1J8YF

Signal recognition particle conserved gtpase domain from a. ambivalens t112a mutant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
295
structure length
291
Chain Sequence
LLDNLRDTVRKFLTGSSSYDKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIERREWFIKIVYDELSNLFGGDKEPKVIPDKIPYVIMLVGVQGTTAGKLAYFYKKKGFKVGLVGADVYRPAALEQLQQLGQQIGVPVYGEPGEKDVVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEEAALLEEMKNIYEAIKPDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELEVFNPRRFVARLHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL RECOGNITION 54 KDA PROTEIN
publication title The crystal structure of the conserved GTPase of SRP54 from the archaeon Acidianus ambivalens and its comparison with related structures suggests a model for the SRP-SRP receptor complex.
pubmed doi rcsb
source organism Acidianus ambivalens
molecule tags Signaling protein
total genus 99
structure length 291
sequence length 295
ec nomenclature
pdb deposition date 2001-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1j8yF01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j8yF02
2GVZC 3T1VA 2CE2X 1LY1A 2CL0X 4V0MA 2Q9CA 2GK7A 3K9GA 2IS4A 1XWIA 2KWIA 2QA5A 2QP4A 3U3MA 1TF7A 4ZI2A 3I32A 2JAQA 2GAAA 4D4LA 1VG1A 1E1QA 221PA 2CK3A 2IEYA 1HQCA 1RYFA 4DCTA 2XTZA 2SHKA 1U81A 4JVLA 2FV8A 3HR8A 4MYUA 5FTKA 2GXQA 5CDFE 3CRQA 2ZUBA 1WE2A 2RCNA 3AKCA 3KXIA 3U44A 4OYHA 4RD0A 1P3JA 4B48A 1TU3A 2ZR9A 4KITB 1CR0A 4P3YA 3Q72A 1RVDA 3LWNA 4QFMA 1N25A 3F3YA 3RS3A 3D6TB 4C7OA 2ZI6A 3WBJA 4D2IA 3VQTA 1EWRA 3EX7C 5F98A 2Q9AA 4KLZA 5G40A 2CCJA 1YZUA 3CIOA 2RGEA 3K0SA 2BHRA 4JLPA 4XVRA 1UKVY 2OV2A 2OSBA 2VBCA 3DKPA 1S2MA 2F7SA 4U02A 4HDOB 3C15C 2OT3B 2FPKA 4KVGA 1Z6TA 3LQQA 1LB1B 4YMUA 4HATA 2ZRCA 5TB5A 3WP0A 2H16A 5DYIA 5FL7A 3QF4A 3FHCB 2A5FA 2O8EB 1RW4A 3K9NA 1OB2A 1IY0A 3IQXA 4BEBA 1NN5A 1M7HA 2QPAA 4URZR 4V02A 3SJCA 4BFUA 2REBA 2QPTA 4P0TA 5CB8A 1LW7A 3BBPA 3ZVRA 1NKTA 2QRZA 3S1AB 1KSGA 3HJNA 4F7WA 1NSFA 1IY1A 3QXJA 4YDHB 1ZNWA 5EUQB 2A5JA 1EFUA 4Q1BA 4DLWA 2QNRA 2DFLA 2HXSA 2OFWA 3BJIC 4A6PA 2F55A 5FOUA 4Z54A 5G3YA 3BB1A 2XITA 3KUDA 2XJ4A 3GJ8A 3GFTA 2GF0A 4R71A 1A7JA 1CJTC 1NVXQ 3I4LA 3LDAA 5JBQA 2WWFA 2ZI5A 1XD8A 4IRUB 3X1WA 1ZD9A 3CW2A 1XCPA 4YXWD 4N1AA 3UWKA 2AN9A 5KOYA 3CWZA 2WIAA 2HLDD 4OJQA 1NLZA 4TQ9A 4C0QC 1IN6A 3QXSA 1DEKA 1G8GA 2B21A 1GVNB 3A4MA 1I2DA 1ZMXA 4Q9KA 3VX4A 3VMFA 2F3TA 1FQKA 3B7GA 3M6AA 4NONA 4A82A 1II8A 4TLCA 4YDSA 3GLFA 2HDNB 2VSOA 2IYUA 3B2EA 2QENA 5AJVB 2HYIC 5KO2A 3MSXA 3B13B 4YMWA 3ZS9A 4GOXA 4HI0E 2ODBA 1AZTA 1E9DA 3T1OA 4DBLC 1SVMA 2A7QA 2FSFA 1UBCA 1QVRA 3T61A 3LV8A 3ADBA 3VR5A 1NG9A 1N5KA 1G1MA 1ODFA 2VF7A 2OZEA 3X1XA 4MKIA 3EWSA 1T5IA 2WM9B 1WDTA 3CRW1 5JCPA 3K09A 1XJ0A 2QTHA 3HR7A 2OCYC 1CJUC 3ZDQA 3K70D 4L9WA 5L3RA 2RGNA 2O0HA 2D74A 2BEKA 1YZKA 1BMFD 2GETA 3TE6A 2OLJA 3RHFA 3ZZUA 5K8IA 3DEFA 3N5CA 1V43A 2WPDD 5CITA 3P32A 1SVSA 3W6PA 2I1VB 1BYIA 2B8TA 4E03A 4M21A 4JJKA 3KUCA 1KYIA 1ZJ6A 1WP9A 2H18A 4IOMA 1UPTA 1AGPA 3WMEA 2OE2A 4CVNA 5IHPA 2IS6A 4QGHA 3P4YA 1ZUNB 4WXPA 1IY2A 1NIPA 4AYTA 3HPQA 1F2UB 1OFTA 3DL0A 3TAHA 3KJGA 2PT7A 2L0XA 5HTKA 1W1WA 1QVAA 1FTSA 3K0AB 4UXJA 2ZJZA 1DTSA 3G82C 2Q3FA 3HPRA 3NBZC 3FPAA 1NF3A 4RZ3A 5KDOA 4PXAA 1E2PA 721PA 1XMSA 3CR7A 3LLMA 1DAIA 3EARA 4HAYA 3KJHA 1H8HA 2GTPA 2PCLA 2ZITA 1A4RA 1N6KA 2B7BA 1DS6A 3BB3A 3LQRA 4DXAA 4ESHA 5AUQA 4MRNA 1W4RA 5CLQA 4ZCIA 3NIBA 3B1ZA 1G21E 1GG2A 1AK2A 3LH5A 2AXNA 4M1YA 3KTAB 4RSGA 5D3MB 3AVPA 3MWYW 4ACBA 3QG5A 3GLGB 2F9MA 2FFAA 1HE8B 3HWSA 4HDQB 2Q21A 2UZIR 3GQBA 1CRQA 4A6XA 3PUVA 3SBEA 5EE0A 2G1JA 2ZJYA 4TLDA 4DUGA 1QHSA 1IJFA 3AKYA 5CM9C 1D2MA 2YOHA 3TR5A 1KO5A 5FUYA 1GAJA 2XZPA 1E0SA 3W34A 4KV9A 5KSOA 4DLYA 2V4ZA 2ZRHA 4IEEA 4NCNA 2ZRIA 4M1MA 4B47A 3EW9A 1VMAA 1ZC3A 1GRQA 3QUSA 2FF7A 1BIFA 2N1BA 5GJWC 4LC0A 3ZIAA 2RKOA 3LVQE 3V00A 1XCGB 1W0JA 1XZQA 1OH7A 3U3KA 1OV4A 2GKSA 4TQUS 5DNYB 1BYUA 3L2OB 5H68A 1IQPA 1KO7A 3I61A 2ZU0C 1NSTA 1ZCBA 2BV3A 4Q4AB 2J7PA 4KCGA 4RZUA 1KMQA 4Z8XA 5KUTA 1K8RA 2WWIA 4HLQB 2ZREA 1E2EA 4AG6A 4B6EA 2UZ3A 3P20A 1E96A 2ERYA 2Y8EA 1AGRA 4KBFA 4FW9A 3IBYA 5DLQC 1XEFA 3K53A 5FTLA 4B71A 1QDEA 2NTYC 4OQFA 1VCIA 4IVRA 4Z8YA 1MRNA 5TVKA 1F60A 2QU8A 1C4OA 2ZJBA 1E1QD 2CK3D 4A0HA 1EK0A 4AYWA 3GLHB 4OL0A 1YRAA 4O0MA 4RFVA 1MO3A 3LX8A 4YONB 4TMXA 5EUMA 1KDTA 4DLUA 4US2R 3THWA 4C3ZA 4QGAA 5CK4A 2AR7A 4FN5A 3DOFA 4URYR 1XFAA 3VAAA 4JL5A 1JJ7A 5HZKA 2IUSA 3ZH9B 5KDDA 4K46A 2ZPTX 3LX5A 3NC0C 4NL4H 4Q00A 4LX0A 1KAOA 4BZXA 5B57C 3SYKA 2ZROA 3KKMA 2RGDA 4TYYA 4BFXA 2D7CA 1G3UA 2ZYUX 2REXB 3UIEA 4RCZA 4A9AA 1XBTA 2ODNA 3QNUA 1NMXA 1Z83A 2IC5A 3LAWA 4OI2A 5E95A 3ZGXA 5A0FA 2WOJA 3K0FA 4Q21A 1AQUA 4LJ7A 4LCBA 2H7VA 4TYWA 1CTQA 2BC9A 3REGA 1NLYA 1G6HA 2AHOA 3FMIA 1G20E 1Q20A 2R6GA 2A5DA 2OLKA 3TH5A 1QHNA 4D25A 1S9DA 1RJ9A 1Z07A 1F3OA 1UKZA 3RAPR 1KSFX 3U7FB 2WWGA 1E2FA 1W4AA 1G3IA 5K8TA 2XOKA 1E99A 4XJXA 3GJXC 2C96A 4HZIA 1Q1BA 1KI4A 2QM7A 4DLZA 1OSNA 4TLAA 2WICA 2GXSA 4GMDA 2VHUA 4EAQA 4KSBA 4J0QA 1GKIA 1S9HA 4Q1DA 1JALA 2RAPA 3MUFA 5DI9A 4IDPA 5EXTA 2J5XA 3I5YA 4ON9A 3KFVA 2KI5A 1II0A 1E2DA 2ZRLA 1PV4A 4KJZA 1ZNZA 4DLTA 2FU5C 1FL9A 2QZ4A 5JWRA 5AUOB 3THYA 5JSZB 2P5SA 5K8UA 5KSYA 3ZZ0A 2CMKA 2JIZA 3WHKA 2ZTSA 2BBTA 1ZM4A 4Q7JB 1L7VC 3PITA 1VG0B 4MGKR 4OHVA 1W36D 4CT5A 4EJSC 2P65A 1VYTA 4NMMA 2FPMA 4F4IA 1T6NA 4QGFA 4YLGA 5AJZA 1Y3AA 1N6LA 2QP3A 1N6OA 2PL3A 4IHQA 5CYPA 5E4FA 2GILA 3UMSA 1XMIA 4DSOA 4DSNA 1XEXA 2FWRA 3ZQJA 4B3CA 5JWHA 4UQOA 2DFKB 4CEJA 2VTKA 1DBSA 1GKUB 1FP6A 2BMDA 4Q1EA 4DCVA 2CCKA 4AG5A 1GZSA 4TT3A 3DPUA 2QT0A 2BEJA 1N6IA 1HA3A 5HCNA 2GRJA 1N5LA 3ETLA 2QAGB 1KI2A 2JDIA 2CE7A 1JBKA 2BBWA 1KHTA 3SJBA 3W6NA 2FFHA 1JR3D 1EG7A 3IILA 3IIJA 3BAFA 4B2LA 2Z6VA 1PLLA 1N3BA 1I4DD 4QRHA 3IEVA 1N0WA 1FMLA 2WJIA 1E0AA 3CRMA 1ETUA 3R7WA 3GLGE 1LVGA 2GWHA 2ZI9A 4JLOA 3EZ7A 1P75A 1P5ZB 2X8AA 5FUVA 1RC8A 3U7HB 4EPVA 2VLIA 5FR1A 1A2KC 2NZ8A 4XWAA 4KBGA 3RS5A 4PC7A 2J0UB 2QSYA 1AKEA 4MDFA 3W8RA 3UMRA 1DADA 5JS7A 2GA8A 2O8FA 1GRNA 5J4HA 5J4KA 5HR5A 3KQHA 3B82A 3A58B 2BMJA 1HH4A 3GJ5A 1CR2A 2FGJA 4CEHB 4RD1A 1ELOA 2IYRA 2IYSA 3GJ4A 1MOZA 3RABA 1EGAA 3F0TA 4G5OA 4D0LB 1G8HA 1R8SA 1SXJC 1GM5A 1XZPA 4B3GA 2ZAMA 2C95A 3RWMB 3SN6A 1OT3A 1VHTA 1AS2A 4KLNA 5C1BA 4TYPA 1M1YE 3GMTA 4DUGD 4MRPA 4PZLA 1SXJE 2V9PA 5DN6A 5FPTA 1O87A 4HAVA 3I3SR 1G18A 4PQRA 2UVQA 1GDDA 4EPWA 3AUXA 4D26A 1S4QA 4I81A 2X19A 1XXHB 2V54A 3EC1A 4AKEA 3NBFA 1J8YF 3ZIAD 1F2TB 2FJUA 2ZUDA 1W0JD 3MLEA 4W5WA 3GLHE 1WCV1 1FP7A 3NBYC 1H8ED 4L9SA 1GL6A 1P60A 5ANRB 1D9ZA 1NY5A 4TMVA 4QGGA 2J7PD 3I8XA 4B2PA 5AUPB 2HF9A 1ZUHA 2IXGA 4KYUA 3H84A 1COWA 4XD7A 1D2NA 2ZQ5A 4CEIB 3AVUA 4XTCS 1SHKA 1DAMA 4JL8A 4RD4A 5G41A 3UG6A 3TQCA 4LPSA 2F1IA 5FPSA 4JVSB 4Q03A 3NHAA 1X8KA 4OK5A 4A36A 1FTNA 4KO8A 3C16C 5TMPA 3IHWA 1RZ3A 4LJYA 1TEXA 3C8UA 1XRJA 1K5DA 3LBIA 2B6HA 2CVHA 1XEWX 1U98A 4GPTA 1ZNXA 1SVLA 4TMWA 1UBFA 3T35A 5KNBA 3QENA 4JLJA 3QXCA 2O52A 5JI3E 1BOFA 4P33A 2QTFA 1UDXA 3ND8A 1KDOA 1Q1EA 1OE0A 2FFBA 1JQJC 3W5JA 2O8CB 3PCRB 3BERA 2LCFA 5IRCD 4C30A 2WAXA 4PHFA 1Z6GA 1L8QA 2DFTA 3PG5A 1XMVA 2GJKA 3AKDA 3NKVA 4QOSA 5EJEA 3AVVA 1U90A 4IFBA 3PIRA 2PEZA 1JR6A 1G3MA 4G3XA 1Q0UA 3HYTA 1G8PA 4NE2A 3T1QA 3E5HA 2TMKA 4HEJA 4DRZA 4DB2A 3SOPA 3GEHA 4DIEA 4C2TA 1S8FA 3THWB 1E9AA 2ZS7A 2FNAA 3QKUA 2YNMA 2GEDA 5SZKB 3QKRA 5FTNA 3NC1C 2ANBA 4MKFA 4N0DA 3IQWA 1KI1A 1GNQA 2FZ4A 2GJ8A 1OIWA 2RGBA 3K8YA 1JAHA 2R6DA 4XOIA 1CF4A 3NG1A 4NP6A 2Z83A 1XDBA 3W3ZB 4DIDA 3IKJA 2NO0A 1R0XA 4QL3A 4Q4HB 5DSZA 1VCNA 1IXZA 3GD7A 4JLVA 1D5CA 4B76A 4UNPA 4ZV4A 621PA 4WVFA 5DYGA 3PR1A 4OI1A 3RS0A 1J90A 2YV5A 2ZR7A 1NBME 2V8OA 2EFDB 3K0FB 3P27A 1AM4D 4L15A 4LPKA 1G7CA 4DDTA 4UNQA 2V7QA 1P2SA 2EFEB 1QBKC 3WNCA 5JLJA 2R44A 3PEYA 1BKDR 2CL7X 3K09C 1B0UA 3OF5A 4B43A 4EJSA 4BLTA 2FGKA 2ZANA 4ERNA 4FMCB 3ZS8A 2D62A 1GOTA 1TF5A 2J3EA 4JZKA 1KK1A 1FX0A 3AVTA 2OAQ1 4JLKA 4LZZA 4H1UA 4F91B 3OEHA 3TSWA 2W58A 1IN8A 3WP1B 3AGQA 4I1OA 4M0LA 2JIZD 1R7RA 1VECA 2ZI7A 4PZZA 1IN4A 4KFSA 5E7IA 2O8BB 3PEWA 2ZXUA 3A4NA 4HB2A 3AVYA 4M1TA 5A5GA 5JJKA 1CP2A 2NPFA 2ZJ5A 1Q44A 3KXLA 4OQNA 1KDPA 4Z51A 3A1TA 1NN0A 1JEEA 4PZYA 4TSFA 3VR3A 2VH5R 1ZIPA 4AKIA 4TT3D 3TAUA 3C5HA 5JZVA 1SGWA 2FSIA 5BYKA 4FMCF 3CZPA 1G5RA 4TMKA 2R62A 4B3DA 3PENA 4Y0AA 2W0SA 2EU8A 2JDID 4A0GA 2CHGA 4A1FA 1MO5A 1P4SA 4BFWA 5KHOC 3BWDD 1R0WA 5L3QA 2ZRAA 3T12A 4ZIRB 3FHTA 3QKSA 3KB2A 4Q9LA 1RRGA 3KFXA 1ZNYA 2CJWA 2J0VA 4DWJA 3UPUA 3CNNA 1OFUX 2EFHB 1DAEA 2VQSA 3TGPA 4NCKA 4IXMA 3DZ8A 5JEDA 2HT1A 1G3QA 1SXJA 2H92A 1IXSB 1RYHA 3MJHA 2CL6X 3LO5A 1IHUA 4A8JB 1C9KA 1CKEA 3I5XA 4A0RA 2XTMA 4OKSA 4O25A 1E79A 2GCOA 4HDCA 5TARA 4TZ6A 4WZBE 1KDRA 1XXHE 1G7RA 1KMHB 3K9LA 2V6JA 5GVRA 5DISB 2FSHA 2AXPA 4NYMQ 3OAAD 1SVKA 5FOTA 1FUKA 3U5ZB 3R9WA 3I1FA 1CEEA 3SS8A 1WRBA 3TRFA 2YOGA 5BN5A 3OHMA 1T91A 4M1OA 1XD9A 5KYKA 1W7AA 3E70C 5CIQA 1LF5A 2C2HA 3SE0A 1OPXA 3A4LA 2R65A 1RRFA 4G5RA 3K9HA 4I4LA 2ZM5A 1J2JA 2O8FB 1YZNA 2O0KA 4NCJA 4V03A 4FWTA 4QHYA 1TTTA 4IDOA 4OHWA 5SZJA 4HB3A 1CJMA 5DN6D 1UDWA 1GRRA 2ZETA 3NTUA 2JA1A 2G3YA 3UATA 1NMZA 2DWOA 1HYQA 2GEVA 1EFHA 2RGXA 2XNSA 4MITA 4M22A 2LWIA 3EAQA 3GLIA 3IIMA 4LV5B 1M7BA 2QTVB 1NKSA 2JLVA 2IYTA 1P6XA 2ZE6A 4Q9HA 1CR1A 3OE7A 1ZM2A 3WRXC 3H86A 4C0SA 3QOFA 5GJBA 3FB4A 1QZXA 3L0OA 3SC3A 2OUKA 4ZO4A 4XD7D 1COWD 4BRWA 1RRPA 1E2KA 2IYWA 3K0EA 5FOVA 4NYMR 2W2VA 4Q7KA 2X2FA 1XPRA 4X8OA 4DT1B 4IOKA 4TQAA 3MRSA 3SQWA 2ORIA 4M53A 5J40A 4EPTA 3OIVA 5FPYA 5FOSA 2CBZA 2GJAA 3ZVLA 2XNDA 4RFSA 2ATVA 4US1R 2ORWA 2YWGA 3BRWD 5H8WA 3SYNA 1ZUIA 1YKSA 3H0KA 3Q7PA 1M8PA 1QHIA 1D8TA 2PZEA 4HLDA 4HZUA 5FBRB 2AFIE 1T8TA 3VR2A 2ASEA 4LYJA 1TQ4A 1NVWQ 1UEIA 2ZJAA 4DDVA 3QI2A 4IW3B 4M1WA 4RZ2A 4UXIA 2VSXA 2NZJA 2A3RA 4HB0A 2OESA 1NBMA 1R0YA 4YQFA 4BASA 1EX7A 5KPJA 2DB3A 1IXRC 3SFZA 4D80A 5FL3A 4QNRA 1KI3A 1KTVA 1U0LA 2AK3A 5SZIA 1OIXA 1ZM3A 4PSAA 4AYXA 1ZU4A 2YC2C 2F3RA 1Q57A 2DPXA 4FI3C 3SYLA 2NG1A 1KNQA 1B23P 4Y0VA 1G17A 4AD8A 1IONA 3A36A 3VHXA 3ICQB 2A2ZA 4ZCLA 2IXEA 3QY0A 1DG3A 5HCIA 1G4UR 1Z0FA 2WJVA 2QBYB 3THXA 4JSYA 2QMOA 3BORA 3QBTA 1KK3A 4FIDA 4WZAE 4IDHA 3VKHA 2IHBA 4JMPA 3DMNA 4R98A 1MABA 2O8DA 1ONBA 3JVUA 4RVCA 4DLVA 3PXGA 3LLUA 1TL7C 2G88A 4LV6A 3WRYC 3ADCA 1TUEA 2ZRFA 1KI6B 4CF7A 1US8A 2V7QD 2RGAA 3PQCA 3K70B 521PA 4RY2A 2IX3A 2PX3A 5F9HA 2F43B 3CB4A 2UKDA 1JXMA 4A2PA 3AKEA 4A0FA 2C9YA 4I1UA 2QI9C 4UJ3A 4BPBA 1AN0A 4QM6A 1SULA 3O8BA 1E9FA 3EIHA 3K0CC 3MWJA 1IN7A 1OH5A 2OG2A 2C8VA 1SVWA 4DSTA 2IEZA 4OI0A 2XB4A 2CLSA 4MUBA 1F48A 5EXXA 3ADDA 2CLCX 1WF3A 3Q8XB 4FXPA 4CDGA 1I2MA 2EFCB 1OXUA 3KXKA 4TMTA 4TTPA 1WXQA 4LBYA 4RD6A 3BH0A 1FX0B 3LBHA 4JLDA 1OYWA 2OCPA 5EE5B 5FH9A 3WMGA 4Q1AA 1GSIA 2GVDC 1HQYE 5EXPA 2I3BA 4JBYA 4G5GA 1Q1ZA 2FFQA 4LBVA 2ZE7A 3P4XA 4TSFD 2C5LA 1VIAA 5KDLA 1L2TA 3MJRA 4MGZR 5L3SB 2EWWA 5CDFA 4TN1A 5E7JA 2RH5A 5JHGB 2RGGA 4F4CA 1NVUQ 3FVQA 2G9NA 4GMXA 3LY5A 3DDCA 3FHOA 4UNNA 2VHQA 1D9XA 4BQSA 4Z1MA 1XD2B 2WJYA 1E0KA 1N6NA 3CPHA 3IGFA 4NZYA 1FQJA 5GVSA 1U94A 3RDPA 2PT5A 1KKLA 1DAFA 4JLNA 3TVDA 2DWPA 1G7SA 1E6CA 1R5BA 2WSMA 1HT1E 3T15A 1R0ZA 3ASYA 821PA 1A1VA 1Z0AA 5FBQB 2WWYA 3QJYA 2AK2A 1EXMA 1G9XA 2FZLA 5CJPA 4MUAA 4X8HA 1I4TD 4RCYA 4V0LA 3B1WA 5G53C 3MFYA 1ANKA 5K8LA 4ESVA 1E79D 1E2NA 3KJIA 1DELA 3MMPA 3MCAA 4D81A 4JVMA 5LBIA 3MGCA 4KSCA 4P4UA 3U4QB 1QHXA 2ONJA 1CS4C 4LHYA 4MRVA 3ZQ6A 2R8RA 2BM1A 2QQ0A 4IDNA 4DHEA 1NVVQ 3DO6A 4AC9A 4HAWA 3SEAA 3Q9LA 4IVQA 2BKUA 3KKQA 2ZYVX 3THOA 3W90A 4C0LA 6Q21A 2NO1A 2GEUA 1Z63A 2KSQA 3IEUA 1CLUA 1W47A 4PPFA 4URWR 1MO6A 1KJYA 4GSYA 4AWXA 5BXQC 3B60A 3HU1A 5JCZA 1O3YA 2X77A 3H1TA 4O3MA 1Z6XA 3W6OA 4MGYR 4P32A 4AI6A 3P26A 1HEIA 4I1SA 2VP9A 3X1DA 3U44B 4I99A 4D4MA 1XB2A 3CH4B 1LS6A 3ECCA 3G0HA 4OHYA 2KBEA 4LSGA 1ZP6A 3WNDA 2GDJA 3AVXA 2W6IA 3PJRA 2FOLA 2XJ9A 4C7OB 5BW8A 3R8CA 4R9UC 2JJ2A 5FL7D 2XXAA 5HE9A 1AQYA 1OXSC 3RS7A 2QRNA 4B3XA 2H8KA 3J81k 1DG1G 2BJWA 2DCUA 4NH0A 1CRPA 3VU9A 2EFGA 2WSSA 4Q4JA 5EP2A 3RSLA 4U7DA 3TIFA 2N42A 4A92A 2CXXA 4BFSA 3V4RA 1CXZA 4PC2A 4JIMA 1YQTA 2C99A 3GFPA 1NJGA 1J7KA 5FFMA 1NVVR 1FNMA 3AF0A 2AWNA 4JBXA 3CONA 2Z4RA 1N0UA 4OQMA 1W2HA 2I4IA 3QF4B 5C2JB 2QGZA 1TQ6A 2MSCB 4BGDA 5BN4A 2ZSEA 4PAOA 2GXUA 2F6RA 3RLFA 4Q1FA 3TW8B 1AZSC 2E87A 1TU4A 1VCMA 2EVWX 3EZ9A 4WW0A 1GP2A 2FN4A 1KIMA 1TEVA 2ZIAA 3UANA 1J99A 1KKMA 3L0SA 1T5LA 1S3SA 4D6PA 5DGXA 4EQ6A 1FPMA 4MKHA 3L43A 5DHFA 5FUWA 4L4UA 4NCIA 1IJEA 1FFHA 4V0NA 1TPZA 3KKOA 2VP6A 1Q3HA 2WJGA 4BFYA 1EFCA 3EZFA 4WBSA 2D2FA 3QPUA 3U60B 2BCJQ 2ZS8A 4DDWA 2Z5FA 1J70A 1Z29A 3KJEA 5LD2B 1KY2A 2N46A 3KQUA 2F9LA 2ZSAA 3RRMA 1WBDA 2JCSA 1QHHA 3T06B 3AF2A 2CHQA 4HZUB 3SFVA 2BJVA 3U3JA 1PZNA 4IEIA 5J4YA 4TZ0A 2QY9A 4OJKA 2E9SA 1M6NA 2HCBA 3DVLA 2W00A 3O47A 4LJ5A 4NKRA 4PR0A 3ZVNA 1YHNA 3GLFB 1II8B 3QPVA 4M2LA 5L3VA 1T8UA 1TADA 1W36B 2C03A 5AUNB 4JKYA 1MO4A 1OHHA 3PUWA 4MA4A 1R4AA 3VTKA 1XJQA 1SVIA 2QM8A 5CYOA 2NOAA 1CJKC 5AR1A 8OHMA 2NMVA 2VHTA 3B1YA 4S35A 1TNDA 3ZZTA 4FCTA 2OXCA 1HURA 4HUQA 2AD5A 2DWQA 3K0CA 1KI7A 4DB4A 2ODEA 4GNKA 1ZCAA 4EFMA 4ZCMA 1CULC 1JI0A 3I72A 4NU0A 3KQKA 1JQLB 5CM8B 1E9RA 4N3NA 3CR8A 1R6BX 3EA5A 4NDZA 2YWFA 3QKTA 5FTJA 3RANA 1YR6A 4GRAA 1IBRA 1E1RA 1SVOA 2O0JA 1P9NA 4LDJA 1MABB 1KSJA 1PVOA 3QIAA 4LUCA 3OESA 4K81B 2OILA 1KY3A 4CYMA 1H8HD 2PJRA 1Z2AA 4ASUA 4QNMA 5SZHB 1T3SA 2KBFA 4BZQA 3GJ3A 2CDNA 2Q9BA 2IF2A 3AP1A 4DZZA 4TYNA 5J4LA 2Q3MA 4MH0R 4URUR 2YWEA 4BFTA 3U61B 1W2GA 2NO6A 5AJYA 3TK1A 1OF1A 3CWQA 4PPGA 2DY1A 1W5SA 4URVR 2HJVA 3AF1A 2JLQA 3MD0A 5IF9A 3DMDA 4DEYA 1VYVA 3TSZA 3BE4A 3ZLJA 4XTRA 4JLAA 3QQ5A 1Z2CA 4R2HA 4Q7LA 2RMKA 4E09A 3WYFA 4Q47A 2V3CC 3DOEA 4PHTA 4KAXA 2XAUA 1Z06A 2YWHA 4M4SA 1OB5A 4JLMA 5DO9A 3TNFA 3N70A 4LV8B 4K8OA 3A1VA 1E3MA 1E9BA 3T5GA 1X8LA 5EZ6B 3EPJA 1VPLA 1KOFA 2CHVA 2ZSDA 2O8EA 4TL9A 1EFRA 2XGJA 4WIAA 4JYBA 4GDFA 4Z1MD 5HE8A 4IXNA 1QF9A 1JXOA 4V0OA 4M9QA 1S0UA 2JGNA 2QE7A 4W5HA 1G64A 4V0ME 2OO7A 4LOAA 3RRNA 3FMPB 2ZSFA 3TUIC 4PTLA 2OBLA 4QHSA 4D0GA 5FBWB 4HUTA 1EFTA 2JLUA 3S1AA 3RRZA 4WAUA 5J5CA 3VHLB 1QRAA 1Z0IA 1Z0KA 3LNCA 4JT2A 5CK5A 2Q3HA 3Q85A 5TDHA 3O8RA 2NPIA 1C1YA 2JJ1A 3LXRA 5F3WB 2ZUCA 2GBLC 2GJ9A 4LHXA 1W48A 5B58C 4ARZA 3TUZC 4X8LA 3AVWA 2W2TA 2I1QA 2ECKA 2W6JA 2YOFA 2P2LA 3ADKA 3LW7A 5EE9A 3ZYCA 3BC1A 2VEDA 3U7GA 3BH7A 1E0JA 3CKLA 4NHOA 3QVVA 1S96A 4BECA 2FPLA 1Z22A 4P31A 1VHLA 2WHXA 4PC3A 1G16A 1GL7A 4JJZA 2GESA 2XB2A 4DLXA 2F1JA 4G5SA 2D06A 1UKEA 1E2JA 1TF2A 3QBVA 4HB4A 1E9CA 3B8HA 5LPNA 1R5NA 4LHVA 5B64A 4TMZA 4EDHA 1JECA 1VDZA 3VNVA 3IIKA 1OXXK 4YC7A 3A1SA 1KAGA 1J8MF 3PEUA 2AWOA 2AX4A 3EZ2A 5C4MA 4C0HA 3LFUA 5P21A 1F6BA 1KK2A 1A2BA 1R2QA 2QGNA 4KVAA 4C4PA 1XNJA 1VKJA 1P9WA 2FH5B 3RSOA 3OIWA 3RRYA 4E22A 5B2ZA 5JJLA 4JLBA 4QJ3A 2J7KA 4CGZA 4CW7A 2JJ2D 3PFIA 4HLUC 4A2WA 4EPXA 1OLOA 2H57A 2WSSD 2RB4A 1XX6A 4POAA 3B1XA 3I73A 1W46A 3DM5A 2AD1A 1E2GA 1E2IA 4PPNA 4RD2A 2J59A 1JPNA 4QC2A 4AURA 3FWYA 3R9XA 2IYXA 3EWAA 4JVNA 1L4UA 2BCGY 3ICEA 2JLRA 2XOKD 4B2IA 1AIPA 1N5IA 2IS1A 3C7KA 3B5JA 4GP6A 3BH6A 4A4DA 3M4YA 2IWHA 3ZJYA 2IK8A 2QN6A 5FBVB 4U00A 2QSZA 2PBRA 2IA5A 3M1IA 3KZ1E 3BB4A 2V6IA 4H9GA 1UADA 3CX6A 1F2UA 1KI9A 1IOZA 1UKYA 3BS4A 1RJ9B 1E4VA 1ZM9A 2QAGC 3CZQA 3IUYA 4M1KA 3TR0A 2ZRBA 3K0AA 3GLFE 3CM0A 3ZVMA 3CX7A 4XWKA 4GOKA 2QMEA 2OBMA 4PSVA 4PHHA 5JRJA 4PSKA 3G5UA 4URXR 2GCPA 3CRVA 1F5NA 2FEOA 5EP1A 1WMSA 1UM8A 3EC2A 2MSEB 4LYHA 4AIIA 2QEQA 4M8NE 2QT1A 2ZRDA 3ZD7A 4UKDA 2R6FA 5D3MA 2OM2A 5EE3A 3KTAA 3WYGA 3GLGA 4LWZA 2BOVA 2CCGA 4KYIB 4OQLA 2VYFA 2J45A 1GNPA 1HV8A 2WKPA 4UNRA 2A5YB 2WKRA 5JI2E 1UBGA 2HV8A 1HTWA 1YVDA 3UXMA 3WBKA 2FDCA 2XSZA 1ZYUA 4C2UA 3THYB 2CVFA 4DJTA 4F38A 1JR3E 3E1SA 5L8VA 1X1SA 3C14C 1A5TA 1WA5A 2ZJ2A 4ZPXA 3GP8A 1OHHD 1HUQA 1FMJA 1KK0A 5M04A 5EQTA 3AVQA 3CF2A 3F8TA 3K1JA 2C77A 5JMTA 4KHZA 4F93B 2IYQA 1BS1A 1ESNA 1WBBA 2R6CA 5EP3A 1XEXB 4Q4AA 4LYAA 5J47A 2G6BA 4L16A 3V9PA 4B73A 4CEJB 1Q22A 2WKQA 4IVPA 1UF9A 2QPOA 4U5XA 3KKNA 4B44A 1U0JA 1Z08A 3JZMA 4EIWA 4KU4A 3BK7A 1ZW6A 3B1VA 3EA0A 2REOA 3U2QA 1SKQA 4LJAA 3AVOA 1KNXA 4II7A 4PHGA 3BIFA 3UG7A 4B3FX 1NG1A 1P61B 4B33A 1LFDB 2IYZA 1P7CA 2Z0MA 3R7WB 3KL4A 2ODWA 1AA9A 5GJCA 3AP3A 1DO2A 1GFIA 1X6VA 3ASZA 3GLHA 2DHRA 3H4MA 5DIFA 2RHDA 4PPQA 2ZI4A 4HSEA 2OAP1 3QEOA 5LB4A 2YYZA 3VKWA 1G291 2FSGA 3B85A 3PUYA 2IS2A 2K5UA 1HE1C 1U8ZA 1ZM7A 1R5OA 1XTJA 2WJHA 3PVSA 4BLOA 4Q01A 1OH8A 5LB2A 5TY0A 2P67A 3AM1A 5HKKA 2F1HA 1UJ2A 2ONKA 2ZSBA 1XCMA 2V55B 4BLRA 2V1UA 2ORVA 2WZQA 3EPHA 1N6PA 2ZI3A 3EIQA 4ZI3A 1DAGA 2AKAB 3N2IA 4BZPA 1X8JA 4OBEA 3I8SA 2P3SA 5E7MA 4CRWB 5AWFC 4D82A 2A5GA 5C4GB 1S1MA 4BUJA 4LHWA 3MWLA 3FMOB 3HDTA 2GBLA 2FEMA 2IYLD 1Q21A 3OFNA 1EFRD 2G77B 3CBQA 4B3BA 4RKEA 4AKGA 4I1VA 3FKQA 1JB1A 1RIFA 2QE7D 1G5PA 1NMYA 2IXFA 2E1RA 1HT2E 3L8ZA 2GK6A 5KTYA 2EW1A 3ONWA 2KJQA 1DARA 4KXFB 2QUZA 5EXSA 1NRJB 4EPRA 2C9OA 1TQ2A 1CBUA 3N2EA 3RC8A 2JJ1D 1W0KA 4LYFA 2GZDA 1BH2A 4OI4A 4P4SA 2CLDX 3BFKA 5FOXA 3SI7A 2ZYTX 5IT5A 2W6JD 3EG5A 3HYRA 1E94E 4PFSA 3KKPA 1S3GA 2ZRPA 3A1WA 1LTQA 2VP0A 3TQFA 1VYUA 2ZU6A 4O2RA 5IDVA 5LDDC 1E98A 1ZD1A 4TLEA 3TSOA 1L4YA 5FPHA 3OZXA 3RVBA 4LK2A 3AP2A 4KI0A 1U99A 2PLFA 3AEZA 1MT0A 4HLUA 1N6HA 5JSZA 2PJZA 1YZGA 1JAIA 4PC1A 5AK0A 4ARZB 4ZDIA 1KO1A 1W4BA 4LJ4A 5JEEA 4XVQA 1N0VC 3EASA 3QXHA 2ZVQX 1II9A 2XEXA 2J9RA 3EIEA 4OHZA 3IBGA 1W5TA 2P6NA 4TWZA 1P72A 2ZS9A 421PA 1XPUA 1Q3TA 2FG5A 2YZ2A 1GITA 2BKEA 4Q4LA 2YC4C 1RRCA 2DFNA 1KJZA 4IJMA 4GI7A 2ZE5A 3FKSA 4QJ5A 4NTZA 5CIWA 3B9QA 1SQ5A 4DEXA 3BD9A 4G01B 3V4FA 4KODA 1UEJA 1AJEA 2QAGA 2OHFA 3X2SA 5IK2A 4DVGA 1G6OA 4KFUA 3QKRB 1KO4A 3L0IB 4JL6A 1DAKA 3B78A 4JS0A 1V5WA 4YMTA 2WMNB 3EPKA 2CNWA 1Y63A 3IO5A 4FMDB 1FUUA 3U7EB 3OIUA 4G5QA 3RWOA 2GF9A 1EESA 4FMBB 5FTMA 4YMVA 1DO0A 2VP2A 2XZLA 5F9FA 2F1RA 1Z0JA 1JR3A 2J0UA 5C18A 4EUNA 4HAZA 2YINC 1TX4B 3GEIA 2JLYA 2GCNA 4CT4B 1AS0A 1RE0A 3UKDA 5UKDA 4IFEA 4Q48A 1D2EA 2IYYA 3GPLA 3EZ6A 5H70A 2ZJOA 3OEHD 3B6EA 3SBDA 4CEHA 4A15A 4D4KA 1ZBDA 4B75A 1E4YA 4FD2A 5CJ2A 4EJSB 4DSUA 1LV7A 3FDIA 3SHWA 3U6BA 2IW3A 1OJLA 5HZHA 3QEJA 1OXTA 1CIPA 2HJGA 2YJTD 5G3ZA 4M1SA 5AJWA 4A8JC 3AV0B 4C0KA 4TL7A 2J1LA 2YHSA 4EPYA 5JHHB 4Q02A 3A8TA 3MG9A 2QAJA 2JATA 3NHBA 3FE2A 3EXAA 2IBMA 1HY3A 4B6FA 1E69A 1XPOA 2XSZD 1W49A 2W2XA 3W8NA 2KB0A 1NNEA 4FMDF 4PAQA 1R10A 3BXZA 5EZ5A 4WOPA 4MRSA 1VTKA 1TUIA 4B35A 3W5IA 2Z4SA 5KSPA 5JECA 2ZYWX 1XXHA 1ZINA 1Z8FA 2EYUA 3LW8A 2JLXA 1F2TA 3MWKA 1GL9B 4PAMA 4OK6A 3D3QA 3PV0A 4HAUA 1KZ7B 1UFQA 3SQXA 3X1ZA 1P62B 1W4CA 2A9KA 2GZHA 1YZTA 2J41A 3JVVA 4OQXA 1U0HC 3VNUA 1DOAA 2P6UA 1XTKA 4CEIA 1TAGA 2R9VA 4MYTA 3AB3A 4BFZA 2QROA 4LJ8A 2FMXA 2HCJB 1G3RA 1I4LD 4V0KA 2W0MA 1SXJD 4BFVA 1YR9A 4R7ZA 2XX3A 3GJ7A 1OKKA 4NCHA 3DKVA 1H8EA 2HF8A 1IAQA 1KI8A 2Q0HA 3O8CA 2ZVPX 3LA6A 5L3QB 1D6JA 2PMKA 2ZEJA 3KDSE 3QKSB 5F2EA 3TBKA 4CZ2A 4L5BA 2LKDA 4WA7A 2CJWB 4GFDA 1ZRHA 3CNLA 3FTQA 2V1XA 5E3HA 2O8CA 1SXJB 3VX3A 3VKGA 2AFHE 3EPLA 3Q5DA 5FI1B 1ZC4A 3U6KA 3E2IA 5JS8A 1JJVA 4B74A 5DH9A 5FR2A 5KU1A 1NIJA 4E07A 2GCOB 2PMDA 3CF0A 1T0JB 3A6PC 1P2UA 3C4JA 4AY2A 3C5CA 3NDPA 4O2LA 5HKKD 1N2CE 3KB1A 3NBXX 3IHLA 1VG9B 4P4TA 5FUXA 5FOWA 1GTVA 2IHYA 3WYAA 4Q19A 1GWNA 2VRWA 1MV5A 4S2EA 2B7CA 2QQEA 3LRPA 1ZD8A 2VL7A 1NN1A 3B9PA 4ZDKA 2G0TA 2D4HA 3KQLA 2P6RA 2QMHA 3KQNA 2KE5A 2VA8A 4XSHA 5AJXA 3WHLA 4C0AC 4TL6A 3CF6R 1S1CA 3D8BA 4Q5IA 3OE7D 3OFND 2P5TB 1YZLA 2R6AA 5KNCA 1P2TA 3NDBB 5BWMA 1XMJA 3NH9A 4Q4HA 1Z47A 2YVUA 5H1YA 1FW6A 3RS4A 2C98A 1NJFA 3BFVA 2JJ8A 3HU3A 4AKHA 5HPYB 2NO9A 1QHYA 3QXXA 4BE7B 4D4JA 2VO1A 2J0SA 1YRBA 1DPFA 5DI3A 4G1UC 3GLIB 3SJZA 4C0JA 2X1VA 2RHMA 4MGIR 2W83A 1SKYB 4NPHA 1U2RA 1YR8A 4C0BA 1W0KD 1E2LA 2XNDD 4R2IA 3ND9A 1KJWA 1UBEA 3SZRA 2PEYA 4LY6A 1G19A 3WMFA 3M0EA 2RGCA 1T4GA 4PX9A 3VR6A 1TMKA 4GOJA 1G5TA 3DHWC 3T34A 2PZFA 2R2AA 3LVRE 121PA 2C04A 3CRRA 2VP4A 3IDQA 1U9IC 4ZKDA 1E2QA 1M2OB 2ZR0A 1XU4A 3DZDA 2GZAA 3NH6A 4NYJQ 4RFSB 4XIGS 4P4SB 5GADl 1NL3A 2EYQA 1RFLA 1AKYA 1T9HA 1OIVA 2JLZA 1NBMD 1XF9A 3K70C 2D7DA 3F5FA 4YMSA 2O8BA 4IOJA 4RKFA 1XTSA 4LI0A 5TV2A 2CEAA 1NI3A 4G0NA 2OXRA 5KNDA 2WVJA 4N0EA 2NGRA 1LF0A 4QBFA 1G41A 3SU8A 4NBSA 4RZXA 1XP8A 3I92A 4B32A 3P1JA 1X86B 3AF3A 3FKSD 3NXSA 3L0PA 3CLVA 3TKLA 1LNZA 1TQDA 2DBYA 3OEEA 4MQBA 2BMFA 2GJSA 5GJVC 1AS3A 3GJ0A 1X1RA 1X3SA 1DE0A 2BVNA 2LKCA 3QE0A 4PO1A 4TTQA 3HP1A 3OIYA 4XH9B 5CB6A 2OEPA 2ZRNA 3CH5A 4TYQA 1CU1A 1YJ5A 5IK2D 2H1LA 4DLRA 1VCOA 4ZIRA 2X2EA 4DCSA 4GZMA 4W9MC 3RNLA 1QG4A 1E2HA 2PCJA 4W7SA 3CO5A 3QPWA 1YZQA 1NLFA 4FCVA 2CNWD 3TMKA 4LBWA 4XVUA 2ZAOA 5TXGA 4H1VA 2AKYA 3THXB 1K6MA 1PUIA 1YR7A 3L8YA 4NYJR 4GT1A 1SZPA 3I62A 4A8JA 2HXYA 2MSDB 3NVAA 2O8DB 4MYCA 2MMGA 2J46A 4DDUA 1IM2A 2XZOA 5FBLB 2J0QA 5JWOA 3UK6A 1WQ1R 3O8DA 2MMCA 2DYKA 3CPEA 1K5GA 1KMHA 2WOOA 4GBMA 1N5JA 2H5EA 4LJ6A 5JRZA 3QF7A 2VPPA 1ESMA 3GFOA 1US8B 1KO8A 2D2EA 2PH1A 3D31A 4LBZA 4Q9JA 5FI0B 2JLSA 2A30A 3SR0A 1PUJA 2G0NA 4GZLA 2OFXA 2QG6A 3BFXA 2BBSA 4M9SA 1G8FA 2BMEA 2BM0A 1G4AE 3UMFA 4FINA 1FZQA 3MAAC 5EE1A 3AH8A 4HLCA 3GJ6A 4DLSA 2BIFA 4PO9A 2ZJ8A 3OAAA 3HU2A 4ZDJA 2QORA 1Z5ZA 4LGMA 2B92A 4FCWA 2A78A 2ZRGA 2BDTA 1PJRA 4EFNA 1P73A 2XTNA 2VSFA 2OCBA 4RJLA 5BN3A 3A37A 3CNOA 3L82B 3Q5EA 1PLJA 1XEWY 1OW3B 4RD3A 1EWQA 3VFDA 3FYHA 4QXAA 2GNOA 1E32A 4TTRA 3BOSA 3NEJA 3U3RA 4PQFA 3SDZA 4EKDA 1Z3IX 2YKGA 2VF8A 4PC6A 3DM9B 4FWIB 2WBLC 4MDEA 2FA9A 1ZAKA 3A1UA 2JEOA 4Q18A 4DT1A 3GEEA 3NWJA 1OKKD 4MKGA 3RC3A 2PX0A 3IO3A 1QG2A 1UAAA 2O5VA 1MH1A 2VIIA 1U8AA 1T3LA 4CIDA 4OHXA 1QHGA 2C78A 2IF0A 2OFOA 2GHIA 4QBGB 5BYJA 2QL6A 4MYHA 4UNSA 4US0R 1E9SA 3T5DA 2DR3A 3FMFA 3D7MA 3IPYA 2VP5A 4C9BA 4DCNA 5J4VA 4PANA 2HYDA 1OXVA 3QSYA 4QJ4A 2ATXA 4GL2A 1OH6A 3REFA 1MR3F 1RKBA 1P9RA 2JASA 2ZE8A 3TLXA 1N6RA 1KZGB 1WGWA 3LBNA 4M9ZA 4LC1A 2GAOA 1G8YA 4HAXA 3SHFA 3ZD6A 4BWYA 1CJVC 3GLIE 1P2VA 1YU9A 2ZRJA 4Q66C 4YXWA 3RS2A 3SJAA 5B30A 3KX2A 2HLDA 4JT4A 2FE4A 3BGWA 2VHCA 1ZU5A 1SKYE 2G1KA 1R8QA 4W5JA 1CR4A 4JBWA 4AK9A 4ILEA 2WV9A 1RPZA 4ZDWA 2IYVA 2W6ID 1EX6A 4PO8A 5EP4A 1M74A 3R9IA 3PUXA 3W3AA 1ZVQA 5KPDA 4QHTA 1T0HB 1U8YA 5A4JA 2FX3A 2OBNA 3GCGA 5BQ5A 1FOEB 1W44A 4BRUA 1E9EA 3T1TA 2QBYA 4NYIQ 1JEDA 5LD2C 4TL8A 4IDQA 4JKIA 1PLKA 3CUEF 1E2MA 1WB9A 2IT1A 4QKQA 1U9IA 2WJJA 1VIYA 2HT6A 4HYYA 4LJ9A 2IWRA 4ACAA 4TLBA 2WMOB 4M9XA 2QP9X 1VG8A 3LXXA 4L8GA 4IKEA 4GP7A 2IL1A 2XXAB 1M34E 2NIPA 4WXRA 1OFHA 2D3WA 1Q1QA 1KI6A 2GXAA 3VU9B 1ZIOA 3WNBA 4PQYA 4JSTA 4XSGA 1A82A 2EWVA 4Q4JB 1W36C 1DAHA 4Q1CA 4ZKEA 2F43A 1BMFA 2NQ2C 2B8WA 1Z0DA 4UJ5A 3LD9A 1OFIA 2WPDA 4EFLA 2IUTA 4DC9A 1GUAA 2G83A 3PUZA 5DE3A 4OK3A 4IOLA 1KSHA 5DI3B 3PEVA 4E5UA 1NP6A 2P0EA 2IUUA 1JPJA 3WXMA 1T3HA 2HEIA 4F92B 1GNRA 4B34A 4D0NA 4Q7MB 2J87A 2JLWA 2BWJA 4UXHA 2HUPA 3IPXA 5D3QA 3TW4A 2ERXA 1Q12A 3FFAA 4ABYA 2RGNC 4JYCA 3AQ4A 1KGDA 1MKYA 2NO7A 3TJZA 4NYIR 1G7TA 2QMUA 4EQ6B 3JZAA 4BLPA 1GILA 1XTRA 3AUYA 2PLRA 3FOZA 1NY6A 5FPKA 1XTQA 2H17A 3R20A 3TUJC 1XTIA 4KFTA 4WZ6A 3UWOA 2AL7A 2WTUA 5ELXA 3W9YA 1SHZA 3FFBA 4DKXA 5L3SA 3OEED 3AF4A 3Q3JB 4Q9IA 4BLQA 2WWXA 4QG7A 3Q7QA 4LRWA 5DHAA 1OYYA 1QHHB 1IN5A 2ZRMA 3AGPA 3FGNA 1DVRA 4MRRA 1XD2A 1JNYA 3SNHA 4QM7A 2ANCA 1XJCA 2Q6TA 2BBOA 4LHZA 3VR4A 2PZGA 4ITRC 4BEJA 1LS1A 2WWHA 1BO6A 2C9CA 4QBIA 3C41J 2EQBA 5CLLA 1YE8A 3X1YA 5C46F 5KSZA 3R8FA 4F4JA 4QBHA 1Z6YA 3WY9A 3CX8A 2WAYA 1H65A 1FNNA 3QG1A 1E1RD 1GKYA 2OCAA 1Z6AA 3VR1A 4HUQB 3H2YA 2VHJA 3U3OA 5JFGA 2WIBA 4BLSA 4XWOA 3RYTC 4A2QA 2ZRKA 1Z28A 3U4QA 3QVUA 3TVTA 3NEYA 3CPJB 4ASUD 2Z43A 5JJIA 1MRSA 4DCUA 4X8MA 1NN3A 2WWWA 1M7GA 1GIAA 4KFRA
chains in the Genus database with same CATH superfamily
3DD5A 3O4FA 4MP6A 3UN1A 2Q9CA 1JEJA 2KWIA 4Y9DA 5LMZA 4OLHA 221PA 3EAFA 1K7XB 1VJ1A 1JB9A 2ZUBA 1E3QA 3WO1A 4GMHA 1FMVA 1O4WA 5H5JA 3KVOA 3Q3HA 1SCBA 3HYSA 3BEDA 1QE3A 3IP7A 2OV2A 2C4HA 3DNFA 4QSMA 3V5YA 2W6NA 4KVGA 1C0PA 1VI5A 2XKKA 5IANA 1QE0A 1A76A 5EHIA 2D5RB 1NN5A 4YCBA 3G5TA 4H1HA 1U2SA 1V1RA 5JQGB 4EFKA 2PUWA 3VUEA 2X3UA 4F7WA 2H9IA 3V8PA 1IY1A 1ZNWA 5KREA 2HXSA 4Z54A 2CN1A 5G3YA 2C54A 3S29A 3B9RA 3NVDA 3CW2A 3EXHC 4PYNA 3HY3A 3PPXA 1IQRA 1VJRA 2XZDA 4C0QC 1GPUA 3QPDA 3VX4A 4NONA 2HWYA 4F4DA 3ZZ1A 3NRJA 5CB4F 4YMWA 1AZTA 3T1OA 1CETA 3T61A 5IUNC 3LV8A 4F9GA 2AXEA 4R32A 4IH9A 5KCMA 1M75A 3UFXB 4KDCA 2RAFA 2I76A 2OCYC 2CVPA 3ABIA 2O0HA 1J56A 1GPH1 1KEZA 4I19A 3R9XB 3P32A 2QF7A 4EUFA 1U3DA 4J6FA 1IEVA 2FKAA 4A6DA 1EUCA 2TS1A 5HKLA 4YJ2A 3KJGA 3KC2A 5EXDA 1BFDA 1TRHA 1YSCA 3FPAA 5KDOA 2XLDA 5ICSA 1F7UA 1MDBA 4LZAA 2OKCA 1DS6A 3WTBA 4BQEA 2YN4A 1AK2A 4RSGA 1KEWA 2UZIR 1TMGE 2AI3A 3AKYA 4H6XA 2B3DA 1TTHA 4M0CA 2C7PA 4DPLA 1PQPA 4FEAA 3LVQE 2PBLA 3OCWA 4QPCA 5FQNA 2QSJA 3OTOB 4U2CA 4IWYA 2J7PA 3PUJA 1N7IA 1YIDA 1YBAA 2QRQA 1E2EA 2E2WA 1EGMB 2Y8EA 1XL0A 4FGLA 4OQFA 5BWBA 2FZCA 2PRSA 3UFBA 3W6UA 1DP4A 3PIDA 3F1LA 5ESXA 4TMXA 5KX5A 3K1ZA 4C3ZA 4J7TA 1UXJA 4Q9NA 1H6BA 1E3DA 3SC2A 1W1IA 2Y0PA 1G3UA 3JD1A 3H2KA 4G8CA 3U09A 3LAWA 1QAMA 4F5EA 1PWHA 4JTCB 2D59A 3FTFA 2J4CA 1O94C 4LCBA 4MB2A 4KMMA 2V7EA 1G20E 3ANNA 3AYXB 3L8IA 4QD3A 2J9FA 3CE9A 3GJXC 1OSNA 1RI5A 3B6ZA 1NPDA 5DI9A 4P0QB 1DC6A 2C3YA 1II0A 4DV0B 1PV4A 2OHGA 1VIDA 3ZZ0A 3UPTA 4OHVA 1UFOA 4MVSA 1OCOC 1JYFA 1GSHA 2P7IA 3DBHA 2C0QA 1Y3AA 3HQ4O 4QPNA 1N6OA 2PL3A 5E4FA 2J5RA 4H3VA 2CCKA 4AG5A 4TT3A 3IHUA 3ITNA 3OCZA 2QAGB 3FUVA 2BBWA 2HJSA 2YBDA 3M5DA 3PNKA 4BN0A 3GH3A 1LVGA 1XTPA 4MLDA 1SWWA 3O1JC 3GPDG 4FGJA 3E7PA 1AKEA 3F90A 3MUNA 4UARA 3AR6A 3UT6A 3L1KA 2AN3A 1Z2EA 2JHGA 5D7BA 4CR7A 4OSPA 2H7YA 5GV7A 2IYSA 1C41A 5CBPA 4NBVA 4MX8A 2ZYDA 2C95A 1C8BA 1VHTA 1SXJE 3WZLA 5FPTA 3P8ZA 4LXXA 1G18A 1GDDA 5J2TA 4PAGA 4TV8F 5IWAB 3QVSA 3WYEA 1J0AA 3IMKA 1A71A 3NR2A 2PKXA 3GLHE 1BA2A 1D0IA 1DOHA 3CF4G 4PF1A 5AUPB 3EULA 2IXGA 3RVLA 3AVUA 4CEIB 3D59A 5KJEA 4RD4A 3I9V6 3EDQA 1U2EA 3BCHA 3HKBB 2CVHA 1XEWX 3R75A 2NP7A 4FDTA 2Y1EA 3PCRB 5IRCD 2G8NA 1UCFA 3GJQA 4CM9A 3RUEA 1GGKA 2GN0A 3M1CB 3BXHA 5DNDA 2HZ7A 1UJBA 3EQ2A 4W1RA 1BEZA 4ZA2A 1FFSA 4Z9BA 3GWLA 3HABA 1XHEA 4L5IA 1R0XA 4RTQA 1VCNA 1BBHA 1WSAA 3SPXA 2ZYGA 1KOLA 3OOJA 5HIMA 5LJLA 4LPKA 5EKDA 4MV8A 1P2SA 1ACJA 2HFJA 5JLJA 3GDHA 3OEHA 4ZOAA 2P1DA 2PRJA 1R7RA 1T15A 4DR1B 3QKWA 4LGVA 1THZA 1HLFA 3NMJA 3LQ4A 5EZYA 4OQNA 1NN0A 4PX3A 3AB8A 1T4DA 2GHRA 3GLSA 3UUWA 4RE6A 2GD0A 3H6KA 3C2QA 5KHOC 4L95C 1L4GA 3FHTA 4PICA 3LGXA 2HS5A 2UZ1B 3CNNA 3INRA 2J9WA 3TGPA 1G3QA 4CDVA 3AZOA 3MQ2A 1JU4A 4GM1A 2JH8A 3POVA 2G1UA 4A0RA 2JFNA 1G4HA 1T6YA 4L7QA 3X0DA 3UXHA 2BF4A 2SKDA 4CIXA 1DRUA 2CUZA 3WODF 1NF9A 5FOTA 4F5DA 3ILVA 5HQ3B 4ALIA 3VYTB 1LPBB 3U5SA 4L78A 1V11A 2R65A 1RRFA 4DJFC 4NCJA 2YV4A 4OHWA 5ES3A 4BMOB 1WB6A 4QGBA 4RJIA 1HNWB 4UOQA 3EQ6A 2LWIA 4GLJA 4B3SB 3DR3A 4A3SA 1K8QA 5GJBA 1D2RA 2BT4A 1Y7IA 5T6MA 5JH7B 2WIGA 1RXYA 4QUAA 5CLIA 3EUAA 4DXWA 4WECA 4JJIA 1QQAA 3NORA 4QEDA 5IVDA 2YIDA 3NWOA 2Q8PA 3F7TA 3PNVA 1AGYA 4KRXA 3HSSA 1PWEA 3FB1A 3G5LA 2P2NA 2C2ZA 1MMAA 2WUVA 1TAQA 2NXCA 2FN9A 1N3YA 3O3MB 3A36A 5B6PA 2ATIA 4CQMB 5TQ0A 2BC5A 3IAS1 2WJVA 3PFBA 4QARA 4KMRA 1MC5A 2P6OA 3DZJA 1LRKA 1OAOC 4CF7A 2F43B 2FPPA 2UKDA 1XDSA 4I1UA 1QONA 1JE1A 3ICOA 2QRMA 1F6DA 1RYDA 3BSFA 5DOVA 4NI5A 5FUQA 2WP0A 4O5OA 1ECPA 3PT5A 2C29D 1N75A 4MUBA 1F48A 3HCEA 3UM9A 3W77A 1I2MA 3AF6A 5CH5A 3LBHA 3ADPA 4IMPA 4JLDA 3IERA 3GT4A 1B2RA 3PR2B 3DXFA 3NIDB 1B3RA 1UBRS 4DMFA 1OCZC 2GLXA 3VC1A 5L3SB 5HZGA 3R0ZA 3VOBA 2VDWA 3AKZA 1A7DA 4ZRMA 3WMWA 1SCJA 4OHUA 3AFHA 5KTMA 1P2DA 3NB0A 1U94A 5A04A 2DAPA 3GY0A 2P9BA 4XWJA 3IA7A 2OORA 5KYYA 3EOZA 4PYRA 2VCYA 4E51A 3TLGB 3KR2A 2RJOA 1AQNA 4NNOA 2XUQA 1CS4C 3INNA 5IN5A 4DHEA 2OCKA 3S6JA 1R5ID 3BXXA 3Q9LA 4LY3A 1BWSA 4OGWA 1BW9B 1O3YA 1SURA 3H1TA 4MGYR 1O1YA 4PWZA 1Z33A 4GM0A 3CH4B 4E33A 2GDJA 1UJCA 5BRJA 5B3AA 5G4KB 4QZVA 2V4MA 1ISIA 2LP4A 4A92A 4RK0A 1CXZA 1YHZA 2OGUA 4JIMA 1TUBA 1DFGA 2R7QA 1Y4SA 2QUBA 1H4VB 3F6RA 4JXXA 4CI9A 4AT1A 2FW8A 1TEVA 2OHVA 4ECAA 4EQ6A 3M1AA 4MVJH 1K2VN 1YI0A 2NZXA 1CUJA 1JHQA 3DBLA 3KKOA 5BSEA 1NVEA 3QPUA 3VC2A 3WG7C 2Z5FA 3FF4A 4F6RA 4H7DA 3GUCA 3OKFA 1T1GA 4IEIA 1JIKA 5DVWA 2E9SA 1V2HE 2IBFA 5B3KA 3A7EA 4P58A 3TOMA 4L4ZA 4B3RB 1OFGA 1ZOOA 4CMBA 2YHUA 3LP8A 3PEFA 4JXZA 1CULC 2VAXA 4MHSA 1QDLB 4MK4A 3VPHA 4CWAA 4XGQA 3RKRA 1Q0PA 1KY3A 4X20B 3ABOB 5FXMA 3HY4A 1UIRA 3MCUA 3HN6A 1QSGA 3NTVA 3SYMA 2RI0A 5EJ8A 5HRUA 3RTGA 2XGMA 3AWIA 4FWBA 3RFYA 3G2LA 1MTZA 4GYJA 1OB5A 1CUGA 3WLPA 1KOFA 3DL4A 1QF9A 4BLUA 4KE7A 4M9QA 1XMPA 3GCXA 4D0GA 3M1YA 2W8ZA 2AR0A 3T9EA 1KVUA 3Q85A 4X1IA 5KB3A 3WLKX 1QQTA 4RKWA 4EHDA 4KOAA 1VJTA 3KXDA 1K97A 4II3A 1VHLA 1QGUA 3EGIA 1G20A 1UKEA 4ZAFA 4BX0A 4ANJA 4LHVA 4TMZA 4YJKA 1KH1A 4BB5A 1EJ2A 3OIWA 2Y05A 5ITZA 4QJ3A 3MJ4A 1XU7A 3A9CA 2WSSD 2BSQA 1DEHA 3H19A 3L92A 2GYVA 1H2XA 4LVNA 4LVUA 3L7JA 4L73A 2JLRA 1P31A 2XOKD 1X2EA 3ZNPA 4GP6A 3F71A 1OV6A 3GRFA 1ZUNA 1UADA 3EXHB 2XMSA 5AOCA 3CZQA 1H94A 5AI4A 3EAGA 3G5UA 3DJYA 4CG1A 5EP1A 1WMSA 4A1OA 5L95A 3V7YA 1YH3A 2HJRA 5CUQA 3ABSB 1W96A 1E3JA 3UCEA 1EFAA 1O5TA 3AJ8A 3DMFA 4KYIB 4IHJF 5JI2E 4HGQA 2XSZA 1VHJA 1YNSA 5KWVA 3CLUC 2JIBA 3M5WA 2PIAA 3II6X 3E2PA 1WTYA 3AVQA 3VGJA 2PLNA 4LYAA 3MLGA 4NZOA 3JATA 1DLJA 4ZOLB 1EKXA 3KZVA 4MVUA 4LJAA 3UG7A 4KN6A 2VZEA 4HVLA 1EEHA 5EESA 3GLHA 1FYFA 5I7HA 5DIFA 3MRXA 1ONPA 2Q1YA 1QIEA 1CRLA 4BLOA 2CDBA 1QCDA 1BE6A 2B4KA 1DAGA 3GDWA 5DT9A 5IAAA 2VAMA 2B0JA 2H4JA 3IAUA 3MGBA 2BRUA 2WYIA 4Z9YA 2DI3A 3E4CA 4RQTA 4RKEA 3MHTA 3DMTC 3S2SA 4E0HA 3H5TA 3GNQA 2D8AA 2GK6A 2GA9A 2NSDA 1VKNA 4LF8B 3SFTA 1JT9A 4QDJA 3ZGNA 4P4SA 1QO0A 3DJUB 1FTWA 3QFFA 2ZU6A 4OXIA 2PBZA 3R6GA 5IDVA 4MZXA 1C30A 4TKUA 1Y1KE 1U99A 3M81A 1DMRA 3VR0A 1X7ZA 1JAIA 1PNRA 3GANA 2CNKA 3H2UA 1C8VB 3WI7A 3H0EA 4YCLA 421PA 1G66A 5A5VA 2DFNA 2Z57A 3AOGA 4PONA 1UODA 1X1DA 2XBUA 2MJLA 2JAUA 1V5WA 2OBFA 1TA4A 3IO5A 5CPFA 4HDNB 4F3CA 3OTIA 5JVDB 3LJKA 3P9SA 2A1DD 4RLFA 1Z73A 4P6VF 3QHPA 1C3EA 4N0PA 2Y1DA 4WNYA 1RE0A 4MMXB 5BV8A 2HFKA 4ZCTA 1CUWA 3U6BA 4PS0A 1CIPA 1JTEA 4TL7A 3E35A 4EW2A 1HY3A 1QUFA 3DBVO 4MJ7A 4FMDF 3WL3A 3Q7LA 1RXVA 1D2CA 3BSSA 1S01A 5C5IA 5AKGA 3NMUF 2VHVA 3LCRA 2YIMA 3M79A 2YASA 2RB5A 4Q3DA 2FMXA 4V0KA 3LCVB 1OKKA 2IDZA 4YRAA 5F1YA 3QKSB 4H54A 2Q3EA 1MT3A 2Q5JA 2PHZA 4JUAA 3A32A 3TOZA 1EWTA 3E2IA 5A2QA 3OX1A 1LKXA 4OD0A 2HAEA 3DGFC 1YRQA 3CCCA 4S2EA 1L7EA 3LRPA 3SKVA 1DQRA 3X2QC 2G0TA 2P6RA 2QMHA 2KE5A 1SD2A 4QQKA 1N8TA 1Z4IA 2I8AA 3AXTA 3GLIB 4C0BA 3D4LA 3A3YA 1M54A 1G19A 3WMFA 3M0EA 1F9AA 1RPNA 3IDQA 4F0JA 3K1TA 1EVZA 3K6RA 1I5OA 2I6GA 2K6GA 3X1MA 4CFYA 4C43A 1NFNA 2I66A 2GO1A 4PRKA 4G1FA 2R6HA 1UFVA 4RVFA 4MV5A 3NXSA 3TKLA 4MVJM 3AW9A 1FQOA 4DLRA 2C2WA 1FSZA 1HE5A 1F8FA 3CO5A 4ISBA 1A5BB 4D8VA 4BC0A 2QT9A 3QW1A 4UZSA 4B3MB 2VJMB 1G5IA 1SKBA 1XAIA 2W2QA 5HKOA 1K5GA 1KMHA 3CYFA 1N5JA 5ALDA 3FLEA 2EPMX 2C8LA 3BWBA 4UMVA 2G0NA 2QG6A 1ZR4A 3X43A 1G8FA 1ZW3A 5EJ7A 3OZSA 1RJDA 2BI4A 4WHMA 4MV7A 5EIXA 5HFNA 1PJSA 2GX6A 4LSZA 3X2EA 4D57A 2XTNA 2O59A 5A3JA 3L5OA 3Q5EA 1USUA 2IEDA 1FC0A 1IZZA 2C3OA 4KO3S 1E32A 4ZO8A 3PD1A 3U3RA 1NQ5A 1LPNA 2J08A 3QYJA 2JK1A 3SSOA 3GEEA 2V0CA 3DE0X 4NTBA 3EH1A 4TZKA 3M82A 4CIDA 1YZAA 3ZX5A 2QW8A 4Y18A 2HYDA 4AQYB 1QYVA 3V5NA 1JDNA 3ZV7A 4CM1A 1OWLA 2P62A 1ECBA 1JR2A 4LCEA 2V7XA 1TKAA 1LSJA 2QRPA 3HJAA 3S5UA 1H6GA 1M74A 1WXXA 1PFYA 4QHTA 4KREA 3CHYA 4NS1A 3QU9A 3ZBUA 1E2MA 1D1TA 1A4XA 1XCBA 3RODA 2AB0A 5DM70 2PJDA 4ACAA 4NHEA 4IKEA 5HQJA 2V4UA 4S04A 3WNBA 2ZIEA 4Q1CA 4BRSA 3J7TA 3GVIA 2WPDA 3KDAA 1XVLA 4OBBA 3PUZA 3V7FA 2HEIA 1VBNA 1Q95A 1QH8A 2JLWA 3QPBA 4RV4A 3BJZA 4LFAB 2D0OB 2I7CA 2ID8A 1M8KA 4I3GA 1OC2A 1EA5A 1GILA 2PLRA 4ILKA 4RF2A 2H17A 2JFZA 2DKFA 4Q9IA 2C97A 2D0IA 5CXXA 1P9LA 4QM7A 2VEOA 1T6ZA 2BBOA 5JO0A 1CUUA 2B98A 2BFBA 4J2OA 5KJ1A 4BVHA 1ZYRF 4FI3F 1GKYA 4LACB 2POQX 5FA5A 3U3OA 3BIOA 2ZIXB 4RHYA 1O58A 2H5IA 3ROTA 5AVKA 3U3MA 2JAQA 2HJHA 2GI4A 2Z6AA 3VV3A 1XZFA 4JVLA 4MYUA 1A98A 1WE2A 5AK3A 1FRFS 4B48A 3DLTA 4MHOA 1JVNA 2W98A 3KV1A 5A1TA 2Q9AA 3AESA 1T0PA 1Z82A 5MHTA 4TUYB 4AWAA 1YDEA 4HDOB 2ZIWB 2HCTA 5EQJB 1V45E 2WJ4A 3FCAA 4HATA 3RR2A 3W8EA 5L7YA 3HH8A 2REBA 3FAJA 4MTOA 1MQVA 1FTYA 2WJZB 1BXKA 1XROA 4JA2A 2H31A 3HJNA 1RCUA 5ALYA 1UQRA 3WYNA 4Q1BA 3BJIC 3FOAA 3PICA 1KPHA 1P91A 2A6HF 3SF8A 3I4LA 3B6JA 1NLZA 1JL3A 5EGNA 3A4MA 1A9RA 1GUZA 1KZYC 3MUOA 3IB3A 2ATEA 4XUEA 4G67A 3E15A 3VHQA 4HI0E 2X8JA 2XNCA 1V7ZA 3GJTA 4OGLA 3LKZA 1XE3A 5KYWA 4FAPB 1XZIA 3ZDQA 3FW1A 5DTJA 1LDMA 2GETA 2E48A 3ZZUA 1V43A 3EVCA 5CITA 4YP7A 4J8PA 4IYRA 1SU8A 2DT5A 3KB6A 2A1TS 3CEMA 3STYA 1ZOSA 4HMQA 2PT7A 4BZZA 5KYNA 1E5TA 3G82C 3NBZC 3L18A 1UQUA 1RTTA 5BQXA 4XZ3A 3ILSA 3WLSA 1Z0UA 4UPVA 5AUQA 5TE9A 3QG5A 1F0PA 1W19A 2R4TA 4NLLA 5EE0A 3V5ZA 1URPA 1NZFA 2H2HA 1UUFA 4IEEA 5AXBA 4HNUA 2OEXA 2VJYA 3ZWYA 1V16A 3KVYA 3QUAA 4J1TC 1AC5A 3VSBA 1XKLA 3E9YA 4NENB 5DBGA 2XNHA 1UMBB 1JSZA 1C7QA 5TJHA 2GYUA 1N2OA 3DV0A 3FCSB 1DKRA 3UMJA 1TMOA 3NW9A 5EKXA 3G2PA 4AUEA 3VDRA 4OF4A 2YMPA 4WESA 2D5CA 4CV2A 4FNOA 2REXB 4K9RA 1Z83A 5M2QA 3NGMA 2Y1FA 4GPBA 5G2OA 4RDHA 3I5PA 5D86A 2WDZA 1BWRA 1NHGA 3FMIA 5K8JB 2R6GA 4HTFA 3LUFA 1AO0A 1VSBA 1UKZA 5EI5A 1XLTA 4HZIA 2WICA 2DC1A 4P3KA 1KDYA 4O8ZA 3FMVA 2WZCA 1CVLA 4IF4A 1GR1A 1ZNZA 2XCIA 3NYLA 4YV2A 3CGWA 1ZM4A 4JURI 4HYTA 5I8WA 1W75A 1H4TA 2OXIA 4NU8X 3QMMA 1J5XA 4KZPA 1GZUA 3LS0A 3V8NA 3MTIA 4AU1A 1PLLA 4QRHA 4DV1B 3LT5A 2VSNA 4LMAA 3I9MA 2Z1NA 4IQGA 2JG3A 3WGVA 1IVNA 1VE6A 2AEMA 4PLWA 3GGPA 3LP6A 5J4KA 1VL8A 4ZZ1A 3W9BA 2DGJA 2QW1A 4KDEA 2J6BA 2FPWA 3LHIA 2I3AA 3G0IA 5BV0A 1FJHA 4PQRA 1S4QA 3RFUA 3AGUA 1MQ9A 2V54A 3ZIAD 5JCXA 1NMEA 1SUEA 3NBYC 1CY1A 4DIMA 3IIIA 5LLDA 2W8BA 2AZ4A 1YOVA 3SZ3A 3OQ6A 1D2NA 4XARA 2F1IA 4WCVA 3VNAA 1BX0A 4YNBA 4GNRA 1TEXA 2B6HA 3ZDXB 2R7WA 4RPGA 2XT9A 2J9UA 3KTOA 3VMMA 3PKIA 3VPAA 1IB6A 5CLFA 5I6DA 1WPRA 1VFPA 1BDBA 4U5FE 1IULA 1ATIA 4PRZA 2Q00A 1G8PA 1A5ZA 5ECWA 2TMKA 5TR9A 3DJNB 2PKQP 4O4JB 2OBXA 3GARA 5DBEX 1TKNA 2L19A 3VJRA 2I7TA 1L4EA 4UQLA 4DIDA 4RTKA 3GD7A 1A7AA 10MHA 3PUIA 1TYCA 5EUBA 4ZYYA 3PS9A 4OU5A 3UMVA 4PY2A 2D1FA 3TRIA 4O1IA 1BKDR 4FIZA 1FPQA 2ABWA 2GH1A 3EFEA 3GT3A 1Q0LA 1OGIA 7MDHA 3C8MA 2ZXUA 1FRZA 1OILA 2HWXA 2YWDA 4NFSA 1S05A 3KP1A 1Q44A 1QMGA 4U6QA 1KJ9A 5K0BA 3N6XA 1CE8B 3DAOA 4ZQEA 3BTOA 3R3VA 1G5RA 4FMCF 4Y0AA 3M6MD 3JQCA 5AHWA 4BFWA 3DBOB 4PV7A 1BGXT 2HQ1A 3KB2A 3L0DA 2AG0A 2RHHA 3C3EA 4CV3A 4OP1A 1FZTA 2WHQA 2XRYA 2FPSA 1E6MA 1S3FA 1TZJA 1QLEC 1IG3A 2C58A 2YV3A 3ELUA 4Y6SA 4EW3A 3H5WA 4HPWA 4I50A 2ZXPA 5DISB 2X9NA 4M6WB 4JI7B 1UDAA 4YASA 1JIQA 2NU7B 2ZK7A 4Z9AA 3GRCA 5A7FA 4IDOA 2HA5A 4R2WA 2F8SA 2PYIA 3C8GD 3C3XA 2WD7A 3MJEA 2K7FA 1M7BA 2JLVA 4KBYA 1IN1A 3QOWA 2KW3C 4C0SA 1C4XA 4DCMA 4WKBA 1OMOA 3PNPA 4YRSA 2OBBA 4X8OA 4TQAA 5HSWA 1CUVA 1XWWA 3T7AA 1OUMA 1Q77A 5LQRA 5H8WA 2V3VA 4JELA 1BEEA 2AU5A 1QHIA 1D8TA 2YJ5A 3VR2A 1P7YA 1M0SA 1NVWQ 3NHZA 5CVJA 5K99A 3C7TA 5EVCA 1GHTA 1XHLA 2J0EA 1KTVA 1OIXA 1YDHA 1ZU4A 4RSHA 3D3KA 4ESOA 5ALGA 2Q50A 5CAEA 4MGEA 4UCWA 1AD2A 2QMOA 1MJ5A 4J7UA 3PGKA 2BI7A 4DLVA 1LCIA 5L0HA 2AEJA 4E5NA 4LOJA 2V7QD 3P5SA 1KPIA 2PX3A 3HO8A 1ZXXA 1I7LA 3K4QA 4FLFA 2QI9C 3ASVA 4WBXC 2VF4X 1E9FA 1E3TA 3K0CC 1O5IA 3Q3CA 1ZL0A 3H97A 3OE1A 1C8LA 4FBGA 4A6EA 4DMLA 1QX4A 3EK2A 3V6LA 2JBAA 3SYRA 4W8PA 2EFCB 1N7JA 4TMTA 2O5CA 1FX0B 4DIFA 1YS6A 4JOBA 5AVTA 4JBYA 5DT2A 1FK8A 4TSFD 1XK7A 3EVZA 2BTQA 4ZU1X 3ZDBA 5CA1B 1WP4A 4MYDA 2GNPA 2QN2A 5IYZA 2XRHA 4NZ9A 3R7SA 4GMXA 1XD2B 2J5QA 4MA0A 1PWXA 4EOGA 4LOHA 4AF8A 3T15A 3ASYA 4JJ6A 1Z0AA 3OTWA 4Q39A 4AJPA 1BS9A 2WWTA 3S40A 3U4QB 1LH0A 2OPBA 3ZQ6A 4R2XA 2OCIA 1ICEA 2B36A 2YTZA 5MN5A 3GNLA 5COMA 4YRGA 1G8SA 4TRRA 1FLDA 2W2NA 4TTAA 2W6IA 3IE0A 3JQPA 2EERA 1AQYA 3CEJA 3F5QA 2ETSA 3N2NA 3M3DA 3U56A 4GECA 1H3NA 2Z4RA 4JSRA 4M1ZA 5C2JB 2RARA 5JAPA 3OZGA 1Z39A 1POXA 2GXUA 4OHPA 5IHXA 3TW8B 1HF3A 4EWLA 2OXTA 1YAUO 1CHNA 1QDUA 3D8HA 5IX8A 2M6LA 1EZ1A 5J5VA 2VYNA 1C1HA 2ZS8A 2C7OA 2VWGA 1MX1A 2F9LA 3E81A 1ZHTA 4V3BA 5EIFA 4YPOA 3O74A 2FLVA 3DQPA 3KTDA 3L7KA 3ZD9A 3ABLC 4PR0A 2BFCB 4C4RA 3QV1A 2C03A 3EGOA 4ENQA 2PUJA 2OYSA 2R00A 5CM8B 1E9RA 2ZT5A 1ZK1A 5E9JA 4MS4B 4UASA 3G8YA 2OHIA 4F8JA 3NTQA 4K81B 2OILA 5EY5B 2I7XA 3MN1A 3I6BA 4EENA 1RRVA 4RA6B 4R1TA 2NO6A 2R48A 3PU6A 3TSZA 2J4FA 3IOEA 2GHQA 3T94A 3L93A 2YWHA 3CGGA 2FN3A 2WSBA 1P5HA 3GZ4A 4ZP1A 4KAAA 1SD5A 2I6UA 3BXGA 3L7IA 3KSRA 5CB4A 3SEZA 1UMCA 3HXQA 2HHCA 1DC5A 1MU0A 3NT4A 5CK5A 3I58A 2GJ9A 5BOSB 2WFZA 2CD7A 2IPLA 3KSZO 3WWPA 4CXMA 3QVVA 3E7FA 4UHKA 1P18A 1PD1A 1GCAA 3ZZNA 3MWFA 4K03A 4D92A 3DJFA 4HB4A 1DKNA 1EFDN 5EJ6A 1ZIYA 1NV8A 4EI9A 5L7WA 2JIRA 1M6TA 3PEUA 4M0FA 3KPWA 4C4PA 3B2QA 2OZPA 4CF6A 3SOZA 4A2WA 4YJDA 5CNJA 3UUEA 1A9OA 3QVWA 3MCTA 3QMWA 2Z58A 4NOKA 1W46A 3OPYB 5DN9A 4N5MA 3ZU3A 5HOQA 3A26A 3ABMC 3F6CA 1QB8A 2P9GA 4YAEA 3WGHA 1PR3A 1CY7A 4M1KA 5JRDS 1N5DA 3HNRA 1BD4A 3NRHA 1QH1B 1CC1S 2FEOA 1OROA 5J5AA 3ZD7A 3KTAA 1MMFB 1S7GA 4ARBA 4GYTA 5CP8A 3UXMA 4HDKA 1ZYUA 4UM7A 1O4VA 1KE1A 2Q29A 3HJGA 1OHHD 2X1LA 4YCJA 1KK0A 4AECA 4CF5A 5EMKA 3K1JA 4H27A 2IYQA 4AUMA 4PYKA 4P6IC 4Q4AA 4ZI7B 3KKLA 3DUWA 3KKNA 2R1VA 4RVNA 5GP1A 4KU4A 1ZW6A 4E12A 3ZNQA 5AVWA 4DV7B 4GPD1 5GJCA 3R0XA 3M4CA 1FMCA 3BMCA 1ZKMA 3PUYA 4D0RA 1ZM7A 3GF4A 5LB2A 5TY0A 3AM1A 1GPWB 5F64A 3ZHZA 2ORVA 3J06A 2J0WA 1R12A 4OBEA 2C00A 2GBFA 4YRFA 3WK8A 1TQHA 2A5GA 3HADA 3P0RA 5GZ6A 3GO4A 3FMGA 1RIFA 1TD9A 3N2ZB 2OXEA 4RWEA 4BO9A 4HP8A 5A6BD 1IFXA 2C9OA 1YDFA 2GZDA 2CLDX 2W6JD 3G7NA 2NWQA 1BX3A 4F56A 2EPLX 1M5RA 3NJ4A 1DT3A 2XUHA 4IWBA 4GGOA 4C22A 1QJ4A 4C1NA 4ARZB 1GUDA 4OP2A 3DWWA 4X6XA 2II6A 1JFFA 2Q49A 1IH8A 3NASA 4G1CA 1NM5A 2JFPA 3TRHA 3TLCA 4KODA 1ZH8A 3FZQA 2OFFA 1A9XA 4OP3A 3L0IB 1Y63A 1CPRA 3ZW9A 2EF0A 2CV0A 2YQZA 4TV8A 3OIGA 1JR3A 4H08A 3RKOF 4YRRA 1PL7A 3IA2A 4I55B 3AFGA 4Q48A 1D2EA 5E9AA 3B6EA 3HYCA 4HQ6A 1MDFA 3SBDA 1ZBDA 1U7PA 2O2HA 5KYXB 3GM2A 4GX0A 1PQWA 4EY6A 4XVCA 1K3TA 4PQGA 5LXTB 2ADMA 3SE7A 3TSYA 4QAQA 1Z8FA 3I52A 2JLXA 1F2TA 3WK7A 4UMFA 2NAPA 3FZGA 4WH0A 3H16A 5B36A 1U7ZA 2YJ3A 3DEZA 3TG8A 1AF7A 1Q0KA 1ZONA 2AW3A 1XVTA 3KDSE 1GAWA 2PUEA 2OO5A 3IP8A 2CJWB 4GFDA 4J0DA 3I6IA 1ZDMA 4MW8A 2H0RA 4XM2A 3U6KA 4FS8A 4KC9A 2OGWA 3MGGA 4FOLA 3CF0A 3C4JA 5HKKD 4MV0A 1WCIB 3IEMA 5BO5A 5IDWA 1X15A 1NN1A 2IKSA 2VA8A 4F3RA 2F3SA 4RIFA 1Z47A 4NNPA 2LE0A 2NO9A 4RY0A 4LRUA 1J22A 4P54A 4QI2A 5B1IA 3N0XA 4L8FA 4EL0A 4MRMB 1GTRA 4N18A 2A9RA 3ND9A 2Z98A 1RADA 1ODJA 1DKPA 3AHGA 3SXPA 1BQEA 3H5LA 1IL0A 1U8EA 1R0LA 3JZ0A 2PH3A 3NH6A 4H77A 3BQNB 1OIVA 1H23A 1Z18A 1ILEA 3PQDA 4B32A 4JYPA 3C3JA 2JD0A 4D9HA 1TQDA 3SIRA 2QL7A 1JRAA 1QIGA 1W8DA 2QR2A 4TYQA 5LMCA 3DB2A 4RQAA 4KW7A 4MUMA 1T2NA 1T5TA 2FWNA 4ZVLA 3CTPA 3UC5A 3DLPX 2VDJA 5AVSA 1A3CA 3SD7A 3O8DA 2WOOA 2H5EA 4DM3A 3EZIA 4MAFA 3LVBA 3FIJA 4MR8A 2VDRB 3MAAC 4IP0A 3A7DA 2GZ2A 3EHDA 4YAOA 3DZBA 3AZPA 4EYGA 1DQNA 5DPMA 4EFNA 2VK1A 5F1PA 3DO5A 2JNWA 1WSDA 3KOYA 2OUIA 4PQFA 1X42A 2HRQA 2WBLC 5JYDA 5LFAA 2YRFA 2BLNA 3RC3A 4UREA 1V3QE 1MH1A 2VIIA 4TX1A 3WIOA 2OFOA 2UDPA 1E5XA 3DPSA 4R8SA 1YRHA 4RD9A 5J4VA 3OX3A 3CBGA 1N6RA 3N9IA 1XN4A 1PW7A 5F2OA 2FW6A 1MENA 5CX1B 2P78A 4W5JA 3HB4X 3Q7SA 4ZDWA 2YZNA 2DPLA 4B4KA 1ZXLA 2OBNA 1DRKA 2YQYA 1C7JA 2Y1GA 1YKGA 4ZPJA 3JAWB 2J09A 5AK4A 2WJJA 4FSHA 4AJ1A 4C21A 1V1MA 5JJCA 2Q9UA 2GXAA 4XSGA 1QGZA 4CNQA 1U3UA 4KK4A 2IKQA 2G83A 4IOLA 1KSHA 3FDQA 2BFFA 4OXRA 5AKXA 3A6EA 5J2UB 4URFA 2VSQA 5KIAA 2R8BA 4BLPA 3NO4A 1XZGA 3VVBA 3R20A 3ITDA 3HNIA 4N39A 3AF4A 1E62A 3HO6A 4I36A 1IN5A 3UKOA 3I37X 3R24A 4QPDA 3RRXA 2G36A 3SNHA 2Y69C 2PZGA 2E5FA 4GOLD 4ULWA 2EQBA 1Z4NA 4F4JA 4QBHA 2WAYA 4BJHB 2FR8A 3D8NA 2AGVA 2BMVA 4MLCA 2FE1A 5JU6A 2ZRKA 2DFDA 1H9CA 3TVTA 4YL1A 4RELA 5C51B 1KJQA 3PIIA 5FLYA 4L51A 3ZNNA 3WGOA 2GXQA 3GI1A 2R6JA 3C1TA 2ZR9A 3A1FA 1N7GA 4TKVA 3F3YA 3RS3A 1NV9A 4D2IA 1RWBA 2RGEA 4J7AA 4XVRA 4UOEA 4RABA 2VBCA 3TWOA 1S2MA 3AB7A 4AP5A 2FZVA 3EQ7A 4XEKA 3DD1A 4YMUA 4FHEA 3K9NA 5K2MA 2BHSA 3LI2A 4GBJA 3D5QA 1NKTA 1VMEA 3NJ8A 1PR0A 1X39A 1NSFA 1BXZA 3NLLA 3FOCA 3F6BX 4EDFA 4ZRDA 2PAAA 2ZI5A 1VL0A 3PWZA 3F7MA 3PYLA 4LOIA 4Z0HO 1ZG3A 5BT9A 5AT1A 4Q9KA 5CT8A 4YDSA 3C1UA 4J75A 2PMCA 5IUJC 1ZHXA 4IIJF 4DCOA 2XMCA 4YB8A 1E7SA 3ELYA 1H85A 2BW0A 1Z26A 5JSUA 4MKIA 2GAJA 2HTFA 2P3LA 3H0CA 3CRW1 1XAGA 3HCFA 4RNDB 2RGNA 1YQ9A 2Q4TA 5K8IA 3KSMA 2IUEA 4JJKA 3TIIA 2RD9A 4UAJA 1GPKA 1QPBA 3LY8A 2KGOA 2L0XA 3K0AB 1VOTA 3N8HA 3LLMA 3BIXA 3PE6A 5KWEA 4UDOA 4JYAB 1G21E 5D6NA 5EIBC 1T2FA 2I65A 3GA0A 3E0QA 2C92A 2LFDA 2H4XA 1V96A 4M1MA 2ENUA 4ZVSA 1WF6A 2E4UA 4L6AA 2RKOA 1XLVA 1OV4A 2GKSA 4TQUS 1GFSA 4WGFA 1USIA 5IUKC 1VKZA 4O08A 2O2XA 4JU8A 3L1UA 1Z13A 3UXEA 7REQA 1EZZA 4JP3A 4RCVA 1RNLA 5KAPA 4WNAA 4MCIA 1KDTA 4US2R 4YV0A 4WXHA 4LVCA 5E3CA 4M8LA 5AIBA 4Q00A 5JYBA 3HBLA 1ADFA 3FOOA 4JQOA 5B57C 5BWNA 1FRNA 4IHJA 4RCZA 4A9AA 3ZGXA 1YYXA 4TYWA 2HC9A 1G6HA 1UKAA 3S0XA 2D6FA 1W6UA 3IV6A 1DBWA 4PZCA 3QV2A 1KC3A 3G0DA 4Q1DA 3LM8A 2V58A 2QVLA 3PNQA 3DC7A 3KYIA 1LE2A 3T5AA 4URHA 1ISPA 4JC5A 4HWKA 3GRUA 4FKZA 4AAYA 4F4IA 1EWYA 2PSFA 1WKBA 4FKBA 4AP6A 4CL2A 4EM6A 1HLGA 2CE7A 4CLOA 2P90A 4E4RA 2WAAA 2VWPA 2HFIA 3KQVA 1FMLA 1LBTA 1P5ZB 3QJGA 4XWAA 1CEYA 1QRSA 4C04A 3HUUA 5J4HA 1QOPB 3WGZA 4CIAA 4AFNA 4OQQA 2GPBA 3GGSA 1ELOA 1LPSA 3LQ2A 4F4HA 5IF3A 1A8UA 3ZU5A 2Z8ZA 1JEQB 3Q2IA 1NQOA 3CWCA 3TTUA 3ZU4A 3UGOA 1O87A 1DWPA 5AVVA 1Z5UA 4H18A 1M83A 5DEIA 3AY0A 2X19A 2C4TA 5DGIA 5DLYA 4MQ6A 4B2PA 2WVNA 1C03A 4RY9A 1JKJB 4BBZA 1ADCA 1SHKA 3F78A 1FTNA 4LJYA 4ABTA 3P9CA 1U98A 2J3QA 4BQPA 3QENA 1NI4B 4D6YA 4DCJA 1LK7A 5ISMA 2O8CB 1IWOA 1I10A