 2PBEA 4KC9A 4DRHB 2M64A 2XSEA 3IQCA 4ER9A 3KH2A 2NUTB 3OWTA 4B6IA 1VB5A 4A2NB 3US6A 3I5QA 5L0GA 2AU5A 1M2VA 2YWAA 2R02A 3HTKC 3DM5A 2XXAA 2XLDA 2J7PD 4N6HA 2UUHA 3K66A 1I5NA 1A7VA 3K7DA 2CW0F 3L34A 3G4XA 1RJ9A 1TWGA 3IPMO 3LUTB 3GEEA 3S84A 1M2VB 1HMOA 2OJED 3KYJA 3WODF 2XXAB 3VAYA 2KNHA 3PMRA 5AGFA 4Z9IA 3C7JA 1ZYRF 3RF3A 3RW0A 3RYLA 3TK0A 1Q0MA 2M4EA 4NTBA 3QMKA 1JPJA 3CSKA 4XQ1A 3AQBA 3KYIA 5JP7A 3NMJA 1EA8A 4Z9JA 2PX3A 1AUEA 3TULA 1RJ9B 1RXQA 5E2QA 3HLZA 3B0VC 1NFNA 1OR2A 1A0BA 3ZTZA 4MVZA 4PFOA 2BL2A 4PJMA 3LLIA 1Z23A 3RQGA 2YLGA 1Z7Qc 2B0JA 2R7UA 3K1IA 3K1IC 2JPUA 3FXHA 1VOMA 2KYHA 4C7OA 4KBLA 1BR2A 1OW6A 5GPGB 2YLDA 5BUOA 3NYJA 2DYSC 1GQAA 5BQHA 2EIKC 2Q9AA 3UMHA 2Y3BA 2PP4A 3TD7A 2EIJC 3DE9A 3EGDA 4U9EA 3C8GA 3BRJA 3WG7C 2EILC 3O39A 4C7OB 2KSFA 3KKBA 3VRCA 1TFOB 1ST6A 1Y4CA 1ZHYA 2XM0A 5JSLA 2HZ8A 4JCHA 1OCCC 2XLEA 1M2OA 5L0DA 4BEJA 2HKVA 2HSQA 4U5HA 3EGDB 5AC5A 2H7BA 3C8GB 5A69A 5KYUA 2X51A 3RFYA 4QI2A
chains in the Genus database with same CATH topology
5T1DB 2L9JA 3QZCA 4AK9A 2P6VA 2ZXPA 5KYUB 2EINC 3CZ6A 4BG0A 3GANA 4WJ0A 4DVZA 2J7PA 2P7VA 1NU7D 2MWQA 1D1CA 4DBRA 5T3TA 4OINF 2V26A 3M1CB 4ULWA 3DZAA 4DOZA 2FFHA 2R7SA 4CIHA 5D92A 4M63A 1VK5A 3W8HA 4CS8A 4CS8C 2J45A 1PCXA 2FGYA 4U5BE 4I1MA 3Q6MA 3N2ZB 1VMAA 3GODA 2WZLA 4H4KC 2W4BA 2J0XA 1N1CA 4XTKA 3NRHA 3K6BA 2MYSA 5E3CA 3EHNA 5KYNA 1M57C 4OIQF 3LS1A 1OCOC 5E3AA 3JYHA 2KGOA 3RIPA 4GYTA 3OEOA 3W8IA 2J0WA 3LEVA 4U5GA 3UMIA 4ZLCA 2Q9BA 3FAJA 3ZSUA 1WGWA 2Y3HA 3T4RA 2PFDA 2Q3TA 3JRTA 1MMAA 3K33A 3S29A 1FFTC 5T3WA 3W2VA 2IXNA 1SF8A 4E7SA 2Y3DA 4U5DE 2J9VA 3EJNA 2WVQA 3EZHA 5KYYB 3SP1A 4PFPA 2QTVA 4QI0A 1TWHA 4EBBA 4MQ9F 5D91A 2J46A 3NDBB 1BR1A 3ECSA 4K7BA 4PJJA 3S0XA 2J9WA 4X0RA 4JJGA 3H65A 1FMWA 3B0UX 1NZEA 1ZHTA 5KYXA 3KL4A 4KNWA 3JCUQ 3EHMA 4C3EA 4JVSA 2R7QA 4C3BA 1OCZC 3AG1C 5DS5A 3FVYA 4PJNA 4YT5A 2D5RB 1O87A 2XL4A 4RBNA 5HSWA 2A69F 5B1BC 5KYXB 1QLEC 2NUPA 4JJFA 3EPVA 2G3KA 4YWQA 3EG9A 2E87A 3LJBA 3DAGA 3ZVRA 3T6JA 2R7RA 4J32B 4I1OB 2NUPB 2YZSA 1MMGA 2OCCC 3EG9B 4JURI 2YHSA 4U5EE 4O79A 5CI8A 2Y69C 2WVNA 1OCRC 1ZHZA 2IXMA 2CDQA 4HEAJ 3SZRA 4LERA 4OIRF 2IXPA 4AX2A 4P6IC 3Q7LA 2VASA 5F5FA 2CGEA 2IXOA 2VB6A 2WVOA 2ZXWC 3AG2C 3E9VA 2A68F 1Z3IX 3S28A 4G7OF 4U5CE 3AG4C 5EHHA 3ABKC 4DBQA 4KI2A 3DD7A 4PJLA 2OG2A 3VYWA 1LVKA 3EH1A 4MNDA 4O6MA 3I5PA 2KJGA 2ZPAA 2R7OA 5CI9A 4IAOA 2KQ9A 5DVWA 4BJTA 3V7OA 1FTSA 2WZGA 2XRHA 3EH2A 1O5HA 4XLNF 3L0IA 3ABMC 3JSZA 3ITFA 3O6XA 2W45A 3CQZA 3UR3C 1G8XA 5FCLA 3ZG1A 1D0YA 2BE5F 1D1AA 3DM9B 1MNEA 2PX0A 1IW7F 2HV6A 2R7XA 1NU9C 3B0PA 1TR2A 2L81A 4KNVA 1V54C 2DGJA 5DS6A 2LSEA 3Q6NA 4HFKB 5KYYA 3LAYA 2IYLD 3DXJF 4AE4A 4BJ5C 4BJ5A 4HFFB 3MX3A 4O7GA 4E7ZA 5B3SC 2I8BA 3EFOA 4F4BA 3FDQA 5F5HA 2YEVA 4EWCA 4AE4B 3K1HA 1OKKD 3NYMA 1PD1A 1Z5ZA 3LNRA 4ANJA 3F47A 3EFOB 1JPNA 1KU2A 4CSAA 4CSAC 2Y3GA 3NG1A 4RDAA 3UGOA 4Q5SF 2KW3C 4BJ6A 4BJ6C 1ZHXA 4BJ1A 4OIOF 3W2WA 2IOQA 2PF4E 2O9XA 3MLGA 2CNWD 3ASOC 3DJNB 2R7VA 3X1OA 4FWVA 1TKNA 3UMKA 1ZU4A 2H7OA 5DQZA 4YT4A 3IEEA 1MMNA 1D1BA 3POVA 1S7ZA 5KYWA 4N06A 3UNGC 2QY9A 4IRUA 1MMDA 4GEHA 1V55C 4O6NA 1J8MF 3SNHA 3S27A 5KYWB 4J30B 4JZAA 3LESA 4CS9A 4CS9C 4OD4A 4ZLDA 4Q4ZF 4LACB 4YN0B 1ZHWA 4PK4A 3RH3A 3NKDA 2HV7A 2WZFA 4XWJA 4K0DA 4XLPF 3N0TA 4C3DA 5DS4A 4I44A 4YJWA 1TWCA 3E70C 2Z15A 3RKOF 2R7TA 5B1AC 4RD9A 3DJUB 3UGPA 2NG1A 3ABLC 5E33A 3EZIA 2G62A 5L3QA 2ZXOA 3HJCA 1LS1A 1SMYF 1OKKA 3JT1A 1W2WA 2Y39A 4CBEA 1D0ZA 2DYRC 2V3CC 1ZU5A 2JD3A 4HE8D 3SEOA 4Q7CA 4LLEA 3LS0A 4YT2A 2A6HF 5DQTA 4JW1A 3FHDA 3DAFA 1J8YF 2G3VA 4OD5A 4OIPF 2WL8A 1VYIA 2CNWA 2H7VC 5DLJA 3ASNC 4QDLA 4G7HF 3EGXA 3ZC4A 1QZXA 4W8KA 1M56C 5IY5C 3I4UA 4IJJA 4IWBA 4G0HA 3EQLF 2Q9CA 2C04A 3Q7GA 4U5FE 4O6YA 3EGXB 3N24A 3NYLA 2EIMC 2W4MA 2ZXRA 1SZIA 2W9YA 1Z63A 1PD0A 4LLCA 1BR4A 1FFHA 1MNDA 2A1DD 3NKEA 4G7ZF 2C03A 3LLKA 5L3VA 4NY3A 3PHF2 3T6BA 1VYKA 3SYNA 2J9UA 2GFHA 4CS7A 3X2QC 3AQCA 3OA1A 1NG1A 1TWAA 1D0XA 1FMVA 1LKXA 3B9QA 2A6EF 4I3MA 4DVYP 2R7WA 2VH3A 4YT8A 3KMIA 2NUTA 1Z6AA 3ZIBA 3F46A 4FESA 5EGYA 1IZMA 2WB7A 3DMDA 4FX5A 3AG3C 4KC9A 2XSEA 3KH2A 2NUTB 3OWTA 4B6IA 4A2NB 3I5QA 1M2VA 2XXAA 3HTKC 3DM5A 2J7PD 3K66A 3K7DA 2CW0F 3L34A 1RJ9A 1TWGA 1M2VB 3WODF 2XXAB 3VAYA 2KNHA 3PMRA 1ZYRF 3RYLA 2M4EA 3QMKA 1JPJA 3CSKA 3AQBA 2PX3A 1RJ9B 5E2QA 3HLZA 3B0VC 4PFOA 4PJMA 3LLIA 1Z23A 2R7UA 2B0JA 3K1IC 1VOMA 4C7OA 4KBLA 1BR2A 5BUOA 3NYJA 2DYSC 2EIKC 2Q9AA 3UMHA 2Y3BA 2PP4A 3TD7A 2EIJC 3EGDA 3WG7C 2EILC 3O39A 4C7OB 3KKBA 1ST6A 1ZHYA 4JCHA 1OCCC 1M2OA 4BEJA 4U5HA 3EGDB 2H7BA 5KYUA 2X51A 3RFYA 4QI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I3M A;  4I44 A;  3LNR A; 
#chains in the Genus database with same CATH topology
 3CEX A;  3U2L A;  5T1D B;  2L9J A;  2LK4 A;  3NMK A;  1F1M A;  4YL3 A;  2KC3 A;  4CDA A;  1XWJ A;  2YQY A;  3QZC A;  4AK9 A;  1JMW A;  2P6V A;  5COF A;  1LS4 A;  1NFO A;  2ZXP A;  5KYU B;  2EIN C;  3CZ6 A;  4BG0 A;  2QE9 A;  3GAN A;  4WJ0 A;  4N4W A;  1U6H A;  2EPL X;  2J7P A;  1KNY A;  2P7V A;  1NU7 D;  3RQF A;  3SXM A;  4DVZ A;  2MWQ A;  1D1C A;  1RCP A;  4CDV A;  1NSG B;  1T6I A;  3A11 A;  5T3T A;  4DBR A;  2L7A A;  4E0I A;  4OIN F;  2EPK X;  2V26 A;  4YL1 A;  4JRZ A;  2YLI A;  1OW7 A;  1WN0 A;  2HJM A;  3M1C B;  3NMI A;  4ULW A;  5BQI A;  1Q0D A;  2AWC A;  3SXZ A;  3DZA A;  3AJM A;  2IBF A;  1AVO B;  3GM3 A;  3TJ5 A;  4BEM J;  2FFH A;  4DOZ A;  4CIH A;  2R7S A;  5D92 A;  5CIV A;  4M63 A;  1BBH A;  1VK5 A;  3W8H A;  1HW1 A;  4CS8 A;  4CS8 C;  1WAS A;  1VTM P;  4XPW A;  2J45 A;  1PCX A;  4NTA A;  3U2M A;  1V4A A;  2FGY A;  4U5B E;  4XEF A;  4FAP B;  1H9T A;  2A0U A;  2H8A A;  3Q6M A;  4I1M A;  3N2Z B;  1VMA A;  4MTF A;  4NCQ A;  3AGT A;  3TOL A;  2OJQ A;  3GOD A;  2WZL A;  3IHU A;  4H4K C;  4AL0 A;  1YA7 O;  2W4B A;  2J0X A;  1N1C A;  2R9R B;  1YAR O;  3NRH A;  4XTK A;  4EBK A;  2P1A A;  2ICW G;  3K6B A;  2HMQ A;  2HS5 A;  2MYS A;  3MFN A;  5E3C A;  4LDK A;  3EHN A;  3ZWI A;  4R32 A;  5KYN A;  1M57 C;  3VM6 A;  4OIQ F;  3LS1 A;  1OCO C;  1YYX A;  5E3A A;  3U9M A;  1T5O A;  1CGM E;  3JYH A;  1QSP A;  3C8G D;  2KGO A;  3RIP A;  4GYT A;  2NSF A;  3OEO A;  3W8I A;  3W4Y A;  2XLO A;  1CGO A;  3U3F A;  3V5X A;  2J0W A;  5DS5 A;  3LEV A;  4U5G A;  3UMI A;  4ZLC A;  1WTY A;  2Q9B A;  3FAJ A;  4MTG A;  1GGQ A;  3ZSU A;  3L1M A;  1WGW A;  4WGZ A;  2QUP A;  2Y3H A;  2PFD A;  3T4R A;  1G4U S;  2Q3T A;  4XEV A;  3WAQ A;  4JIO A;  1B68 A;  3T9O A;  3JRT A;  5K0I A;  1MMA A;  2CYD A;  3K33 A;  3S29 A;  4IGG A;  1FFT C;  5T3W A;  3W2V A;  2IXN A;  1SF8 A;  4E7S A;  1HMD A;  3JSE O;  1K04 A;  2Y3D A;  4NQF A;  2LQG A;  1H9G A;  2XS8 A;  4U5D E;  2J9V A;  1SR2 A;  1LPE A;  3EJN A;  2WVQ A;  1YYJ A;  1T6U A;  2XLV A;  1YVI A;  3EZH A;  1R4T A;  1M6T A;  2AVK A;  3HNL A;  2F22 A;  3SP1 A;  5KYY B;  4PFP A;  2QTV A;  3GEH A;  3M4B A;  1FAP B;  1ZW2 A;  4EIY A;  3PCV A;  4QI0 A;  1TWH A;  2UUI A;  2YVK A;  1RKE A;  4ULV A;  4EBB A;  4MQ9 F;  2XLM A;  2GA0 A;  5D91 A;  3MYF A;  1GM5 A;  2J46 A;  3NDB B;  1C17 M;  3GEI A;  1BR1 A;  3ECS A;  4K7B A;  4PJJ A;  3S0X A;  2OQM A;  2J9W A;  1HE9 A;  2LFD A;  4J7Y A;  4MTO A;  2HFI A;  4X0R A;  3U5S A;  1RKE B;  4JJG A;  3H65 A;  4EKW A;  1FMW A;  3GM1 A;  2HJ3 A;  4MVM A;  1YJG A;  3B0U X;  4DXW A;  1WOL A;  1NZE A;  3S90 A;  4BPM A;  1ZHT A;  1PV3 A;  2EPM X;  1E86 A;  4IAQ A;  5KYX A;  3KL4 A;  4KNW A;  3JCU Q;  3EHM A;  4C3E A;  4JVS A;  3TOM A;  1HW2 A;  1XZQ A;  1MQV A;  3R2P A;  3M4C A;  2VCA A;  1LM3 B;  2R7Q A;  4C3B A;  1OCZ C;  3C63 A;  1LI5 A;  3AG1 C;  2I15 A;  3FVY A;  4PJN A;  4YT5 A;  2D5R B;  2ETS A;  4JTA B;  1O87 A;  2XL4 A;  4RBN A;  5HSW A;  2A69 F;  5B1B C;  5KYX B;  5L0F A;  4EUK B;  4PAC A;  1QLE C;  1L3P A;  2NUP A;  4JJF A;  2YL0 A;  3EPV A;  2P0N A;  3QW1 A;  3O10 A;  3QVY A;  1EI7 A;  2XLH A;  2G3K A;  3ZTM A;  1VLT A;  1XZP A;  4YWQ A;  3EG9 A;  4PR9 A;  1E84 A;  2E87 A;  2NSG A;  2OEV A;  1UG7 A;  1QPU A;  1TQG A;  4CJO A;  1BDJ B;  3LJB A;  3MBG A;  1Q0K A;  3DKA A;  3DAG A;  4MVO A;  3ZVR A;  1FNT c;  3GOR A;  3T6J A;  2LFF A;  2R7R A;  4J32 B;  4I1O B;  2NUP B;  3HKK A;  2YZS A;  1MMG A;  2OCC C;  3RVY A;  2J9B A;  3U9J A;  4MS2 A;  3EG9 B;  4JUR I;  2KK1 A;  2YHS A;  1RMV A;  4U5E E;  4O79 A;  4JKV A;  5CI8 A;  1OXB A;  2Y69 C;  2WVN A;  2YL7 A;  1OCR C;  1ZHZ A;  2IXM A;  3B29 A;  4MVR A;  4N6C A;  4EHP A;  2CDQ A;  4HEA J;  3S9O A;  3SZR A;  2IM8 A;  3U8V A;  4JEA A;  5BQG A;  1ORJ A;  1U89 A;  4LER A;  4OIR F;  2IXP A;  4DJ9 A;  1TFK B;  4EBJ A;  3QTH A;  2VC9 A;  4AX2 A;  5L0C A;  4P6I C;  3Q7L A;  2Q4F A;  2VAS A;  2OEX A;  4H54 A;  4L6R A;  4MVS A;  3JRM O;  5F5F A;  1DOW A;  5TJ5 E;  3GM2 A;  2CGE A;  2IXO A;  2VB6 A;  2WVO A;  2ZXW C;  2BC5 A;  3AG2 C;  3E9V A;  2A68 F;  1Z3I X;  4IB4 A;  3S28 A;  4CDY A;  1QVX A;  4G7O F;  2B0H A;  4U5C E;  2Q7R A;  4ONS A;  3U0C A;  3CAX A;  3AG4 C;  4YK5 A;  5EHH A;  2NPU A;  2OOC A;  4XEK A;  1YZC A;  4JC7 A;  3ABK C;  2HMZ A;  4DBQ A;  2RD9 A;  4KI2 A;  3DD7 A;  4PJL A;  2OG2 A;  3VYW A;  5JT4 A;  1LVK A;  3IQT A;  5B3I A;  3ZQY A;  3EH1 A;  4MND A;  4O6M A;  3I5P A;  2KJG A;  2YRF A;  2ZPA A;  3JZ0 A;  2R7O A;  3G4Z A;  5CI9 A;  5JUA A;  4IAO A;  3M79 A;  2PNO A;  2KQ9 A;  4AL1 A;  2OKU A;  5DVW A;  4BJT A;  3V7O A;  3TQO A;  3G50 A;  1DOV A;  1FTS A;  2WZG A;  2XRH A;  2AP3 A;  3SXK A;  1A7E A;  1S05 A;  3EH2 A;  1O5H A;  3C62 A;  4D4N A;  4XLN F;  3L0I A;  3ABM C;  4CJG A;  2EPN A;  3JSZ A;  5L0I A;  3ITF A;  1E83 A;  1UFB A;  2XL8 A;  3JYY A;  1EKY A;  3O6X A;  1ORY A;  2W45 A;  3CQZ A;  3JTL O;  3UR3 C;  1G8X A;  5FCL A;  3ZG1 A;  3GWL A;  1D0Y A;  4A4A A;  1BZ4 A;  4CX9 A;  3A9C A;  2BE5 F;  1D1A A;  3DM9 B;  1ZZP A;  3HNK A;  5JRA A;  3VF0 A;  1E85 A;  1MNE A;  1YA9 A;  2PX0 A;  1IW7 F;  1OW8 A;  2HV6 A;  2R7X A;  1NU9 C;  1VLS A;  1TR2 A;  3B0P A;  3SXY A;  2L81 A;  2J8W A;  4KNV A;  1JR8 A;  1V54 C;  2DGJ A;  5DS6 A;  2LSE A;  1L7C A;  3ATP A;  3Q6N A;  4HFK B;  3LAY A;  1K05 A;  2IYL D;  3DXJ F;  5KYY A;  2YKZ A;  2VCB A;  5COM A;  4AE4 A;  4BJ5 C;  4BJ5 A;  1ORS C;  2Q00 A;  4HFF B;  3MX3 A;  1C03 A;  4CIP A;  2RSE B;  4O7G A;  1O3U A;  1RKC A;  5EK0 A;  4J7T A;  4E7Z A;  5B3S C;  2I8B A;  2FAP B;  3EFO A;  4F4B A;  4XPY A;  3FDQ A;  1LE2 A;  5F5H A;  2OU6 A;  2YEV A;  4EWC A;  4AE4 B;  1OXK A;  2DI3 A;  3K1H A;  4NC3 A;  3DWW A;  1CPQ A;  1OKK D;  3MYI A;  3NYM A;  1PD1 A;  1Z5Z A;  4MW8 A;  2QNL A;  2R05 A;  3LNR A;  1ZVZ A;  2XLW A;  3F47 A;  4G78 A;  4IAR A;  4LDQ A;  3EFO B;  4ANJ A;  1JPN A;  1KU2 A;  4CSA A;  4CSA C;  4YL0 A;  4MW3 A;  2Y3G A;  4MVU A;  3NG1 A;  4RDA A;  4DRI B;  3UGO A;  4Q5S F;  2KW3 C;  2ZD9 A;  3ZQV A;  4BJ6 A;  4BJ6 C;  3H2U A;  4WGY A;  1ZHX A;  4BJ1 A;  5HV9 A;  1GS9 A;  1HY5 A;  4NTF A;  1A41 A;  4DRJ B;  3W2W A;  4OIO F;  3H2V A;  2IOQ A;  2PF4 E;  2GAQ A;  2O9X A;  1EQ1 A;  1HE1 A;  3MLG A;  4Z9H A;  2CNW D;  3ASO C;  2ASR A;  1KTM A;  3C18 A;  3DJN B;  2R7V A;  3X1O A;  1QKR A;  1SYQ A;  4FWV A;  1TKN A;  3UMK A;  5A6K A;  1ZU4 A;  2H7O A;  5DQZ A;  3BEH A;  3R7C A;  4YT4 A;  4P9F A;  1V74 B;  3IEE A;  1MMN A;  3O55 A;  4JE9 A;  1D1B A;  4GQH A;  3POV A;  1YDI A;  1K40 A;  1S7Z A;  5KYW A;  3AGU A;  4N06 A;  3UNG C;  2QY9 A;  4IRU A;  3RVZ A;  1H7I A;  1MMD A;  4GEH A;  5L0J A;  1V55 C;  4P9T A;  3QW0 A;  2L6G A;  4O6N A;  2XS1 A;  1YLM A;  1Q0F A;  1J8M F;  3SNH A;  3RQE A;  5JVE A;  4UDV A;  3PDM P;  3S27 A;  5KYW B;  3GWN A;  3L8J A;  4J30 B;  2D4U A;  4JZA A;  3LES A;  2YL1 A;  5A6B D;  4CS9 A;  1I4Z A;  1WWP A;  4CS9 C;  5JLI A;  4OD4 A;  3DE8 A;  3V5Z A;  4ZLD A;  4LDR A;  1H6G A;  4Q4Z F;  4LAC B;  4U9D A;  4YN0 B;  1ZHW A;  4PK4 A;  3RH3 A;  3NKD A;  2HV7 A;  2VCC A;  2WZF A;  3QVZ A;  4MVQ A;  4XWJ A;  4K0D A;  4XLP F;  3N0T A;  3DI5 A;  3L8I A;  2EPO A;  4C3D A;  5DS4 A;  4I44 A;  1I4Y A;  4YJW A;  3ZDL A;  3T6G B;  1QQ3 A;  2YL3 A;  1LIH A;  1TWC A;  3E70 C;  2Z15 A;  3RKO F;  2R7T A;  5B1A C;  2L6H A;  1JRA A;  3DJU B;  4RD9 A;  2TMV P;  2LP4 A;  3UGP A;  1NLX A;  1T01 A;  1T6Q A;  2NG1 A;  3ABL C;  3EZI A;  5E33 A;  5A6A A;  2G62 A;  1C02 A;  5L3Q A;  2ZXO A;  3HJC A;  1LS1 A;  1SMY F;  1OKK A;  1W2W A;  3JT1 A;  1R5I D;  2Y39 A;  3J06 A;  2CCY A;  4CBE A;  1D0Z A;  2DYR C;  1JOG A;  2V3C C;  1APC A;  1ZU5 A;  2JD3 A;  3LNM B;  3B71 A;  4HE8 D;  4K1O A;  4Q7C A;  2X0C A;  4LLE A;  3LS0 A;  4JTD B;  3SEO A;  2XL6 A;  1U0B B;  4YT2 A;  2A0B A;  2A6H F;  1LE4 A;  5DQT A;  4E18 A;  3V5Y A;  2AWY A;  1T9K A;  3AOU A;  3FHD A;  3DAF A;  1J8Y F;  4JW1 A;  4W8P A;  2G3V A;  2LIG A;  3FMS A;  4OD5 A;  5F28 E;  1CPR A;  1NBB A;  1YAU O;  2GDC A;  4OIP F;  2WL8 A;  5COG A;  1VYI A;  2CNW A;  2H7V C;  3IQ5 A;  3KPH A;  3ASN C;  5DLJ A;  4QDL A;  4G7H F;  4JTC B;  1G5Z A;  3EGX A;  3ZC4 A;  1QZX A;  4E0H A;  2L6F A;  1Y6D A;  1Q0G A;  4W8K A;  1M56 C;  5IY5 C;  3I4U A;  3M15 A;  1YZA A;  2JX0 A;  4IJJ A;  4IWB A;  5JS5 A;  5AC4 A;  2QLA A;  4G0H A;  4JEB A;  1CGN A;  3C8Z A;  2MHR A;  3EQL F;  2C04 A;  2Q9C A;  3Q7G A;  4U5F E;  3FAP B;  4O6Y A;  2LD6 A;  2P61 A;  3EGX B;  3LEO A;  1LI7 A;  2R03 A;  3N24 A;  4JCZ A;  1ZW3 A;  3NYL A;  2LCH A;  2EIM C;  5FZT A;  3U3B A;  2W4M A;  3U8P A;  2ZXR A;  1SZI A;  2R25 A;  2XM4 A;  2W9Y A;  1Z63 A;  1PD0 A;  4D4X A;  1FR0 A;  4LLC A;  1BR4 A;  1FFH A;  1MND A;  2A1D D;  3NKE A;  5A6B A;  2C03 A;  3LLK A;  5L0H A;  4G7Z F;  1E2X A;  3IQ6 A;  4WAB A;  5L3V A;  4NY3 A;  1OQC A;  3PHF 2;  3T6B A;  1VYK A;  3SYN A;  2J9U A;  1OR3 A;  2GFH A;  4CS7 A;  3X2Q C;  1JAF A;  2GWW A;  3FOP A;  3AQC A;  2DB4 A;  3OA1 A;  2HSB A;  1D0X A;  1NG1 A;  1TWA A;  1FMV A;  1LKX A;  3B9Q A;  2A6E F;  3HNI A;  3WHN A;  1A7D A;  4I3M A;  4DVY P;  2R7W A;  2VH3 A;  4YT8 A;  3FOO A;  1AEP A;  3HNJ A;  3KMI A;  2NUT A;  4E17 A;  1Z6A A;  3ZIB A;  2HUJ A;  3F46 A;  4FES A;  5EGY A;  1IZM A;  2WB7 A;  3DMD A;  1G4W R;  5A6J A;  256B A;  4XPX A;  1WAT A;  4FX5 A;  3AG3 C;  3TJ6 A;  2PBE A;  4KC9 A;  4DRH B;  2M64 A;  2XSE A;  3IQC A;  4ER9 A;  3KH2 A;  2NUT B;  3OWT A;  4B6I A;  1VB5 A;  4A2N B;  3US6 A;  3I5Q A;  5L0G A;  2AU5 A;  1M2V A;  2YWA A;  2R02 A;  3HTK C;  3DM5 A;  2XXA A;  2XLD A;  2J7P D;  4N6H A;  2UUH A;  3K66 A;  1I5N A;  1A7V A;  3K7D A;  2CW0 F;  3L34 A;  3G4X A;  1RJ9 A;  1TWG A;  3IPM O;  3LUT B;  3GEE A;  3S84 A;  1M2V B;  1HMO A;  2OJE D;  3KYJ A;  3WOD F;  2XXA B;  3VAY A;  2KNH A;  3PMR A;  5AGF A;  4Z9I A;  3C7J A;  1ZYR F;  3RF3 A;  3RW0 A;  3RYL A;  3TK0 A;  1Q0M A;  2M4E A;  4NTB A;  3QMK A;  1JPJ A;  3CSK A;  4XQ1 A;  3AQB A;  3KYI A;  5JP7 A;  3NMJ A;  1EA8 A;  4Z9J A;  2PX3 A;  1AUE A;  3TUL A;  1RJ9 B;  1RXQ A;  5E2Q A;  3HLZ A;  3B0V C;  1NFN A;  1OR2 A;  1A0B A;  3ZTZ A;  4MVZ A;  4PFO A;  2BL2 A;  4PJM A;  3LLI A;  1Z23 A;  3RQG A;  2YLG A;  1Z7Q c;  2B0J A;  2R7U A;  3K1I A;  3K1I C;  2JPU A;  3FXH A;  1VOM A;  2KYH A;  4C7O A;  4KBL A;  1BR2 A;  1OW6 A;  5GPG B;  2YLD A;  5BUO A;  3NYJ A;  2DYS C;  1GQA A;  5BQH A;  2EIK C;  2Q9A A;  3UMH A;  2Y3B A;  2PP4 A;  3TD7 A;  2EIJ C;  3DE9 A;  3EGD A;  4U9E A;  3C8G A;  3BRJ A;  3WG7 C;  2EIL C;  3O39 A;  4C7O B;  2KSF A;  3KKB A;  3VRC A;  1TFO B;  1ST6 A;  1Y4C A;  1ZHY A;  2XM0 A;  5JSL A;  2HZ8 A;  4JCH A;  1OCC C;  2XLE A;  1M2O A;  5L0D A;  4BEJ A;  2HKV A;  2HSQ A;  4U5H A;  3EGD B;  5AC5 A;  2H7B A;  3C8G B;  5A69 A;  5KYU A;  2X51 A;  3RFY A;  4QI2 A; 
#chains in the Genus database with same CATH homology
 5T1D B;  2L9J A;  3QZC A;  4AK9 A;  2P6V A;  2ZXP A;  5KYU B;  2EIN C;  3CZ6 A;  4BG0 A;  3GAN A;  4WJ0 A;  4DVZ A;  2J7P A;  2P7V A;  1NU7 D;  2MWQ A;  1D1C A;  4DBR A;  5T3T A;  4OIN F;  2V26 A;  3M1C B;  4ULW A;  3DZA A;  4DOZ A;  2FFH A;  2R7S A;  4CIH A;  5D92 A;  4M63 A;  1VK5 A;  3W8H A;  4CS8 A;  4CS8 C;  2J45 A;  1PCX A;  2FGY A;  4U5B E;  4I1M A;  3Q6M A;  3N2Z B;  1VMA A;  3GOD A;  2WZL A;  4H4K C;  2W4B A;  2J0X A;  1N1C A;  4XTK A;  3NRH A;  3K6B A;  2MYS A;  5E3C A;  3EHN A;  5KYN A;  1M57 C;  4OIQ F;  3LS1 A;  1OCO C;  5E3A A;  3JYH A;  2KGO A;  3RIP A;  4GYT A;  3OEO A;  3W8I A;  2J0W A;  3LEV A;  4U5G A;  3UMI A;  4ZLC A;  2Q9B A;  3FAJ A;  3ZSU A;  1WGW A;  2Y3H A;  3T4R A;  2PFD A;  2Q3T A;  3JRT A;  1MMA A;  3K33 A;  3S29 A;  1FFT C;  5T3W A;  3W2V A;  2IXN A;  1SF8 A;  4E7S A;  2Y3D A;  4U5D E;  2J9V A;  3EJN A;  2WVQ A;  3EZH A;  5KYY B;  3SP1 A;  4PFP A;  2QTV A;  4QI0 A;  1TWH A;  4EBB A;  4MQ9 F;  5D91 A;  2J46 A;  3NDB B;  1BR1 A;  3ECS A;  4K7B A;  4PJJ A;  3S0X A;  2J9W A;  4X0R A;  4JJG A;  3H65 A;  1FMW A;  3B0U X;  1NZE A;  1ZHT A;  5KYX A;  3KL4 A;  4KNW A;  3JCU Q;  3EHM A;  4C3E A;  4JVS A;  2R7Q A;  4C3B A;  1OCZ C;  3AG1 C;  5DS5 A;  3FVY A;  4PJN A;  4YT5 A;  2D5R B;  1O87 A;  2XL4 A;  4RBN A;  5HSW A;  2A69 F;  5B1B C;  5KYX B;  1QLE C;  2NUP A;  4JJF A;  3EPV A;  2G3K A;  4YWQ A;  3EG9 A;  2E87 A;  3LJB A;  3DAG A;  3ZVR A;  3T6J A;  2R7R A;  4J32 B;  4I1O B;  2NUP B;  2YZS A;  1MMG A;  2OCC C;  3EG9 B;  4JUR I;  2YHS A;  4U5E E;  4O79 A;  5CI8 A;  2Y69 C;  2WVN A;  1OCR C;  1ZHZ A;  2IXM A;  2CDQ A;  4HEA J;  3SZR A;  4LER A;  4OIR F;  2IXP A;  4AX2 A;  4P6I C;  3Q7L A;  2VAS A;  5F5F A;  2CGE A;  2IXO A;  2VB6 A;  2WVO A;  2ZXW C;  3AG2 C;  3E9V A;  2A68 F;  1Z3I X;  3S28 A;  4G7O F;  4U5C E;  3AG4 C;  5EHH A;  3ABK C;  4DBQ A;  4KI2 A;  3DD7 A;  4PJL A;  2OG2 A;  3VYW A;  1LVK A;  3EH1 A;  4MND A;  4O6M A;  3I5P A;  2KJG A;  2ZPA A;  2R7O A;  5CI9 A;  4IAO A;  2KQ9 A;  5DVW A;  4BJT A;  3V7O A;  1FTS A;  2WZG A;  2XRH A;  3EH2 A;  1O5H A;  4XLN F;  3L0I A;  3ABM C;  3JSZ A;  3ITF A;  3O6X A;  2W45 A;  3CQZ A;  3UR3 C;  1G8X A;  5FCL A;  3ZG1 A;  1D0Y A;  2BE5 F;  1D1A A;  3DM9 B;  1MNE A;  2PX0 A;  1IW7 F;  2HV6 A;  2R7X A;  1NU9 C;  3B0P A;  1TR2 A;  2L81 A;  4KNV A;  1V54 C;  2DGJ A;  5DS6 A;  2LSE A;  3Q6N A;  4HFK B;  5KYY A;  3LAY A;  2IYL D;  3DXJ F;  4AE4 A;  4BJ5 C;  4BJ5 A;  4HFF B;  3MX3 A;  4O7G A;  4E7Z A;  5B3S C;  2I8B A;  3EFO A;  4F4B A;  3FDQ A;  5F5H A;  2YEV A;  4EWC A;  4AE4 B;  3K1H A;  1OKK D;  3NYM A;  1PD1 A;  1Z5Z A;  3LNR A;  4ANJ A;  3F47 A;  3EFO B;  1JPN A;  1KU2 A;  4CSA A;  4CSA C;  2Y3G A;  3NG1 A;  4RDA A;  3UGO A;  4Q5S F;  2KW3 C;  4BJ6 A;  4BJ6 C;  1ZHX A;  4BJ1 A;  4OIO F;  3W2W A;  2IOQ A;  2PF4 E;  2O9X A;  3MLG A;  2CNW D;  3ASO C;  3DJN B;  2R7V A;  3X1O A;  4FWV A;  1TKN A;  3UMK A;  1ZU4 A;  2H7O A;  5DQZ A;  4YT4 A;  3IEE A;  1MMN A;  1D1B A;  3POV A;  1S7Z A;  5KYW A;  4N06 A;  3UNG C;  2QY9 A;  4IRU A;  1MMD A;  4GEH A;  1V55 C;  4O6N A;  1J8M F;  3SNH A;  3S27 A;  5KYW B;  4J30 B;  4JZA A;  3LES A;  4CS9 A;  4CS9 C;  4OD4 A;  4ZLD A;  4Q4Z F;  4LAC B;  4YN0 B;  1ZHW A;  4PK4 A;  3RH3 A;  3NKD A;  2HV7 A;  2WZF A;  4XWJ A;  4K0D A;  4XLP F;  3N0T A;  4C3D A;  5DS4 A;  4I44 A;  4YJW A;  1TWC A;  3E70 C;  2Z15 A;  3RKO F;  2R7T A;  5B1A C;  4RD9 A;  3DJU B;  3UGP A;  2NG1 A;  3ABL C;  5E33 A;  3EZI A;  2G62 A;  5L3Q A;  2ZXO A;  3HJC A;  1LS1 A;  1SMY F;  1OKK A;  3JT1 A;  1W2W A;  2Y39 A;  4CBE A;  1D0Z A;  2DYR C;  2V3C C;  1ZU5 A;  2JD3 A;  4HE8 D;  3SEO A;  4Q7C A;  4LLE A;  3LS0 A;  4YT2 A;  2A6H F;  5DQT A;  4JW1 A;  3FHD A;  3DAF A;  1J8Y F;  2G3V A;  4OD5 A;  4OIP F;  2WL8 A;  1VYI A;  2CNW A;  2H7V C;  5DLJ A;  3ASN C;  4QDL A;  4G7H F;  3EGX A;  3ZC4 A;  1QZX A;  4W8K A;  1M56 C;  5IY5 C;  3I4U A;  4IJJ A;  4IWB A;  4G0H A;  3EQL F;  2Q9C A;  2C04 A;  3Q7G A;  4U5F E;  4O6Y A;  3EGX B;  3N24 A;  3NYL A;  2EIM C;  2W4M A;  2ZXR A;  1SZI A;  2W9Y A;  1Z63 A;  1PD0 A;  4LLC A;  1BR4 A;  1FFH A;  1MND A;  2A1D D;  3NKE A;  4G7Z F;  2C03 A;  3LLK A;  5L3V A;  4NY3 A;  3PHF 2;  3T6B A;  1VYK A;  3SYN A;  2J9U A;  2GFH A;  4CS7 A;  3X2Q C;  3AQC A;  3OA1 A;  1NG1 A;  1TWA A;  1D0X A;  1FMV A;  1LKX A;  3B9Q A;  2A6E F;  4I3M A;  4DVY P;  2R7W A;  2VH3 A;  4YT8 A;  3KMI A;  2NUT A;  1Z6A A;  3ZIB A;  3F46 A;  4FES A;  5EGY A;  1IZM A;  2WB7 A;  3DMD A;  4FX5 A;  3AG3 C;  4KC9 A;  2XSE A;  3KH2 A;  2NUT B;  3OWT A;  4B6I A;  4A2N B;  3I5Q A;  1M2V A;  2XXA A;  3HTK C;  3DM5 A;  2J7P D;  3K66 A;  3K7D A;  2CW0 F;  3L34 A;  1RJ9 A;  1TWG A;  1M2V B;  3WOD F;  2XXA B;  3VAY A;  2KNH A;  3PMR A;  1ZYR F;  3RYL A;  2M4E A;  3QMK A;  1JPJ A;  3CSK A;  3AQB A;  2PX3 A;  1RJ9 B;  5E2Q A;  3HLZ A;  3B0V C;  4PFO A;  4PJM A;  3LLI A;  1Z23 A;  2R7U A;  2B0J A;  3K1I C;  1VOM A;  4C7O A;  4KBL A;  1BR2 A;  5BUO A;  3NYJ A;  2DYS C;  2EIK C;  2Q9A A;  3UMH A;  2Y3B A;  2PP4 A;  3TD7 A;  2EIJ C;  3EGD A;  3WG7 C;  2EIL C;  3O39 A;  4C7O B;  3KKB A;  1ST6 A;  1ZHY A;  4JCH A;  1OCC C;  1M2O A;  4BEJ A;  4U5H A;  3EGD B;  2H7B A;  5KYU A;  2X51 A;  3RFY A;  4QI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...