1J8YF

Signal recognition particle conserved gtpase domain from a. ambivalens t112a mutant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
295
structure length
291
Chain Sequence
LLDNLRDTVRKFLTGSSSYDKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIERREWFIKIVYDELSNLFGGDKEPKVIPDKIPYVIMLVGVQGTTAGKLAYFYKKKGFKVGLVGADVYRPAALEQLQQLGQQIGVPVYGEPGEKDVVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEEAALLEEMKNIYEAIKPDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELEVFNPRRFVARLHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL RECOGNITION 54 KDA PROTEIN
publication title The crystal structure of the conserved GTPase of SRP54 from the archaeon Acidianus ambivalens and its comparison with related structures suggests a model for the SRP-SRP receptor complex.
pubmed doi rcsb
source organism Acidianus ambivalens
molecule tags Signaling protein
total genus 99
structure length 291
sequence length 295
ec nomenclature
pdb deposition date 2001-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1j8yF01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j8yF02
5BN3A 4HLQB 1YKSA 1HE1C 4V0MA 1XP8A 4CYMA 4DKXA 1E1RA 3K0FB 3GJ4A 1T91A 1RJ9A 2PZEA 3DDCA 3ZIAA 2AKAB 1Z2CA 3BB3A 2OFXA 4PC1A 1GDDA 1KJWA 4ESHA 4OQFA 1DAEA 2H18A 4IXMA 5LDDC 3LLUA 2P0EA 1S4QA 3AF0A 4KVGA 2LKDA 1U90A 4Q1AA 4TMWA 4TL8A 4F92B 4IEEA 3LWNA 2CVFA 4DCSA 2BC9A 3F5FA 2WSMA 4G1UC 3WNBA 2RGEA 1KHTA 1MV5A 2A9KA 3QEJA 1P73A 4Q9LA 3K0SA 1QRAA 1EFRA 2V54A 4Q9JA 1OW3B 1GL9B 2IUSA 4BASA 3LXRA 1YHNA 4PQFA 2WAYA 3D7MA 1FX0A 1ESNA 4DDUA 4DSOA 4V0NA 1NG9A 1IM2A 3ZS9A 1E9AA 4Q48A 1NG1A 4M8NE 2Z43A 2XGJA 3QQ5A 2W6IA 4DUGA 1UBEA 4TQ9A 1N0UA 2V7QD 3SFZA 1NBMD 3AF2A 2TMKA 1GP2A 2IEZA 3EA5A 3Q7QA 4M9SA 3EPLA 4RKFA 1Z83A 2WM9B 3OEEA 3MWJA 3GLHB 4M21A 1OFIA 1Z0DA 2OV2A 2HT1A 2GF9A 1G3RA 2H17A 5CLLA 4TQUS 5BN4A 3QE0A 4EFNA 1DE0A 3Q5EA 4X8LA 1F5NA 1L2TA 1SHKA 3TIFA 1XD2B 2ZE7A 4Q4AA 3SYNA 1WBDA 1GIAA 5GJWC 2V4ZA 3AKCA 4CRWB 1I2MA 3RHFA 3B60A 4YXWD 5FI1B 1OH5A 1EFUA 2PCJA 3U3JA 2O52A 2IS2A 4Z1MA 1T8UA 2XAUA 5C46F 3TW4A 3BB4A 2QT1A 6Q21A 2QA5A 4TMVA 3GLGA 1RFLA 3SZRA 4ARZB 3GP8A 3GD7A 1CJTC 2WZQA 4H9GA 4QHSA 2BKUA 2ZVPX 2CE2X 5AWFC 1JNYA 3LA6A 2J0QA 3GFOA 2ZJOA 4WW0A 3FHTA 5FBWB 2V55B 1GAJA 1JR3D 3BJIC 1E2KA 1Q57A 4TMTA 4TWZA 1H8EA 3PV0A 4P31A 5JSZB 4HZUA 1DO0A 3KJHA 4LJ5A 3THWA 3ADKA 2O8FA 1GM5A 1EXMA 3R8FA 1YQTA 2O0JA 5EP4A 4DLSA 3H86A 4C0BA 4KBFA 2NO7A 3N2EA 1F2TA 3U3KA 4EJSA 2O5VA 2J3EA 1D2MA 4L5BA 4D26A 1S96A 2GK7A 2ZRLA 1X6VA 4HUQB 1QVRA 4US0R 4KLNA 5CIWA 4A0RA 4EFLA 2ZUBA 4OK6A 3R9XA 8OHMA 1DAKA 2IUUA 4ZDIA 5BW8A 1BIFA 2XX3A 3VR1A 3LY5A 2WTUA 1JR6A 2ZETA 2HF8A 4JLKA 1YR6A 4K81B 3BC1A 2CBZA 2GETA 1BMFD 1ZC3A 3CNNA 4MGIR 5IRCD 4ACAA 5JRJA 2CJWB 4OJQA 2IWRA 3TR5A 3B7GA 1QF9A 4B2IA 2J7PD 2F1RA 3FFAA 4JVSB 4PSAA 2HCBA 1TL7C 1BYUA 1Z2AA 5ANRB 621PA 3GLIE 1P2TA 1K5GA 1SXJE 2GXAA 4UNRA 1YZKA 2VPPA 2D7DA 2IS6A 1WE2A 3QVVA 3VKGA 3GFPA 4GRAA 2GILA 2P3SA 4LX0A 2A30A 3V00A 5FTLA 3NG1A 1N6KA 4I81A 4C0QC 5FPTA 1XJCA 4BLRA 3KFVA 1XX6A 3AVVA 1N6PA 3K1JA 3L8ZA 3LFUA 2J0SA 3QKRB 1J8MF 4KHZA 1AN0A 1ZVQA 3A1UA 3I8SA 5FUYA 5KYKA 1QHYA 4C2TA 2JJ2D 4GP6A 3A1SA 3OEHD 5TV2A 1OLOA 3AB3A 4IEIA 1WF3A 1MKYA 2QMOA 2HXSA 3K9NA 1ZD9A 4PHGA 5JECA 4IVQA 1SXJC 5BYJA 4GI7A 4C0AC 1Z0JA 4A82A 1YR9A 4QHYA 1BKDR 1U9IC 4V0OA 5LBIA 3TSZA 3MAAC 4HATA 2HF9A 1Q20A 1VCNA 1W2GA 3WYGA 1M7HA 3P27A 1KK2A 1VCIA 1IJFA 5KSOA 1KI1A 1XD9A 3QF4A 4X8HA 4ITRC 3SHFA 1W4BA 3VAAA 4GOKA 2G0TA 2BBSA 4TL7A 3S1AA 1A2BA 1VCMA 2C95A 2O8DB 2Q9AA 2GESA 3DKPA 2QU8A 4RSGA 2CL0X 5FPYA 4BWYA 3LXXA 1Z0AA 3G82C 1UEJA 4JYBA 2ZRKA 3AKYA 5FBRB 1G7RA 4GNKA 4A36A 1AKYA 1Q22A 2D62A 5B57C 2XOKA 4Q1EA 1S8FA 5FI0B 3SE0A 5IK2D 2OUKA 1YJ5A 2P5SA 4AYWA 4QM7A 3T5DA 4P3YA 2ZRMA 1ZJ6A 4A9AA 3TUZC 3PJRA 1QHHA 1JJVA 4PO8A 5DYIA 4DIEA 1G17A 2CCJA 3DKVA 3IILA 3H2YA 4H1VA 4L8GA 1TADA 4LJ7A 2VH5R 4Q47A 3THYA 1RYHA 2V6IA 4R98A 4BFTA 2FGJA 4W5JA 1FUKA 2FSGA 2GKSA 4B3DA 5JCZA 1XMVA 1XTRA 2O0KA 2FPKA 1ZM2A 1CR2A 3RNLA 3IQWA 2C78A 1E2DA 3IPXA 4JL5A 5E7IA 3OIWA 4MGYR 4F4CA 4M2LA 4XJXA 5SZIA 4KYIB 4YLGA 2R6FA 3C14C 3I8XA 3L0OA 2MSDB 5CYOA 3OIVA 4EKDA 4V0KA 5DSZA 2Q3FA 4KXFB 2RH5A 3LBHA 3UK6A 2OSBA 3ASYA 1SXJD 3CIOA 4C2UA 4FMCB 3ZVMA 3SR0A 3ZZTA 4YMSA 5JWHA 2WJGA 1KI9A 1DS6A 4KCGA 1TNDA 4RD4A 2C77A 3W3AA 3U44A 1UPTA 1E1QD 5EP1A 3VHXA 1FZQA 2FFHA 2QRZA 3VU9B 1Z22A 2I3BA 5FOTA 3LBIA 1FOEB 2WPDD 1R5NA 3NHAA 3X2SA 1OH6A 1GKUB 1UKZA 4B3GA 1CR1A 2ZQ5A 4FINA 3SS8A 3MWYW 4A0FA 1T0JB 2GK6A 2BDTA 5DISB 2HUPA 2XNDA 1XXHA 1NY6A 2ZI3A 5A5GA 5HKKD 4ON9A 1AZSC 2WHXA 5JWRA 5FR2A 3SC3A 2ZEJA 1ZRHA 3HR7A 1G3UA 3KTAA 4C0HA 3IIKA 2GRJA 1R5BA 4Y0AA 3CONA 4II7A 4QRHA 4UJ5A 4UQOA 1ZU4A 2RGXA 1IQPA 3UG6A 2ZU6A 4JIMA 4B6EA 3M6AA 5D3MA 2BIFA 4B34A 4PO1A 3ZQ6A 4Q4LA 2DCUA 1LS6A 1QHGA 2J59A 2AFHE 2IF0A 4XH9B 2IYYA 2O8BB 1SULA 1XZQA 1ZIPA 4XVRA 1PZNA 2YWFA 3BWDD 3NHBA 5A0FA 2QAGB 4JT2A 1TU3A 1VYUA 1JAHA 3KZ1E 4CEJB 1MO5A 4AK9A 2GXSA 3A1WA 3QSYA 2ZRBA 1CJUC 3OFND 3AVWA 1KTVA 5KHOC 2CLSA 2P67A 3TAUA 3BIFA 5E3HA 1KI8A 5FTNA 1KO4A 2AK2A 2P2LA 1OHHD 3BBPA 2WKRA 5IHPA 4K8OA 2IWHA 2GBLA 4MRNA 1ZM9A 5HPYB 1UBGA 3LQRA 1P2UA 3SQWA 3K09A 3LD9A 1R10A 2EYUA 3RS5A 3FWYA 4N0EA 5EJEA 5FBVB 2IXGA 4ZCIA 2J0VA 2H92A 2W6JA 2YWEA 2ZJAA 4BGDA 1E0JA 1SVOA 5JJIA 3KQHA 2NTYC 2NPFA 1OXSC 3O8BA 3U7GA 3B9QA 4NYMQ 4Q02A 2GJSA 1GWNA 3EZ7A 4TTRA 1EX6A 1KZ7B 2C98A 2VP4A 1FFHA 1AS0A 3NC1C 1NF3A 4LHWA 2VF7A 5GJVC 2C99A 2IC5A 5L3SB 1N6LA 2B7CA 1AK2A 4IDPA 4JKIA 2QZ4A 2Q3HA 4JKYA 4GOXA 1N6NA 1HT1E 2ZREA 4A6PA 2D2EA 4AIIA 4AURA 1MRSA 1U8ZA 1B23P 5GJCA 4LV8B 4M9ZA 4URZR 2OHFA 3EW9A 3ZDQA 1E9SA 2FU5C 4D0GA 5J4YA 3P4YA 1GVNB 2XZPA 3FVQA 2KE5A 4MYCA 1VG1A 2OFWA 3A4LA 4IFBA 5EXSA 4B76A 1IOZA 2FFBA 4ASUD 2KSQA 4P4UA 2DHRA 3TK1A 1HURA 3Q9LA 5EUQB 1A1VA 3L8YA 1HH4A 1V5WA 3A36A 2QGZA 2X8AA 4LBYA 5H68A 4OI2A 5FUVA 1KI4A 1NVWQ 4IKEA 4PQRA 3SFVA 1P9RA 4XOIA 1TTTA 2V6JA 4X8MA 4LSGA 4JBYA 2REXB 1IHUA 1KDRA 4B74A 1G19A 2BBTA 3TW8B 1OH8A 1DVRA 2VSOA 2PX0A 1W0KD 5M04A 4DEXA 1X1SA 3R20A 2OCBA 1F2UB 5BN5A 5HE8A 1KK0A 1CJVC 3B6EA 1Q1QA 3CNOA 4XD7D 3RVBA 5KNCA 1T8TA 2QENA 4DDWA 2E9SA 3NBFA 4MGZR 5CJ2A 5DHFA 1NIJA 3IBGA 1PV4A 4NDZA 2Q9BA 2FGKA 3W6NA 2RHMA 3EC2A 221PA 2WWIA 2OFOA 4QBIA 1QBKC 4C0JA 3RS0A 3KKOA 2JLRA 1KMHA 4Q5IA 3HR8A 1SQ5A 4A2WA 4RD1A 4FMBB 3EXAA 2D4HA 1G291 2FN4A 3TVTA 3KJGA 1ZD8A 2IYXA 1P61B 2ZRPA 1XRJA 2VP9A 5KDLA 4QBGB 4TMKA 1VG9B 4EQ6B 2VHQA 4DC9A 4ABYA 4NCIA 2HXYA 2ZRFA 1LF5A 1XEWY 3CWZA 3CPJB 1S1CA 1Z47A 1TEXA 5FOVA 2NQ2C 3GLGE 2BHRA 3ICEA 2ZSFA 2QUZA 5CLQA 1GTVA 1IAQA 2AN9A 3GJ5A 1S3GA 1ONBA 4MYTA 2QMUA 1YRAA 4PHFA 2WVJA 5B2ZA 4PPFA 3UKDA 1SVIA 3T1VA 1W7AA 2GJKA 1YVDA 1OF1A 1GITA 1M7BA 4LHZA 4QJ5A 5KTYA 1ZM3A 5JBQA 4I1SA 1OKKD 2QY9A 1YRBA 5KPDA 3AVYA 4IVPA 3GLHA 3PEWA 4D4LA 1VECA 2IK8A 3QBTA 4G0NA 4D4KA 3KQNA 1XMJA 1CU1A 2DFTA 2AX4A 4IOJA 3TAHA 3ADDA 2R2AA 5JMTA 4HDCA 5HCIA 1RVDA 1E1RD 3VKWA 1G18A 4F4JA 4MA4A 1E2GA 1XD2A 4LDJA 1GRQA 4IFEA 3OE7A 5L3RA 3THXB 4HDQB 4URYR 4TLCA 2HYIC 3T34A 2IYSA 3ND9A 4LYHA 2GWHA 4KODA 3ZVLA 2JDIA 3C7KA 3ADBA 1P9WA 4HAYA 5AUNB 3T61A 2QM8A 3HU1A 5EE3A 3OIYA 4ARZA 3DO6A 5JJKA 2FPLA 4RCZA 4L4UA 2HLDD 2JLQA 1A7JA 1M7GA 1LV7A 1D9XA 1Q1BA 3C15C 4EJSC 2IBMA 4DCNA 1EFRD 1QG4A 1W4AA 4KLZA 1NVXQ 4TYNA 1N6IA 2XTZA 1E2LA 5DIFA 1MR3F 1T9HA 4LJYA 2EW1A 1XTJA 3FMFA 3EG5A 1X8LA 5KOYA 4S35A 4ZCLA 2OCYC 4HEJA 2ZRAA 2B7BA 1NJFA 3BB1A 1E9CA 2BV3A 2W6ID 5UKDA 4DUGD 2YKGA 4MITA 5H8WA 1OB2A 3B2EA 4XSHA 5BQ5A 1OJLA 1E9DA 1J8YF 5JRZA 3N2IA 3RS4A 3K9LA 1D6JA 5BXQC 2X19A 1NLYA 3MWLA 1PJRA 2VHUA 2PCLA 3OESA 4QOSA 3W8NA 1BS1A 2CJWA 1MABB 4CGZA 1E99A 4LHVA 1DARA 1LY1A 2PX3A 5FOUA 1C1YA 1COWA 3HDTA 1VIYA 3L2OB 5GVSA 2HCJB 4PC2A 3RABA 1NN5A 4YMTA 4PC6A 3B78A 5J40A 2F55A 4DZZA 4WZBE 1GSIA 3TUIC 1HUQA 2OE2A 3RS2A 4B32A 3EASA 2ZM5A 3H84A 2GTPA 4NPHA 1JAIA 4AG6A 4LYAA 1XNJA 1RZ3A 1W44A 3W34A 4URVR 1XTQA 2C5LA 2ZE6A 2Z5FA 4IOLA 4Z8YA 3UWKA 1KKLA 2JA1A 4KV9A 1XZPA 4PO9A 1U0LA 5DGXA 1LNZA 3RLFA 3FTQA 3QG1A 4RVCA 4JT4A 2YWGA 2VP0A 1A82A 4CT4B 2GJ9A 4M1WA 2CLCX 1HV8A 2N42A 2CXXA 3K0CA 3I5YA 5E95A 1QG2A 2R44A 2H5EA 3D6TB 1L4UA 1G8YA 1KYIA 1Z5ZA 5JS8A 1US8B 1Z3IX 2Q9CA 2NIPA 4JBXA 4NYJQ 2ZJZA 5DI3B 4BZQA 1II8B 4BE7B 2PJRA 2OEPA 3RSLA 2FFAA 2J7KA 2OESA 2QSYA 1CKEA 1T6NA 3GJ3A 1CR0A 3UWOA 2NO9A 2O8DA 5J4LA 3K53A 1WP9A 4AWXA 2BOVA 1CTQA 2KI5A 3SNHA 4NYJR 5G3ZA 2Z4RA 3PENA 1D9ZA 2Q0HA 4GFDA 4R71A 5DO9A 5JEEA 3WBKA 1XBTA 3UPUA 2NOAA 5J47A 1XPOA 1A5TA 4HSEA 1LF0A 2AWOA 4MKHA 2XJ4A 5DHAA 5KNBA 1CXZA 3MLEA 2ASEA 5FR1A 4AKIA 1ZNYA 1TAGA 3CF2A 1RRCA 3VNVA 3IBYA 5B64A 1XU4A 1R0ZA 4Q4HA 4LBVA 2QG6A 1NN3A 4QGGA 3K70C 5HTKA 1TMKA 3FKSA 4BLQA 4DLTA 2YWHA 5FPKA 1FTNA 1Z6AA 1OH7A 1PLKA 4UNQA 1OB5A 3H0KA 2RGNA 4AKEA 1XXHE 4PSVA 4A2PA 3W6OA 1KJZA 3FMPB 2YJTD 3B1WA 4TSFA 3WP0A 1E9EA 2DFLA 4WA7A 4DIDA 1KDPA 2DFKB 1RYFA 1CRQA 2GXUA 5B30A 4KI0A 1BO6A 2VSXA 3GLIB 2DR3A 2X2EA 1SXJB 1JJ7A 4QBHA 5DN6A 5GJBA 4UJ3A 1NSTA 4DSNA 4BLOA 3U7FB 4LJ9A 2HT6A 2CK3A 3RSOA 4DLVA 1VIAA 4JLMA 1T5LA 2P5TB 4NU0A 2W00A 4OQMA 1CR4A 1E0KA 2EWVA 3AUYA 1AS3A 4YDSA 5LB4A 2H57A 4CDGA 4C0LA 4DLRA 4YQFA 3FDIA 1ZNXA 3LBNA 1VYVA 1R8QA 3VR4A 4QXAA 2B8WA 4B35A 2A5YB 3Q8XB 3FHOA 3ADCA 3T12A 1SVMA 2JIZD 4G3XA 2ZYVX 1YZQA 1KI6B 2OAQ1 1EK0A 3F0TA 4CF7A 2ZJ8A 1HA3A 4KFRA 3SHWA 2IYWA 2OXRA 2VYFA 4HZIA 2W58A 3HJNA 5LD2B 1T4GA 4JLDA 3WMFA 4DT1B 2R6CA 3NH9A 4KVAA 1E79A 1NRJB 2PLRA 2WOOA 3NDPA 4E07A 1CIPA 3UMSA 1B0UA 2ZSAA 3CF0A 4JJZA 5FTKA 1NSFA 2QAGA 4LPKA 4NCKA 1OE0A 2E87A 4Q4JB 4RFSB 1LS1A 2GNOA 2K5UA 4MUAA 4A4DA 3K70D 3X1XA 1O87A 2BCJQ 2GBLC 3M4YA 2AHOA 1DAFA 3PCRB 1IN7A 2ZYUX 4MYHA 2IYZA 3R9IA 3SYKA 3TUJC 5KO2A 3CBQA 1SKYE 3E5HA 3FYHA 1E2NA 2EVWX 3BFVA 4IHQA 4ACBA 4ERNA 2J41A 4M4SA 4IDOA 4RZUA 1EGAA 4V02A 1FMJA 5FL7A 5FL3A 3ZH9B 2QP3A 1XEWX 1T0HB 1XDBA 4OHVA 1E2QA 4I99A 1Z63A 2IF2A 1GKIA 2E1RA 3QVUA 2X2FA 4QNMA 4E5UA 2OG2A 1L7VC 1EX7A 1NIPA 2ORWA 5DH9A 3CH5A 4I1OA 4POAA 4XTRA 1KY3A 3TQCA 4EPYA 4D2IA 5H70A 4JLJA 2XNDD 5CITA 3ZZUA 2YC2C 4IDQA 4RZXA 1S1MA 1U81A 3QY0A 3QXXA 2ZI7A 5EQTA 2AD5A 1WB9A 5L3SA 2QTVB 1C4OA 1KMQA 3B5JA 1G41A 1KIMA 2RB4A 1FL9A 3AP2A 3U4QB 1NJGA 2F1HA 1HEIA 5EE9A 1FPMA 2NO6A 4KYUA 3VX3A 1KK3A 2FF7A 2W2TA 3O8DA 2QORA 3QXSA 4PHHA 1SVKA 4H1UA 2VQSA 2ZI5A 4Q00A 1W0JA 4Q66C 4NCHA 3THOA 2FOLA 4LWZA 1FMLA 2R6DA 1M1YE 3RRNA 1W36C 1JALA 2ZRDA 1E2PA 4M9QA 3ZZ0A 4M1YA 4B71A 5GADl 2XXAB 2J0UB 2JASA 4G01B 2QI9C 2O8EA 2Q6TA 3GJXC 1UADA 2O8CB 3CH4B 1Z06A 1LVGA 1KSJA 3KFXA 4DLZA 3L43A 3R7WB 1XEXB 5KNDA 2JLXA 1KAGA 3P20A 4TTPA 1AQYA 3LH5A 4D4JA 2AFIE 1RIFA 1X86B 3PUWA 3PFIA 4HLUA 5E7MA 3AGQA 4MRRA 3GLFA 3GEEA 2W6JD 4PTLA 1X8KA 1OXXK 3TSWA 2QMEA 3V4FA 1P62B 3ZD7A 3A6PC 3SN6A 1PUIA 3EIHA 3AQ4A 4QJ3A 3I3SR 4LK2A 3SJZA 3VTKA 4MUBA 3EIEA 1X3SA 1AS2A 2OZEA 1NI3A 2IS1A 1G8GA 3T06B 4O2RA 3WHLA 3H4MA 3ICQB 4D0LB 2G3YA 5EE0A 4DSUA 2I1QA 4DWJA 5L3QA 2GCPA 2MSCB 4OJKA 4YMVA 4DVGA 1VG0B 2CHVA 4NH0A 1UKEA 5G53C 3PUVA 1E3MA 4S2EA 2B8TA 4PPGA 1IN6A 3K9GA 2BKEA 2BM0A 4OI1A 5BWMA 3X1DA 1AZTA 3TMKA 4CEIB 1EFTA 5LD2C 4FIDA 2F43B 1E2FA 2OLJA 2XSZD 1A2KC 4FCWA 121PA 1W2HA 1XB2A 3LQQA 1XD8A 4A6XA 3IQXA 2ORIA 3T15A 4XVUA 1W5TA 2GDJA 2FMXA 2OLKA 2PL3A 5EE1A 4HB0A 2DY1A 3W90A 1S9DA 2CMKA 4GMDA 3QNUA 5CM9C 1T3LA 2FDCA 1S3SA 4PZLA 4XWKA 2UVQA 1OIVA 2VF8A 4TLBA 1W36D 1E9FA 4XTCS 5G40A 2ZI4A 2ZYWX 5AUOB 4A1FA 1E32A 1X8JA 1RKBA 2ANBA 4XSGA 3KQKA 4A8JA 1UKVY 1U8AA 2P6NA 2PMKA 2IXEA 4KAXA 4LCBA 3VQTA 2R9VA 4UKDA 1WRBA 3BE4A 3U61B 5CB6A 3NEJA 4D80A 4WXPA 4D81A 4M1TA 2V8OA 4HB3A 3THXA 1ZNZA 2H8KA 2JEOA 1KSHA 4AKGA 3M1IA 4DCTA 4QBFA 3WMGA 3T35A 1N3BA 2J45A 3P26A 4P4SA 2P6RA 2OT3B 1T5IA 1XF9A 1XTKA 4MKGA 1R0XA 2IXFA 5FPHA 4N0DA 4BRWA 2FNAA 1E2IA 1E94E 1S9HA 1R2QA 4AY2A 2F6RA 2HV8A 1JR3A 2Z4SA 1D8TA 1Q1ZA 4NKRA 2BVNA 1DAIA 5AJWA 3SOPA 5KDDA 2XZLA 1ZU5A 1FX0B 3K0AB 4FMDB 3B85A 3RS3A 3VR5A 3V4RA 2KWIA 3FGNA 3KXKA 4US2R 1NVVQ 4DLUA 3RC8A 1SZPA 4LYFA 3CZPA 3U3MA 4LJ6A 5K8LA 1EFHA 2ZJYA 3CRQA 3Q72A 4BFWA 3J81k 1DADA 4Z51A 4Q7JB 2AK3A 2G77B 3A1TA 4M1KA 1M34E 3TJZA 4F91B 4YC7A 1OYYA 5L8VA 2J9RA 4XIGS 2WV9A 1GKYA 4QKQA 5EXXA 2A5DA 3IIJA 1KO8A 1NKTA 2P65A 2QN6A 1NVVR 4X8OA 2GXQA 4HAUA 3MUFA 2QPOA 3QF7A 3C5HA 2J7PA 4JLNA 4BRUA 2REOA 4CIDA 2WJIA 2FFQA 1P6XA 1G16A 4B48A 5EUMA 4JBWA 1DEKA 3SQXA 3E1SA 1P5ZB 4D25A 2OBNA 3UIEA 3OE7D 2VHCA 5CK5A 2PMDA 2LCFA 3IDQA 2FWRA 5CDFE 4JVNA 4U02A 4DRZA 3GLGB 4AD8A 5FOXA 4TMZA 1HY3A 1Z07A 4BECA 2JJ2A 2GVDC 1FQKA 3OF5A 1W49A 4UNSA 5FOWA 2GCOB 2R6AA 4Z8XA 4FI3C 3JZAA 4IVRA 4OI4A 4TLEA 2JATA 3BFKA 4N3NA 2O8FB 1XJQA 1KGDA 1U8YA 2QAJA 1J7KA 4ZKEA 2N1BA 1E4VA 2O0HA 2RGCA 1F2TB 5EP2A 4EJSB 3IIMA 4TT3A 4GSYA 3T1TA 2VA8A 1DBSA 4FD2A 2ZPTX 4V0ME 1IN4A 1E0SA 1SKQA 1VTKA 4NYMR 1KZGB 3QOFA 5DI3A 1W5SA 1GL7A 2DFNA 3MJHA 4NYIQ 2BCGY 2WJJA 4XWOA 2WWHA 3PUZA 3CKLA 3L0IB 2MMCA 2OILA 3QKSA 1DTSA 1G6OA 3AF4A 4JSYA 3HU2A 3KKMA 4YMWA 5IF9A 2UZ3A 4PR0A 4D82A 4O3MA 4B2PA 5IK2A 1XWIA 1FP6A 1TQ6A 3IPYA 3DOEA 4FCVA 2QP4A 2BMEA 2FSIA 2J87A 3OAAA 2QROA 3LX5A 4JL6A 1W48A 3EWSA 2ONJA 2BM1A 4NMMA 4CVNA 1MO3A 1TF5A 5KDOA 3PR1A 4LV6A 5K8UA 2OXCA 2D06A 3CRRA 2RGNC 4K46A 2JLWA 3U7HB 3NTUA 4BLSA 4HAXA 4EPRA 3K0FA 1XCGB 4R2IA 4DBLC 3QI2A 4Q1BA 4HLDA 2KBEA 2AXNA 3KJIA 2EYQA 4M1MA 1G3MA 3DOFA 4U7DA 4GP7A 4AYXA 1H8HA 1PLJA 2LWIA 3C16C 4AG5A 1U99A 2IHBA 4NZYA 3QKUA 4AKHA 1VDZA 4L9SA 4PX9A 5KSPA 3GJ8A 4KFTA 2ZYTX 4QNRA 1CJKC 2ORVA 3SEAA 1RE0A 3NXSA 2FZ4A 1RRGA 1OPXA 4WAUA 3QF4B 2ZSDA 3VR3A 4W5WA 3MGCA 1N0WA 2RGAA 3Q7PA 2ERYA 4QJ4A 2A5JA 3W9YA 4ZI3A 4RZ2A 1TF7A 1U9IA 1Y63A 2Y8EA 3B1VA 3QPWA 1XFAA 4LRWA 3S1AB 1PUJA 2I1VB 3PXGA 4DHEA 3TSOA 1G3IA 4MRSA 2PT7A 2WOJA 3T1OA 4YMUA 3GCGA 2EFHB 5HZHA 2NG1A 3ND8A 4WZAE 1G1MA 1J90A 2DB3A 5AUQA 2WPDA 1R4AA 2WSSA 3VHLB 4EAQA 1G5TA 4Q03A 3BS4A 3NVAA 2IYQA 1OFTA 1ZP6A 4GZMA 1DAGA 2ZRIA 2G83A 2FG5A 5HKKA 2C9OA 4G5GA 2JLZA 1WBBA 2PH1A 2XJ9A 3GFTA 1IY2A 2JGNA 4IXNA 1KI6A 4RCYA 4ZDJA 3THYB 1U98A 1KK1A 1UEIA 3E70C 4LJ8A 5CM8B 1OIWA 2G9NA 2PEYA 2W0SA 4BZXA 1Z6GA 1GG2A 3B1YA 2FA9A 4P4TA 2JCSA 3A1VA 4M1SA 3ZIAD 1Z0KA 5EE5B 1ZINA 1QHNA 5CB8A 1Y3AA 2YZ2A 5KU1A 3GEIA 4TSFD 3K70B 1II9A 4OI0A 1JEDA 3X1ZA 4EUNA 2AR7A 4DLYA 2ZTSA 2JAQA 3TBKA 2IT1A 3RS7A 3BORA 1IXZA 1TQ2A 3BH7A 4Q4JA 4RFSA 3OFNA 4AC9A 1OXUA 4GL2A 1G4UR 1XMIA 3GMTA 1D2EA 4RD6A 2ZUCA 4DDVA 5A4JA 4LC1A 4QGFA 1EWRA 1KI7A 2CK3D 2RGBA 5G3YA 4NCNA 2V1UA 5JSZA 2CHQA 1Q21A 1HT2E 2QMHA 5C4GB 4NCJA 3W3ZB 2X1VA 4A92A 3KQLA 1ETUA 3U44B 5F98A 4AI6A 1N25A 3D31A 3SBDA 3IUYA 4RZ3A 5JWOA 1OV4A 2VEDA 1ESMA 3BD9A 4HUQA 3UANA 3BRWD 1Z6YA 3G5UA 1NL3A 1XXHB 2A3RA 2F7SA 2MSEB 1HE8B 4JLOA 3DM9B 4URXR 3OEED 5CYPA 1TU4A 2PZGA 1JI0A 2IYRA 2XB4A 4C7OB 4DLWA 3MG9A 2V1XA 4LHYA 2FSFA 2A2ZA 3MMPA 3AVUA 2AD1A 3GJ7A 1N0VC 2FV8A 2OCPA 4KSBA 3UXMA 5C4MA 3GLFE 3ZQJA 2WWYA 2Z6VA 2BMFA 3GJ0A 1MRNA 2OBLA 1E2EA 1JBKA 1E4YA 3I1FA 4LPSA 1YZNA 4Z1MD 2YYZA 5C1BA 2QPTA 3FFBA 1ZCAA 2F9LA 2ZS9A 2GZDA 4ASUA 2RGDA 2ZR0A 5GVRA 1HQYE 2F3TA 3QKRA 4OBEA 4R2HA 4A0HA 2IYVA 2RHDA 2GEUA 3PEYA 3WY9A 2MMGA 1OT3A 1CLUA 1TUIA 2QE7A 3CRMA 1GNQA 2V9PA 4O2LA 5FUXA 2XXAA 4WOPA 4FMCF 1N5KA 4HLUC 3CF6R 3T5GA 1C9KA 2YC4C 2QQ0A 1MOZA 4PZZA 3TRFA 2F3RA 1H8ED 2A5GA 2GZHA 2NPIA 3R7WA 1XEXA 2VLIA 3CM0A 4LBWA 4YDHB 2WICA 5LPNA 2G1KA 1TQ4A 4ZIRB 4JMPA 3RYTC 4OKSA 1JPJA 3RRZA 1KDTA 1GNPA 3CRVA 4XD7A 4B3FX 3GPLA 1JB1A 1ZC4A 1ZIOA 5AUPB 2LKCA 4Q1FA 4M53A 1AGPA 1E2JA 3E2IA 4JL8A 2Q3MA 1HTWA 2VIIA 3PIRA 3SU8A 3TGPA 1BYIA 4MRPA 2GEDA 2ONKA 2ZE5A 4MRVA 2CEAA 3SJCA 4Q9KA 4A15A 4MYUA 4M0LA 3DMNA 2QSZA 1M2OB 1CJMA 4C9BA 1GUAA 1MT0A 3HYTA 4URWR 2W0MA 2JJ1A 2J46A 2OBMA 4MGKR 1I4LD 1SKYB 4JSTA 4L16A 1ZW6A 3DEFA 2HEIA 3SI7A 3C41J 4BFUA 2NZJA 4BLTA 4EPTA 1W0JD 2CCGA 1BH2A 3EARA 3ZLJA 2ZJ2A 3DMDA 3C8UA 4UXIA 1UM8A 1P3JA 3IO5A 5DE3A 4GPTA 3WYFA 3ZVNA 3FMOB 2W83A 3QBVA 2F43A 4LUCA 4OHXA 4PPQA 1ZUIA 4ZDWA 4A0GA 2CL7X 4IOKA 2YINC 3QPVA 521PA 1CRPA 4FN5A 1Q0UA 1SGWA 4C3ZA 2WKPA 1K5DA 1W36B 1VYTA 1OYWA 1WQ1R 2EFEB 4HB4A 4A8JC 2FJUA 2A78A 1CS4C 2PBRA 2R6GA 3EAQA 4KFSA 5TY0A 1Z28A 1IBRA 1UFQA 4TYWA 1Z08A 4BEBA 1FTSA 3VR6A 4IRUB 4UXHA 4HYYA 1G9XA 3CUEF 2VP2A 4JLVA 4ZDKA 4JYCA 4JLPA 3AVPA 3LV8A 2EFDB 2IYTA 4XWAA 1FUUA 4LC0A 1NMZA 1P2SA 3ASZA 3CZQA 5J4HA 3PUXA 1OSNA 3EPKA 3A58B 4MQBA 3DZ8A 1KMHB 1W4RA 4Q9IA 5E7JA 3VU9A 1G7SA 2QEQA 4KITB 3N5CA 2HJVA 2ZRGA 2HLDA 2XOKD 4ZV4A 3LVQE 1MH1A 5IDVA 1YZGA 1JQLB 1XTSA 3CX6A 2C96A 1KI3A 4KBGA 4BZPA 4A2QA 3OZXA 1E0AA 3ONWA 4JLBA 2QM7A 2VHJA 1N6HA 3B82A 1R5OA 3K0AA 3U6KA 4TYYA 2HDNB 3B1XA 3NBXX 2GVZC 2PZFA 1ZAKA 5J5CA 2IX3A 1KKMA 4G5OA 2JLUA 1GFIA 4QHTA 1GOTA 1YU9A 2B92A 3CW2A 2D3WA 5K8IA 1I4DD 4TL9A 3A4MA 3LLMA 3U5ZB 1Q44A 1Z8FA 1UDWA 1Z0FA 3B1ZA 2O8BA 2YOFA 2QBYB 3HP1A 3D8BA 3X1WA 3EC1A 2VP6A 4CEJA 1JECA 1I4TD 3H1TA 2PJZA 4HAZA 5K8TA 2CNWA 4D0NA 1Z6TA 3BERA 3Q85A 4DLXA 2JJ8A 4TLAA 3TKLA 4OQLA 1K6MA 1P60A 4CEHB 2ZI9A 3K09C 1JXMA 3KJEA 4QGAA 3FE2A 4E03A 4NONA 1QZXA 1TEVA 2ZR9A 3MJRA 4MKFA 1UAAA 2VHTA 3GJ6A 3I5XA 2D74A 2PEZA 4MH0R 1KAOA 4B6FA 4NP6A 4JZKA 3LAWA 5FUWA 1TQDA 3GEHA 1E9BA 3TE6A 4PXAA 4PPNA 1ANKA 1J99A 3QXCA 4QGHA 4LZZA 1E2MA 3WMEA 2GCOA 2NGRA 1R0YA 3W8RA 1RW4A 1UF9A 4JS0A 1GZSA 1TF2A 2GF0A 3AKDA 3TH5A 3V9PA 4B73A 2DBYA 2ERXA 2WWWA 2RCNA 4W5HA 1WXQA 3DPUA 3SYLA 4BUJA 4ZCMA 4P0TA 4C0KA 1RRFA 2FEMA 5KSYA 5IT5A 4RY2A 3CB4A 3R8CA 3JVVA 2IEYA 2CE7A 5H1YA 4HAWA 2GJ8A 2QT0A 3KXIA 2VRWA 3LVRE 4LV5B 5HCNA 2XZOA 2WWFA 1NMYA 4QG7A 2XITA 2WIAA 2NMVA 1UBFA 2B6HA 1D5CA 3KL4A 2UKDA 4BLPA 2KBFA 3U6BA 2GAAA 4O25A 4EPWA 2ZE8A 3CO5A 5CJPA 3DHWC 1OXTA 3VX4A 5JHHB 1G8HA 3CNLA 3BXZA 3PUYA 2WAXA 4LBZA 3TR0A 1E9RA 4M1OA 1M8PA 4B43A 1AA9A 3QG5A 3EZFA 4TYQA 4DJTA 4DSTA 4C30A 3REGA 3BAFA 1Z29A 1AQUA 5JCPA 3OIUA 4I4LA 1PLLA 2YHSA 4PAMA 5AR1A 5FTJA 1QHIA 2H1LA 1ODFA 3HPRA 3KUCA 4JJKA 3RDPA 3WBJA 3G0HA 1RC8A 1Q3HA 3CLVA 1VCOA 4QFMA 1AJEA 4P32A 1KO5A 1OFHA 2ANCA 3NKVA 5TDHA 2IHYA 4GT1A 1CULC 2BMJA 2ZS7A 4B3BA 3TQFA 4E09A 2NO0A 1F2UA 3KX2A 1RPZA 1KDOA 2GEVA 4U5XA 1AM4D 3GQBA 4TQAA 1TPZA 4HUTA 3AVOA 4O0MA 3DVLA 3KKNA 5AK0A 3CRW1 1G21E 2GHIA 2ZSEA 3GLHE 5AJZA 1GNRA 2EQBA 2H16A 4HDOB 1QHXA 1NVUQ 2RGGA 3EA0A 3WRXC 5F9FA 4BFSA 4TT3D 1YZTA 5AJVB 3HYRA 1N2CE 5P21A 3U2QA 1GL6A 4DDTA 4MDFA 3RRMA 4URUR 1EFCA 2CDNA 1OIXA 2W2XA 3REFA 1TX4B 3BK7A 1Q12A 1U2RA 4BQSA 5JZVA 4J0QA 2ZROA 1XCPA 1IY1A 1WDTA 3B13B 4EQ6A 1CEEA 1LFDB 1I2DA 1JEEA 821PA 2J5XA 3VFDA 3L82B 3QKTA 1E96A 4XVQA 5LB2A 3PVSA 2AL7A 3CR8A 3CPEA 4NHOA 5TARA 4HLCA 2ATXA 2V7QA 1NMXA 1NBMA 2GJAA 4LGMA 1R8SA 4PQYA 4G5QA 5J4KA 3FOZA 4QM6A 1EWQA 2R8RA 3UG7A 2VL7A 4IW3B 2QPAA 3K0EA 1NY5A 1XCMA 2JIZA 3OAAD 1UJ2A 4YONB 5KPJA 3I62A 2XTMA 2BMDA 3RC3A 1XPRA 1MO4A 1DPFA 4DXAA 3MCAA 4L15A 4F38A 4Q4HB 2N46A 1VHLA 2KJQA 3Q3JB 2AWNA 3NWJA 4U00A 2QTFA 1RJ9B 2ZRNA 2F1JA 4DB4A 3F3YA 2IYUA 2KB0A 2IW3A 3FPAA 4LOAA 4YXWA 5B58C 5EZ6B 1R6BX 2QL6A 2YVUA 1Q3TA 1T3SA 1VG8A 4V0LA 5SZHB 1DG3A 4OK3A 1KSGA 5HE9A 4PFSA 1BOFA 4DB2A 1TUEA 4TMXA 3WRYC 4EFMA 4E22A 4B2LA 1N6OA 2BBWA 1H8HD 4OHYA 4PHTA 5AJXA 4Q1DA 3LRPA 2ZJBA 1AIPA 5JLJA 2BWJA 1NKSA 3KQUA 1NNEA 4B3XA 3I4LA 2A5FA 4WXRA 5G41A 3LX8A 3AM1A 5DNYB 1G5RA 1JXOA 2IS4A 3D3QA 3MSXA 4FWTA 2BEJA 1OXVA 1P75A 3PITA 2R65A 2WWXA 2C9YA 2G1JA 2VSFA 4CZ2A 3NC0C 1E69A 3NIBA 5JI2E 3SDZA 4CW7A 3PQCA 3HWSA 1XPUA 2AKYA 4Q1CA 4I1UA 3AV0B 4P33A 1ZM4A 3X1YA 1E98A 4RJLA 1DAMA 1VMAA 5SZJA 3SJBA 2WSSD 1DELA 2REBA 3WXMA 5KUTA 1IJEA 3RANA 2WIBA 3NH6A 1U94A 1S2MA 3LW7A 3W5JA 1BMFA 2C9CA 2VTKA 2YNMA 4F93B 5TMPA 2W2VA 1M74A 2XTNA 4BEJA 4C7OA 2BJWA 4OL0A 3VR2A 3QJYA 4NL4H 3K9HA 1MABA 4Q4AB 3P1JA 3IKJA 1YZLA 4IJMA 1G4AE 3ZJYA 2XNSA 4DCVA 1LB1B 2HYDA 3AP1A 2DPXA 3W5IA 2BBOA 1YZUA 2ZJ5A 5HR5A 5FH9A 4ESVA 4BFYA 3KB2A 4BFZA 2ZS8A 3A8TA 5JS7A 2ZAOA 4I1VA 3EZ6A 4PAQA 1R0WA 2JDID 3Q5DA 3NBZC 1VKJA 4ZI2A 3B8HA 2EFGA 2AXPA 4WVFA 2EU8A 3OEHA 1SVLA 3LO5A 2PT5A 3K0CC 4Z54A 1JPNA 1WCV1 2WMOB 1SVWA 3N70A 4IDHA 4HZUB 4HI0E 5FBQB 4MKIA 3THWB 1U0HC 3IEUA 1KNQA 2JLVA 1W47A 4B44A 4ZPXA 1N5IA 1IXRC 1F6BA 1GRRA 4N1AA 3O8RA 1AGRA 1F3OA 2WJVA 4FXPA 1KI2A 4RKEA 4UXJA 4UNNA 4LY6A 2QTHA 4ZIRA 3IEVA 3JVUA 2DWOA 1LTQA 4PSKA 3WHKA 1US8A 1XTIA 1SHZA 1O3YA 1XMSA 5JHGB 5ELXA 2XB2A 1II8A 3LW8A 1DOAA 3LNCA 2G88A 1YR8A 5DLQC 5FPSA 5EP3A 1DG1G 1G64A 4KO8A 4NE2A 2G6BA 5L3VA 2FE4A 1DO2A 2J1LA 4TL6A 1P9NA 3B9PA 4LJ4A 3ZS8A 2ODBA 1YR7A 4UNPA 4B33A 4MDEA 3EX7C 4IOMA 2L0XA 3TVDA 1AKEA 3TLXA 3KB1A 2EWWA 2OM2A 1G8FA 3L0PA 2GA8A 2NO1A 4NYIR 4OHWA 1IN5A 1COWD 5E4FA 3DM5A 2EFCB 3RRYA 3AVQA 3ZGXA 1CF4A 4DCUA 4EIWA 1ZMXA 2Z0MA 3U60B 3CWQA 3FHCB 3FMIA 3I72A 5CK4A 4BFVA 1X1RA 5JEDA 2YOGA 1CBUA 2A7QA 2GCNA 1G6HA 2XEXA 2XSZA 3NDBB 3BGWA 1KNXA 1N5JA 2FH5B 3CX7A 1KO1A 3I92A 4FWIB 4Q7LA 1VHTA 2OCAA 2Z83A 2O8EB 4CT5A 1FP7A 1W4CA 2QE7D 2RKOA 2FEOA 3QUSA 1ZBDA 1W46A 4HAVA 5SZKB 2DWPA 1MO6A 1KOFA 3VNUA 3RWMB 4TYPA 4OYHA 5FOSA 5F3WB 1HYQA 4JLAA 2ZU0C 2C2HA 4Q19A 1ZM7A 2IUTA 2C8VA 4ZO4A 4WZ6A 1K8RA 4PC3A 4R9UC 3GLFB 1P72A 4GZLA 3GLIA 2ODWA 4EPVA 1SXJA 3EPHA 3KXLA 2BJVA 5F9HA 1KSFX 2ECKA 2ZXUA 3QIAA 3PEVA 2ZR7A 3U7EB 1EESA 5BYKA 1L4YA 3BH6A 3C5CA 3M0EA 4M9XA 4Q7MB 3WNDA 1N6RA 4JVMA 2JLSA 2QRNA 1F48A 4GBMA 1E1QA 1Q1EA 4KU4A 3CX8A 1F60A 5C2JB 1SVSA 2SHKA 3AKEA 5DYGA 3UMFA 1ZNWA 4PZYA 1EG7A 5L3QB 1HQCA 4KJZA 4OQNA 1QHSA 3C4JA 2JJ1D 2ZIAA 4NTZA 5EZ5A 3DZDA 3AF1A 1E2HA 4ZKDA 4G5RA 4BPBA 3EZ2A 3IGFA 1QHHB 4RD3A 1V43A 2GAOA 3O47A 4C0SA 2ZRJA 5HZKA 5F2EA 4QL3A 3I32A 5KSZA 3R9WA 4LJAA 2P6UA 1S0UA 2CL6X 3HPQA 4FCTA 2VBCA 3BH0A 4Q21A 5TB5A 2QAGC 1P2VA 3UATA 3FKSD 1G7TA 1L8QA 2VP5A 2WKQA 3EZ9A 4Q01A 4DT1A 3P32A 1FNMA 1DAHA 4EDHA 4B47A 3HU3A 3QEOA 1IN8A 2H7VA 4L9WA 2QBYA 3MD0A 2C03A 2HJGA 1GRNA 1VPLA 2D7CA 3EPJA 4Q9HA 4A8JB 2GZAA 1W1WA 3K8YA 4HB2A 3AVTA 1ZYUA 2QQEA 3PG5A 3DL0A 4LI0A 1WGWA 4M22A 4TTQA 4TZ0A 5DN6D 1Z6XA 3ZD6A 3CPHA 1WA5A 4PC7A 4CEHA 1FQJA 1J70A 1OHHA 3SBEA 1UKYA 4F7WA 3U3OA 1G20E 3RWOA 1NN0A 1ZCBA 3FB4A 4W7SA 3I73A 3IHWA 3QXJA 3BFXA 2JLYA 2WWGA 4P4SB 4RFVA 3L0SA 2FZLA 3JZMA 4EPXA 2F1IA 1QDEA 2ZITA 1P7CA 3VKHA 4IDNA 2IL1A 1T3HA 3AP3A 4D4MA 2QP9X 3LDAA 1KO7A 2ZVQX 5AJYA 2DWQA 2QGNA 1ELOA 1P4SA 3A4NA 3PEUA 3O8CA 1FNNA 1J2JA 1NLFA 4B3CA 4WIAA 5DI9A 3KTAB 5EXTA 3AF3A 1E6CA 5JFGA 3AVXA 3U3RA 4DEYA 2DYKA 3WYAA 2X77A 1NN1A 1XEFA 3U4QA 3NBYC 1ZUNB 3WNCA 4LYJA 3KUDA 5EXPA 2BEKA 5JI3E 3ETLA 5D3MB 4KFUA 5D3QA 3IO3A 3KKPA 5FTMA 2WJHA 3A37A 4PAOA 5JJLA 2F9MA 4GDFA 3QENA 5TVKA 1E79D 1WMSA 4AYTA 1RRPA 1IY0A 3KDSE 3ZYCA 2G0NA 3TNFA 2ZANA 2OO7A 1R7RA 4RD0A 4OQXA 3AEZA 2WBLC 4R7ZA 4US1R 2CNWD 1YE8A 3T1QA 3SJAA 2J0UA 4Q18A 2ODNA 4LHXA 3QXHA 2CVHA 3P4XA 2O8CA 3FKQA 4RD2A 4OK5A 1II0A 1A4RA 421PA 1UDXA 2ZSBA 4ILEA 3VMFA 5J4VA 1H65A 3QPUA 4TN1A 2UZIR 1W0KA 1KJYA 2FPMA 3F8TA 5FL7D 5TXGA 3ZVRA 1XJ0A 2ZRCA 3OHMA 4TLDA 3KKQA 2B21A 4GMXA 2Q21A 3AUXA 1NBME 4QC2A 2CLDX 4B75A 2CCKA 2NZ8A 4WBSA 1D2NA 1UBCA 1IXSB 3ECCA 2D2FA 2FX3A 4PANA 4Y0VA 2IA5A 5FFMA 4OHZA 4FMDF 2ZI6A 3MRSA 4G5SA 3NEYA 4F4IA 4GOJA 1M6NA 3AGPA 1ZUHA 2RMKA 2ATVA 2WMNB 1GILA 3MWKA 1JQJC 4TZ6A 1Z0IA 2ODEA 2YOHA 1G8PA 1ZD1A 1KY2A 2OAP1 1QVAA 1G7CA 5FBLB 2C04A 4V03A 3IHLA 4C4PA 4Q7KA 5CIQA 1OFUX 2RAPA 3QKSB 3MFYA 5CDFA 3W6PA 1CP2A 2VO1A 5C18A 3RAPR 2I4IA 3WP1B 3BOSA 1G3QA 2IYLD 4CEIA 3AH8A 2QNRA 1NLZA 4W9MC 1G5PA 721PA 3I61A 1FW6A 2WJYA 1IONA 4BFXA 1U0JA 3EWAA 1LW7A 1JR3E 2ZUDA 2YV5A 2CHGA 4FW9A 1OKKA 2PLFA 1PVOA 1N5LA 2ZAMA 2ZRHA 2R62A 2V3CC 2FSHA 3EIQA 3UMRA 3CR7A 4JVLA 4NBSA 1NP6A 4D6PA 4KSCA
chains in the Genus database with same CATH superfamily
5FI5A 1SQFA 2PWYA 4YRPA 4L0CA 4QFDA 5LLDA 1KH1A 2W98A 2LKDA 1NV9A 2B4AA 4X63A 3MLGA 1ZVVA 1P73A 2XCQA 1GL9B 5CBPA 2C61A 3O8OB 3ICOA 4PQFA 1WXFA 1N3YA 1KKUA 4QUEA 3COSA 4A0QA 4B79A 1N0UA 3K32A 2TMKA 1KMIY 3P9IA 3PRKE 2Z8ZA 3QE0A 4NBUA 1NXOA 4QO8A 3GORA 2O1XA 2YZKA 3HS3A 3OHPA 2CKDA 3HRKA 1EFUA 4J16A 4KDCA 3IQ6A 4BC1A 1QYCA 2XVXA 4ZRNA 4QHSA 1Q11A 1I6MA 2J0QA 2HPZA 4YT5A 1YHZA 1O3UA 3OQIB 3VAYA 1NNI1 3PC8C 1JXQA 1D2MA 4L5BA 3V2HA 1QIIA 2XX3A 3DP7A 3VR1A 3FPEA 4ARAA 2CJWB 1M33A 4OJQA 4B2IA 3IOMA 3ZQYA 4D92A 1C7QA 1SU6A 1K5GA 1ZSVA 5BUCA 1N6KA 2DBZA 5FPTA 3EH1A 3B5IA 1XX6A 2FOXA 2X0FA 2QVYX 5EA2A 4NBTA 3KXPA 1FY2A 4QELA 4GP6A 3RROA 2X51A 5IAEA 2NUPA 3SVZA 3DBOB 1MKYA 3E81A 5EEGA 1DHTA 5BSUA 1NVDA 1MB4A 4OKIA 2GSWA 4CIVA 2EX4A 3VPSA 4X8HA 2ZYGA 4XX1A 3VSDA 2PSFA 1NQXA 1IJKA 2XHEA 2XD4A 1V11A 1E58A 3RJZA 4MQUA 5DHUA 5FAXA 4QARA 5CCBA 4EVQA 4Z0HO 3NM4A 1Y42X 3MINB 4A36A 4K7BA 1AKTA 2V8BA 4ZA2A 4AYWA 2H54A 3O21A 1ODIA 1VJ0A 4PO8A 5L0JA 4NG5A 2Q29A 4MVCA 2F3SA 4ZJZA 4BE4A 2AE2A 1E2DA 3IJPA 2BFEA 3SJ7A 4NC3A 5AJTA 3DHVA 3V5XA 3IPLA 5BMVA 1XAJA 4MWZA 1EB8A 4X54A 2CFRA 4MB6A 1CCWA 5KYGA 3NEAA 3WQQA 4L4ZA 3ZZTA 3EYWA 3MB8A 5E1MA 5EP1A 3BCRA 4JOSA 2LK4A 2HHAA 2GK6A 3WHPA 1KJ9A 5JCJA 5IDQA 4Y0AA 2RHBA 4UOZA 5A4IS 1VKRA 4M87A 4WASA 3EG9A 3GLQA 1PZNA 2W48A 3OE5A 3RYLA 1JAHA 1JHQA 4KJXA 1X2EA 3FMVA 2I1WA 4PIPA 1L5SA 3BIFA 5E3HA 3PCXA 1KO4A 3RQGA 3L6UA 4JMLA 1YIOA 2IXGA 2H92A 1JE1A 5C5CA 1PJ8A 2XEDA 4Q02A 2OKUA 3EZ7A 3PQ5A 4E70A 2C98A 1DJPA 2D1QA 4KYTA 4MEBA 3C39A 1N6LA 3I0ZA 3ZLVA 4MQ6A 4DN6A 2VHEA 4A6PA 5K3AA 1MRSA 2XUOA 4GLJA 1Y8QB 4LYDA 3V4VB 3ZDQA 5J3JA 4G84A 3TIVA 1RXYA 1BXRA 3FSRA 4ZI7A 2RCYA 2LIVA 1HURA 4A26A 4YRDA 4MWDA 2EPKX 1E7YA 2HKIA 3JQAA 3PUIA 3HFSA 4X0RA 4GI3A 1KI4A 1TTTA 2XLCA 3DBRA 1KDRA 1QE0A 1DVRA 5FA8A 3C3KA 2X0CA 5ITZA 5IYZA 5HE8A 3B6EA 2V58A 4XM1A 4RTRA 4J0HA 3IBGA 5MFPA 4GZ6A 2ROQA 221PA 3IXQA 5LLSA 4N7JA 1Y33E 3A26A 3BFPA 4EYOA 1ZD8A 2IYXA 5IJ0B 1ISPA 1XJ5A 3SNKA 4EQ6B 2O1SA 1TVMA 2PFDA 1IAQA 1XYYA 4Y7CA 1QVZA 5GINE 5FOQA 4E32A 4PHFA 3QBDA 3UKDA 3BJMA 3C2QA 1Q92A 1OKKD 5JR3A 2GN2A 2ZIEA 1EK1A 2WHQA 4N6GA 2PQMA 4WV3A 2XRHA 3VKWA 1XK6A 4F9TA 7MDHA 3THXB 1MOPA 4LHEA 4LA4A 4DABA 1YIDA 4NNPA 4G0HA 1FK8A 1BGXT 4QT0A 5T3WA 3CVJA 4HFKB 5KWJA 2QLNA 1MMNA 1J2RA 3C15C 3NC4A 4PPYA 1EFRD 4RV5A 2PZAA 1I9GA 2J09A 3OQIA 2OORC 3KR9A 4ZXPA 3FMFA 2GT1A 2BMAA 4BNUA 2W6ID 3B2EA 1SK8A 3F78A 3F71A 1PJRA 2CJWA 4EUHA 3NPMA 4XWTA 1TO1E 4CE6A 1HFEL 2PHZA 2ZT7A 3CC8A 3JVIA 4PRZA 1T5TA 1MZPA 1XTQA 4H16A 3RLFA 4RVCA 2Q5CA 3AHGA 5KCZA 3VDQA 3UT0A 1SNYA 2XRMA 4G23A 3T5AA 2Q9CA 5ICGA 5KVVA 2OQIA 5ALFA 2CXHA 4W9NA 1V8OA 3BKWA 5J1SB 3LUGA 1JX6A 1IB6A 4NYJR 1ODCA 3PENA 5JEEA 5DO9A 3A04A 1WMFA 3ZTYA 3A0UA 1RRCA 3QM1A 2Q1UA 4H4CA 1PJSA 3Q3IA 1HDCA 4PCLA 4PG6A 4LACB 3ETJA 4ZAFA 1GKKA 4UTZA 3J7AC 2GK4A 3WP0A 3FMPB 1W2WB 4WA7A 1KDPA 3UJ8A 2GXUA 1FYXA 5CEEA 4PIVA 2PRYA 1ZKDA 4BLOA 1U0TA 2CVQA 1QK4A 5EIBD 3BRJA 2OD7A 3WG7C 1PJ4A 2VDWB 3AUYA 5EJIA 1OASA 1KIAA 4YFYA 2YL0A 4YDRA 4KMMA 4MW1A 3QVOA 3H99A 1R8QA 2ZWIA 5G2OA 3M8KA 2OV8A 1V6SA 5U1PA 2YWJA 3B9RA 3F0TA 5DKFA 2H65A 4HEQA 4YPFA 3EMKA 4E5KA 1SVNA 4JLDA 4PLFA 4QU0A 2R6CA 4KVAA 3WODF 4LJSA 2OD2A 4OB6A 3ESDA 5EWMB 5LKAA 3K70D 4FW8A 1IUOA 1NPDA 2CLHB 3R9IA 3TQRA 3UGOA 4UAJA 1KEKA 4RZUA 3GB9A 2O8NA 5FL3A 4H54A 2QP3A 2X0EA 4OHVA 5HOQA 1I7NA 2IP1A 3EC7A 1F9EA 3RIMA 5IASA 2WYOA 5B1AC 3AXSA 4UDOA 1KQOA 2QZ9A 1ORIA 2WB4A 1U3UA 5ECWA 4B0OA 5BMVF 1FMLA 1KE2A 4R3WA 3G1TA 2D5BA 2D4UA 3R7WB 5FTWA 2B2NA 1MX3A 4AL4A 2SKDA 2Y1EA 3E9DA 1FS6A 4C07A 3ACCA 2IPXA 1AD2A 5EIEA 1X7ZB 4RDXA 2ZBUA 3P2OA 3HR4A 4AS1A 1FSPA 3UC9A 1LE2A 2Q6VA 3P0RA 1PV1A 5IJ0A 2E4UA 3NRCA 4ZYXA 5IKPA 4E18A 3K9GA 1JQ5A 3X1DA 1X70A 3WQRA 1XD8A 4OTZA 5A4DA 2FDCA 3PJEA 3SYRA 1TCVA 1E9FA 5C34B 5DX8A 3BCUA 3JD4A 4XSGA 3KQKA 4BRZA 2EJCA 2PMKA 2IXEA 4LCBA 3BE4A 2GZSA 5DLJA 3THXA 4BMDA 4YL0A 3M1IA 4HVCA 4MKGA 4N3GA 5EIHA 2Q2OA 3MWGA 3OIFA 3LNRA 1VP9A 3CLUD 3VR5A 5DNEA 1GGQA 3Q72A 1RBYA 4RV4A 4QKQA 4QQ8A 2GERA 1EFDN 1RE1A 1L6IA 2Z57A 1P0MA 4EB6B 3B6JA 5DBGA 3DE9A 3KTFA 1JJAA 3D2LA 4MMXB 3MGAA 3G8CA 3DFMA 1JHZA 4AD8A 1YKGA 5HM6A 2XVMA 4BMOB 1ORRA 2RB5A 2ADOA 1GO2A 3JZFA 4UNSA 4Z8XA 4H4KC 3KPWA 3M6WA 2J9ZB 3EEOA 1XJQA 4GQAA 5I7WA 4FD2A 1HSOA 4R2JA 5HBRA 5ALKA 4F21A 4NYIQ 1EFAA 4II2A 5AOBA 3QFCA 5COMA 1HXHA 3AW8A 4JSYA 2PKYX 5ALWA 1U3TA 3CLRC 4OJTA 3M6FA 4COKA 3QLUC 3NMJA 4XEUA 2DUWA 2OXCA 2OMEA 2RGNC 4TV8B 1UEXC 5U9CA 2PSSA 1CY7A 2HA6A 2JCXA 2AXNA 5ES3A 3SYMA 2P2DA 2VDNB 5IARA 2RD9A 3GR6A 2HIMA 4NZYA 1W2WA 3QF4B 3SZUA 3MGCA 1PT6A 2RH4A 3ZV5A 4LDRA 1VBFA 2BMWA 1ZW2A 1PFWA 5T6BA 4B3JA 3F1LA 1F4PA 2BL4A 2NG1A 2VDWA 3W9UA 2HC9A 2DB3A 1PZMA 2B4KA 5DT2A 4XM0A 2R84A 5AVJA 5DNDA 3UKJA 1RHJA 4BKPA 3EVCA 1AF4A 2HRBA 1S8OA 1TTPB 2PEYA 4M1EA 4R6XA 1XQ1A 1CY4A 4AXBA 4RIIA 2NM0A 4TXMA 2X1HA 1Z2NX 3T0IA 3AEUB 2NXJA 4X93A 3CLTD 5EWMA 1IXZA 4AC9A 4PJMA 4DSZA 4GL2A 3FUUA 1D2EA 4K9OA 1EWRA 2CK3D 4NCJA 2OXFA 1AN9A 1K1EA 4RZ3A 3N24A 3MIZA 4PZCA 1TM2A 3UANA 1M66A 2ACEA 3EXG2 3ZXIA 3RHTA 3K6BA 5I3CA 1TU4A 4C7VA 3QE2A 3OZAA 4FESA 2AD1A 5F2KA 2VI5A 3L9WA 2Z6VA 3QVMA 4OHUA 2HEGA 4W5QA 4JCHA 1E61A 5EHIA 3OQNA 1KWKA 5G4KB 2QPTA 1GSOA 5GVRA 4R2HA 2HHHB 2WT9A 2FWBA 2G9QA 4O2LA 3WGMA 1WNTA 3VYSB 4CKEB 4XPYA 3FPFA 3R7WA 3Q7RA 1XUOA 4X3PA 2G9ZA 2QD5A 1F1BA 3HCAA 1ZIOA 3JRWA 3HQ4O 3QVWA 3ZC4A 2IH2A 3TGPA 3GV0A 2ONKA 2ZE5A 4Q9KA 4RK5A 1MQSA 4BNJA 4YWQA 3ZXXA 3FF1A 1TA9A 1M3SA 2QG4A 2JW5A 4BFUA 3DMDA 4MIKA 2XCLA 1I14A 1M9NA 1VHWA 1QNLA 5ALJA 3H04A 3HHPA 5A6BD 2IM8A 1Y9ZA 4KFSA 4GRIA 4UXHA 3CUEF 3B53X 4X60A 2R11A 3AVPA 3LUDA 1D3AA 4JJIA 3EZGA 4LC0A 4AMUA 2WMDA 4D3SA 4FWBA 3AF5A 2JGMA 1Y7PA 5T3TA 2HLDA 1YZGA 1LS4A 3W77A 2C4NA 4J6FA 2P7HA 4ZLCA 2QM7A 2O0LA 3QVLA 1HY5A 2X0JA 4KACA 2JLUA 3D0RA 4AJ4A 1YU9A 3KT6A 1JQ3A 3M5WA 3R4VA 3KV3O 1Z8FA 5H0IA 2J3QA 1YAJA 1W9HA 4LQLA 1BJKA 3VYTB 3KU4A 4IQ0A 4CG1A 4TLAA 3GI1A 2ZI9A 4DA9A 1W88B 5ILOA 3LK7A 2VHTA 3WL6A 3CGGA 4POOA 4NP6A 3DH0A 5C5EA 2X3FA 5AK6A 3FR7A 4H0CA 1ISMA 3NDRA 2DM6A 4UVHA 2AWYA 1ISSA 4REOA 4NULA 4UBMA 4ZFNA 3T7EA 4JA2A 4YREA 2B6HA 4IV0A 5KOHA 3UTDA 5F5XA 3BXZA 2GHQA 3WDSA 5DEOA 5FWNA 1NU9C 1A7EA 3WLJA 5FKJA 4QJBA 2H7OA 2CLLB 1LQ2A 4JJKA 4D9GA 5IFLA 1AJEA 1BD3A 5B4VA 3ZJ4A 4GT1A 2PSJA 2VVTA 3BIXA 2CYBA 1TPZA 3AU8A 4KPYA 3AVOA 1W76A 1WM1A 4YK5A 2XCOA 3RR2A 2EQBA 5F9FA 4ALMA 2QXTA 4PQGA 4OHFA 3RRMA 4PZEA 3H1AA 3EZHA 1AB5A 2IGBA 5CCDA 2ILVA 5F21A 2QUAA 2JHGA 1FU8A 1JN0A 3CPEA 3AEKB 2PKQP 1EWQA 4U39A 1QOZA 1NMSA 3OAAD 1FFDA 5LMNB 2YJGA 1XZNA 4L15A 1TVKA 3LDHA 1DKLA 2RGWA 2PZMA 2Y2VA 3TLEA 2AWNA 3ZE7A 2QTFA 1C02A 2IYUA 3CUVA 4IDBA 4L5YA 3CRNA 2NZUG 1AIPA 1CP3A 4FZRA 3ZZNA 4EP1A 4CMGA 1U0RA 3H1EA 4PLVA 1E69A 1UXHA 5TJ9A 4CW7A 2OQMA 3MJCA 3UYLA 2XB8A 2VCBA 5E2IA 4K5QA 1N2EA 5ISMA 2ZD9A 4UVDA 4H31A 4WLNA 4PVCA 3TMAA 4FNOA 3IKJA 1G4AE 3H4VA 4YWHA 5HR5A 2ZUUA 1QCZA 4WADA 5ALIA 5EINA 3C18A 4HADA 4BDSA 2EJUA 2JEZA 3WXBA 4CMHA 2IHJA 1MVOA 4IDHA 8GPBA 4MKIA 2PRIA 3GELA 3PC6A 5F5LA 4W9NC 1TJ4A 1Y98A 5K6AA 2HPHA 1IZ8A 1EZ4A 3FW1A 4JJGA 1TE2A 3PR3A 1KC1A 2VTBA 4H3SA 4B8WA 4F4BA 1WMAA 4FQ7A 3TLXA 5BSWA 5T41A 1VYKA 3ZDRA 3G17A 5CFLA 2YOGA 3OF3A 1KNXA 2O5CA 1YBFA 2ZFUA 5JAOA 3G79A 5A5DA 3HBNA 5HW0A 5CX4A 3QBEA 2G25A 3PEVA 3QWHA 2X0NA 1Q1EA 1UAGA 5EFZA 3IR7A 1SVSA 2SHKA 3CNEA 3Q9UA 4Z0TA 1T5SA 4OQNA 2ZIAA 3PUHA 3PNPA 4G5RA 3E2PA 5AJHA 4JURI 2MYPA 3C5VA 4U3JA 2GSDA 1JKFA 4Q21A 2Y69C 3IQZA 3P32A 1DAHA 3FY4A 1GXSA 3OZ7A 1C5KA 1WY7A 3QEOA 1PI3A 1C7ZA 1E92A 2VKTA 3SWWA 1QFMA 4LI0A 5IULC 4FUTA 1U3CA 3CPHA 5LZ9A 4WQMA 1XTPA 3HCBA 3AHFA 2CYCA 4LTNA 4EPXA 1P7CA 3M2TA 4PBTA 3EGOA 3LYAA 1U3GA 3A4NA 1FNNA 4GQBA 1IBKB 1TT5B 2JLBA 5LU8A 2P6VA 4G89A 3PHJA 3PTLA 4FE7A 4U6SA 3ZCQA 2YIVX 3ZHSA 1MVLA 4FDVA 3EBLA 4Q18A 4DHWA 2ZSBA 3E1KA 2FPMA 1N3LA 2ZT8A 3BGDA 3KKQA 3RYHA 4JU8A 2WT8A 3ZNNA 4Q3BA 2D2FA 2D0OB 3NEYA 3PR2B 1T1SA 1JEYB 2PAAA 2WMNB 2IZ7A 3NGXA 2D1FA 3R0XA 3NGMA 2OAP1 5I9LA 1OFUX 4Z4CA 5AM4A 3QKSB 4XUGB 3WP1B 2V7GA 3CZ9A 1N36B 1YJGA 3QGMA 4LWOA 3CINA 1U0JA 3LUAA 4E94A 2VRCA 1J0CA 4UE6A 1FFYA 3LCCA 3UMRA 3F96A 1AUXA 4NBSA 4QPZA 1YB2A 5KHLB 1YKSA 3Q5GA 4F56A 1R4NB 4EL0A 3U4CA 3A1DA 2H18A 4N5IX 5SY9A 1J33A 3AMVA 3MWFA 4DDMA 3L8DA 4F92B 4U4AA 4IEEA 2CVFA 3QEJA 5T4EA 1CDOA 4Q9JA 1WO8A 1OW3B 1XQYA 1ZA1A 3RODA 4V0NA 4RJIA 1IM2A 4E2XA 4JEAA 3V7WA 2XGJA 2OCGA 1USWA 2P5UA 2IXOA 4UBJA 5ENDA 4BUZA 4U7JA 3FPKA 1YR1A 1B1CA 3QYAA 4MRAA 3GBVA 1L2TA 4JI0B 1JU9A 1GAEO 5BWOA 3Q11A 5BPFA 4EG6A 1GTSA 3L4BA 2XAUA 4HAIA 2WY2D 2IIPA 4P7KA 3RAJA 3C24A 4EMSA 5K2OA 4K8RB 3A4VA 3A9UA 3GFOA 2ZJOA 3IUMA 4WW0A 1VGVA 3W1EA 1DEXA 4M88A 1GM5A 3KK0A 2ZW9A 3GNQA 2XBUA 2ZUBA 3D4NA 1DAKA 1BIFA 4AY3A 1G6Q1 3C7JA 4MAFA 5AW1A 621PA 3KOUA 3OOHA 1XJCA 1WLYA 3AVVA 1MU0A 2WFZA 1ZAYA 2GZ3A 3M6MD 5JAQA 4C2TA 5A9TA 5K0ZA 3P9XA 3SICE 3VUFA 3VBEA 3C6QA 2VPQA 2V7BA 4A82A 1YR9A 3I09A 4V0OA 4LE0A 3P27A 1GQSA 2BEVB 3UGJA 1VKNA 2I76A 4GOKA 4RSGA 5DOVA 4Q4DA 4NPCA 1UAYA 2X5OA 4D46A 2EP7A 4JYBA 4GDMA 1WCIA 3W7AA 4N3CA 2FMFA 4R8VA 2VHZA 1O8BA 2R79A 3K1IA 3OQPA 4W5JA 5ALGA 4G24A 1SBHA 3EIOA 1EWVA 4KIJA 3DS8A 2WP8J 4J07A 4KXQA 5K51A 3U3FA 1FP2A 1QFZA 4BVFA 2ZVDA 3SR0A 1MC4A 4XARA 4E7OA 4KCGA 2II6A 3PWTA 4R54A 3LBIA 1HLPA 3ZWYA 2BDTA 3FDQA 2VAXA 1RLJA 4NTAA 2ZI3A 1SOWA 1BRTA 2V96A 4G0ZA 1Y5MA 4MUNA 1BHJA 3GEMA 2GRJA 3D7SA 1W0CA 2PT9A 1TT5A 4UQOA 2AFHE 3FCEA 2YWFA 2VK1A 2OGWA 2XCUA 1VYUA 1T0BA 1QIEA 3AG4C 4E11A 1E7SA 2GBLA 4DRXB 2B8EA 3K09A 2H5JA 5FBVB 3ER6A 1KDVA 2W4MA 3HSKA 3S68A 3HJFA 3PYMA 5CXUA 4QOJA 3HVRA 4A7PA 1NF3A 4LHWA 4BUCA 2DERA 1K04A 2I66A 5GJCA 3HYCA 3ZJVA 5ITVA 4R0VA 1GVNB 3FVQA 1RMVA 1DQPA 4HPXB 4ASUD 5EJ6A 1B8UA 1NXPA 3OTQA 1AV7A 1A9ZA 1C1DB 1NXSA 1ZH8A 1J20A 2DHCA 2BGWA 1ST2A 1H5UA 2GZRA 5FB3A 1W0KD 5M04A 3RKOF 3ZE1B 5BN5A 2ZUTA 2HDHA 1R4NA 3WB2A 2BLLA 2UUBB 5DHFA 1FTQA 2A57A 2AMJA 4ZTZB 3N8KA 4JBHA 2OFOA 4QBIA 2XKKA 3TD9A 1FXWF 3HTXA 1N8NA 4Q5IA 1ORVA 2WR8A 3HR8A 1NASA 2C2YA 2WM3A 4AIRA 4GLBA 1VG9B 4M0DA 2M6SA 4Q37A 3ICEA 3ZU5A 1RM5A 4OM8A 3LUJA 1ORDA 5BQGA 1OF1A 3RBZA 1RCTE 4DMHA 3LZDA 3LSTA 2ZQZA 5MN6A 1RS0A 4D4LA 2XV1A 3QBTA 1XMJA 2AUMA 4LZNA 4F4JA 3ET5A 1UZLA 2V7PA 3WE7A 4U5BE 1T2DA 5CGZA 3LX6A 2PS0A 5E1BA 5HMMA 3STVA 1ONPA 4RCZA 2RC5A 3G5AA 1LTHR 4YRFA 3ELUA 3X3HA 3EMDA 3FA2A 3I9NA 2O3UA 2EHJA 4Q93A 1RAGA 2A35A 4TSKA 5BXQC 1NI5A 2PCLA 1GGMA 3W8NA 3OCZA 8ATCA 1IHOA 1IK4A 1AY0A 2RGYA 2L9JA 1A76A 4OJMX 2GD1O 4NECA 1WZIA 5NULA 2PQ0A 1M1NB 4FYJA 5A5FA 2CVPA 3DNFA 1ZLYA 1B43A 2A6PA 1OR8A 5JVEA 4C7BA 2FPIB 1GGNA 2VTEA 1Z5ZA 1Y3FE 4NYJQ 2BEVA 4QDKA 3KC2A 5JQWA 2Y1LA 5J4LA 2NP6A 1UXGA 3IP8A 1Q5PA 4HYEA 1ZH0A 3DNMA 3R3SA 4YAFA 1QYDA 1CXZA 2JFNA 1ZNYA 1CIVA 2ZP1A 4RZHA 3ZEAA 4TVKA 1E9EA 2QTBA 1JXAA 1FVXA 2R8YA 1O94D 1ECGA 1KS2A 1JHRA 1NSTA 2A1TS 1PJTA 1MA3A 1XYGA 5IJZA 4Y30A 2WA2A 4EHLA 1RHMA 4KO2S 3WGYA 1VHJA 3BJZA 3ZDDA 1ULHA 3H9JA 1QR2A 3NWOA 4YCLA 1ZNXA 2P41A 4OIRF 1YQXA 1AHHA 3LY8A 2PFKA 2VUSA 1XQ9A 2FW7A 3OJEA 2WHEA 1GDHA 3DVSX 2J5QA 4RW0A 4DT1B 3Q7IA 5LZ8A 4QTZA 1QXSA 5BY2A 1NRJB 4KOAA 2XUZA 3CF0A 4LRQA 4MUAA 3C1UA 3OTHA 2QG9A 3S8EA 4KFCA 4JKVA 4EUKB 2FQWA 3QX3A 3ZH9B 3K2QA 2PRKA 1OROA 3RYIB 1ZUD1 4G4SP 4E5UA 4DJJA 3U37A 1N1MA 5FWXB 4NSNA 5B1DA 3OWTA 4D2IA 3TEFA 4C6TB 1VLVA 2E55A 1S1MA 4IKOA 1KYXA 1T3TA 2WB7A 4RHXA 1V48A 2Z1DA 2IXMA 4UPDA 3FX2A 3NHMA 3GGOA 3CKYA 2XOXA 3KNZA 2XXAB 1L5NA 3L43A 4MW7A 1GQQA 3VF0A 2C57A 3S27A 3VPAA 3AIKA 3GVXA 2FUKA 1GPUA 3HBJA 5COBA 2R8OA 3AQ4A 5IKMA 1G8GA 3ICQB 3VTZA 4KNWA 5T3UA 1LK7A 4LSWA 1NDHA 1UKEA 1IUKA 4CS9C 3K7DA 4L74A 4WXEA 1XZBA 3TMKA 1WMDA 2XSZD 1C3XA 5B2FA 2GDJA 2QVXX 2JJQA 3OE1A 3W90A 2CMKA 2NVUA 4DV1B 5G40A 4D4GA 3CS3A 1IEWA 3AI2A 2YMQA 4PG4A 1U8TA 1L9KA 1H0SA 1WDKA 4DQKA 2OOSA 2D8MA 2BR5A 2SNIE 2OT3B 3ZCVA 1TAUA 1Z25A 4GECA 2Z6QA 4AY2A 5B7PA 4QYXA 3ORHA 4B40A 4H60A 3V4RA 3S8YA 5JIBA 4Q7JB 4XIGS 2WV9A 5EXXA 1LLDA 3NT4A 5EHNA 4JLNA 4HH1A 4CIDA 1JJFA 3OOWA 1P6XA 4JBWA 3AETB 2FW8A 4G65A 3BE6A 1DXOA 3HA7A 4DRZA 2J5KA 3O38A 5FLXA 3RUAA 1JDTA 2UVPA 3EAFA 5I4CA 2VXCA 2HU2A 1D0SA 1EPUA 1LLCA 2R6AA 2C2WA 5F35A 3E7FA 4YP0A 2XWBF 3QMMA 4WY2A 3TFOA 1K68A 2ZOSA 3PRYA 4GSYA 5B53A 4JJ4A 2ZPTX 1NU8A 1IN4A 2P62A 3C45A 1A8UA 2HMAA 4L51A 3UR3C 4ZT4A 4QQNA 5BMOA 1S8NA 3ID6C 4PACA 4P0PB 5IF9A 2BM1A 1VJRA 1C29B 5A7HA 4CVNA 1JIIA 4NABA 4EDFA 3VZCA 4P82A 2JLWA 2QD4A 4JODA 1E2BA 4BHTA 2NUPB 3IDSA 2PK3A 1V4NA 4DYHA 4QOEA 1G3MA 4U7DA 1H8HA 4CIBA 1RTKA 1PHRA 4LF6B 3PD1A 4P86A 1SM4A 3Q7PA 4QBTA 1YA7O 2JAOA 1V11B 1ZN8A 3M6IA 5T5QA 3L7NA 3Q41A 3PXGA 1RXCA 5CH3A 4Z4FA 1HEUA 3VHLB 4GZMA 5I7AA 2NXCA 2G83A 3A14A 4LISA 1JFFB 2GUWA 2JGNA 3DFFA 4RCYA 1C14A 3L4BC 3MOSA 4ZYZA 4BU1A 3KSZO 5JNVA 5I9IA 5IT4A 3P0IA 5HYVA 5AI5A 3BEHA 1DIAA 3NATA 3PQDA 1WULS 1VIVA 1OI2A 1G4UR 4DANA 1LLFA 3GMTA 2X8WA 1FQWA 4LC1A 4GNRA 3PXDA 1L4BA 2CHQA 1HT2E 3OKAA 2W43A 3MYRA 4WERA 1OV4A 5LYYA 1YDEA 3CZAA 3LCVB 1U0OC 2A3RA 4FGSA 3FTNA 2G80A 3SF8A 4C6TA 5SV2A 3BIJA 3GIDA 3TRIA 4FDLA 3ZKWA 5JNUA 3VKUA 4ARVA 4BX3A 1E3TA 5ESRA 3I5QA 3EG9B 2HREA 3C97A 1KFCB 1A9PA 3OTIA 4GMHA 1XTBA 3CRMA 5CVEA 1Z7Qc 3ROQA 1U7XA 2PH3A 2XXAA 1U2DA 1EQ2A 3T5GA 2QQ0A 3C0KA 1WXEA 1NVKA 1PQWA 3IUBA 3N2LA 1P1HA 4BJ5C 3LLVA 3ZPXA 1BVUA 1SBTA 1F5SA 1T4DA 1PT8A 2LSEA 3PXUA 4OFWA 4Q1FA 3B5EA 2YX1A 2BAGA 3BHNA 3HP4A 3WGQA 1QQ6A 1MT0A 1L5WA 2WAMA 5I8WA 3F6CA 4BQNA 1SZIA 1VXOA 4YIKA 1KAQA 1BXRB 4AZSA 4ZI7B 1WLSA 3FMOB 2GDCA 3K5HA 4ER5A 2CDCA 3JQAB 3HB9A 1IBSA 3IKVA 3OP1A 1TJ3A 1FTSA 3ZZMA 5ITZB 5IYZB 1T24A 3LV8A 1AKQA 3WFZA 1NMZA 1HC7A 2WSYB 3PUXA 5EJGA 2IEAA 3B7PA 1LK5A 2QEQA 3JVEA 4HQFA 1J6UA 3GH3A 3RC9A 3C8ZA 2DU8A 2ZBGA 1PNQA 3T54A 2IZ6A 4PR3A 2ZIXB 3EFOB 4LNUB 3C8GD 1GQFA 4K6MA 3BXOA 1N7IA 2YOFA 3PKZA 2JJYA 2H1FA 3K09C 3OCVA 3AETA 3WI7A 4I9UA 4L8WB 4E03A 1YJCA 1FYDA 4MKFA 3GJ6A 4B6FA 1LQTA 4MPRA 5I5GA 2P9EA 1A5ZA 3QXCA 4JS0A 2NNWB 1GZSA 2QRMA 1POWA 3A6ZA 1WXQA 3FOFC 5A3RA 3JVVA 1QOQB 2P4EA 3EZIA 1V37A 3FPSA 5JBIA 1IUNA 2GAAA 4I1RA 4YJGA 3ZU4A 2H1CA 1DBIA 1E9RA 4KQ6A 1X1EA 4XEVA 1VMEA 5FRDA 3DE3X 2XLEA 5AR1A 1QHIA 2VZLA 1KO5A 4PYIA 4OREX 3KEOA 2NO0A 1R0RE 5DBOA 5K3EA 3RTDA 3SMVA 4MNTA 1H2WA 4FBMA 3TPFA 3EPPA 3Q6MA 4AY4A 4C4XA 5K5EA 4BQSA 16PKA 4XQ1A 3PKJA 2J5XA 5HS4A 2VWQA 1YA9A 2EDAA 3TBHA 3N59A 2OC4A 4PQYA 5IH3A 4OQ4A 1UBUS 1UIRA 3NONA 2JIZA 4YONB 2XTMA 5JS2A 3WBFA 1JFFA 1UPXA 2BR4A 3UJPA 2F1JA 3S3TA 1T3SA 3ZHXA 4DB2A 4TMXA 1HE1A 2QK4A 2BBWA 5H83A 2ZJBA 2BWJA 2DLNA 4WXRA 1G5RA 1JXOA 3WQHA 2OP0A 4M0CA 2ZJ4A 3GLUA 1F12A 4KVFA 4LYGA 4F6LA 4Q1CA 3L7IA 3HZRA 3GZNB 1HQDA 4EY4A 4F93B 5C80A 2BJWA 2W2LA 4X5OA 5AM1A 1TEZA 1HDGO 3UV7A 1GDTA 3QH4A 1LB1B 3R3UA 2JIPA 4GM0A 4BFYA 2ZAOA 4I1VA 3JASA 1YTLA 1VL5A 2PUTA 2V9ZA 4YR9A 4R68A 1I94B 4YQYA 1XYVA 5K3DA 4B44A 4N47A 4CF5A 3AKZA 2Q4BA 1GQ2A 5CAEB 3WHKA 3LW8A 2G88A 5H3LA 2GBGA 4NE2A 3PHLA 1SUEA 3IBFA 1I4ZA 1LRKA 2I2AA 3DCNA 1ZESA 1I51A 1ZOPA 3DLHA 2A1TR 4I3FA 2C2BA 1B6GA 2WKSA 4XI9A 3UAOA 2Z2IA 3VJMA 4K2HA 2INGX 3W8HA 3BGWA 1AV6A 3A05A 1VHTA 2OCAA 1W4CA 3KAQA 4CMIA 1W46A 2NYRA 3L9XA 2WFAA 4OYHA 2EBUA 3V8QA 1O2DA 1RQNA 2PRSA 4HVAA 1K8RA 1Q0QA 4JB3A 2OEXA 1FYWA 4AB1A 2UYOA 3QIAA 4KPUA 3NYQA 3I2JA 1WY5A 2WMYA 3N05A 4NXNB 4DDKA 4NFSA 1G9TA 5F51A 4W8HA 4PSCA 2XUAA 3NYWA 2FB9A 2AVKA 3EZ2A 4RD3A 5DHRA 2IHVA 4GKKB 2QRLA 3OMLA 5EG5A 1ZOOA 2ZIXA 2I8LA 3OCUA 3EFOA 2FMKA 2Q4EA 4LNUA 4KB5A 3O0DA 1CIJA 5C37A 2DFVA 2QL5A 2D7CA 2DCMA 1HTTA 1UKCA 4TTQA 5KNDH 2QQGA 3GY0A 3FB4A 2PXXA 3S40A 5MN5A 4TTAA 2ZITA 1LH0A 1ADBA 5T6MA 3PXXA 4JC4A 3W5CA 1J2JA 3X1KA 3H5LA 1PJ3A 3R3JA 1G2OA 1VLQA 2P9HA 1XEFA 2NZVG 5LL6P 1JF8A 3R3XA 3PLRA 2ZANA 3VNQA 3HXPA 1R7RA 2HWXA 4A5SA 4L07A 4ZYUA 5LP1A 3W79A 5JNRA 2IZZA 4JC0A 5TT1A 5AHOA 4HQNA 4ILEA 1GADO 4JN6B 2XS8A 5FL7D 2D0DA 3KKEA 2IUYA 4E2FA 4MUFA 4TLDA 1O89A 1RBMA 1H2HA 1TYBE 1QCYA 3TL3A 1UBCA 4EGAA 2AFHA 4C7KA 2VOEA 1PQYA 3DEAA 2RMKA 2ATVA 2BUAA 4KC9A 1ZS9A 3LT5A 4LMAA 1M0WA 2LZ0A 1KY2A 2I6FA 2XKBA 1X94A 1DWUA 2GRAA 5FBHA 5B3AA 3BPSA 4CEIA 2QNRA 2DQSA 5DXFA 4XWJA 1G5PA 2JFOA 1W1IA 1T6YA 2X58A 3EIQA 4D6PA 3RSSA 5MHTA 5FUBA 3Q9NA 3U9TA 2GPTA 4IXMA 2Z2XA 1GGEA 1HDRA 1SUIA 4IV5A 2BC9A 3F5FA 3HN7A 1MV5A 1JMYA 1Y4DE 3KPVA 4JGBA 4WUTA 3UWMA 3NS7A 3RIEA 1B8VA 2H08A 4E14A 1TVEA 3HUUA 3EPLA 4ND3A 1DRKA 2WM9B 3GZNA 2G63A 4ZU1X 2HSGA 2YWDA 2OV2A 3A1CA 3GRKA 4TQUS 2IU0A 5A7GA 5CVCA 3BHJA 1S7GA 1I2MA 1C8LA 3RHFA 2WWTA 2W6MA 1GN9A 4DIKA 3VZSA 1VE9A 2IYOA 2DULA 2Q7OE 4TWZA 4XW2A 5HIIA 3E18A 4EJSA 3UCXA 2GK7A 2ZRLA 2RH8A 5CAEA 4E31A 5BO5A 4ZDIA 2WTUA 2K87A 4JLKA 4U1RA 1UDRA 2YYYA 3EEIA 5JRJA 2GEFA 3QXGA 2G72A 2F90A 4IIYA 1UBOS 2D7DA 1YZKA 4ZHQA 2MOKA 1FPQA 1X0VA 1SXIA 1JG3A 2P90A 1EP2B 2P61A 3OM0A 3UEOA 5IX8A 3I8SA 4L73A 3AB3A 3ETHA 2Y66A 4M98A 1P0QA 2FZEA 5DF1A 1VL6A 3LUTB 1Z74A 3C6ZA 1W2GA 4FR5A 5AVQA 4ZQGA 3Q7GA 1BCSA 5KSOA 1KI1A 2VDLB 1IJBA 2WU3A 2G0TA 2Z95A 1A2BA 1CYDA 2JHAA 2BKAA 1VJDA 3G82C 1PBTA 4OHOA 2D62A 3GHYA 4P4NA 3IAUA 3AC0A 3ICPA 4OM7A 5A3JA 5AQ1A 4B6SA 4I4NA 3TLKA 2V6IA 1XTRA 1GPWB 5H82A 3LPNA 3UNXA 2WYHA 4MVUA 4L8YA 3NYRA 1BS2A 1ACMA 3CIOA 3CEHA 4CQJA 3WZMA 3GAAA 4YMSA 3DOCA 2QRZA 1GKUB 2ZQ5A 1RNLA 2AN5A 2DYRC 1ECFA 2HUPA 3LNTA 7MHTA 1NM5A 2SBTA 3AI3A 4ZI7F 1SCDA 1VCHA 1Q19A 4QRHA 4G4GA 2EGGA 1A0OA 3UG6A 1X9GA 1L5VA 1TEHA 1KOLA 4Q4LA 2QMYA 1ZIPA 2H07A 4KQGA 2CWDA 3O75A 5F28E 2HR1A 5IYZF 3V48A 4F46A 1LRLA 1S2IA 2P67A 3UJ9A 4RTPA 2Q1TA 4J3NA 3B0VC 3O2SB 4K8OA 5GQSA 4DR2B 5M29A 3T7SA 5HPYB 2OHIA 1JNXX 2L18A 3TW0A 3LL7A 4B3RB 2ZJFA 4M7OA 1OXSC 4FGJA 4BWGA 4E6EA 4TTRA 1WKCA 2VP4A 4GU5A 1QGUB 1OCEA 3PDJA 4IO0A 1MQAA 4Q0MA 2OHFA 5KOHB 4ENQA 2UXBB 3MJVA 3FCXA 3ONEA 2Q7DA 2OR3A 3ROZA 2OO5A 1I4EB 4DJAA 1DWPA 4BBJA 1IZMA 1M6WA 4BVEA 5H68A 5KYTA 2PUGA 4IKEA 1P9RA 4UHKA 4AWBA 1SG6A 2YTZA 3KPJA 4DDWA 3NBFA 1OU0A