1J8YF

Signal recognition particle conserved gtpase domain from a. ambivalens t112a mutant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
295
structure length
291
Chain Sequence
LLDNLRDTVRKFLTGSSSYDKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIERREWFIKIVYDELSNLFGGDKEPKVIPDKIPYVIMLVGVQGTTAGKLAYFYKKKGFKVGLVGADVYRPAALEQLQQLGQQIGVPVYGEPGEKDVVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEEAALLEEMKNIYEAIKPDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELEVFNPRRFVARLHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SIGNAL RECOGNITION 54 KDA PROTEIN
publication title The crystal structure of the conserved GTPase of SRP54 from the archaeon Acidianus ambivalens and its comparison with related structures suggests a model for the SRP-SRP receptor complex.
pubmed doi rcsb
source organism Acidianus ambivalens
total genus 99
structure length 291
sequence length 295
ec nomenclature
pdb deposition date 2001-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1j8yF01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j8yF02
2ZI3A 2ZJBA 4OHYA 2ZR9A 1II8A 1YR8A 3RDPA 2QENA 4UQOA 4TT3D 4TLAA 3AB3A 3CRW1 2GESA 4QFMA 3GJXC 5KDOA 3CBQA 3UMFA 2YWEA 4UXJA 4OK6A 4URXR 3QQ5A 1VHTA 4II7A 5GJWC 3NIBA 4JIMA 5FBRB 4LWZA 3VU9B 5JRZA 2CMKA 5FH9A 2LWIA 1KMHB 2N42A 1FTNA 4GMXA 1G8PA 1N5JA 3WYGA 4L8GA 4DXAA 5HKKA 5BXQC 2CDNA 1MRNA 2J7KA 1P62B 4MKIA 5DISB 1RZ3A 4RZ2A 3THWA 3IQXA 2VSOA 4AIIA 1TL7C 4D80A 1BMFA 4N3NA 2GDJA 1K6MA 3CF0A 4X8HA 3PQCA 1Y63A 1AN0A 5L3QB 4EUNA 2OO7A 4DLZA 4X8OA 3GLFA 3D6TB 1W4CA 1UBCA 1MRSA 1KY2A 1P2VA 2GRJA 4BFYA 4EQ6B 3OAAD 1T5LA 2ODNA 4Z8YA 2R44A 5KTYA 5AJVB 1E2LA 2ZJ5A 4QBFA 3SDZA 2BHRA 5G41A 5EXSA 1NLFA 3EZ2A 1X3SA 1E2PA 4OHXA 3AF0A 3BD9A 4KV9A 5KDDA 1TF2A 2C96A 2W2VA 2REOA 3MG9A 4E07A 3CPHA 4A0HA 1DS6A 1G3QA 4Q18A 2IYVA 3QIAA 3AKCA 3CR7A 1MR3F 2GF9A 5HTKA 1X8LA 3FKSA 3WNDA 3S1AA 4DSTA 3THXB 3C4JA 2EFCB 2WJHA 1E79D 4CGZA 3U6KA 4S35A 1EWQA 2ZS8A 5AUPB 1BYIA 2C78A 2HT6A 5HE9A 4EFNA 2DY1A 5EZ6B 2D7DA 1JPJA 1W0JA 5JFGA 1WGWA 4DSOA 4UNPA 2GAOA 1F2TA 3BORA 2O0JA 2Q6TA 4LBYA 3CX8A 4O0MA 5J40A 1NBME 4DLUA 4L16A 2DR3A 1XFAA 2ERXA 3BOSA 3CPJB 1E9RA 4A8JB 1YR9A 2OUKA 3HP1A 3KL4A 4MYUA 3FGNA 1G1MA 1P3JA 4PO1A 4BFTA 1J8MF 1ZU5A 4PC3A 4CYMA 5KO2A 2UZIR 1TMKA 1YVDA 2YOGA 4TSFA 1CU1A 3D31A 3VHLB 2F7SA 1OW3B 4FMBB 4Q66C 3K0AA 3R9WA 1T8TA 2P3SA 3AP1A 2O8CB 5EE0A 4I81A 4TMXA 1E0JA 2CBZA 4A4DA 2CVHA 4LRWA 2ZE5A 1GL9B 2ZTSA 5L3RA 4F4IA 3U3KA 1VCOA 4GP7A 5JS8A 3LLMA 2XGJA 2ZJOA 3UIEA 3W6PA 4WXPA 4P4UA 1XTRA 1N6IA 3X1XA 3UWKA 3IHLA 4BUJA 2IWRA 5JCZA 1F60A 3WXMA 3GLHA 3VR2A 2P6UA 4Z54A 1DARA 2O8EB 2BV3A 1GOTA 3F5FA 2CHQA 4KSBA 4JJKA 1XJQA 5J4KA 4LJ5A 3QI2A 3TQCA 1U8AA 1PLLA 1ZUNB 4CEJA 2OV2A 2WV9A 5FR2A 2IS1A 1PV4A 1KHTA 2P5TB 1E1RD 4CDGA 1ZBDA 4ZCLA 3IILA 4TQ9A 1G3MA 3U7HB 5AR1A 4JVNA 3T15A 3F0TA 5HR5A 1E9DA 3GLGB 3PUWA 1S2MA 2XTZA 1XEXA 1F5NA 2XX3A 4FMCB 5CM8B 4PHTA 4XOIA 2ZYWX 1ANKA 1MO5A 4Z1MD 1T6NA 1Q12A 4B48A 3MLEA 1OPXA 1N6PA 4L9WA 1Q3HA 2DYKA 1CRPA 3NH9A 2IK8A 1VYUA 1KSGA 4IOKA 4A6XA 3CIOA 4B2LA 1FP7A 2AXNA 4IHQA 1GTVA 3GEEA 1Q57A 2BCGY 1XPOA 5L3VA 3B8HA 2BKEA 3LRPA 4H1VA 5IDVA 5IT5A 1YHNA 2FX3A 1XRJA 4V0ME 3B1VA 4OQFA 4D4MA 3QBVA 3BB4A 1IN8A 4DIDA 1W2GA 1GVNB 2YC2C 1Z6TA 1M7BA 4CT5A 4HB0A 4QM6A 2B6HA 2CXXA 4URYR 3CH4B 4DDVA 1Z06A 1ZNXA 2GF0A 2IUTA 1F2UA 5CYPA 1NLYA 4WA7A 1Z8FA 3VFDA 3SYLA 3E1SA 1D5CA 3MSXA 2FFBA 2ORWA 2FPMA 2Q3FA 4KFUA 4A6PA 3HU3A 1COWA 2WICA 1KI2A 1KI6B 2EFHB 3NC1C 4I4LA 3RABA 4AKEA 3UXMA 5IF9A 1R8QA 2RGNA 2ZRNA 4LYFA 4RD2A 4Q9KA 2NTYC 2F1HA 1Z07A 4BFXA 5HKKD 1W1WA 2BDTA 1UKYA 4PXAA 1JXOA 1D2MA 4O25A 2FJUA 2RKOA 2FA9A 2J7PA 1KMQA 1BMFD 4US1R 2D74A 4JLMA 3AP2A 3EZFA 4BLTA 3B2EA 3NVAA 2WMOB 3A1TA 3A58B 4NH0A 1IHUA 4PAMA 2FGJA 2VO1A 1KAGA 4JT4A 5DI3A 2FEOA 1TUIA 3ZZTA 1U90A 4TWZA 4EPVA 1Z0JA 2VP0A 4GZLA 8OHMA 4IJMA 4EPXA 1WBDA 2OM2A 2FGKA 2WJJA 3LX5A 4Q4JA 4MKGA 1NSFA 1UBFA 2ZAMA 1GG2A 1DO0A 2PT5A 3SU8A 3T5GA 4TL7A 5L8VA 4HLUC 4HAVA 1E2FA 2IF0A 2QSZA 2QL6A 3H4MA 1CR4A 1W5SA 3MMPA 3FKSD 2CLDX 2NO6A 4US2R 4LHZA 3AF4A 3BB1A 1NMZA 2P5SA 821PA 4QXAA 1VYVA 2WJGA 3Q9LA 4KLZA 1N0UA 3P20A 5J4VA 5FTMA 2CCGA 2IHBA 1N6RA 4F4CA 3LBIA 1W0JD 4OJKA 1H8ED 3IHWA 3LD9A 3MJRA 4NYIR 3CM0A 4OI4A 1YE8A 5FPHA 3TUIC 4HAUA 5J4HA 4G3XA 2BBSA 3VAAA 1N2CE 1QHHB 4JLDA 2GAAA 4C30A 4N0DA 1W36B 2PLRA 1Z2CA 3GEHA 5FTJA 1XPRA 1IY0A 2AFIE 1AZTA 3GJ7A 4M1SA 1BS1A 4ZPXA 1DPFA 3U7EB 3H86A 4TSFD 1JJ7A 2CCKA 4L5BA 4GT1A 3B5JA 1KIMA 4ILEA 1ZAKA 1LTQA 1K5GA 3KJHA 4O3MA 1S9HA 4DCVA 1KDTA 2XAUA 1NF3A 4MQBA 2J5XA 1O3YA 3EAQA 3Q7PA 1FMLA 5TXGA 5FI0B 5GJVC 1AGRA 4TL8A 3T1OA 2QMOA 1E4YA 1HTWA 1N6HA 2RCNA 1NMXA 3WYAA 4C0AC 3SBDA 1RJ9A 2AD1A 2ZRGA 2ZITA 3OEHA 621PA 1CP2A 3ZQJA 4MGZR 3PG5A 3T1VA 2VQSA 2QPAA 2A9KA 3B9PA 4PQYA 4Q9HA 1XD2A 2QN6A 4NYMR 3SQXA 4TYYA 5EP4A 3BC1A 4HAXA 3QY0A 4I1SA 3TRFA 4B47A 1CJTC 4R71A 1VECA 3FFAA 1HV8A 3RHFA 5DH9A 5ELXA 3U2QA 5F2EA 4RFSB 5CDFE 1DAKA 3V9PA 3IKJA 1MOZA 2QP9X 4B32A 2W6JA 2GCOB 1I2MA 3BGWA 5E95A 3FMOB 5JEEA 2PBRA 2JLRA 2QI9C 2ZRCA 4ESHA 5JJLA 4JKIA 2Q0HA 4NONA 1EGAA 5EUQB 2FFHA 2VHCA 1ETUA 1HUQA 4YMTA 2RHMA 4TYPA 1DAFA 1XNJA 2OAP1 2EYQA 4NKRA 1RRPA 2A2ZA 3NG1A 4NL4H 1ZW6A 1Z29A 4QM7A 3MWYW 3BRWD 4HI0E 3AVVA 3EA5A 2FF7A 4CW7A 3RC8A 4B6EA 3LVQE 2OFXA 2BBOA 1AKYA 1E2IA 2EW1A 4DDUA 3GMTA 5EQTA 2ZIAA 3RS0A 1VCNA 4FWTA 4HAYA 3EWSA 4HEJA 2O8BB 2VP4A 3K09C 5G40A 3TUZC 3QKTA 4HZUA 3KKMA 4Q4HA 3QPWA 3QBTA 4AG5A 1XTJA 1CJKC 1G5RA 5TY0A 5FPTA 3PITA 4JLPA 1R5BA 4DB2A 4ABYA 4ACAA 1KJZA 2EWWA 4LV6A 4LK2A 1OH5A 3O47A 3GEIA 1JR3E 3LFUA 4FINA 4MDFA 4LHVA 4ARZB 4BFUA 1RW4A 2V6IA 4O2LA 1AS2A 3VNUA 2VHJA 1R0YA 4KLNA 1ZIOA 4Q47A 1COWD 2YNMA 2ZRLA 4Y0AA 4ZI2A 3QXCA 1SZPA 1CS4C 2NG1A 3CX6A 1DEKA 2G0TA 2NIPA 3C16C 3EPLA 1ZJ6A 1HE8B 1HA3A 3VQTA 4Z51A 4CEIB 5F98A 1HT1E 1AM4D 4H9GA 2J7PD 3R8FA 1E98A 3LVRE 1S8FA 3EC1A 3RWMB 5JCPA 5LB4A 4LHYA 4B3CA 1OXTA 1CR2A 1JEEA 2BMFA 2C04A 3DMDA 2XXAA 1ZMXA 2QORA 3L0OA 3P26A 4W5WA 3GFTA 2IS2A 4XWAA 3X1ZA 1JI0A 1G4AE 1Q1EA 1V43A 5DLQC 2FMXA 2WBLC 1CJUC 4BRUA 2AD5A 4ZCMA 4HATA 1W0KA 3NBFA 4MYHA 2KWIA 1FOEB 1SVSA 2OCBA 3ZVNA 4Q7LA 1HH4A 5JZVA 1JALA 3M0EA 2RGNC 3NTUA 4NCNA 2WKRA 2ZYVX 4LY6A 3EW9A 4Q1EA 4ZIRA 4IW3B 1ZP6A 2ERYA 1OH6A 1XTQA 5B57C 5CB8A 3TR5A 2YHSA 1XMJA 4JVMA 2CHGA 1E94E 4DLRA 1G6HA 3LX8A 1KSFX 1Z6YA 3FDIA 2A5JA 2FNAA 1H8HD 2JAQA 2ZR0A 1QZXA 2ODEA 4TQAA 4JLBA 4FW9A 1TEVA 3CNNA 1P2UA 5FR1A 2RAPA 3MGCA 3C5HA 5D3MB 5FOSA 1D9ZA 2BMJA 4V0LA 4WOPA 4EDHA 3SR0A 3GLIA 3L0SA 3GLFE 2KBEA 3B9QA 2QPOA 6Q21A 5FL7A 2Q9BA 4OBEA 3JVUA 3SOPA 4FMDB 3ADKA 4OHVA 5CYOA 5KU1A 5DSZA 4C0JA 1FUUA 2B8WA 2PEZA 1NN1A 4JSYA 2CJWA 2GKSA 4Q5IA 2V1XA 1CLUA 2BMDA 1SXJA 3DKPA 4JBXA 4EFMA 3OAAA 1SVKA 2GJ9A 5A4JA 1FW6A 1A1VA 4MGKR 4LX0A 3HJNA 1VKJA 1K5DA 4MH0R 3GJ3A 1QF9A 3UMSA 3KXKA 2OXRA 4OYHA 2HUPA 4FMDF 4P4TA 4WXRA 4I99A 5EJEA 4PHHA 3CX7A 1MKYA 4V03A 3U60B 4JLNA 2XJ4A 1KJYA 3HWSA 2IC5A 4E22A 1HQCA 4D81A 1W2HA 1G291 4M9SA 1D8TA 4NCIA 4LPKA 5BN3A 1U99A 1FNNA 2GK6A 4IKEA 1E2KA 2BWJA 3NHAA 3W8RA 2AFHE 1P72A 2VPPA 3FHCB 1J70A 2LKCA 3M1IA 2CVFA 3UG7A 3SQWA 1PVOA 1BYUA 1UJ2A 5JJIA 4GOKA 4PX9A 3ZZUA 2ORIA 1TU3A 5DGXA 2P6RA 2GVDC 3LXXA 2WWYA 3D8BA 2QT1A 5TVKA 1TQ4A 3AF2A 2J59A 5JI2E 1OXUA 2BOVA 1QBKC 1YJ5A 2QQ0A 2YINC 1ZM2A 3PUYA 3ZQ6A 4BLPA 4C9BA 4BEBA 5M04A 1UAAA 4MRRA 2R8RA 4OI2A 2WAXA 3Q85A 1X1SA 3U3MA 2W6JD 2JATA 4B43A 2IYZA 2NPIA 4D0LB 1Z22A 2R65A 2WSMA 1Z0AA 3VR1A 4DRZA 2O8DA 1GL6A 3FE2A 5KSPA 3KQKA 4PC7A 3N70A 1ESNA 2BM0A 3NWJA 3C8UA 4OQXA 4Q4AB 2G77B 3BWDD 2GXAA 1FX0A 5UKDA 3PUZA 5JBQA 2FH5B 1OXXK 2IXGA 1G21E 1M1YE 4BPBA 4JYBA 1RPZA 1N25A 1P75A 3T12A 3ICQB 3QXSA 3PEUA 4I1UA 1L4YA 3PV0A 5GVSA 1AKEA 1CJVC 2BM1A 2OT3B 3BH6A 2VP5A 3P32A 2H8KA 1VIYA 2IYRA 3N2IA 1OV4A 3G5UA 4RZUA 1M2OB 4M1OA 1FQKA 3J81k 3ETLA 5GJBA 2YZ2A 4RFVA 4MKHA 4RSGA 3B78A 2EYUA 2J41A 4TTQA 3WY9A 2X1VA 2A30A 2PCJA 3FMIA 3ZD7A 4DJTA 3L8ZA 2VP2A 4NTZA 4DLVA 2EVWX 3EX7C 4Q7MB 1W5TA 4RD3A 4PC6A 2F1JA 1SKYB 4KSCA 1OLOA 3JZAA 1Z3IX 1KI1A 1G8FA 2GETA 1OFUX 3EZ9A 4HUQA 4XVRA 5AJZA 2K5UA 2BIFA 5L3SB 1FFHA 2FU5C 1DBSA 1E2GA 1J2JA 2XITA 2QNRA 3LW7A 3GJ4A 5FI1B 1GP2A 3U6BA 4LJ8A 1NRJB 4TTPA 3IO5A 2FSGA 4Z1MA 2HJVA 2C8VA 2F43B 4LV5B 2C03A 3KQUA 2ZS7A 4GMDA 1GUAA 4D0NA 1A2KC 4ESVA 1WE2A 2WWFA 2KI5A 4ASUD 4D4JA 3KTAB 4LUCA 2D4HA 4HB3A 1E4VA 2IW3A 5EE5B 4YMVA 1U0LA 3QF7A 4E09A 3K70C 3W3AA 4Q9IA 4JLVA 1W0KD 1N6OA 2GNOA 4BZQA 3AVXA 1PLKA 1GZSA 1S0UA 4OQMA 1WF3A 2GILA 1AQUA 3BAFA 2OG2A 1Z0KA 1YZLA 1GITA 2QAGA 3QKUA 5G53C 4D6PA 4UNQA 5FOUA 2WZQA 2ZU6A 3IIJA 2QEQA 3GCGA 4DT1A 3C7KA 5AUQA 1AZSC 2HEIA 2ZM5A 2HDNB 2C9OA 2ORVA 2XZPA 4PQRA 521PA 1QRAA 2WWGA 3K53A 4G1UC 2D7CA 3AF1A 4R2IA 3ZYCA 4BFZA 2R2AA 2J0VA 3QENA 2ZRFA 3CF2A 1KDPA 4LJ6A 4QHSA 2GJ8A 1KO7A 3BK7A 2AHOA 1E0AA 1E2HA 3U7FB 1ZUHA 2IX3A 4KFTA 4EJSB 3SBEA 4C7OA 4M1WA 4CZ2A 5FL7D 4RKEA 3CLVA 2MMCA 3GQBA 4C0KA 1US8B 2ZUBA 3W3ZB 1DVRA 4YONB 2C2HA 3JVVA 3QF4A 2WMNB 3RLFA 4UNSA 1SXJD 3EIEA 1EX7A 3QKSB 3W90A 5JSZB 2A5FA 4NZYA 5FUWA 1XEWY 4DEXA 1UADA 2WSSA 4YMSA 2O5VA 4GNKA 1L4UA 4ZKEA 3ZVRA 4BLRA 1G9XA 1Z0DA 1CKEA 3V4RA 1G7SA 3BH7A 5C4MA 1XZPA 1XXHE 1E2EA 4XD7A 2PZEA 1YR6A 2WJYA 5SZHB 4BZXA 2XNDA 1T3HA 5EUMA 4PC2A 2WWWA 1X6VA 1U9IA 3HYTA 2N46A 4XSGA 4TLCA 4YC7A 2ZYTX 2HYIC 5F9FA 2DFLA 5CK4A 4QHTA 1ZNZA 1ZM4A 3NKVA 2AN9A 3FB4A 4B73A 2V7QA 2AR7A 2O0KA 1H65A 2W00A 1NJGA 5CLQA 2J0UA 3SI7A 4QBGB 4XTCS 1H8EA 4MITA 3TMKA 1Z63A 3X2SA 1IXSB 4GZMA 2QZ4A 1A7JA 3WP1B 4KVAA 5SZKB 4EKDA 3K0CC 1II8B 5DN6A 4HUTA 2QA5A 2BBWA 1AS3A 1U94A 4DVGA 4YLGA 3LQQA 2XB2A 3R9IA 1EK0A 1P2TA 4NYIQ 2PMKA 4Q1AA 2ZXUA 4M9QA 2CLSA 3AVQA 2J87A 2WWIA 1MV5A 3CUEF 1T0HB 2ZI6A 3FYHA 2IA5A 4RD4A 3OIWA 4PAQA 1KK3A 1KI7A 1Q1BA 4PTLA 3NEYA 5LD2C 2RGGA 4OHWA 4FD2A 5E7JA 4EPRA 1ODFA 3O8CA 2NQ2C 5ANRB 3DHWC 1YKSA 3KKQA 1LV7A 2ZRPA 4IDNA 3THWB 2A5YB 1GRRA 3AUYA 1QG4A 2QP4A 3B60A 5SZJA 1SVLA 2HXYA 1OFIA 2QTFA 3DM5A 3BJIC 2GEUA 2FSIA 1FUKA 3SHFA 3GLFB 1T0JB 1UBGA 4F4JA 1G8HA 2FE4A 1GRNA 4E03A 1S4QA 1RYFA 1D9XA 1LS1A 1SHKA 3NH6A 1AQYA 3A1WA 1W7AA 1KSHA 5P21A 1Q1QA 2GJAA 2MSEB 4N1AA 1XTKA 2H5EA 2ZPTX 3QXHA 1R7RA 2TMKA 1M8PA 4R2HA 5HCIA 1TU4A 4NYMQ 3SHWA 1MT0A 4HDCA 5IHPA 3MCAA 221PA 4W5HA 4DCNA 2Z4SA 3TLXA 2R9VA 2XOKA 4IXNA 3TVTA 4AY2A 3S1AB 1ZD9A 3IUYA 1I4LD 1R8SA 4K46A 3WP0A 4EPYA 3RANA 4I1OA 4RD6A 4PPGA 3CRVA 1X1RA 3PEVA 5DHFA 3VKGA 3CZQA 3NC0C 2VL7A 4PZLA 5K8TA 1EFUA 1EWRA 1X8JA 2QP3A 4P31A 3O8DA 4QNRA 2J9RA 4KODA 2AK2A 5KPDA 1F2TB 3R7WA 4EJSC 2KB0A 2OFWA 2RGXA 3SFVA 5GVRA 1CBUA 3RVBA 1TF7A 1XJCA 2FPLA 3QUSA 1G19A 4M1TA 3I5YA 4X8LA 2QRZA 5CB6A 2F9LA 2KSQA 5FTKA 3B1WA 3LXRA 2ZI7A 4ZCIA 4LZZA 2IXEA 2GJSA 3AGPA 1WA5A 2D62A 2KBFA 3K0AB 3WHKA 5G3YA 2QQEA 2WHXA 1JNYA 2VP9A 3B6EA 1AS0A 3OIYA 2NO9A 3AVPA 4NMMA 4RVCA 1XEWX 4Z8XA 1BKDR 1HT2E 3GP8A 2FDCA 1QG2A 4PSAA 5F3WB 4R7ZA 2NZJA 2XJ9A 3OFNA 2GZAA 2Q21A 3I73A 4GOJA 4CEHA 3Q5DA 3QKRA 4IVPA 3NDBB 2O52A 1LVGA 3FKQA 1I4TD 3I3SR 1MO4A 2REXB 3BS4A 4EIWA 1E9FA 1KK1A 2B7CA 2FV8A 3ONWA 4MA4A 2P2LA 3A4LA 4QGFA 2ZRAA 3GLHB 4A0GA 4B33A 4B71A 1YZNA 4XWOA 3NBYC 1E96A 3RSLA 4DUGA 1D6JA 5FOXA 5B2ZA 1OIVA 3ND9A 3SE0A 1KZ7B 1E0SA 4Q1BA 4CEJB 4MRNA 1N0VC 3AF3A 3BH0A 1U8YA 4KXFB 3TVDA 1R0ZA 1S3SA 2WJIA 5AJWA 1OB5A 1ZRHA 3WBJA 4IXMA 3EZ7A 3P4YA 4KU4A 1KY3A 3P27A 2WSSD 3AUXA 1JR3A 3GLGE 1XEXB 4OQNA 1MH1A 2ZSBA 4WIAA 4DHEA 4GPTA 4B3DA 2RH5A 1J99A 1ZC3A 4XD7D 4IOMA 2EQBA 2VTKA 2XNDD 1NVUQ 1E32A 2H18A 1YZKA 2G9NA 2WIAA 4BLOA 3I61A 2GBLA 3DM9B 2PT7A 3QXXA 5IRCD 2F9MA 1WMSA 3KXIA 4PANA 3HR8A 1KI8A 1H8HA 1SULA 3IPXA 4M4SA 2JGNA 3K0SA 3PIRA 3ZLJA 2V7QD 4G5SA 3DOEA 3T35A 4BE7B 2X8AA 2WOJA 4FN5A 4TZ6A 2IYUA 1EFRA 1P61B 3QG1A 4HB2A 2P65A 3THYA 4V0OA 1T91A 4WZBE 3LWNA 4G5RA 2GXUA 4DWJA 3GJ6A 3B1YA 3TAUA 1CTQA 4D2IA 2VHTA 5DN6D 4OL0A 4US0R 1F2UB 1JQJC 4BLQA 1R6BX 4C0SA 2DFNA 1GNPA 2QG6A 4UKDA 2GWHA 2NOAA 4G5GA 3NDPA 1L8QA 4EPWA 1KNQA 2DWOA 1TX4B 3FMFA 1MABA 4G01B 3SJBA 1CRQA 2AKAB 2G83A 1OSNA 3GLHE 4KAXA 3U61B 4HDQB 2QM7A 4QG7A 4C2TA 3KB2A 1NL3A 3G82C 2OXCA 4EPTA 2ZI5A 1NIPA 3SZRA 1G7CA 5GADl 1E6CA 2OFOA 2OILA 3EXAA 4LSGA 4A9AA 4DCUA 4EAQA 1TPZA 4NE2A 2FSFA 2GXQA 4OQLA 3B7GA 2ZE6A 3REFA 4AK9A 2ZJZA 1S96A 2FG5A 5KHOC 2G6BA 1U2RA 5HCNA 3AKDA 3ZGXA 3QVVA 1OJLA 2EU8A 2I1QA 5A0FA 1AA9A 5DI3B 3BERA 1EFCA 4O2RA 3FVQA 5EXTA 2DWQA 1UEIA 4PSVA 5JWRA 5KNBA 4JJZA 5KNDA 2IYTA 2WM9B 4JSTA 4MDEA 3TAHA 4Q4JB 5EXPA 1NN5A 3K0FA 5BN5A 2GEVA 4M9XA 5E7IA 1VIAA 3K0EA 3FMPB 4KFRA 4DB4A 4C0BA 3AKEA 2ZUCA 4D0GA 2R6FA 3GD7A 4URZR 3WNBA 3KQNA 2XOKD 4V0NA 4JL5A 5FOWA 3VR5A 4CRWB 1NLZA 2C5LA 5AJYA 1FTSA 1G3RA 3ND8A 1DADA 5DO9A 1B23P 4BGDA 2DHRA 2IYXA 3W5JA 1A82A 4BZPA 1IONA 4OKSA 4Q21A 2R62A 3KKOA 1OH8A 3I72A 3BFKA 4LBZA 4OHZA 1C9KA 1GKYA 3I62A 5CLLA 3DZDA 2ZVQX 3TSOA 3ZVMA 5JJKA 4PSKA 4XIGS 1L2TA 5DYIA 4BASA 4IOJA 5CIWA 1UFQA 4B2IA 4KO8A 4CT4B 4DC9A 3VMFA 1EX6A 2OBLA 1E3MA 3PEYA 4LBVA 4MRSA 4KBFA 2ZRBA 3D7MA 3Q72A 2JJ8A 1FL9A 2C99A 3CONA 1DAMA 5FUXA 1E9SA 1NKSA 1WQ1R 3KKNA 4X8MA 3BIFA 3HU1A 1SVOA 3LDAA 5FPYA 1KI4A 1OIXA 2J1LA 3SYNA 3KJIA 4B76A 4TYNA 2CE7A 2ZRIA 1P9NA 3WRXC 2AX4A 1NN0A 1SQ5A 4S2EA 1RRCA 3CKLA 4M0LA 4YQFA 2HT1A 4JBYA 2ZI9A 5KOYA 3CR8A 1OH7A 4ZI3A 3L0IB 2IF2A 1RJ9B 4A82A 3OFND 2GZDA 3Q7QA 2C9CA 5B58C 2XEXA 5TB5A 2ZQ5A 3RS2A 2GA8A 3U44A 4IFBA 2V8OA 1J8YF 1YZQA 4K81B 2Z43A 1OT3A 1XD2B 1KGDA 4A0RA 121PA 2O8FA 4LV8B 5C4GB 4DUGD 4JL8A 1W36D 1R4AA 2E87A 2IXFA 1Z6AA 1KO1A 3QOFA 1I4DD 1SKQA 2Z83A 1Z6XA 4NP6A 3HPQA 4ASUA 3GJ8A 1WDTA 1YZGA 1ZUIA 2IYYA 1XD8A 4FCVA 1Q22A 5HPYB 2IYSA 4NYJR 4Q7JB 1OB2A 1ZYUA 1GWNA 3CO5A 1UBEA 1OXSC 4QC2A 1RC8A 4TYWA 2CK3A 3X1YA 1JR3D 1NVWQ 1ZCAA 1R0WA 3REGA 3B13B 5JS7A 4TYQA 2BJWA 2AXPA 2W2XA 1TEXA 3RRYA 2QRNA 3TR0A 2QTHA 4M1KA 4ZDWA 2WPDA 2QGZA 4NCHA 1GFIA 2FPKA 5CM9C 3RYTC 1NKTA 2SHKA 5AJXA 3AP3A 4L4UA 4QKQA 4B35A 5IK2A 4G5OA 5KSOA 2X2EA 1DAEA 3OEEA 1EFRD 1ZVQA 3OESA 4GDFA 3TSZA 4HZUB 4MUBA 4Q4HB 1A4RA 3PXGA 1EXMA 5H1YA 2GZHA 2WKQA 2IYQA 2VEDA 4M2LA 3KUCA 1IJFA 1MO6A 3L0PA 4NPHA 1BO6A 5JRJA 2D2EA 1NVVR 2QBYA 1R10A 3O8BA 4FCWA 4G0NA 4GOXA 1XZQA 1U0JA 4BEJA 4TMKA 3K70B 4AKGA 1IY1A 5H8WA 1IBRA 5FTLA 5KUTA 3RWOA 5FFMA 2GCNA 4LGMA 4TMVA 4MGIR 4AYXA 3W6OA 4F7WA 1QHIA 4AC9A 3U5ZB 1OXVA 1VG9B 2RMKA 1ZCBA 4M22A 4KCGA 1AK2A 1Q20A 1OKKA 2OLKA 1NSTA 4LYAA 4M1MA 4BFSA 5J47A 3DDCA 3AH8A 2HF9A 1TF5A 4JL6A 5HE8A 2RGCA 4NU0A 2R6CA 4EFLA 2XXAB 4P4SA 1R0XA 1KDOA 4TL9A 4PPNA 4FWIB 2CL7X 4IEIA 4QJ5A 5H68A 3WRYC 2ZE8A 3CB4A 1Z47A 3X1WA 4KYIB 2HCBA 2JLSA 2IS6A 4QJ3A 1P6XA 4Q02A 1HY3A 3NEJA 3QPVA 4UNNA 3U4QA 4PO9A 1QDEA 1KZGB 4ZIRB 3PR1A 2XZOA 2AK3A 1N5LA 2H17A 2HJGA 2FFAA 1W47A 2YOFA 4MRPA 4D4LA 4LCBA 2OCPA 2QMUA 1S9DA 4YMWA 1SVMA 1G5PA 1XXHA 2VIIA 3DVLA 2GTPA 3AVTA 2X19A 1U8ZA 3RNLA 2YKGA 2PL3A 3WYFA 3KUDA 2BEKA 4DKXA 4DLYA 1DAHA 3IBYA 2UKDA 4AG6A 2ZRKA 1W4RA 3ADCA 1W4AA 1P2SA 2IS4A 3GLIB 1JECA 1E2QA 2FN4A 2OCAA 5BWMA 1W4BA 4PR0A 4PHFA 5J5CA 1XPUA 3IQWA 2QSYA 2FZ4A 1KI3A 2CJWB 2DFKB 3LY5A 4LOAA 3JZMA 1NBMA 1SXJB 1XMIA 1J7KA 4ON9A 4DCSA 4M8NE 2REBA 1XTSA 2YC4C 1JJVA 1FP6A 2H7VA 2PCLA 4HLDA 1M6NA 4L9SA 1JXMA 5B64A 5K8IA 1G17A 2BBTA 1CULC 4KITB 4JBWA 4DDTA 5EP3A 4IFEA 3W34A 3EPKA 2Z5FA 3LBHA 1IN6A 1G8GA 4QBIA 4WZAE 2GEDA 4JYCA 4LPSA 3VU9A 3EPJA 5FL3A 1W36C 1XD9A 1VDZA 1E2DA 1KMHA 2QPTA 1RYHA 1WRBA 1JBKA 4C2UA 1N6NA 2R6AA 4JVSB 1VMAA 5AUOB 4URVR 5LD2B 4HLCA 2GCPA 1HURA 5L3QA 3GFPA 1ZD1A 1G7TA 1E2NA 3GJ5A 4IDHA 2F1RA 4RZXA 1W48A 1G64A 1II0A 4IEEA 4EQ6A 3RS7A 2QY9A 5HZHA 2FWRA 1FQJA 3CWQA 4GSYA 3KDSE 4Q01A 1L7VC 1QHYA 3A1VA 4AWXA 1EFTA 3DOFA 3W6NA 4B34A 1ZU4A 3RRZA 5CJ2A 2C98A 4HLQB 4AYWA 1OYYA 2CK3D 2O8DB 1UKZA 1BH2A 5CIQA 4HDOB 2BJVA 4QGGA 4BFVA 1LB1B 3CNOA 3THXA 4W5JA 1KTVA 1FX0B 1ZM3A 4JVLA 4JMPA 2D06A 2WPDD 1CEEA 1N5IA 3K1JA 2P67A 5EP1A 4Y0VA 3TNFA 1YQTA 3LH5A 4PPFA 3GLIE 2WVJA 2Q9CA 4QHYA 4UJ3A 1S1MA 1IAQA 4TLDA 1OIWA 3UWOA 5IK2D 3O8RA 2JASA 4TN1A 1LF5A 1RVDA 1CJMA 1SHZA 2WIBA 3K9GA 2VYFA 4Q03A 2XNSA 3F3YA 2W6IA 3OEED 5TMPA 4A2WA 4MKFA 3VR6A 4A8JA 2WTUA 3HDTA 1YRBA 3MWLA 3C14C 2CL0X 3PVSA 4M1YA 1R5NA 2QUZA 4F38A 2F1IA 1TAGA 3QPUA 1TADA 4V0MA 1DOAA 2JLZA 2JIZD 4ZV4A 3IEVA 1XWIA 4LJ9A 1P5ZB 1SKYE 721PA 1GSIA 1BIFA 1PLJA 2WWHA 1UF9A 4HUQB 3RS5A 2ZJYA 5E7MA 4RJLA 2L0XA 1QHXA 1TQ2A 2O8CA 4P33A 3LW8A 4TTRA 3IO3A 1R2QA 3AVOA 2EWVA 4RCZA 3Q3JB 4HLUA 5FPKA 3T1TA 1TNDA 1Z83A 2PH1A 4MGYR 3HYRA 3RS3A 2XZLA 5JECA 4ZDKA 1OYWA 1RKBA 4JT2A 3R9XA 4A2QA 3VHXA 1OKKD 3PFIA 1IQPA 3L8YA 3ZJYA 3KXLA 2GJKA 5FPSA 3C5CA 4A15A 4IDOA 2OLJA 4MYCA 1E9BA 2O8EA 2GHIA 4BWYA 2BCJQ 1W44A 2FFQA 1VYTA 3E5HA 2I4IA 4XTRA 3T34A 2J46A 1KYIA 3E2IA 3ICEA 1SXJC 2G1JA 3LNCA 4AI6A 3R8CA 2JCSA 4RY2A 2KJQA 2ASEA 3Q8XB 1G5TA 4DZZA 2OZEA 4A36A 1QVAA 3EIQA 4HSEA 2ODBA 1KK0A 5K8UA 3ADDA 3LLUA 5FBWB 5JHHB 3P1JA 3IIKA 2QAGB 2P6NA 2QMHA 2ZETA 5CITA 3GLGA 3QXJA 2VHUA 4HYYA 2H1LA 1DG1G 4Q1CA 4DT1B 4DSNA 2FOLA 2ECKA 5DI9A 4P0TA 2QMEA 1FMJA 1IY2A 1M7HA 1VHLA 4NCJA 4WVFA 1N6KA 2F6RA 4W9MC 2PEYA 4TQUS 2ZRJA 3CRRA 1UKVY 5DIFA 3MJHA 4IVQA 3HR7A 3QEJA 4F91B 4HAWA 2IUUA 2HV8A 2DWPA 2Q9AA 2DPXA 3ZS9A 3CRMA 5C2JB 2DFTA 1IXRC 1PZNA 2HXSA 3A1UA 3BE4A 4HAZA 4B74A 1VG8A 4C7OB 1XBTA 2JLVA 2PZGA 2IHYA 4RKFA 2QROA 3MD0A 3TJZA 2ANCA 2FSHA 3QF4B 4UNRA 1OFHA 1SVWA 1V5WA 4C0LA 1NBMD 4MRVA 3CH5A 3PCRB 3CPEA 2E9SA 1G8YA 3RSOA 3TW8B 3ADBA 2IYLD 4WW0A 1JAIA 1N6LA 2ZEJA 4LYHA 2OESA 3TW4A 2FZLA 4E5UA 1G4UR 3EZ6A 2JLWA 4LC1A 2OE2A 4QBHA 1A2BA 4KI0A 1KI6A 3P4XA 3T5DA 4IVRA 4TMTA 3OIUA 3TUJC 1ONBA 1X8KA 4L15A 1TQ6A 2UVQA 2QAJA 3U3OA 1XDBA 3VKHA 4Q19A 5KSYA 2IBMA 3RC3A 2VP6A 2ZSEA 5C1BA 4U7DA 1QHSA 2N1BA 2JEOA 3DKVA 4PFSA 4OK5A 2J0UB 4R98A 2XTNA 2LCFA 2PJZA 1FPMA 3OZXA 5AUNB 2E1RA 4B44A 1F48A 3CNLA 1LS6A 2RGBA 2OCYC 1N5KA 4FCTA 4LJ4A 4ERNA 1CF4A 1KDRA 5EXXA 3L43A 3OIVA 5DE3A 1DG3A 1LF0A 3K09A 1A5TA 1JQLB 4Q48A 3I5XA 4IDQA 1NY6A 5CDFA 5EE3A 4DSUA 2OBMA 2BC9A 2JLQA 1VG0B 1E99A 4C4PA 1WP9A 3FPAA 4LJ7A 3WMFA 2LKDA 2PX0A 1YZTA 4R9UC 3AEZA 3A37A 3EA0A 3VR3A 3W9YA 2V6JA 4OI1A 1U81A 1HQYE 4Q7KA 3NBZC 3MWKA 5J4LA 2RGAA 3NXSA 2O0HA 3WBKA 3RRNA 4FMCF 1IN4A 4QOSA 4URUR 1IN5A 2WAYA 3AVUA 2BMEA 2VBCA 1CR1A 4BLSA 1XCGB 4YXWD 2HLDA 3V4FA 5FOVA 1XCMA 3FOZA 3UPUA 2ZJ8A 2PMDA 2QE7A 1QHHA 2ZANA 4M21A 2CHVA 1QVRA 1VG1A 2OSBA 4D26A 1HEIA 2W6ID 3A6PC 4IOLA 4PZYA 1OE0A 5C46F 2CL6X 1G16A 2DBYA 1UKEA 3AVYA 5AK0A 4A0FA 4QRHA 4IDPA 1YR7A 2RHDA 4CIDA 1F3OA 1LY1A 4N0EA 1JB1A 2ZROA 1G3UA 2QAGC 3QVUA 1Z28A 1RRFA 1O87A 2I3BA 2NZ8A 3N5CA 1J90A 1GAJA 4UJ5A 4ZDIA 1UPTA 4Q9LA 3HPRA 3AV0B 1DTSA 2JJ1A 3ECCA 3SS8A 3ZIAA 1D2EA 4Q4LA 3ZD6A 2ZSDA 3AGQA 1VPLA 1NY5A 5JMTA 3EWAA 1M7GA 4H1UA 3NHBA 4TL6A 1KNXA 1U98A 2VLIA 1ELOA 2CLCX 2JJ2A 4C3ZA 1FZQA 2ZS9A 3KB1A 3MRSA 2NMVA 3SJZA 1RIFA 4CVNA 2OBNA 1PUJA 2ZRHA 2QT0A 1YZUA 1KO8A 1IJEA 2YYZA 3LBNA 5G3ZA 4A8JC 3QSYA 4NYJQ 3ZZ0A 3R7WB 1OFTA 4KBGA 4JKYA 4YMUA 3D3QA 4PHGA 3ZS8A 2V1UA 3UKDA 3VX3A 4AURA 4AD8A 5EE9A 4U00A 1EFHA 1XU4A 3QNUA 4F92B 4RFSA 2W58A 3U7GA 1VCMA 4KHZA 2ZRDA 3ZH9B 3DMNA 1YU9A 5JWHA 1C4OA 1NG1A 2QTVB 3EC2A 3LQRA 1DAIA 4UXHA 3RAPR 2GCOA 4D4KA 2J0QA 2HF8A 2Q3HA 3X1DA 1GIAA 2ZSAA 1E0KA 4JLJA 1ZC4A 4MUAA 4GBMA 3OHMA 1IM2A 1G18A 3ZVLA 1U9IC 4LYJA 2BVNA 4CEHB 3QKRB 5DNYB 1C1YA 3THOA 4C0HA 3IPYA 3V00A 3DEFA 4URWR 1NVVQ 2XSZA 3TKLA 1T3LA 4BQSA 5FUYA 5SZIA 2B21A 5BN4A 2YOHA 3SC3A 1IOZA 2JA1A 1ESMA 5KDLA 4WZ6A 3CF6R 1WCV1 3BFXA 2G3YA 3A36A 3A8TA 4PQFA 2O8BA 4TLEA 4DLXA 3E70C 3B1ZA 1HYQA 4LJAA 2DB3A 3UK6A 2ZUDA 4TZ0A 4JLKA 4LI0A 1KOFA 2D3WA 2PLFA 3L82B 1AGPA 1T3SA 1CR0A 2A3RA 3UG6A 5FBLB 4RD1A 3NBXX 3DL0A 2CNWA 3LAWA 2GK7A 2IEYA 1Z08A 4F93B 2RGEA 3VKWA 4ARZA 1RRGA 2Z6VA 3PENA 4AKIA 1DE0A 2V55B 3L2OB 4JLOA 3AKYA 5JHGB 1FNMA 1B0UA 3GPLA 1NNEA 1Q1ZA 4LBWA 1S3GA 2R6GA 3DPUA 1EG7A 4GP6A 1P7CA 1JPNA 4W7SA 3I32A 4B3GA 3F8TA 1E1QA 2H92A 2ONJA 2KE5A 5E3HA 1LFDB 5CJPA 2VSXA 2WKPA 3M6AA 4NCKA 1GM5A 5TARA 3PUXA 5C18A 2G88A 1XEFA 3SFZA 4OI0A 2XTMA 4CEIA 2F3RA 5LB2A 3I4LA 2A78A 1Q44A 1GRQA 2EFDB 1K8RA 4XVQA 2J3EA 5H70A 3THYB 1XMVA 2GXSA 2YWGA 3KJGA 3T1QA 5JI3E 1GILA 4QGAA 3GJ0A 4QJ4A 421PA 3VX4A 2H16A 3I8SA 2XB4A 4J0QA 3FHTA 1G20E 2YWHA 4FI3C 4KYUA 4YDHB 1G7RA 1E2MA 4RD0A 2MSCB 2RB4A 1II9A 3CW2A 3T06B 3BBPA 3QEOA 1R5OA 3TSWA 1Q0UA 1YRAA 2X2FA 4M53A 1UDWA 1NMYA 2YJTD 1KO5A 4XSHA 1MABB 4KJZA 3SN6A 3IGFA 2R6DA 1ZNYA 2VSFA 3BB3A 4DLSA 2DCUA 3QE0A 1P4SA 2G1KA 4HB4A 2V9PA 3PEWA 2NO1A 2JDIA 2YV5A 2HCJB 1Y3AA 5D3MA 1P9RA 1T8UA 2ZU0C 2JLXA 1ZINA 2HLDD 2V3CC 2IYWA 3MAAC 2BKUA 1KAOA 1XMSA 2QE7D 4B3BA 4FIDA 2IL1A 5DYGA 3TQFA 4ZDJA 2W2TA 1GL7A 1LNZA 2B7BA 4FXPA 4TMZA 4NHOA 1NVXQ 5FOTA 3G0HA 3W8NA 3K0FB 1KKMA 5K8LA 1F6BA 3DO6A 4DLTA 5BW8A 3KFVA 5KYKA 4HZIA 2JJ1D 2AKYA 4MYTA 3ZIAD 3OE7A 3KKPA 1N3BA 2G0NA 5D3QA 5KPJA 5BYKA 2JJ2D 3KQHA 3EG5A 5JWOA 4B3FX 4DLWA 3FFBA 5HZKA 1UDXA 1NJFA 4IRUB 2V4ZA 3BFVA 3Q5EA 4A92A 1DELA 5KSZA 3H2YA 2A5DA 2QU8A 2ATVA 5F9HA 3VNVA 1E9AA 2ZJAA 2AWOA 3B82A 1GNQA 2WJVA 1UM8A 3LV8A 3MUFA 3MWJA 2P0EA 3CRQA 1XP8A 4PAOA 5LPNA 3QJYA 3K9LA 5GJCA 3BXZA 5TV2A 3WNCA 4B2PA 4PPQA 5JEDA 4RZ3A 1XJ0A 4XJXA 2HYDA 1OHHA 2VA8A 2J45A 3A4NA 2C77A 2IT1A 1QHGA 1XTIA 1KO4A 4BFWA 2EFEB 4TT3A 2VHQA 4LHWA 1Z6GA 1TTTA 4A2PA 5FBQB 4DCTA 2JIZA 3K9HA 2IWHA 1KK2A 1XB2A 3I8XA 3LO5A 3C41J 1VTKA 3IIMA 4OJQA 4AKHA 4A1FA 1WBBA 1P9WA 4V0KA 3WMGA 5AWFC 3U3JA 3RS4A 2GBLC 5FBVB 4Q4AA 2ATXA 3KZ1E 1XCPA 3PUVA 1ZIPA 4CF7A 1Q21A 4DEYA 4PO8A 3FWYA 3EASA 4POAA 3WMEA 3U44B 3GFOA 1T9HA 2A7QA 2IUSA 2XSZD 3TIFA 4NDZA 5LDDC 1S1CA 3QG5A 2O8FB 2H57A 3EARA 4G5QA 1RFLA 2ZREA 2Y8EA 3K8YA 1SGWA 3ASYA 4Q00A 1TUEA 5JLJA 4U02A 4UXIA 3UANA 4GI7A 2Z4RA 4JLAA 2YVUA 2W0SA 1Z2AA 4KFSA 2ANBA 4M9ZA 4RCYA 3SJAA 2Q3MA 3FTQA 2GVZC 5BYJA 5TDHA 1W49A 3K0CA 3IBGA 2CE2X 4K8OA 1P60A 2VF8A 1NP6A 2ZYUX 3B85A 1UEJA 1EESA 5A5GA 2CNWD 3DZ8A 4B75A 1KKLA 3M4YA 4ZO4A 2JLYA 2VRWA 1G41A 3C15C 3KJEA 5L3SA 2ODWA 2IEZA 1AIPA 2ZE7A 3I92A 3RRMA 4B6FA 1E79A 2QGNA 3KFXA 3OEHD 1HE1C 1E69A 2F3TA 2VF7A 1IN7A 1GNRA 3TH5A 4C0QC 1GKUB 4JS0A 2ZAOA 1E1QD 4D82A 2ONKA 2ZRMA 2B8TA 1LW7A 1P73A 4LC0A 2F43A 2MMGA 1T4GA 1ZD8A 5B30A 4BRWA 3W5IA 2FEMA 2CEAA 4DDWA 2D2FA 4TLBA 1U0HC 1Q3TA 1Z0IA 3B1XA 3MFYA 5EP2A 2WWXA 2J0SA 3KTAA 4GRAA 1NN3A 2AWNA 2QM8A 4GFDA 4XWKA 4Q9JA 1WXQA 1ZM7A 2X77A 3UMRA 1D2NA 2RGDA 2ZSFA 1E9EA 4Q1DA 1E9CA 1XF9A 4DBLC 5E4FA 2QBYB 3VR4A 3H1TA 3UATA 1Z5ZA 1PJRA 4OK3A 1PUIA 1E2JA 4JZKA 2NO7A 1KI9A 2ZI4A 2OEPA 3TGPA 3I1FA 4DIEA 2JLUA 4D25A 2MSDB 1T5IA 2W83A 1I2DA 4WBSA 3SNHA 4NBSA 1QHNA 2V54A 3AM1A 4TMWA 3CWZA 3KX2A 4QL3A 2WOOA 3OF5A 1G3IA 4PZZA 1MO3A 1XX6A 2YWFA 5DHAA 4KVGA 3TBKA 4XH9B 3U3RA 2I1VB 2ZJ2A 1DO2A 3K9NA 1X86B 1W46A 3SEAA 2ZR7A 1JAHA 3A1SA 2JDID 2W0MA 1TQDA 3AQ4A 4ACBA 1M34E 4P4SB 4WAUA 2C9YA 1JEDA 3SJCA 4B3XA 4EJSA 1ZM9A 1NIJA 2UZ3A 3KQLA 3AVWA 1US8A 4LDJA 3EIHA 5EZ5A 5J4YA 1E1RA 1CXZA 5EE1A 3TK1A 3WHLA 5CK5A 4P3YA 2F55A 1Z0FA 4Q1FA 3QKSA 1KSJA 5JSZA 2NO0A 3IEUA 4QNMA 3U4QB 1G6OA 3K70D 2B92A 2NGRA 4U5XA 3FHOA 1VCIA 3R20A 2PZFA 1M74A 2EFGA 1KJWA 3ZDQA 2PX3A 2NPFA 3VTKA 1BOFA 3OE7D 2OHFA 1XXHB 1NI3A 2C95A 2VH5R 2CCJA 4LJYA 2AL7A 3T61A 2ZVPX 3LA6A 5KNCA 4XVUA 4V02A 1GKIA 1ZNWA 3HU2A 3PJRA 3CZPA 3TE6A 1NG9A 4LHXA 3EPHA 2A5GA 1N0WA 1OF1A 1RE0A 5FTNA 5BQ5A 4ZKDA 4PC1A 2Z0MA 1DAGA 2OAQ1 3H0KA 2PJRA 3H84A 2BEJA 4QGHA 4ITRC 1WB9A 4I1VA 1AJEA 1JR6A 4YXWA 3A4MA 4GL2A 4AYTA 5LBIA 1SVIA 1IXZA 1CIPA 1OHHD 3IDQA 1GDDA 3N2EA 5FUVA 3ASZA 3SYKA 1SXJE 4BECA 4YDSA 4P32A
chains in the Genus database with same CATH superfamily
2ZI3A 3UWSA 3LG2A 3TDNA 5T57A 2EWMA 4IKOA 3WYDA 4LFAB 3GJXC 2YWEA 3RTDA 1B6TA 3Q9UA 5FBRB 4OB8A 4IH4A 3Q8LA 3WYGA 5BXQC 3FNHA 2Y0EA 2OHIA 3BXHA 2G06A 3B9RA 1SRQA 2ODNA 3V1NA 3A25A 3DMTC 3SDZA 4CIPA 4P86A 2ZUVA 2I76A 3MG9A 5HRUA 3QIAA 2C1ZA 5AXDA 1Z4KA 3W2WA 4BN0A 3WDMA 4EUHA 2FW9A 4I9GA 2YXDA 4PCLA 2BKXA 1PT9A 2Q2WA 3E4DA 3OPYA 3BMCB 3PDJA 2HN9A 5CT8A 3CX8A 5TT0A 1KDVA 4A8JB 1YR9A 4ARUA 4D98A 1EZ4A 1ZU5A 4CYMA 4NTFA 3R4VA 1PR9A 1WAMA 3M5CA 3ZHCA 2XB8A 4TMXA 2ZJ3A 1AG9A 1HE3A 1P44A 4BHTA 4F2PA 4Z3DA 2QZ9A 4AO6A 1K5HA 3VR2A 1JI3A 5DNCA 3VYVA 2PZBA 1J5EB 1LJUA 3BTUA 4ER6A 4GI5A 5J1TB 5ALVA 3EWNA 2POQX 1WMBA 4UZFA 2YIMA 1T8WA 2ID9A 1OY1A 2JFZA 2AB0A 5ALPA 1TAQA 4FMCB 3LL4A 2E18A 4K9OA 3AJ9A 2X1MA 2IHZA 2JKZA 5L3VA 4P4LA 2IYAA 5IT5A 4I4CA 4ZN6A 3FSGA 1JQEA 1UWCA 1EK2A 2EJCA 3NOQA 1W2GA 4H4DA 3SXPA 1OXMA 4QM6A 3WGZA 2D0DA 2IUTA 2XA2A 1C81A 1JLRA 1DQPA 1YV9A 4K2AA 3JAWB 3M5PA 1QVZA 3AHHA 1GDTA 3WWPA 3ITKA 1Z07A 1W1WA 2RHHA 2QIOA 1XZHA 2TYSB 2OM6A 1Y3HA 2EC5A 4JT4A 4AX8A 5DI3A 5D7BA 5DPMA 5JZOA 3V4SA 4S24A 3EFOA 3ZHOA 3OCUA 4EPXA 3QI7A 4K7BA 1F6DA 1N8SA 4MW7A 4H4KC 2B8NA 4RK5A 3EW7A 2DGDA 1WMDA 4JYPA 2RE8A 3JQFA 2W4IA 3UAGA 4FYXA 3MJRA 2QTGA 1IEWA 1VTMP 1ID8A 3FCCA 1E5VA 1XPRA 4C5CA 5GV8A 2V7EA 1QGYA 3ASVA 4E2ZA 4OU4A 1EFVA 1M6VB 1T1SA 5TXGA 5FI0B 1O4WA 2VATA 6ABPA 1E4YA 5GPGB 4B3JA 3QLVC 1K68A 1OJ7A 3W05A 4G36A 2FF5A 3FPJA 2GASA 5LP6A 4ETWA 4BJ6A 4RTRA 3PX3A 4B47A 4WN9A 2ODTX 3UAOA 6AT1A 3NOVA 2Y68A 1LLQA 1IJBA 1L3CA 3BCSA 1JLHA 1GGQA 2I7VA 3BGWA 3R09A 4L50A 1RAAA 4LRTB 4BXOB 1U9JA 4PLYA 1CW2B 3ZR4B 4E1AA 4HI0E 3GDOA 4ZVUA 1CY1A 4QPJC 1Y9EA 5BN4B 4F1JA 1CUWA 2HMAA 2I9PA 4DB2A 3TRJA 4D79A 1T29A 1X77A 5AQEA 3UN1A 4U8GA 3EQ9A 3AHJA 1RW4A 1SUIA 1MVLA 3EXIB 1CS4C 3CX6A 1SCUB 3FJ1A 4ISBA 3EPLA 3ABLC 1RKCA 1QIIA 3R5JA 3EC1A 2XCTB 4B3CA 3WGQA 4M9CA 1FTWA 3IIIA 2J3KA 4J1QA 1A9QA 2ACWA 2OGZA 4NV0A 3T38A 1ICIA 4DAEA 1TD9A 1HNZB 4ZK2A 3SEFA 5FCLA 3PGKA 4B4VA 1OXKB 4A2NB 3C6QA 1U8TA 1XO1A 4R7GA 3TNLA 2R48A 2R84A 3Q3EA 5U1PA 4OBEA 3SOPA 4CCWA 5CYOA 3H2JA 3QEMA 2EDAA 1B6GA 1CLUA 4JXZA 4WLUA 1XWJA 1QF9A 1XTTA 3I30X 2HUPA 1OMOA 4PHHA 4BDTA 4F5ZA 2VWGA 3TZ6A 2C2WA 1Z13A 1V25A 3FD8A 3W8RA 3TEJA 1WB4A 4GOKA 1K08A 4YA6A 3IXLA 3LXXA 4AZ3A 1PL8A 1YJ5A 3LUKA 5BSUA 3G5TA 1GAQA 2VRCD 2R2GA 3Q85A 4LOIA 1Z2DA 1QCCA 5FWXA 1Z0AA 3VNBA 1XG5A 4B0OA 4AJPA 5JE8A 3IJEB 4U7WA 2ICAA 3BD6A 5JBQA 5A3QA 1FYDA 3ICQB 4G7HF 2IE8A 2PX6A 4C7VA 3ZUPA 3QRWA 4UCXA 1FRVA 3LQKA 3AUUA 4DTIA 3WY9A 2A30A 1W87A 4R2XA 4B09A 4KXNA 1RAEA 3DZFA 1OLOA 2GETA 5IUNC 2K5UA 4ZOLA 5EQFA 1XT6A 2QL5A 1DRVA 1GZ3A 3ZLVA 5B58T 5IKOA 4X90A 1QPZA 1WEHA 4TTPA 3PLAE 1RZRD 2C03A 4MQFA 2NU8B 5CA1F 4IRXA 2IYOA 3GC6A 4ASUD 2Q8NA 1J6UA 4EEXA 4YMVA 3NM6B 1UBLS 3CLRC 1UBSB 4OQMA 2GILA 1FBTA 2OG2A 1P74A 3N59A 3FRHA 2C9OA 521PA 3LKVA 3AF1A 4U5DE 1JL3A 2G1PA 2DFVA 3PHJA 1R0KA 3GOQA 3H3FA 1SBZA 4FDUA 2VJPA 4DA9A 3ASNC 1FXWA 4YONB 3JSAA 3LP6A 4EG1A 4BPRA 3C98A 4H7KA 3ONVA 2YJZA 1L4UA 4ZKEA 1G9XA 3V4RA 1T4CB 3UNGC 3L7LA 4ALLA 4PYJA 4R7TA 5EJ6A 1U9IA 3LBAA 3N2YA 3SMVA 5F9FA 2AN9A 1Z63A 3U7QB 3H8WA 4JYZA 3T7JA 4CODB 1P7YA 5BUCA 4FNOA 2O2XA 3TD6A 4Z9AA 1AS3A 2CFRA 5EHIA 2B1JA 4BUCA 3UFBA 1MV5A 2ZI6A 3QVSA 5CB0A 4PAQA 1XQXA 3N7AA 5DP1A 4G89A 2QQGA 2ETVA 1NWCA 1TYCA 1QAOA 4YFYA 3B60A 3O0TA 1FSZA 2VG8A 2A9VA 3CEXA 2GEUA 1H2AS 5DW3A 2X4LA 3PVZA 2DKOA 3WIDA 2V3WA 2GJAA 2Z2YA 1XTKA 3AW9A 1R7RA 4G1VA 1QANA 3WL4A 1TU4A 2J9FB 3ZDXB 4FLEA 4DCNA 5TRTA 1EKXA 1R8SA 2BEWB 3RANA 5K0FA 1ZNQO 4PLWA 1X1RA 4F96A 4AZ0B 2QRVA 5HIMA 1C8VB 4XPIB 1FU8A 4PTZA 3N2KA 1XJCA 4L27A 4X8LA 3KC2A 2G4VA 2JAWA 2JCXA 1I0IA 2CNLA 1FW8A 1RI2A 3LA8A 3MTEA 1AS0A 1PWYE 3AVPA 4NMMA 5K3BA 3DLAA 4MWGA 5CA0B 1L7QA 3V8EA 3I73A 3Q5DA 4IVPA 3NDBB 3A04A 3KEGA 2A3NA 1JF8A 2ZRAA 1TCAA 3GLHB 4XWOA 1E96A 1TLTA 3HXMA 1BWQA 2WZDA 4CLOB 1OIVA 2LUOA 4NE7A 4RL6A 3AF3A 2VAWA 3BH0A 1C7FA 1R0ZA 3B89A 2H5LA 3RD5A 1NFQA 1JKJB 3I2IA 4BP1A 1L4BA 1PSWA 4JQOA 1EM8A 1P17A 1XEXB 4OQNA 3I5PA 2B2CA 1D5WA 3LYUA 3DM9B 4CIAA 3NAMA 3JQGA 2F9MA 1ZDMA 3WISA 2QVGA 4L6CA 3AJRA 1JA1A 4W1SA 1P61B 4HB2A 3HKCA 5DN6D 4UPEA 4JBNA 1A7DA 3KEOA 4P38A 3I04A 3JAKA 3D4LA 4G97A 4L6IA 4LECA 3UC5A 3HJBA 4OQLA 2G6BA 3ORRA 2I1QA 2V03A 4NWIA 5EMLA 3WL5A 4PSVA 4WFIA 3OZCA 1IPEA 4OHRA 5EXPA 3VGPA 4FM9A 1VIAA 2O2EA 2PPVA 3MBIA 3GD7A 3WGIA 3IOCA 3UMCA 1DV2A 4OIMA 4XJSA 4RY9A 2GD2A 4EYKA 3NM5A 2OZLA 3TD9A 2JLCA 4BN4A 4BASA 5BT9A 5DS4A 2JJ8A 4HRYA 4KR7A 2PGXA 1QVWA 1URPA 1KAQA 2ZRIA 1PTJC 3CKLA 5EHXA 5BSKA 3O2NA 1VMKA 4JASB 1JIJA 3Q7QA 4MHSA 5T3YA 1B41A 4CF5A 2O8FA 2C29D 4A10A 4XDHA 4B17A 1SIBE 3OO1A 2Z83A 2IOFA 1U5CA 1YZGA 2C92A 2O1EA 5HPYB 2EL9A 3ZCRA 3B13B 5E0OA 3DE5X 2PFGA 2WPDA 1ULZA 2VBGA 4C1NA 4DMKA 5DWQA 3AP3A 2OOSA 4KN8A 4QKQA 3NV7A 3PT9A 3QE4A 3KOYA 3DJYA 1YIDA 4CMBA 5TVGA 4EVIA 3MTIA 1CZNA 3IBSA 4NPHA 3RSCA 2Q7XA 1CPYA 2LFFA 1P0CA 5DSXA 1Q20A 4P4SA 4TL9A 4FWIB 5JLIA 1BKYA 4MWOA 3CLSC 5H7XA 4UNNA 5C4IA 4ZIRB 4ZYUA 2FFAA 4D8UA 3LC1O 2BFBA 4CG3A 3DZBA 3IBYA 4YH1A 5IZCC 4HY3A 3EIFA 1L7BA 3CZ9A 3Q0EA 3V3TA 3QOWA 2PRJA 3QX7A 1E3TA 3KVOA 3RT9A 4OKIA 4YV1A 3B8EA 2OFPA 1FVHA 4UBLA 3PDWA 5CBPB 4PG7A 4HLDA 3L4JA 3PGJA 3BF7A 2YJ4A 3FFXA 3OI7A 3CG4A 1G8GA 4EZIA 4P7BA 2FCAA 4C2UA 3V33A 4JVSB 2D7JA 3PC7A 1BR1A 4YPOA 1U2TA 3GJ5A 1KMIY 2C94A 2QG9A 1CR6A 4F4HA 2X1HA 1YH3A 3KBOA 2H1OA 1GUYA 3DI5A 3IAM1 2BJVA 1EM6A 2WC1A 4RPHA 1REQB 1ZM3A 4WFKA 2ZM6B 2JIPA 1SCJA 3K1JA 1AH2A 2YWAA 1LBIA 5A0TA 2EIXA 1OIWA 2YHUA 3O8RA 1Z36A 1JE0A 1ML3A 4EP1A 3OEED 4DV5B 3HDTA 1ESZA 4MVRA 5KYYB 4ZAYA 2C4HA 4C7BA 2VP3A 3ZV3A 1UF9A 3UQYS 3REQA 1ZN9A 3R76A 1LH0A 3ROMA 3SHVA 3K9QO 1TVKB 1JJAA 1YMVA 4Z4GA 4K6OA 5C1OA 3GLRA 4CSAC 4PJLA 4NPCA 1IQPA 1MPXA 4ZVMA 4O79A 2AP3A 2OLJA 1WULS 4A23A 1Q0SA 1V5IA 4RVFA 4CN8A 1QVAA 1HEYA 3IIKA 1Z5VA 4DCOA 3KELA 4MK4A 1MQ8B 5CDSA 1FMJA 4H15A 1GA4A 4KTVE 2IZOA 4F91B 1Y4DE 4CKCB 1M8FA 1M10A 1RKUA 2F8SA 1NQVA 4MGEA 2WQ6A 1VXRA 4JP1A 3A1UA 4ZGGA 4IIDA 1GADO 2LCQA 3O4GA 4RKFA 4AECA 4C0LA 1AOXA 1YULA 3CE9A 3PXEA 5K03A 3HE3A 5LP1A 1AO0A 4XTKA 1YXMA 2FN9A 1K1EA 2BFDA 1TRKA 4BIMA 4TTTS 5C1BA 2XDQB 4C4OA 5B6PA 3EBLA 3L1VA 3PMRA 4QQRA 5EXXA 3ANNA 3AL0C 3LU1A 3E9EA 4IDQA 1OA1A 4IIVA 2BD0A 3RV3A 3CLTC 1VL8A 3OPXA 5EFZA 3FI9A 4FZJA 1HKHA 4NBRA 2IYFA 2M1ZA 3JQ9C 1L7AA 4G8CA 1R6XA 1R4MA 3GWZA 4M6WA 2XNKA 4RJKA 3LP5A 2ILVA 1E6LA 3ZC3A 5KYXA 4LXGA 1HEIA 2W6ID 2H63A 5HMLA 2VF4X 1UKEA 2F9FA 2Y1LA 3C3AA 2ADOA 3WVNA 3N5CA 1RRFA 4JCZA 1JSXA 1OCZC 4Q3CA 1QH8A 1FUEA 3AGQA 2BFNA 1U02A 4KPUA 2G08A 3ROGA 1AKWA 4D1YA 4UM8B 2YN2A 5AHRA 5JS2A 3GUVA 2E37A 4KBGA 1D2GA 3D3QA 1XU4A 4FFWA 1S8AA 1BTOA 4F3CA 4EVSA 3I28A 3KZNA 1UPAA 3M6XA 3NFRA 3F5MA 4D3FA 1M2KA 3G2JA 2W93A 2IV2X 2BVNA 3F49S 1L4MA 1XAJA 3THOA 4FMPA 2YOHA 1WMAA 2QIPA 3VMMA 2VSQA 3IQGX 4JT8A 3A36A 1SWVA 4TLEA 4YJ3A 3RVYA 5FUMA 2O2IA 4RD1A 4BJ5A 3DL0A 4YAEA 2GAJA 1Z08A 4ZV7A 2RGEA 4ARZA 1YFZA 1JOGA 4CKZA 1EK1A 4QOHA 5E3HA 4MWSA 1V9LA 2G88A 4OLBA 4KAAA 2WTEA 3MJVA 1ENZA 2FWPA 3HS3A 1HLGA 5D85A 2VTVA 3I8SA 2XB4A 2OL4A 1V7QA 3FHTA 3A9TA 1RI3A 1O94C 3CW2A 1EQAA 3Q7SA 2QAIA 2XUPA 4ER0A 1E60A 4B81A 3I04M 4MUFA 3LIPA 2DCUA 4RPGA 4XQGA 5ITVA 1Y3AA 1I3CA 1T8UA 4PM4A 4YBZA 2P62A 4J16C 4QWWA 2A5LA 4TMZA 5G0SA 3AUAA 3PDIB 4CBEA 5LVAA 4CQJA 3OVMA 5BYKA 2W42A 2GPNA 5LL6P 3LQ1A 3S7ZA 1QZUA 3GPDG 4RWZA 3UWMA 3O6XA 3GV0A 4IIBA 2G36A 4OP1A 4WCVA 2PNOA 2C54A 5KKNB 2IUFA 3ESQA 3G17A 4XCXA 2VBIA 1N7HA 3GM2A 4DNPA 2VTBB 1SGWA 4Q4ZF 4UXIA 2XL6A 1JP7A 4FAPB 2VT7A 3UV3A 1C8LA 1POXA 2Q3MA 3S2SA 4I44A 2D5AA 2H48A 5TPZA 3LCRA 1IHPA 5E6UA 2YH2A 5AO9A 5L3SA 5HUJA 4NCXA 1KVTA 2HPHA 2UUHA 1TT5A 2D0PB 3LS0A 1QO9A 3H2KA 2QX4A 2B8TA 3L7IA 1FRZA 5GONF 1PIWA 4KO4S 4RJ2A 4KO2S 2FEMA 5IAKA 1JAFA 4OFBA 4FGSA 2D5LA 2K2QB 1VIMA 1KFJB 3HWWA 2QL7A 2QBYB 1PJRA 3E81A 4RA9A 3TGPA 4LVUA 3SOZA 1I2DA 3V8NA 1F51E 2RHWA 2VXCA 1JQ3A 4CHGA 4LF7B 5JAZA 2JC3A 3TXAA 1AUOA 1TLFA 2IDZA 4YAIA 3UICA 3Q7TA 1C0IA 3W1EA 2EZ4A 4LDKA 1ZM9A 4XPXA 1NIJA 3AVWA 1D4ZA 3CMMA 2WYIA 3QKSA 2FWJA 1AK9A 3CLRD 2QVXX 1KJWA 1NFOA 2R60A 1J49A 3AR7A 4K9RA 3FPLA 3WWDA 1VKHA 3DQPA 4Q3BA 2CCJA 1U1IA 1ZKDA 3EVAA 4PXSA 4LISA 3MMSA 4DR3B 4LY0A 1E61A 3EPHA 2HBQA 3SQDA 4EBJA 4EKGA 2C4MA 4RMGA 2BSAA 1M6EX 3SYKA 3LZ6A 1K89A 3OOJA 2ZBPA 2Y1OA 4P32A 4R81A 4JW1A 3R4CA 3F71A 4RPIA 5DCYA 1X38A 3CE6A 1RYEA 3VU9B 2CMKA 3NWBA 3OEYA 5FWDA 2PS3A 4DXAA 1MQSA 1MRNA 2CDNA 2FSUA 1YVIA 3LDGA 4QYIA 4AU1A 5L9AA 4KPYA 1EE1A 4KIUA 4MAFA 3TZHA 3KQSA 3BWEA 3URKA 3EZ2A 4OHXA 3CPHA 4UAGA 4ZC1A 3VR6H 2ZTMA 4HWGA 1QRUA 4EUKA 4Y2SA 4AQ7A 3B48A 2B1GA 4JU9A 1KYWA 3DKRA 3RIHA 3KL4A 3UW1A 5JXWA 3PRKE 3OKCA 1GVHA 1CS0A 1I24A 2JGJA 2P3SA 4G7ZF 4OP3A 2MIIA 4IILA 1EB8A 2V7BA 3VHXB 3MCZA 2F1OA 2H2IA 2P6UA 2JLAA 1TAHA 2QLNA 2JARA 1DBWA 1SBHA 4BYMA 2WV9A 1RKQA 2R8BA 1E1RD 1MD9A 2LW7A 3C3BA 3AJ8A 3S6JA 3FYUB 1H4TA 2XX3A 4RZSA 1PE0A 3PHIA 3ZD9A 4B48A 4DANA 4AFNA 1B2LA 3DE1X 4A6XA 1MO2A 4B2LA 4NIMA 1MB3A 3WGLA 4H1VA 2CXSA 1YQEA 1U3DA 3U09A 4D4MA 1N92A 3BB4A 1IN8A 2VS1A 3DTTA 4DIDA 1RRVA 4ESOA 4F8JA 4G0XA 4HNVA 4BV3A 4EB3A 1M7BA 1EWYA 2ORED 4WA7A 3ZQKA 3V4LA 1QU3A 4UFNA 3UXEA 2P2ZA 1NVFA 4RD2A 4L6AA 2RKOA 4ZCQA 3EHEA 3OM8A 5C8YF 2GZ3A 1RJWA 1CRLA 5AKLA 1RBZA 1OWMA 2WJJA 1E20A 3TLZA 5CDHA 5BQIA 2ZAMA 4TL7A 1QYRA 2ZYHA 2GHQA 2O19A 3ZV7A 2C7GA 3F6EX 5T8KA 1NMZA 2P5SA 3I1IA 3Q9LA 3DTVB 5BSTA 3T0IA 1QIKA 1H8ED 1P7WA 1T35A 4CKEA 4HAUA 3K05A 4ZANA 2FMTA 1ATIA 4FB5A 1ZGGA 1XWFA 1JHVA 4PYMA 3CR3C 2B4RO 5FNZA 1W29A 4TSFD 5BW5A 3WGJA 3I34X 3B5JA 4F45A 3MGKA 4LZAA 1OW6A 4GGPA 2XAUA 4ZI7F 1M0WA 1AGRA 1X7HA 3EULA 2ZRGA 3KT6A 4JUFA 1O2DA 5B1YA 4BGIA 2GFQA 1XD2A 4LTDA 4L5JA 5K3EA 4BP9A 1I8TA 2IPAB 3DE3X 2PUWA 4ZU1X 2WP8J 2XODA 4DMGA 1OFVA 3GVHA 3D3WB 4EUFA 4JKIA 4I50A 4FBLA 3NBMA 3W4JA 2A2ZA 3Q11A 2A92A 3CKYA 3RC8A 2Z98A 4NZMA 3LJBA 2LR0A 2E21A 2E0IA 1H23A 3MZ0A 4HEJA 2O3QA 3AR8A 1W76A 2FWNA 1NW8A 1R6UA 2Z9DA 5GV7A 1N9GA 3OZRA 1KJZA 4PVCA 3O47A 1JR3E 1ZEJA 1N75A 2V6IA 1PGNA 5K01A 2P35A 3PC4A 3RVZA 2R02A 2XLWA 3NVDA 3WI7A 1M6HA 1AM4D 1BC5A 1S8FA 2Y4OA 3DMDA 5KVCA 5C35A 3EFEA 4GOMD 5DKFA 1SG6A 3ZDFA 1YU6A 1HH4A 3PQ6A 4L4YA 2ERYA 1Z4IA 3RRJA 3KKLA 4LXIA 4NEHB 1O4VA 1MNDA 4RESA 1GV1A 1S7ZA 5B2FA 3L0SA 1E3WA 4OLHA 4JSYA 2CJWA 1RIIA 2V1XA 3FWKA 3L6BA 1T6UA 4LX0A 3CLSD 4RQTA 1YL6A 5K5EA 4ZAZA 2IHUA 1EK6A 1XQ1A 1BMDA 3A3KA 1MKYA 3AU9A 4WY8A 3G0BA 2IC5A 4HQ0A 4D81A 4MVUA 1O6CA 1BRTA 1QQAA 1P72A 1J70A 1RWXA 2FEXA 2Q5QA 4LHSA 2BOVA 2QQ0A 2WE7A 3L8EA 4Q5SF 3PNBA 3EVNA 3OPYI 4BX0A 4D0LB 2OKCA 3B2QA 2OR3A 1FDUA 2IXGA 4P92A 1N25A 5G02A 2JZNA 2PUCA 4LFBB 2OT3B 4DV6B 3OKAA 1ZN2A 2GYUA 1ZMOA 3O8QB 3J81k 5A69A 5GJBA 4ENVA 3UKOA 3P9SA 2PCJA 4DJTA 1MB4A 3OJCA 4Q7MB 5KC8A 1Z17A 4UEOA 1HE4A 5HRCA 3ZHSA 2YFQA 2J6HA 2R25B 4FVTA 3I42A 4LX8A 4BQFA 2QT9A 1OZGA 5JS5A 3L7NA 3EXFB 3C18A 1TM7E 4Z1MA 3A10A 3AFGA 3HWRA 3MINB 9LDTA 4X92A 3LHSA 3MLBA 1HFEL 4W4TA 1LK5A 3FLEA 2FMHA 3SR4A 2JGDA 4G0PA 5FAKA 1NM5A 3FDJA 2WZQA 1AUQA 4IS2A 1USGA 4NENA 5EPUA 4GMKA 2KX7A 2DULA 4UBIA 3BK7A 1P8JA 4MS1B 4EJSB 2WJ6A 3DAYA 2X7XA 3RLFA 1E92A 4R1PA 4C7JA 5LA6A 3W90A 1U9YA 4IICA 1K4YA 2ZBEA 3E3AA 1ULSA 1EUQA 1PZEA 4RDHA 3HJRA 2O5VA 3RVJA 4P53A 2NSLA 4GNKA 5BSGA 3W3AH 1DDOA 3HMQA 3G50A 5ERXA 3O4VA 4OBWA 2GCEA 4KBLA 3KP1A 4JJIA 2PSFA 4W82A 5K05A 3RF7A 3ON5A 4Z3OA 1QGED 1QQ7A 3GG2A 2H2WA 4YYZA 4KG7A 2AFRA 4IO1A 5B53A 3CZ4A 1OQAA 5E7JA 3FNBA 3B1JA 3HA5A 3HHEA 4FBMA 5I3ZA 4B7CA 2RD9A 4XGIA 1NXVA 1U6KA 4S1VA 4AL0A 1KZ4A 4XIJA 5JOQA 1DCMA 4E03A 5ALRA 1RYFA 5ALZA 3DAOA 2PIAA 3A2NA 1VLSA 4JOSA 5EWLA 5AP9A 1FU7A 4BBZA 2ZPTX 4R2HA 3PYLA 4R0MA 1MT0A 5IHPA 1ZAYA 2Z4SA 3NYLA 4BZWA 2W4MA 3D6JA 3C70A 3CLTD 3HQ4O 1K2WA 4PPGA 3A1DA 1EWRA 3L7JA 1YZVA 1XELA 1PKEA 1A5ZA 4F4BA 1CBUA 3PNOA 5CXXA 4N4WA 1VMDA 2H0QA 2EPMX 3AB8A 4DV3B 4OVKA 4E4YA 1C3OA 5G3YA 4XYMA 5D3ZA 4RVCA 5BOSB 4AP9A 5A3VA 4PF1A 3ILVA 1H5QA 1JDBB 2V0GA 2JRCA 4EHPA 2H5JA 2REXB 2ZIVB 3GLFE 2P2LA 3A4LA 4QSMA 1KZ7B 3EVEA 1NZEA 1KP9A 1SIUA 4FFLA 3TVDA 1K86A 3OOHA 3GXBA 2G1AA 5THXA 4UREA 4A8PA 5IH3A 2AMYA 2WTAA 4DOZA 1E32A 4ZT3A 3K1YA 1E2BA 3LUFA 3RJ5A 1SULA 3ZLJA 3KBBA 2H4JA 1Q0PA 2P65A 5KOHA 2JPDA 1UPCA 3Q15C 3NCTA 5IYZB 2QJOA 4G6ZA 4IIUA 1KOJA 4ZD6A 3SC2B 4B31A 4HAOA 1JH9A 5ER6A 3U7RA 2G83A 1MFPA 3LHFA 2YVQA 4QG7A 4LDNA 2XUDA 2PKCA 2ZI5A 3QMVA 3K20A 5CFNA 4J0CA 2ZJZA 1U28C 2EU8A 3C3DA 1J8FA 2VHVA 2RBEA 5T67A 3NEPX 1YSCA 1QNFA 3MW8A 3ZU4A 4FHZA 4QUDA 2PKEA 5E4JA 4HWPA 4OCZA 2R62A 3Q40A 3NU1A 2WVAA 4PSKA 4CTMA 3ILHA 2IBTA 4KLCA 3K1TA 4CFZA 5ES4B 3J06A 2BFFA 4GKJB 4MKZA 4OIFA 3SYNA 5T3UA 4TYNA 1ZO8A 5K2MA 3WRXC 5KNBH 4S2EA 3W2EA 3JYPA 3Q2IA 3TXXA 4D9EA 1LDNA 4A82A 1T1JA 5DVZA 2ZQ5A 3GA0A 2R7SA 1X80A 4DQLA 4NP6A 4BO5A 4LRSB 4D44A 1YKFA 3GUUA 2PJUA 5LZ4A 1RR6A 4QVGA 3CGWA 3P0FA 2O3SA 1I5EA 4WESB 3AM3A 4II3A 4TYQA 1RM0A 2QTHA 2VHEA 5PGMA 4RORA 3DC7A 3RW0A 4CS8A 3PR2B 1EXMA 4MR9B 2ZDGA 2VEDA 4DE5A 2C4UA 2GM5A 3HI6A 3LZCA 3ZWKA 1BXZA 2PKXA 4TMKA 1RXSA 1TKAA 5H8WA 1ZK0A 4X1YB 4MGIR 1QHIA 4AC9A 3QA9A 3U5ZB 1H5UA 1OXVA 1ZZGA 4WZAB 3DD1A 3KNZA 4EFLA 2JVIA 1R0XA 3VPAA 2FPRA 1EEHA 4KQHA 3CB4A 3BRJA 2DM6A 2F22A 4R84A 3AG4C 1JHAA 4FDTA 4AJKA 5BV2P 5AM0A 5F2NA 1N5LA 3T99A 4OQYA 4MRPA 3PNPA 3CO0S 2X19A 1TYAE 2DBZA 1A7KA 1W4AA 4BO4A 2IS4A 4DMCA 3G1TA 2OCAA 5BWMA 3GDHA 1R3UA 3E2PA 2JCVA 4HMOA 2OBFA 5DXAA 3IVRA 3FHDA 2WU0A 1JQ5A 2D8AA 1E2DA 2HLHA 3OJXA 1EDBA 3L8GA 1LRJA 1L7CA 2I8CA 5L3QA 5SY9A 3SNKA 1XVLA 4GBED 1Z5OA 2QY9A 1WKVA 4C2AA 4BNNA 5CFRA 1HZJA 4A7PA 1OYYA 1GG9A 4Z7JA 1X87A 3TJ5A 1LB1B 1RYZA 3TK0A 1KERA 4D9GA 2ZYDA 1QIHA 5H59A 5ECDA 3REOA 2JFWA 4AJ9A 3MAGA 4A5SA 3BWCA 4CTOA 5IK2D 3UUFA 4EUSA 2VYFA 3P96A 2XQJA 1AV7A 2XLBA 2AQ8A 3GO4A 3GMDA 4FZRA 4M1YA 1MOQA 1FYWA 4V3BA 2Q9UA 1P1KA 3OJWA 4PIVA 3TOSA 5B3SC 3SS9X 3U3FA 1ZGJA 3KT3A 3G2QA 1Y1QA 1OLUA 2ZTHA 2GJKA 4XM1A 3OQBA 4NY1A 2BCJQ 3R7AA 4JT9A 1T9GS 1SXJC 2ISQA 4N54A 2KJQA 5ALWA 1X1TA 3ZSUA 4AL4A 1V3TA 5JRAA 1PJ4A 1FDTA 5BSMA 1PK9A 5KI6A 5B37A 4DSNA 1FK8A 3ZJTA 1M7HA 5F5XA 3EGWA 2YEVA 1Q77A 2OHHA 2PEYA 5CYGA 2QVBA 3PJDA 1RWNA 4HAWA 2DWPA 4Q3LA 2DPXA 4BKMA 4B74A 2DKFA 3PPXA 2VYVD 3WTBA 1OFHA 1YAUO 4J0DA 3Q8WA 2YZ7A 4PX3A 2ZEJA 1NZJA 4IO0A 3ICOA 5CT5A 3OIUA 1X8KA 3RFUA 2GCGA 4U9HS 2B98A 4UEJA 4Q19A 3LM8A 2NO5A 3OZXA 4R2KA 4B44A 1N5KA 3LFHA 4DLPA 3UXYA 3FNEA 3PQEA 2G9RA 2Q1XA 2P9HA 4LOHA 2XMZA 3PC8A 5BQ3A 3EXEA 2DERA 3A37A 3VO9A 1LI7A 1M5UA 3EA0A 3W9YA 1E7RA 1AO3A 1MC4A 4NG4A 5BVHA 4D4GA 2NSGA 3HLYA 4H08A 2VBCA 4DQ0A 2CN1A 5HXAA 2ZANA 4TPKA 1QVRA 1BS9A 3AVYA 1GQYA 2I2BA 5ABPA 4ZTZB 1G3UA 1Z28A 1WUHS 4Q9LA 2I4MA 4D42A 2JJ1A 5TMBA 4PNZA 1NY5A 5KOJA 3OTWA 5LQRA 1MHTA 2JJ2A 1WPXA 1XU9A 1TYZA 3QSYA 2R5NA 3AINA 4XQEA 1XVAA 1KY4A 1J0XO 2V58A 3CZRA 4XQ1A 2WNIA 4JR1A 3FAPB 2C07A 1YU9A 5CVTA 2AJ8A 3TRIA 1O9GA 4R3WA 2GCOA 1OZAA 2VQDA 2HJRA 2I54A 1E0KA 3O0DA 4OHKA 3GFBA 1N3IA 3K94A 4IIGA 4KI7A 1FDSA 4C01A 4YRJA 3CCBA 1VPWA 1WVGA 3RKUA 4L3VA 1RZUA 1RS0A 2WM2A 4X0EA 4M0DA 3O26A 3NZEA 3H2GA 4Y30A 2ZSHA 3EEIA 3CUKA 3LDHA 4JP3A 3U4AA 3KZXA 3L82B 3L6CA 1H9CA 3RUIA 1RRGA 5JG7A 5JHGB 1WZEA 3NONA 2D2IA 3E3MA 1K05A 2OO5A 2JBAB 3F8TA 5AK5A 4BO7A 4J9UE 3S1LA 3S9OA 2ECPA 3OOSA 2K7FA 2J3EA 5H70A 3THYB 2V65A 1L7DA 2IXAA 1XZ8A 5G1NA 4Y2TA 1GGMA 3LCUA 1KQOA 4LG1A 2FPGA 2EIKC 4G8JA 5I45A 1T13A 4M53A 5BMOA 3B0UX 5CI9A 4N7RA 1SYQA 2H08A 1PJBA 3QW0A 2C0PA 1ZI8A 3NRCA 2YMLA 4TS4A 3VBCA 5DNAA 4WKPA 2PMFA 2ECOA 2HCJB 5D3MA 3INRA 1Q7GA 3ZHBA 4DEVA 4Z4CA 3F97A 3CX3A 4N4AA 1SBTA 2WRZA 1YCDA 4RHTA 1GG8A 4C6RA 4DLWA 3HVJA 3BE8A 3KT0A 4PAOA 1SA0B 1ULUA 3BXZA 2NUPB 4XJXA 1XNRB 3ZXYA 3FPEA 3ZHYA 2XYHA 1KO4A 1Q7EA 3FY4A 1BR4A 4MV6A 4M0PA 4CLXA 1FEZA 3FUUA 1LZKA 3I8XA 5JSFA 4GX0A 4ZVRA 3N8KA 4PPYA 2P3QA 4DA6A 4MLZA 1ISPA 5BWBA 2BT4A 4PAGA 4X00A 3FX2A 3BWYA 2JGFA 5LQAA 3BULA 1V1MA 3RSHA 1LI5A 4F2WA 2VT3A 5JAQA 2ZREA 4Q00A 3ANSA 1SK9A 1BBHA 4J6EA 4F12A 1C3LA 3JRWA 2EAUA 4RGBA 1ITZA 3UB4A 2G6TA 1KKLA 3C15C 1C30B 3W0LB 4TWAA 1X39A 1DBRA 2QD4A 3M1CB 3LHIA 3OPVA 4KIFA 2XMDA 1E1QD 3UGOA 4ZXPA 1X1CA 5C51B 4GQIA 5B30A 3EMKA 3M3HA 2I2DA 2VZ9A 1WXQA 4XX0B 3H1TA 3UATA 3AR3A 4JZKA 3WR5A 3CCCA 1X7XA 4D25A 4YN0B 3LUTB 1FLDA 5IT4A 3H5IA 4Z9FA 1GFWA 3PNLA 5JCXA 3CGGA 1N5MA 5U4QA 5I4CA 4PGAA 1ZOPA 1I2CA 4CMEC 3TFWA 2UZ3A 2YYAA 3X43A 3MCWA 1ORSC 3VH1A 1AHPA 1L1FA 1CX9B 1DFGA 2OHJA 1H9TA 3ZDQA 1DP4A 2OMEA 1XLWA 4JYAB 1C3EA 2EP7A 4PVDA 1KETA 1GKIA 3HB9A 4CMGA 4HEHA 3WJ7A 2WK1A 1OF1A 1O6FA 4ZYTA 4I3MA 1WB9A 2NSHA 3VO8A 3P2OA 4BECA 4YDSA 4G4JA 5T3WA 4L2IB 2GESA 3K6SA 1XMXA 3ELUA 1Y8CA 3C8GA 3UHPA 4R1SA 5FH9A 1B0ZA 3ZCSA 3CVJA 3THWA 4D80A 1N5DA 2GLTA 1NNI1 3FA2A 4DLZA 1MIHA 3SQNA 3GLFA 1W4CA 1JPUA 4E0IA 2HS5A 1FMCA 5EXSA 4BLWA 1Q6ZA 3P2KA 4BBJA 5AKZA 2FPPB 5FX2A 3ZCXA 1CDOA 4DF3A 2RDMA 1A76A 5TJ9A 3U31A 4DSOA 4CKWA 1YGYA 4KZPA 4WNYA 2R6HA 2ERXA 4KMRA 1IOVA 1F4PA 4K8RB 4E4TA 1KAEA 2IYEA 1XCJA 3VR4D 5JSUA 3WKCA 2DZDA 1P0MA 3EGIA 3A4TA 4R8SA 1VCOA 3OPNA 3T9EA 4WCFB 4Z54A 2WZGA 3E9MA 4KSBA 1Q0RA 3H2IA 5A02A 2QLMA 4E7ZA 1ZUNB 2Y0BA 1PV4A 1RKEA 2CLEB 1G3MA 3UHOA 4LMBA 1Z7Qc 1TA4A 5D5QA 3HCFA 2ZCJA 3NTOA 1F5NA 4XCQA 4P0PB 4CIHA 5KNCD 1YQUA 2IK8A 1KSGA 4EBBA 1Y5LA 2BCGY 3JQ8A 3LRPA 2FX3A 5F51A 4LOJA 3KSBC 4E6PA 2EQAA 3OU6A 2BM8A 4MI6A 3HJAA 1Z6TA 3KUXA 4D7AA 2CXXA 3Q7EA 4O4JF 3CH4B 3RR2A 4DR7B 5CYPA 3WG9A 2FPMA 3G6WA 5DNDA 1XTPA 4N3BA 2JIOA 3H4VA 3QYPA 4LYFA 4GMFA 3IR7A 1KMQA 3PNQA 1KOLA 4RS3A 5AKKA 2WMOB 3BD8A 3DH0A 2FGJA 1F12A 1GU7A 3FWNA 5IF3A 3LX5A 1ZR4A 4X1IB 4GYWA 1W96A 1W5SA 2HSEA 3H6GA 4ZARA 3GJZA 5CT6A 4CF4A 4D99A 1W0JD 1RPNA 2XB6A 4NYIR 2EF1A 1WM1A 1RMTA 5TEWA 3K1IA 4K7JA 4AICA 4AXXA 3GEHA 5DOVA 4M36A 1NF3A 3RYIA 4C88A 3DV0A 1HTWA 4RKRA 4JI5B 4BRSA 1J97A 3B9PA 4PCUA 3CTMA 5HUHA 1M6YA 1NW3A 2QJRA 1A8UA 4C5BA 3RG2A 3KSDO 2REQA 4U6QA 1QIFA 3F9RA 1NVKA 1N0HA 4OSEA