1J8YF

Signal recognition particle conserved gtpase domain from a. ambivalens t112a mutant
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
295
structure length
291
Chain Sequence
b'LLDNLRDTVRKFLTGSSSYDKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIERREWFIKIVYDELSNLFGGDKEPKVIPDKIPYVIMLVGVQGTTAGKLAYFYKKKGFKVGLVGADVYRPAALEQLQQLGQQIGVPVYGEPGEKDVVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEEAALLEEMKNIYEAIKPDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDELEVFNPRRFVARLHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL RECOGNITION 54 KDA PROTEIN
publication title The crystal structure of the conserved GTPase of SRP54 from the archaeon Acidianus ambivalens and its comparison with related structures suggests a model for the SRP-SRP receptor complex.
pubmed doi rcsb
source organism Acidianus ambivalens
molecule tags Signaling protein
total genus 99
structure length 291
sequence length 295
ec nomenclature
pdb deposition date 2001-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1j8yF01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j8yF02
2BWJA 4JLDA 1CEEA 4JLAA 1HT1E 4IHQA 5SZHB 4GBMA 3NBZC 3CW2A 1GKIA 4Q03A 1OIVA 5DHAA 3GJ3A 1EGAA 4GP7A 1OFHA 4B3GA 5GJWC 4IVPA 2J1LA 1VCIA 3BB4A 3T12A 3THXA 4C30A 5EJEA 4KSBA 1VECA 2OCYC 4EDHA 1OLOA 1P60A 3P27A 4OQMA 1TF7A 1G1MA 1KO1A 2RMKA 5K8UA 2BMEA 3FMIA 3KXIA 2QBYB 1A82A 3QE0A 3TW8B 3TNFA 3GLHE 2W2VA 3BH7A 1NLZA 2FPMA 3SHWA 1XX6A 1E2GA 2DFNA 3IUYA 2NO9A 3EPKA 3THYB 3KJEA 3K9HA 2O0KA 3DKVA 4QHTA 4F4JA 1RKBA 3A8TA 4P4UA 3AVQA 1BO6A 1G7TA 2OT3B 4TL6A 1P9RA 4TYWA 1AS3A 4LJAA 2AN9A 2QEQA 1ZM9A 1NN3A 4AI6A 4HLUA 4AG5A 5FPSA 1UM8A 5CDFE 2C78A 3HU1A 1E3MA 1ZNXA 3L8ZA 3R7WA 2OV2A 4Q4AA 3X1ZA 2HF9A 4LV6A 4AKEA 2H5EA 4LJ5A 2YWGA 2D7DA 1LW7A 2BBWA 1S96A 3TLXA 1E79A 1NBMD 3REGA 5B57C 1G7CA 1KAOA 2QTHA 1MO4A 4JVMA 3DM5A 1EESA 2CNWD 2D3WA 3ZQ6A 1UF9A 1L7VC 2J41A 2NO0A 4R9UC 3RANA 3ZQJA 1J8YF 2RGNA 3A4LA 5HE8A 3KB2A 1RJ9A 4K46A 3EZ9A 1OXXK 2A78A 3RC8A 4CIDA 2GETA 3WYAA 1WDTA 1G3RA 3GLFA 3U4QA 2ZJYA 4L8GA 2ZJ2A 2ANCA 3CRRA 3QF4A 1M7BA 2V54A 4ZO4A 3KKPA 4MRRA 4C0JA 3CNOA 2ZRFA 2ZU6A 5G53C 2FDCA 1WBBA 2XX3A 4Q01A 2MMCA 3KDSE 2GAAA 3BFVA 2F7SA 3NIBA 4LHWA 5SZJA 1F3OA 1KKLA 2ZUCA 4JJZA 4MRVA 4TSFD 5IDVA 1HQCA 2ZJAA 2F43B 1ZM4A 5JWOA 1DELA 4C0KA 3LW8A 4PAOA 1OFTA 4LBZA 4HAUA 2KWIA 3AVOA 1R8SA 4DLWA 1E9SA 1G5PA 4KSCA 1S1CA 5DIFA 1ZU4A 2ONJA 1Q44A 2R44A 2QM8A 1SZPA 4W5JA 1W36C 1ZYUA 4CGZA 5KPDA 1P2UA 4PTLA 5AK0A 2H17A 3DEFA 1QDEA 2PMDA 3LBNA 3GLGE 2VHTA 2HF8A 5D3QA 4AKHA 1DO2A 2JJ8A 3SE0A 1D9ZA 2BDTA 2RAPA 6Q21A 1KDPA 5FH9A 3AKYA 3BK7A 3TSOA 2YKGA 1TEXA 3OESA 5KO2A 3CX6A 2JDID 1GSIA 3I8SA 4QHYA 5AJWA 1XDBA 3DO6A 3I4LA 1QHXA 3CPHA 4KLZA 2LKDA 2GBLC 1VYTA 4UJ5A 2O8DB 3U2QA 5G3ZA 3U6KA 1OKKD 4NCJA 1XXHE 1D2NA 1VG8A 1E32A 1CF4A 4PQYA 4R2HA 4M1YA 2VP6A 3H86A 1HUQA 3KXLA 1KO8A 3LVRE 1XD2B 1ZP6A 3C5HA 1OXUA 2A5FA 4W5WA 5JEEA 1XMJA 4DWJA 4JLPA 2I1QA 4HZIA 2J0UB 3W90A 1E1QA 4BASA 1HH4A 4UXHA 1RVDA 5DGXA 2CLDX 1R0YA 2C96A 2CHGA 1GZSA 2GCNA 4JVNA 4PHHA 5HPYB 2QRNA 4M4SA 2PT5A 3C8UA 4II7A 1E2FA 4URWR 2R65A 3EX7C 1F2UB 4ZIRA 2Q0HA 3PCRB 2F1JA 5BYKA 4QM6A 3GJ5A 1Z29A 1II9A 2OXCA 1G4UR 1KO4A 4BFZA 2WWFA 4HZUA 1M34E 2ZVQX 4HLQB 3LY5A 1UADA 3TUIC 3CONA 1I4LD 5KHOC 5JSZB 4G5GA 1SVLA 5L3QB 2BVNA 3OE7A 2Z4RA 3VKHA 2HEIA 3GJ8A 4JVLA 4CT5A 1XTIA 2FGJA 4DXAA 2WMOB 3NKVA 2WOJA 1O3YA 4A6PA 3K09C 3UANA 1ANKA 4Q9HA 2QE7D 3IILA 2B7CA 1W44A 4P31A 4R7ZA 2OCAA 3NDPA 5EP3A 2YHSA 1X86B 3B1WA 3CLVA 3I3SR 3TVDA 1FUKA 3TUZC 2XSZA 3WBJA 1PUJA 2UVQA 3WNBA 1Q12A 2WJHA 2QMHA 3Q7PA 2HUPA 1GUAA 1CKEA 2J3EA 3B8HA 5B64A 3BFXA 3VHXA 2FFBA 1VCNA 2OAP1 2VTKA 4WAUA 1AQUA 4BECA 2I4IA 4B6FA 5C1BA 1P2SA 2QAGC 4NL4H 2P6NA 2TMKA 2HCBA 1R0XA 3V4FA 3EPLA 2ZI3A 2GJAA 3GMTA 4O25A 5DE3A 5FTNA 3SYNA 1SXJD 4CEJA 4EKDA 2J7PA 5FTJA 3AF4A 3TMKA 5K8LA 2W2XA 4YC7A 2V6JA 1YE8A 4TT3A 5FOSA 4Q1EA 3C15C 5FL7D 5SZIA 5E3HA 4DIDA 1XEWX 1BIFA 5KNCA 1RZ3A 1X8LA 5TY0A 2IA5A 4TLAA 3A4MA 2ZI4A 2ATVA 2FPLA 5HR5A 1JXMA 2WPDD 4R71A 4X8LA 4Z54A 2YYZA 5KUTA 4FMDB 1G6OA 1TF5A 2IYXA 2YV5A 3M6AA 4DEXA 3OHMA 1SXJB 2CXXA 3UATA 3VKWA 1W4AA 2R2AA 1Z6AA 3SNHA 4BLQA 1LF5A 2DFLA 2FE4A 3THOA 3CNNA 2Q3FA 1FOEB 2K5UA 4PZYA 5JEDA 4GL2A 2ZYWX 3SFZA 1CJTC 4DUGA 3TRFA 4QOSA 1AN0A 4NYIQ 4BLSA 5KDOA 5DNYB 1SGWA 2AXNA 4JT4A 4LHVA 2BJWA 3SHFA 2R6CA 4URVR 2WWYA 2D62A 1NY6A 2ZI6A 4NYIR 1TL7C 1E2JA 5EXSA 3RSLA 1P5ZB 4KODA 1NI3A 2O52A 5BYJA 2FX3A 4GP6A 4DSNA 3ZVRA 4ZDKA 3U44B 4Z1MA 1G9XA 4QC2A 1QHSA 1ONBA 2GZHA 4BWYA 2ORIA 2P3SA 5ANRB 2EFHB 4HI0E 2BJVA 4GOJA 5JWHA 4KBGA 1II8A 3WMFA 3QVUA 2AHOA 3P26A 4TYPA 1CBUA 1LFDB 1KO5A 4ZV4A 1KK1A 2WSSA 1KI7A 4RD2A 4ZCIA 4QM7A 1TF2A 1UKVY 3U5ZB 2NO6A 5IF9A 4LWZA 1VG9B 4DLZA 4CDGA 1PLKA 2EFCB 1EFHA 4ZCMA 2VP9A 2L0XA 4MGKR 1ZJ6A 1XTKA 3RABA 3EXAA 3T61A 1AK2A 2SHKA 1EXMA 821PA 1K8RA 3H0KA 1VIYA 3LW7A 2CDNA 4O3MA 3DMDA 1KY3A 2KE5A 2OEPA 2HDNB 3ZD7A 2XNDA 3IEUA 4FMCF 1E1RD 1M7GA 1Z0JA 1YZGA 4IEEA 4U00A 4TL9A 1KMHA 1KSGA 4EFLA 1G8FA 2RGCA 3K09A 2DFKB 3OAAA 4DLUA 1T9HA 2QI9C 5AUPB 2RGEA 4QBFA 2CJWB 3GLHB 3FMFA 1US8A 3LH5A 5JJIA 1XMSA 2HV8A 2GDJA 1U2RA 4MYCA 3RS3A 5DYIA 1CJVC 3C7KA 3GFPA 2QENA 2YWHA 4HB4A 4MA4A 3GP8A 3B5JA 2IWHA 2WV9A 3H1TA 4UNPA 4F92B 3E2IA 3A1SA 4DSTA 1XD9A 5J4HA 2W6JD 2REXB 3Q9LA 1L8QA 1E4YA 5A0FA 3LXXA 3T35A 3VU9A 2CL0X 1JEEA 3BOSA 3I32A 3ZVMA 5L3VA 2PX0A 2H7VA 4FCTA 4NCNA 2C2HA 2P5SA 4XIGS 2OFWA 3SBDA 2CK3D 3FFBA 3QIAA 1KYIA 1EWQA 5KNDA 2IT1A 1MABB 5A5GA 1JR6A 3R9WA 3QKSB 2ZSAA 3TAHA 2W0SA 5DISB 3EW9A 4LHYA 2W58A 5JBQA 2O8BB 3FMOB 3NH9A 1E96A 1QHGA 3AKEA 3TW4A 4A1FA 3AVUA 2NO1A 1DS6A 1NG9A 5EE1A 1T5LA 4Q47A 3NH6A 1X8JA 4GDFA 3RWMB 4Q5IA 1CR4A 1OXTA 1NSFA 1ZCBA 3P4XA 4KFTA 2HT6A 3PJRA 1JALA 1IY2A 4Q9KA 4A6XA 3QPUA 3ECCA 2XZLA 3DOEA 2DHRA 4CEIB 4NPHA 4MRPA 3VR6A 2JLUA 5LD2B 2REBA 1R2QA 1BOFA 4GNKA 3PEYA 4C7OA 4XH9B 4YMVA 4YDHB 2QN6A 3LXRA 4D2IA 2Q9AA 2GJKA 4S35A 1FQJA 2PZFA 3VR2A 4Q4HA 1D5CA 2A2ZA 1UKYA 3BWDD 4MDEA 3KUDA 1VPLA 2YOGA 2ZUBA 3NBFA 2J46A 3AVYA 4JVSB 3SR0A 4UXJA 1T6NA 2W6ID 1YQTA 2AD5A 1JR3A 1OFIA 4PQRA 4HAYA 3CZPA 4UQOA 1A2KC 3VX4A 4ABYA 2XGJA 4WZ6A 1XU4A 3D31A 4D4LA 5CJPA 1XEXB 3ICEA 1AJEA 3MG9A 1U8YA 4Q4JA 3BC1A 2PEYA 2GXSA 2PBRA 3W34A 4P4SA 3O8DA 3T06B 4YMTA 4PC6A 1XJ0A 2G77B 3QKUA 3T34A 5HKKA 3AH8A 3ADDA 5KNBA 3ADCA 5FOXA 4URXR 2V55B 1M2OB 2FFHA 1C4OA 1XXHB 3T1QA 2VHCA 5LBIA 1JJ7A 2PLRA 2NGRA 4LYJA 4BGDA 1FPMA 4NCIA 3LRPA 4OK6A 2JLQA 1ZNZA 4OK3A 5KOYA 2GZAA 2JLXA 4RFSB 1P72A 2HT1A 2QQ0A 1HTWA 2PJRA 1HT2E 1M1YE 2QQEA 4X8HA 1G7RA 3WY9A 5H70A 4JKYA 4AY2A 5CJ2A 2F1RA 4DLXA 4FWTA 3ZLJA 3DZ8A 2C5LA 2GEVA 4XSGA 2BOVA 4E03A 1EFUA 4PC1A 2BEJA 5LDDC 2JJ2A 1VG1A 3PIRA 1PJRA 3PUWA 1QVAA 4YMSA 4B3FX 3SS8A 3MWJA 3IBYA 4NKRA 4NYJQ 2J0QA 2VO1A 4DLTA 5CIQA 2J9RA 3SU8A 1YZNA 1NRJB 4B3XA 2CBZA 1VYVA 2MSEB 4Q1DA 2XJ4A 4TL7A 1W5SA 1ZBDA 4TMZA 3KQHA 1U9IC 2FEMA 3KUCA 3TJZA 4TYQA 1JBKA 4LJYA 2F1IA 2H1LA 1SVIA 1I4TD 5GVRA 4EJSB 1QG2A 1JEDA 2E9SA 3L0SA 3CRW1 2ZI5A 1F2TB 4PC3A 2ZYVX 3TSZA 3K0CC 2Q3HA 4GFDA 5G3YA 2WAYA 1NKSA 4G01B 1I2MA 1ZU5A 1YZKA 3FVQA 5CLQA 3NDBB 1Z83A 2GNOA 3VTKA 5CB6A 1E2QA 1HA3A 4DB2A 3FTQA 4V0KA 3I5YA 1OXSC 1IXRC 1W7AA 1OB5A 2QBYA 1VKJA 4M1KA 2C99A 2CL6X 4QNMA 4WBSA 1DPFA 2WKQA 3OFND 1E6CA 3QXHA 4KYUA 3GLFE 3T1VA 3UMFA 4YDSA 3T15A 2QY9A 2QL6A 4P4TA 1KI1A 1OF1A 1UKZA 2QMEA 3AUYA 3I5XA 1DO0A 2FFAA 4WVFA 3O8RA 1W4RA 1E2LA 3ETLA 1NN1A 4PR0A 3HJNA 3OIUA 5IT5A 1OIXA 1E69A 4KI0A 1BKDR 2BV3A 1I2DA 1RE0A 2CCKA 2AK2A 3BORA 3CPEA 2PCLA 2OXRA 5L3RA 2W00A 2Q9CA 3WP0A 3M0EA 1G20E 4LUCA 1DAHA 4BFVA 1GKUB 2X2FA 1BMFD 1Q3HA 2FPKA 4D6PA 4EUNA 1N6NA 3OIVA 1CRPA 2ZRPA 1DAKA 1YHNA 1BH2A 4DDWA 4DSOA 1FNNA 1G3UA 2LCFA 3BBPA 2IWRA 2QA5A 2G83A 1XWIA 1FW6A 2JCSA 1OE0A 1CXZA 1E2IA 3MSXA 4N0EA 3QXCA 4G0NA 2W0MA 3QKRA 3QXJA 1R5OA 3EG5A 3K8YA 2JLVA 3B60A 2A7QA 3KJIA 4KFUA 3J81k 2F9MA 2ZI7A 1Z0IA 3CF0A 3Q72A 3C4JA 2ZYUX 1NBMA 1Q20A 3LO5A 4ESVA 1G6HA 2C8VA 4B2PA 2MSDB 4POAA 4URUR 3VX3A 3CF2A 5B58C 3Q85A 4IRUB 2OBLA 3VFDA 4BRUA 2GVZC 3MFYA 4OK5A 2C03A 2IXFA 4RKEA 3THWA 4IFBA 2W83A 1ZCAA 3BD9A 3BH0A 2OZEA 2RCNA 3BGWA 1KDTA 1XRJA 3U7GA 2R6GA 4M9SA 3HYTA 2IYQA 3IPYA 4JSTA 5GJCA 4LPKA 4HUTA 4A92A 4ASUA 3W5JA 1KSHA 1I4DD 3MWYW 4KFRA 421PA 3EZ2A 4W7SA 4DLSA 5FBWB 1Z0FA 4D80A 3GLIB 1Q57A 4TLCA 2G9NA 1GP2A 1J2JA 3QSYA 4GOXA 3NG1A 2ERXA 4FMDF 1SXJC 4M1SA 4TSFA 1XB2A 1Z6YA 3WHLA 4OHYA 3NBXX 5FOVA 4U7DA 3PEWA 2Q21A 3HYRA 1KI3A 1OHHD 1P4SA 2V1XA 3HPRA 3NC1C 4IXMA 4NBSA 3FYHA 3LQRA 4LC0A 4ZI3A 3U7HB 2WZQA 1E9RA 2BKEA 2ZR9A 1C9KA 4RFVA 4HYYA 4F4IA 3T1TA 3QG1A 1Z2AA 2QT0A 4Q00A 1SKQA 3H4MA 4EPYA 2RH5A 4K81B 5CK5A 4MRSA 3HWSA 1T8TA 4L4UA 4XD7D 1FFHA 4Q7LA 1XD2A 3G5UA 4C9BA 3AVVA 1CJMA 4C3ZA 2AL7A 1KI2A 2B7BA 4KAXA 4WXRA 1D2EA 1DARA 1KZ7B 1NVVQ 3QVVA 3B1XA 5FFMA 2DR3A 2JDIA 1KKMA 4QXAA 3K0CA 4Q4LA 2IBMA 3F0TA 4KU4A 1Z22A 4M9QA 4ZKEA 2OHFA 1SVOA 2C04A 3U61B 5DHFA 1NVVR 4AKGA 3CX7A 4UNNA 1OKKA 2D06A 3TAUA 3PUYA 2EVWX 1HEIA 3IHWA 4IEIA 2GESA 1J70A 1N6PA 1ZM3A 4Q19A 4DC9A 5DO9A 1OSNA 3PEUA 3QPVA 2F3RA 1SULA 4HB0A 1E0JA 3FKSD 3TBKA 1M8PA 4KXFB 1IQPA 1PUIA 1AS2A 3G82C 1G3QA 3LLMA 1AS0A 4TTRA 4YXWA 2ZROA 2OFXA 3SDZA 1P75A 3QXXA 4Q48A 4BE7B 2ZSEA 5JJKA 2QSZA 1IBRA 3KJGA 4TTQA 2DWPA 5L3QA 4FN5A 2CHQA 1Q22A 4ILEA 1NN5A 4LBYA 3I8XA 1T5IA 5D3MB 4LC1A 2IYRA 4LZZA 4QGGA 2X2EA 2GCPA 2ZE5A 4XTCS 3GEIA 2PJZA 3CM0A 1NL3A 2PMKA 2IYWA 3ONWA 5FUYA 1SHZA 3KFXA 4OI4A 2FF7A 5E7JA 4O2LA 1DG3A 3GJ0A 1W0JA 2GEDA 3SZRA 4PSVA 4EPWA 2CLCX 4G5SA 4AYXA 3I92A 4Q9JA 1Q0UA 1TX4B 2A9KA 2WMNB 3DOFA 1X1RA 2YC2C 3FB4A 1J90A 2OAQ1 4US1R 1PZNA 1AKYA 1H65A 2YNMA 3KKMA 2LKCA 2ORWA 2F1HA 1E2MA 4WXPA 3SFVA 3ZS8A 4YQFA 5L3SB 4MQBA 3M4YA 4XVQA 1AM4D 2OLJA 3E70C 2VP2A 2ZI9A 1YR7A 1X3SA 3B1YA 4RD3A 3EASA 3ZVLA 3PUXA 5JI3E 2QMOA 4JBYA 1XFAA 3KTAB 2NIPA 4NMMA 3BB3A 2FSFA 2VYFA 3A36A 1DTSA 1COWD 1KDOA 1RRGA 3TIFA 5FTKA 1FX0B 2OCPA 2X1VA 2O8CB 2VA8A 3IDQA 5BN4A 2O8EB 5LPNA 2OSBA 3RAPR 1JECA 4A0GA 4G3XA 1TQ2A 4Y0VA 3UPUA 4DB4A 1Z0KA 2KB0A 2DB3A 2H57A 3K0FB 2F6RA 5P21A 4E07A 2WBLC 3PUVA 1SXJA 4B74A 2V1UA 3AGQA 2FN4A 4TMXA 4D0NA 3B9PA 3H84A 4TLBA 1YRBA 5LD2C 2ANBA 5FBLB 5FL7A 2WIAA 2X19A 4LPSA 1XD8A 2HLDD 3FHOA 4D81A 1EFCA 4LJ4A 2WPDA 3EPJA 4Y0AA 1NN0A 1KDRA 1L4YA 1DVRA 2XTNA 3TSWA 4D26A 2JIZD 1XZPA 2N1BA 4GMXA 2C9OA 4CVNA 3AP1A 3SN6A 2Z4SA 2FGKA 5DI3A 1J7KA 4JJKA 1GRQA 3U44A 1YR8A 2P67A 2A3RA 1PLJA 2D74A 2GXUA 3CH4B 4BLRA 2OBNA 2ASEA 4AWXA 4US0R 1G3MA 1LVGA 2V8OA 2WHXA 3TUJC 3MJHA 2EYUA 1N2CE 1KY2A 2IW3A 3AEZA 4OJKA 2JLWA 4QGAA 1WP9A 2J59A 4MGZR 2P5TB 2YWEA 1E9AA 3W8RA 1HE8B 4RZUA 3RNLA 1K5DA 1W47A 2NZJA 1VYUA 1V5WA 1KGDA 3AB3A 1DAIA 2BBTA 4JLOA 1ZNWA 1N5LA 2ZRGA 4D82A 3FWYA 4JLMA 2ZE6A 4Q4AB 3CIOA 2GXAA 5G40A 3DMNA 4LHZA 1CR0A 4UXIA 2AKYA 1N6RA 2X8AA 1VCOA 3HR8A 1KAGA 4V0MA 1N3BA 1XEFA 2ZRMA 4A15A 3ZDQA 2IS2A 1SVSA 4Q7JB 1ESNA 3PV0A 3LA6A 3SQXA 4DJTA 3QNUA 2ZS9A 4FIDA 4RY2A 4ACAA 5H1YA 4M0LA 4I4LA 4X8MA 4UJ3A 1RJ9B 5JWRA 4JL5A 1TQDA 4Z51A 3HR7A 2XTZA 4AK9A 2CJWA 3AGPA 3GLHA 2CVFA 2R6DA 3GLFB 3U4QB 2DCUA 3F8TA 5H8WA 4GSYA 4MKFA 1N5IA 3EWSA 3K70D 1TUIA 2G0TA 2R8RA 3CWZA 4M9XA 3WMEA 1E1RA 4NH0A 4LJ9A 1CS4C 1XCPA 1LS1A 1M7HA 5J40A 3RS5A 4DDUA 3SJZA 1S2MA 2OO7A 5CDFA 2AWNA 1OB2A 1NMXA 1EX7A 3AF3A 3W5IA 2V3CC 1ESMA 4D4KA 4IDPA 3UG7A 2YJTD 3PUZA 1UDXA 4W5HA 4U02A 3ZZUA 1TMKA 3OF5A 3K70B 1G21E 2GK7A 1AZTA 4GRAA 1X1SA 1FQKA 2DYKA 2WJIA 4ON9A 2WJGA 2DBYA 1E2DA 3EC1A 2WWGA 4KBFA 1JR3E 4N0DA 3T1OA 1MV5A 4EPRA 3MD0A 2W6JA 1DEKA 4TTPA 3KL4A 4DLVA 1GNQA 1S8FA 3SOPA 5BN5A 1TEVA 3D6TB 3KQNA 3FOZA 1RYFA 1SHKA 1MH1A 2FOLA 4PSAA 5TVKA 1D8TA 4OI0A 3GJ4A 4PPNA 1YRAA 1GL6A 4OHWA 2CK3A 4DEYA 1JPJA 2RGGA 2Z6VA 3L8YA 5C4GB 3QENA 1NF3A 2GBLA 5CLLA 2FG5A 3N2EA 3BERA 4E22A 1G8YA 1QG4A 5FOWA 3T5DA 3FFAA 1AZSC 1RYHA 5AUNB 2R6FA 2WM9B 3MJRA 1H8ED 4CEIA 4CEHA 4LBVA 2KBEA 2WJVA 2JLSA 3B82A 2XTMA 3JVUA 2D2EA 4H9GA 4M1WA 4LX0A 2B8WA 2Z0MA 4I1OA 3X1YA 2GXQA 1FMLA 3QBTA 1J8MF 3ASZA 3L43A 3P20A 1KJYA 2QPOA 4DBLC 3O47A 4IVQA 4HLCA 3RSOA 2ZRKA 4HAVA 3T5GA 1D9XA 2EU8A 3TKLA 5BXQC 1P61B 1Z0AA 2GCOA 2NTYC 1Z28A 4QJ4A 4ZIRB 2G0NA 4JLVA 1XEXA 2ZRJA 3HP1A 4B2LA 2PZGA 4A8JB 2V7QD 1S3SA 2B21A 3EIEA 4HAWA 2GVDC 4PX9A 1XNJA 4HZUB 4C2TA 2XOKD 1M74A 4G1UC 3IQXA 4ARZB 3TR5A 3WRXC 4Z8XA 4KVGA 1UKEA 4TQUS 1MT0A 5HCIA 2ZEJA 4US2R 4RD4A 1FUUA 2BC9A 2QUZA 4M9ZA 4BLTA 3LQQA 3TVTA 2W6IA 5F3WB 1K6MA 1IJFA 2IXEA 1VIAA 3K9LA 4OHZA 3CBQA 2JLRA 4DT1B 1TU3A 2AFHE 4HEJA 1EFRA 3OEED 1G5TA 1ZUHA 4BLPA 4L9SA 4PAMA 1Y63A 4JLJA 1ZINA 2VP0A 1GOTA 2ZSFA 4RFSA 3W6NA 2IS6A 3ZZTA 2J0VA 4IOLA 5A4JA 2XNSA 1OYYA 4Q21A 1JQJC 1YU9A 1VHTA 4H1VA 1F6BA 4AD8A 1WE2A 4C0LA 3TK1A 2EQBA 4MGIR 3ZVNA 1QBKC 2ORVA 1Q1BA 3CRVA 4I81A 1TQ6A 4D4JA 3GEHA 5DLQC 5DH9A 5LB2A 3TE6A 2QAGA 3MWLA 4W9MC 2A5JA 4N1AA 5J4YA 3IKJA 3MLEA 4AG6A 1JAIA 1WB9A 5FBRB 4LI0A 3SQWA 2VLIA 3OEHA 4S2EA 1H8HD 4IOKA 4CEJB 5DSZA 3S1AB 4EPTA 2ZPTX 4OQLA 1XMVA 1SKYE 4Q7MB 4DSUA 2BM1A 1XEWY 3L0IB 2WJYA 2ZRLA 4I1VA 4NONA 1V43A 4A2PA 1OH8A 1E0AA 3I73A 2ZR7A 1DBSA 1L4UA 2AK3A 4M22A 1TNDA 4JBWA 1VHLA 4NZYA 1VCMA 5EZ6B 4JZKA 2VHJA 4PAQA 3P1JA 2ZANA 1E2EA 4HDQB 1XCGB 1VG0B 4MDFA 1XTSA 4WA7A 1XP8A 3MWKA 4JBXA 4ACBA 3DL0A 3KQLA 1E99A 4Z1MD 4TLEA 3WBKA 3PQCA 4IOMA 3VQTA 4C0HA 1N6OA 1IY1A 5FBQB 5JRJA 1NVXQ 3AF2A 2XXAB 4ZDWA 2QGZA 1DE0A 4I1UA 4GI7A 3K0AA 1JPNA 5EP2A 3U7EB 1MOZA 2VF7A 3W9YA 3K0EA 3NHBA 1XTJA 5IK2A 2ZXUA 2QRZA 3IPXA 4CYMA 3Q7QA 2FFQA 2WSSD 1GNPA 4XTRA 3Q3JB 4LYHA 3B9QA 2QZ4A 1HE1C 4UKDA 4H1UA 2C95A 1W48A 5BW8A 1Z3IX 1GTVA 4OI2A 3LX5A 2FMXA 2BEKA 2Q9BA 2QU8A 2BM0A 4OQFA 4F7WA 1PV4A 2IF2A 4JMPA 1IOZA 4MKHA 2R6AA 5J4LA 2XEXA 4EPXA 2EWWA 2DWOA 4V02A 5E4FA 4B3CA 1II8B 3DM9B 1EK0A 2BMFA 3IIKA 4XWOA 1AKEA 3DDCA 4DKXA 5FPYA 2BKUA 3ND9A 2CCGA 3V00A 2GEUA 5KTYA 4PZZA 1KI6A 4JLBA 3OZXA 3OAAD 1GWNA 2ZIAA 4GMDA 4LY6A 4PHFA 1IN4A 1YZTA 2FWRA 2KJQA 2OLKA 4QRHA 2IK8A 3O8BA 3SC3A 2AKAB 1NJGA 5JMTA 3W3AA 3KZ1E 3DHWC 5FI0B 4HUQA 3TQFA 3HU3A 1CIPA 1W0KA 1U8ZA 1ZAKA 1KMHB 2DY1A 3QY0A 4PHTA 2A5GA 1ZNYA 3E5HA 3MMPA 4D25A 5EZ5A 4AC9A 4QJ5A 1YZLA 1N0UA 4NU0A 5FUXA 3QOFA 5AUQA 2FV8A 4NHOA 1P3JA 3ICQB 1US8B 3HPQA 4HAXA 4XWKA 4OHVA 1ZIPA 4MKGA 4EQ6B 3BS4A 3ND8A 3GLIA 2WTUA 4IDOA 4L15A 2GA8A 4ERNA 1OT3A 3FGNA 4OBEA 5EQTA 4TQAA 1MO3A 3RRYA 3VNUA 4A9AA 4AKIA 4KHZA 1JQLB 2JGNA 2ODNA 1GRRA 2VL7A 3L0PA 1LB1B 2O8FB 1P7CA 3BJIC 3VU9B 2IS4A 3ZIAA 1R6BX 1Z6TA 3GPLA 2NMVA 1N6KA 4M2LA 4MUAA 2FNAA 3PR1A 1W5TA 1P2TA 5IHPA 1A5TA 4O0MA 4E09A 2J7KA 4FI3C 1TADA 3PITA 3SJCA 5EP1A 1B0UA 3WYGA 2ZAMA 1OHHA 3N70A 1G4AE 1IONA 1JNYA 1E9CA 3LWNA 2OE2A 4UNSA 2GF0A 5FOUA 4A2QA 2ODWA 3THYA 4MGYR 1RC8A 2PCJA 2ZJBA 3EARA 2QNRA 2YOHA 1NVWQ 1FTSA 4TLDA 5J4KA 5K8IA 3VKGA 1IY0A 5CYOA 2QG6A 1CLUA 2IS1A 5CIWA 3UMRA 3EIHA 1VMAA 1KO7A 2WKRA 4XD7A 2AR7A 1MRNA 5DYGA 1YVDA 521PA 5CK4A 4URZR 3BRWD 1S0UA 1JR3D 1UEIA 2WWIA 4KJZA 1N6HA 3PENA 2ZYTX 3CRMA 4C7OB 2VBCA 1P9NA 4BEJA 2OUKA 3EIQA 4NP6A 4PFSA 3TGPA 2ECKA 1WA5A 2FSGA 1XJCA 3AVWA 3AP3A 1R10A 1MO5A 2RGBA 1CP2A 1T3LA 4RSGA 2QP9X 1W49A 5D3MA 2YINC 5EP4A 5HKKD 5K8TA 2BIFA 4PQFA 4O2RA 1IXSB 3W8NA 4ZDJA 1KNQA 3FKSA 2OFOA 2P2LA 3D7MA 3W3ZB 1Z8FA 5CM8B 5E95A 4LV5B 2IUSA 3CNLA 2GZDA 2N42A 2YWFA 2VF8A 1YKSA 2UZIR 2CNWA 4P4SB 2ZSBA 2ERYA 1QHYA 1Z6GA 3IO3A 1SXJE 2RGDA 2UKDA 3WNCA 1E2HA 2JEOA 3B13B 3ZZ0A 2PX3A 3RHFA 1OFUX 1IN5A 2F43A 3B7GA 1Z08A 1JAHA 3UK6A 1X6VA 2ZRIA 1DAMA 1NSTA 4OI1A 2C9CA 1AA9A 4L5BA 4R2IA 3UG6A 1YZQA 4BFTA 3IO5A 4BRWA 4RJLA 1E0SA 5FI1B 2YZ2A 2EFEB 4NYMR 1FNMA 2WKPA 2ZVPX 3B2EA 1OW3B 1S9HA 4Q7KA 3K70C 1RPZA 1OH7A 1KSFX 4RKFA 1NMZA 5C46F 1AGRA 4FD2A 4V03A 1D6JA 5JHGB 5JECA 4N3NA 3WNDA 2VSXA 2ZRAA 4IDQA 4YMWA 2R9VA 4XOIA 2O8CA 4BFWA 1KOFA 1UBGA 2IXGA 4PZLA 4A36A 1GFIA 2C77A 4WZAE 2BBOA 3B85A 4TL8A 3GEEA 4Q1AA 4XVRA 3TR0A 2FZLA 1WGWA 1OH6A 1E9FA 1NVUQ 5KSYA 3NHAA 2QPAA 4TMKA 3LBIA 4KO8A 4GZMA 4EAQA 1NP6A 2V9PA 3QF7A 1IHUA 1RRPA 2ZAOA 4HLDA 2GJSA 5EE0A 1L2TA 2JJ1D 2O8DA 2ZM5A 2WJJA 3PVSA 3I72A 2J87A 1FL9A 4LJ7A 1COWA 2O0JA 1FZQA 1U9IA 3AVPA 3GFTA 2HXSA 3LLUA 1GL7A 1Q1QA 2YVUA 2IYTA 2CE2X 2DFTA 4M1OA 2G1JA 5AR1A 3U60B 1Q1EA 4F93B 2J0UA 2RHDA 1VDZA 1WBDA 4V0ME 1MKYA 4MUBA 221PA 1KI8A 4DCVA 1IM2A 1S1MA 3BB1A 3CKLA 1Q1ZA 3Q8XB 5HTKA 5HZHA 3TQCA 2XZOA 4PO8A 5EE5B 121PA 4RD6A 5BWMA 3A6PC 5KPJA 3KXKA 5C4MA 2A30A 3SYLA 1F2UA 5DN6D 3GQBA 5CYPA 3K53A 3Q5EA 3VR4A 4A8JC 3EA0A 4KITB 2ZJZA 2HLDA 5IRCD 3MUFA 3RYTC 1U98A 4BFYA 2O5VA 5JSZA 1KIMA 3ZGXA 2JIZA 1GG2A 1KK3A 4FXPA 5KU1A 3CX8A 4JKIA 5JI2E 2BMJA 2IYSA 2X77A 4B3BA 3AF1A 3CO5A 721PA 4WZBE 3KKOA 3SYKA 1OPXA 3AKDA 2NZ8A 1UAAA 1VTKA 1C1YA 5FL3A 4FMBB 1SKYB 1UJ2A 5FPTA 1Q21A 5TXGA 3X2SA 1GKYA 4B76A 3KKNA 1XPRA 1UBFA 1LF0A 4MKIA 1BYUA 1YZUA 1OXVA 3ZYCA 3QJYA 3C41J 3LX8A 2IF0A 4HSEA 2VHQA 1DOAA 3RS7A 3QKRB 3V4RA 3A58B 4KVAA 3UMSA 3EC2A 1NKTA 1GVNB 4RCZA 4Q1BA 5AJZA 4CF7A 1QHHB 1E98A 2CLSA 2D7CA 1NJFA 2QE7A 2ZSDA 4KYIB 2OBMA 4B6EA 5C2JB 2I1VB 1A1VA 2P6RA 1Z06A 2QTFA 1ZD1A 2REOA 4ASUD 4RZ3A 5FOTA 4ZKDA 3FKQA 4QHSA 2NOAA 3N2IA 1RW4A 4TYNA 1HY3A 1CULC 5ELXA 4FCWA 2Z83A 3CUEF 1T4GA 3THWB 1B23P 4KFSA 3R9IA 3RWOA 4B34A 4AYTA 4B75A 3KFVA 1IAQA 3ADKA 1HQYE 2EWVA 3IHLA 2IC5A 4HB3A 1R5NA 2OCBA 2WICA 4OYHA 1TQ4A 3LBHA 1LTQA 5KSPA 2FZ4A 3R8FA 2PLFA 4P0TA 4TZ0A 5UKDA 3SI7A 4PO9A 4IXNA 2IYLD 3CR7A 4DCUA 2OESA 2RGXA 2PH1A 4BFSA 1EG7A 1F5NA 4E5UA 2LWIA 4QKQA 2RKOA 1NNEA 1Z0DA 4FINA 2ZRNA 3KQKA 4L9WA 1T3HA 1CU1A 1W46A 3B78A 4P32A 1NY5A 4RZ2A 5AJYA 4OKSA 2ZREA 4PPGA 3CH5A 2YC4C 2VSOA 4ZDIA 1XBTA 4QBGB 3EPHA 2B8TA 1M6NA 1ZC3A 2ZR0A 1E9EA 3NBYC 2MSCB 1U94A 5HZKA 2PL3A 5J5CA 3THXB 1Z5ZA 2JLZA 1W1WA 3AV0B 4HATA 1N6IA 3NWJA 4RD1A 4PC2A 4DLYA 1KJZA 4XVUA 5TMPA 3KJHA 1U99A 2VH5R 4Q9LA 5EE9A 1P62B 3HU2A 3A37A 3GFOA 3VR3A 3VR5A 1JJVA 1DG1G 2N46A 1ETUA 2ZE8A 4IDHA 4MYHA 4BPBA 3LVQE 1UBCA 2G1KA 1G8GA 4YMUA 2H16A 2PZEA 3U3RA 1WXQA 2V4ZA 4QNRA 5L8VA 5TDHA 3RS0A 1E79D 5F9FA 5FTLA 4YXWD 4CZ2A 4QG7A 4LJ6A 3I61A 3WRYC 2WWWA 4RD0A 3SJBA 1O87A 2IEZA 5DI9A 3AVTA 2BCJQ 1YR9A 2ZJ8A 1MRSA 4TN1A 4WOPA 3VHLB 1Z2CA 1TAGA 4B33A 2VHUA 4QFMA 3EZ7A 1AQYA 2NO7A 1U0LA 1H8EA 3R7WB 2WIBA 4CT4B 2GTPA 2ZRBA 3CWQA 5E7MA 4TMTA 4B44A 2F55A 2A5YB 4OQNA 3JZAA 3FMPB 4A8JA 4LSGA 2FSHA 2WSMA 3VR1A 2CHVA 1GL9B 3BIFA 1JI0A 1W0JD 4QBHA 4ARZA 2HYIC 1G18A 1UBEA 2RB4A 4LGMA 1U81A 4EIWA 5LB4A 4QGHA 1A2BA 1GILA 3U3MA 2OG2A 2ZTSA 3QQ5A 3WXMA 3FHTA 2PT7A 1T91A 2ZU0C 2P65A 3R8CA 1S4QA 4M53A 1UEJA 4LOAA 4BZQA 4DT1A 4Q1CA 3I62A 3DKPA 5TARA 1NIPA 2V7QA 3A1WA 1A4RA 3EAQA 3GJXC 4OHXA 2HYDA 2QAJA 2XOKA 3QF4B 5GVSA 4NDZA 2HJVA 1QHNA 2CE7A 4OJQA 2GK6A 4EFMA 1EFTA 1W4CA 3K9NA 2XZPA 2C98A 2VP4A 3RS4A 4QBIA 4DLRA 3H2YA 2ZS7A 4BFUA 2FEOA 2FU5C 2GAOA 2OM2A 3ASYA 3LD9A 1N0VC 2ZS8A 3ZS9A 1T8UA 1Z6XA 1OJLA 3JZMA 2Q6TA 3BE4A 4JIMA 3NC0C 5SZKB 3OEEA 2WOOA 1CTQA 3LV8A 5JRZA 1TPZA 3FHCB 2D4HA 5H68A 1R4AA 4TMVA 3GLGB 2Y8EA 1U8AA 3BFKA 5EUMA 4BZPA 2GKSA 1KI9A 3HDTA 1G7SA 5AJXA 2GF9A 4Q02A 4TZ6A 3MAAC 5KYKA 1Z63A 4LJ8A 4AYWA 4X8OA 1MABA 2WWHA 3QKSA 2ZRCA 1ODFA 4JSYA 1WMSA 3S1AA 2KBFA 2JA1A 4BQSA 1N5KA 1HV8A 2ODEA 1XZQA 1NLFA 2O8BA 3GCGA 1ZRHA 2H18A 4B32A 2WWXA 3A1TA 2NPFA 3EZFA 1CRQA 2H8KA 1E1QD 2BMDA 2ZJ5A 3SJAA 4G5QA 3EZ6A 1G8HA 3RRNA 2VSFA 4TWZA 1OIWA 4PHGA 1H8HA 3TH5A 2WVJA 4DIEA 1KJWA 5F9HA 1AIPA 1IN8A 3EWAA 4C4PA 3FPAA 1QHIA 2RHMA 3FDIA 2BHRA 1K5GA 4DZZA 5FPHA 2JAQA 4FWIB 2VQSA 5B30A 1KMQA 2QPTA 3P4YA 4QJ3A 3C16C 4B71A 2XXAA 4NTZA 2FSIA 2P6UA 3OIWA 5EUQB 1RIFA 4QGFA 4U5XA 2KI5A 2XJ9A 4PSKA 4Z8YA 1T3SA 3WP1B 4GT1A 4D0GA 4LYAA 4TYYA 3LFUA 3FE2A 3JVVA 3OE7D 3CZQA 1GM5A 3AM1A 3R20A 5DI3B 2IYYA 1NLYA 3GLGA 5M04A 1Z07A 2DPXA 3C14C 4B73A 2EFDB 2O0HA 621PA 5C18A 4LCBA 3KB1A 3UKDA 1R8QA 3IIJA 5GADl 3GLIE 2DWQA 3PFIA 5JFGA 2G88A 3Q5DA 5CM9C 3ZD6A 3EA5A 5JLJA 3IIMA 3IQWA 4ITRC 2XSZD 1W4BA 5TB5A 1U90A 1DAFA 1G8PA 1XTRA 3QPWA 5F98A 1WCV1 2QP4A 3KX2A 3QKTA 1AGPA 3UWKA 2IHBA 2QP3A 3CR8A 4PPFA 1CJKC 1XXHA 1RRFA 3GD7A 2ZQ5A 1IN7A 4B47A 4EJSC 4M21A 1QZXA 2ZETA 4NCHA 2ZITA 3F3YA 3QUSA 1QVRA 1UPTA 1BS1A 4ZI2A 1A7JA 2JATA 2CMKA 3PXGA 1ZC4A 1G17A 1ZIOA 2J0SA 4G5OA 1ZVQA 5G41A 4DDVA 1S9DA 1KHTA 1LV7A 3I1FA 4BFXA 1N6LA 2BBSA 4A0RA 2ZRHA 4B2IA 2B92A 2ZJOA 5CB8A 5GJVC 2J7PD 1YJ5A 2IEYA 1Y3AA 4HB2A 4I99A 3DPUA 4BEBA 4IJMA 4TT3D 2QORA 3W6OA 5JCPA 1EX6A 5JJLA 4FW9A 1G16A 2CVHA 4C0SA 2R62A 1E2KA 4EQ6A 1W36D 2QM7A 1DAGA 2HCJB 4JYBA 2QROA 4R98A 3ADBA 3SBEA 4DCSA 2IHYA 3L82B 4JL6A 4V0NA 1G5RA 4A0HA 3NXSA 2NPIA 4D4MA 2EFGA 3V9PA 3G0HA 2VPPA 1E4VA 1G41A 3NEJA 5KDLA 4A2WA 1N5JA 3D8BA 1N0WA 1F2TA 2VEDA 4LK2A 1UFQA 2O8FA 1GITA 1IJEA 5AJVB 4J0QA 1LS6A 3RLFA 1W36B 4Q1FA 4DUGD 1G291 2FH5B 4HAZA 4JLNA 3IGFA 1XJQA 4P33A 3KQUA 1OH5A 3UWOA 4MITA 4YONB 1GIAA 5KDDA 3O8CA 1T0JB 1KK2A 1JXOA 5EE3A 2CEAA 3MCAA 4C0QC 4JLKA 5FTMA 5FBVB 3X1DA 1NBME 1FP6A 3NTUA 2VRWA 2G3YA 2WAXA 3RRZA 2JLYA 2GWHA 3BH6A 1ZW6A 1E9BA 1G3IA 1R7RA 2ZE7A 4GZLA 2XB2A 1E2PA 5JCZA 4TQ9A 3LNCA 4JYCA 1P73A 4HDOB 3SEAA 3OFNA 1E0KA 2IUUA 4DCTA 2A5DA 4CEHB 1FMJA 2UZ3A 4MYTA 4DHEA 4I1SA 4PXAA 1UDWA 5B2ZA 1Q3TA 1U0JA 1QRAA 3CPJB 1HURA 3QBVA 3LAWA 3VAAA 2AD1A 2NG1A 4BLOA 4C2UA 3A1UA 2XNDD 1GNRA 2CL7X 1DAEA 5FPKA 2J5XA 2QT1A 1R0ZA 3B6EA 4A0FA 4B3DA 2C9YA 5JHHB 1GDDA 1GAJA 2HJGA 1XPOA 1BMFA 2CCJA 5J4VA 2AFIE 4CW7A 3L2OB 2GCOB 3RRMA 1BYIA 4B43A 3WHKA 1XCMA 3AF0A 3BXZA 3OIYA 2NQ2C 2XITA 1EFRD 2VP5A 1TUEA 1ZMXA 4K8OA 3GJ6A 8OHMA 2XB4A 1G19A 3BAFA 1OV4A 2IYZA 4DDTA 1E9DA 1WQ1R 2ONKA 1TTTA 2I3BA 2IUTA 3P32A 1E2NA 3ZJYA 4NCKA 3WMGA 3B1VA 4DCNA 2E1RA 1T0HB 3NVAA 3RS2A 4URYR 2IL1A 4EJSA 1NG1A 2Q3MA 2QTVB 4AURA 5BN3A 3KKQA 3U3KA 4G5RA 3K1JA 4BZXA 5EXTA 1RFLA 4JT2A 1R0WA 3LDAA 4IFEA 3REFA 4IW3B 3UIEA 4UNQA 3ZH9B 3QEOA 4KLNA 3W6PA 1X8KA 3M1IA 1ZM7A 4PO1A 3QXSA 4PPQA 3VNVA 4XJXA 3OEHD 4ZCLA 4B35A 5KSOA 5JS8A 1N25A 3AQ4A 3IBGA 4F38A 1TU4A 2GJ9A 2EYQA 3IEVA 1XTQA 3K9GA 1MR3F 3VMFA 2F9LA 2H92A 2QAGB 4V0LA 4JS0A 5E7IA 2W2TA 3F5FA 1KZGB 2P0EA 1GRNA 4IDNA 4LHXA 5EXXA 1ELOA 2OILA 2Z5FA 2ZRDA 4LDJA 3A4NA 1WRBA 2ODBA 4A82A 4RZXA 1ZUIA 4NYJR 4QL3A 1ZD8A 3WYFA 4RCYA 3CB4A 2VIIA 4F4CA 5KSZA 1KK0A 2IYUA 1P2VA 4M1MA 2E87A 1SVWA 4AIIA 1EWRA 2G6BA 3U3OA 2F3TA 1II0A 1SQ5A 1MO6A 1SVKA 1WF3A 2EW1A 5JZVA 3N5CA 3MGCA 2JJ1A 4RVCA 4F91B 4BUJA 1E94E 1ZM2A 1XPUA 4PANA 4HDCA 2B6HA 2ZUDA 4HLUC 4TMWA 5IK2D 3R9XA 2QMUA 1PVOA 3CF6R 1G64A 2KSQA 4JL8A 4GOKA 3U7FB 5GJBA 1IN6A 1KSJA 5AWFC 2J45A 1CJUC 3C5CA 4MH0R 1SVMA 4LRWA 1W2HA 2D2FA 4FCVA 1IXZA 4Q4HB 4ZPXA 3K0AB 5TV2A 2QGNA 1KTVA 1LNZA 5FUWA 2IYVA 2RGNC 3U6BA 2GHIA 2PEZA 4IKEA 4Q66C 4PC7A 5BQ5A 3RDPA 5DN6A 4M8NE 2XAUA 1FP7A 1YR6A 4IOJA 1P9WA 3A1VA 3GJ7A 3AUXA 5FR2A 1ZUNB 1PLLA 5HCNA 1NMYA 3DZDA 2GILA 4V0OA 5FR1A 4EPVA 4Q4JB 1FTNA 2GRJA 2FA9A 3CRQA 5HE9A 3AKCA 3RC3A 1JB1A 1KI4A 1KNXA 3QI2A 4C0BA 1HYQA 4M1TA 1NIJA 3UXMA 4CRWB 2RGAA 4EFNA 4WW0A 1QF9A 1S3GA 3AP2A 4UNRA 3QEJA 4GPTA 5JS7A 3PG5A 3X1XA 5CITA 4OQXA 5J47A 4NYMQ 1J99A 4XSHA 1W0KD 1QHHA 1Z47A 3X1WA 2AWOA 4A4DA 3MRSA 4XWAA 1KI6B 1XF9A 2AXPA 3DVLA 5AUOB 5L3SA 4ESHA 2JJ2D 4Q9IA 3B1ZA 4WIAA 3D3QA 1RRCA 2Z43A 4D0LB 1D2MA 1CR2A 3AVXA 2IX3A 4P3YA 1U0HC 3RVBA 3K0SA 3KTAA 2QSYA 3L0OA 1ZD9A 4IVRA 4MYUA 4C0AC 2FJUA 4FMCB 3NEYA 4OL0A 4HUQB 1FX0A 3QG5A 4LBWA 4DVGA 1DADA 1F60A 1F48A 4YLGA 2HXYA 4LYFA 5FUVA 2AX4A 1R5BA 2JASA 1W2GA 2O8EA 5F2EA 2MMGA 4NE2A 2BCGY 4Q18A 2ATXA 5EXPA 1LY1A 4LV8B 4DRZA 4MRNA 3E1SA 4L16A 2V6IA 3ZIAD 2GJ8A 1XMIA 3U3JA 1P6XA 1CR1A 2YOFA 1OYWA 3K0FA 4KCGA 3PEVA 4KV9A 4B48A
chains in the Genus database with same CATH superfamily
4JLDA 1YJCA 1W9HA 2PR7A 3GJ3A 8LDHA 3TO5A 3DOUA 4JI5B 4OYLA 1LDYA 1KO1A 2YHBA 1ZRMA 3CISA 4QVKA 3THYB 5DPMA 4F4JA 1BO6A 2XE7A 3CE9A 3DMRA 3U0CA 4R5HA 3WA6A 3GGOA 4N6CA 2JIBA 4S0XA 1T3GA 3DAFA 1MO4A 1CC1S 2QQGA 2IU0A 3F74A 3SC4A 4YDRA 5DTEA 1L5KA 3FSRA 2GAFA 3JWGA 2ECFA 2ZRFA 2D2VA 2GAAA 1WPQA 4LHWA 2CVQA 5CFPA 1HQCA 5JWOA 4C0KA 5JZOA 5DGDA 1WZ2A 4BO5A 1E9SA 1UZMA 1DV2A 4E1VA 2X42A 1Y7LA 4ZHSA 3C8GD 3R4CA 5AXAA 4KC9A 5IH7A 1RIIA 2RHJA 3W7AA 4MWSA 3BSWA 1XK7A 2UU9B 3DMGA 1BXGA 5AVSA 1SCNE 3P96A 1Q0QA 3E0QA 4ZT6A 2Z58A 2P9TA 3VGJA 5ADUS 3AZOA 4PJJA 2Y93A 5G3ZA 3U6KA 4TKVB 1IOWA 1NFQA 1HUQA 5IYZF 5JEEA 3DE6X 3HS3A 3OICA 2J3MA 3CEXA 3RFYA 4CL3A 1SCBA 1GZSA 2W71A 3MWGA 3TX2A 1L5HB 2FPRA 3T0GA 3EQ8A 5BYKA 4CM4A 1EGHA 4FYWA 3PHF2 5KNCH 3CONA 3PPXA 5E6UB 3D4PA 2HEIA 1A4XA 2AOUA 3F2VA 1USIA 3MW8A 5E9WA 2OCAA 3O1HB 2O0MA 3TFOA 1PUJA 2QMHA 1REQA 2QW8A 4R6WA 4U2DA 4BECA 3D5TA 1P2SA 2Z04A 4NECA 2O5CA 1DX6A 2ZXPA 3AF4A 1XVTA 4X93A 2PU7A 5LBTA 2OXFA 3FWPA 3NLLA 2B1RA 5TY0A 1JT9A 5F73A 4JJFA 1XQXA 4MWZA 1AKUA 3IUMA 3O4HA 4HPWA 1VZ3A 2R2AA 4G26A 3MD9A 1FVOA 4GL2A 2H85A 4DWVA 4F3TA 4NYIQ 3OT1B 4WCFC 1ZO8A 2B2NA 5LP6B 1TL7C 5CJJA 5IUJC 3IV9A 2YBDA 3ZYZA 4MW8A 5HX7A 5BMVF 1C5KA 4YV0A 3BL5A 3OZBA 1T6IA 4DR6B 4NZMA 4S24A 4ZCTA 2Z09A 1E8NA 5EJ5A 1VIYA 4G1MB 3DMDA 3KQOA 3KLPX 5FYDA 5DYYA 3G6KA 2Y1OA 4TL9A 3WK6A 1P2DA 1KSGA 2RKWA 2OLEA 1J9EA 5D2CA 3GLHB 4BOYA 2OOKA 2HV8A 4BN0A 2PNOA 2QENA 4L51A 2WFAA 1O2DA 3F7TA 4RLQA 3BOSA 2GFQA 3EIOA 1HRDA 2P5SA 4GPEA 3K05A 1ARZA 2RHTA 3KVNA 4Z0PA 1JIVA 1SG9A 3O8OA 1F9AA 2ONZA 4PCUA 3AVUA 1KS9A 1GQAA 2CHFA 1OXTA 2HT6A 3MQ4A 3RSZA 3VR6A 1IBCA 3VBCA 1R2QA 4IIVA 4UM9D 4I2VA 1MIOA 1Z37A 4ZI7F 3UV3A 5AOBA 3EUEA 2FXIA 5D5PA 3OE1A 1P17A 1RXEA 3GCXA 1OFIA 1RBMA 2FSUA 3RQEA 3ILYA 4ZT3A 4EKYA 1RZRA 2EERA 2HBRA 4X3PA 2AF4C 5GTDA 1XR3A 1YRLA 3AW9A 3SXKA 1EQ2A 1C4OA 4QXQA 1HOTA 4Z4HA 4UAUA 4FKBA 2O23A 1FPMA 2DX7A 3BGVA 1IHOA 1M1UA 1HTWA 1POXA 3Q7GA 2XLCA 1FP2A 2YR0A 4UPDA 2WT9A 4B7AA 2F1IA 1O9GA 1BZ4A 1V48A 3CRW1 2EKBA 2XYVA 3VTKA 3O0DA 3CKYA 2HIAA 3Q12A 1L8LA 1Y3CE 3ZI4A 2TMDA 4G0WA 1K7YA 2QMEA 2DUWA 3W8EA 4AS1A 3TW0A 3HJNA 2YY7A 3DEKA 1JAYA 2CCKA 2PCLA 2OXRA 2YJ6A 4ANFA 3OKPA 3ABOB 2GPNA 1KTMA 1GEGA 1P0MA 3ZWDA 2QN8A 4FAPB 2O2EA 3W3AD 2YYSA 5B4VA 4NBKA 3HDJA 3DDOA 2A7QA 3KJIA 1WULS 4KFUA 3HEBA 3PYXA 5JLIA 3Q72A 1UJMA 1UM9B 4IRUB 5DVZA 2I67A 3SF8A 5LYJA 4IFBA 2HHAA 1MV8A 1F14A 1I7QB 5LZ9A 2DM6A 1KZ1A 5F1PA 5IXSA 3W5JA 4DNPA 3EZ2A 5FBWB 2EILC 4H7DA 2G9NA 4EVSA 1QIKA 3QSYA 2FSVA 1QIHA 5L0IA 1I5RA 1OHHD 3QVMA 2YZKA 4NBSA 3OCJA 1E9RA 2DUMA 3X43A 5EJ4A 2VHVA 4YV2A 1B4DA 2XUHA 3LOUA 2O19A 4MW4A 1SXQA 1SCQA 1R50A 2V7GA 1FX1A 5IUNC 1BDMA 5HS6A 2R3SA 5EMNA 1BE0A 3D4BA 3R9XB 4UATA 2AMYA 2CLFB 2O48X 3SVZA 1E0JA 1E66A 2WJ3A 2WHQA 1AS0A 3BIJA 4PE5B 2EPOA 1SAYA 3LS1A 3B5EA 1I0IA 4C43A 4OAPA 1PZMA 1WSWA 3KFXA 2FF7A 3OETA 4O8CA 3MCUA 3BWXA 3PHJA 4O2BA 5BQHA 4QQ8A 1XZJA 1D3AA 4IG9A 5K0CA 4MKRA 2DH6A 5FD8A 4FZJA 1PBTA 2OXTA 1IXYA 5C1OA 1XZEA 3ER6A 3OJOA 1JWBB 1MEOA 1KDOA 2H2FA 4HQ0A 2XY4A 1UBKS 1D0XA 4LFAB 3QMWA 3RAPR 3HVUA 1YUNA 2Y9MB 4ITVA 3D8NA 3DP9A 4CWAA 1FVHA 3K0FB 4BWGA 3FCEA 1J0CA 4ZMRA 2HLDD 3FHOA 3MWDB 4ZN6A 4EA7A 1M6WA 1KDRA 1GARA 2A9JA 3SN6A 3L7CA 3AB8A 3CNQS 2A3RA 3LGSA 4TSKA 3E58A 4HQKA 1O58A 1WUHS 5L4LA 1JHYA 1TWGA 2ETSA 2FAPB 3PQ3A 1HE8B 4RZUA 1TKRA 2BBTA 4MRAA 2XQGA 4KIWA 5KNLA 1FP4B 4I4LA 2HMQA 5AW7A 4FFSA 2MHRA 4ZVKA 2G7MC 2IH5A 4PZ0A 3OQPA 3NMJA 2CEKA 3NAZA 3N3BC 4N9QA 1N5IA 4AL4A 3CWZA 4EEKA 3WI7A 1Y8QA 4WZBA 4NICA 4XEFA 1BJTA 3H9GA 4D4KA 2YJTD 3MVEA 1A9TA 2OHIA 5C8YB 3NTXA 4DV7B 1IG3A 3NRBA 1QR6A 3I6ZA 1BRTA 1KZYC 3W5VA 5TSDA 2I3GA 1GTMA 4IHAA 3N7AA 2Z6VA 3HCCA 1JRLA 4DQDA 1IJKA 2JLSA 3B82A 3STVA 3FROA 4TMYA 2N3ZA 4YJFB 2NW6A 4YA6A 4EI7A 1J25A 3P20A 5I4CA 4DN6A 2CT8A 3ANLA 1DUIA 1NVEA 3WDLA 1WMBA 3HZOA 1IVNA 2A59A 4ZIRB 2G0NA 1OREA 5B1YA 2V7QD 1X19A 1YL7A 4XQ1A 4IUDS 1RKCA 3KLNA 2ZEJA 2GHRA 1FUUA 2QUZA 2WQZA 5A2QA 3QOYA 3NHWA 4DF3A 1V6SA 1PFQA 2IE0A 3SSNA 4KK4A 3DL2A 3DVRX 2IS6A 1VHTA 4MVXA 4F5DA 2BSAA 3JQ7B 2FMHA 1B6SA 4ICIA 1JAIA 2GOYA 3EAFA 1BHSA 2R87A 2HDOA 4QEDA 2OAEA 3TDKA 3JALA 1TT7A 1MB0A 2BDUA 4IJVA 3M70A 2PF4E 2VNKA 1YB6A 4H17A 3IBTA 1CZOA 1VJRA 3W3AH 5FI3A 2VHJA 4PAQA 4MLCA 1QPZA 3ROFA 3E7DA 3VZBA 2IOFA 4JBXA 4ACBA 2OECA 3FYCA 1QIEA 1OFVA 4FEAA 5H59A 3DOIA 4DQVA 1FVXA 3W9YA 3O9ZA 2C1EA 2FFQA 4XTRA 3Q9SA 2C95A 4WKGA 4G89A 4YAWA 4BZZA 2IF2A 1AUPA 5E3IA 5J2UF 2R86A 1INLA 1E3SA 1JFFA 4PZZA 3JSXA 1B8OA 4LY6A 5DW0A 4WA8A 2M9MA 3T7IA 3W8FA 1W0KA 5B7NA 3FNRA 1ZFNA 2IXMA 3FG9A 3GDFA 3NR2A 1N0UA 5AUQA 4WWHA 3W4JA 3A0UA 1HYBA 4IDOA 1NV8A 3KOOA 4LWPA 1L7XA 2ZQYA 5EQTA 3E9MA 4AKIA 1P0PA 1LB1B 2GJ4A 5J58A 1LQTA 1R8XA 4KXVA 2VDMB 4GQHA 4MUAA 1W5TA 1P2TA 2ZKLA 4E1AA 1GRCA 1R9MA 4H3HB 1NMEA 1LRLA 1GGHA 2H8AA 1O6GA 4N82A 3DBOB 1MB9A 3NANA 4B9AA 1KH1A 1KO7A 4ZT5A 5CK4A 1GZDA 2JEZA 3W79A 5AI0A 2DETA 2NVUA 3U9LA 4AU1A 1ABEA 5D3MA 3N3AC 4PQFA 4O2RA 2CMHA 1R1DA 5ARDA 2P2LA 5F9MA 4FSDA 1ZUD1 4EUHA 2E0IA 3RT7A 2F43A 2YMLA 4OCZA 3UK6A 3OF3A 4EJSB 5FWYB 2WG2A 1E0SA 5KWIA 5IAKA 3K70C 5JECA 1FRQA 2QZZA 4YROA 1UWCA 3DEJA 4WZAE 4MK4A 1QGED 3NONA 5JD4A 1NP6A 2GJSA 3STXA 2RI0A 3MERA 3HBNA 1PDVA 1O1YA 2ID4A 5AR1A 3U60B 3O4VA 1ICIA 4C5CA 2DFVA 5DV9A 1IQ0A 4B40A 3TE7A 1CETA 2O2YA 4AE4B 1GFSA 5C4MA 1FSPA 3G9ZA 2QN3A 4ID3A 3FOFC 3CJQA 3SZOA 2FN7A 3BMCA 1U1GA 3ZGXA 2Q4OA 3CX8A 2DY0A 4DR5B 2XS1A 4Q7EA 5FADA 1A9YA 1EXWA 4PACA 1DAPA 4RTPA 3ZN2A 9MHTA 1NJ8A 2CNNA 2ZSDA 4G6ZA 3AW8A 1P4HA 1ILWA 4LK3A 5TF0A 4Z53A 4RDXA 4CDAA 1QV9A 4XWGA 1A27A 4B7XA 3THWB 3R0IA 3W9SA 3OWXA 4DTCA 5BV1A 2VBGA 4XUEA 1ZVJA 3ZXSA 2RGXA 4D9JA 2PH1A 1F5NA 4DZRA 2RKOA 1SVNA 4L9WA 3HDGA 3TLAA 4ZDIA 2R7AA 2N75A 2I78A 3U1VA 1GQOA 1EHIA 3FCXA 2EGHA 5IC4A 1YFJA 4CCYB 1EHCA 5COQA 5CBPB 3NOXA 5DRTA 2P62A 5JLAA 2COUA 3KR2A 4XEKA 4BWVA 3DKKA 3VHLB 4B33A 4L50A 2WIBA 2PJDA 4CT4B 3R7LA 3KO8A 3HM9A 1VTMP 4B44A 4GYTA 5JO9A 5D01A 1RXSA 3CJTA 3FMPB 3NBUA 4ENQA 4CS9A 3BM5A 4YK7A 1JI0A 5DEIA 5H02A 4QGHA 3L1KA 5H3HA 4IFIA 5LZ7A 3V97A 1KGSA 3GLQA 3QYFA 5K3EA 2P2NA 1AEPA 3KPUA 1QIJA 4NDZA 3RIXA 3VUFA 1XQWA 3M83A 1YVEI 3EIUA 3GUVA 3LEOA 2ZAGA 3VZCA 1VL6A 2WUEA 3ICVA 3FHCB 1T1JA 4UD2A 3RV4A 1DQYA 4MB0A 1QYDA 3S55A 3QKSA 2Z9BA 5ER9A 4GQAA 1M2NA 4KGDA 1SEPA 3GCGA 1EUDB 1L8AA 2NPFA 3BYZA 2D3TA 2QX9A 4X84A 3DDUA 4H27A 5AW8A 2PE5A 3PC3A 2AFRA 1GCIA 4C4PA 2CVPA 3ZW7A 4CFYA 4N3BA 2ZIXB 2HJMA 3OD5A 4PSKA 4D0GA 3NEAA 3ZE1B 3AM1A 5M04A 1IAVA 1USKA 1KFCB 4N5DA 3I9NA 5JFGA 1B68A 4ECAA 4ITRC 4FB5A 1FXWA 1EJ6A 2PUWA 1U3VA 2QLJA 1BR4A 1M2OA 2ZQ5A 4LVNA 5EKSA 1RACA 3NVKI 4HHEA 3ESRA 1ZY2A 3JQBA 5GJVC 4I99A 1B15A 3AZPA 1MT3A 3W6OA 1DC8A 3EXHC 4KE7A 5HF8A 4YP5A 1TE2A 5THXA 3M6MD 2XMQA 4W6ZA 1IPHA 1I7SB 1AUQA 3GI1A 1KZHA 3E8SA 3D8BA 3WWYA 1NUSA 2CD9A 1LS6A 3RLFA 5JCOC 1G291 1DXOA 3JWEA 2DEUA 2PRJA 3O8CA 3A6DA 6AT1A 4HSGA 5KYGA 5E4YA 5BOSA 2I15A 1WU7A 5K0GA 1LLFA 3LESA 4CEHB 1VPVA 1HF3A 2GPSA 3A25A 2C5AA 2FJ0A 3QVJA 2AN3A 1BYIA 3G0OA 4ZO7A 3WHKA 1XCMA 1PVDA 2NQ2C 1GPAA 2VP5A 5IVDA 4AJEA 5LYJF 1X7XA 3D59A 2Z3WA 1AU9A 3WMGA 2Z98A 3B1VA 1M0EA 4IG4A 3NVAA 4AURA 4HGRA 2AVDA 3I9V1 5G1OA 7GPBA 2XUKA 3W8DA 3M1IA 2JCGA 1N25A 1PQPA 4O5AA 2LE0A 3QA9A 4W8OA 3F5FA 4IDAA 1KZGB 3OZSA 4L95C 1SCKA 3CH7A 4N5MA 4QBTA 2PX8A 5CGQB 3UKOA 2IYUA 1OQCA 1HORA 3U3OA 2QTRA 1QDLB 1SQ5A 2L69A 4P5PA 5BY2A 3CVVA 2VDUE 4AECA 2HR1A 5F5LA 3ZUGA 4C87A 4N5LA 2WTNA 4WNIA 4JL8A 4L2IA 1V74B 1X1DA 1GQ2A 4Q4HB 1RZRD 1Z4LA 1MGPA 5FUWA 2ZBRA 2ZJ0A 2PEZA 4Q66C 3AEQA 4CM8B 4FDTA 1YIOA 4IOJA 1KJIA 1FQWA 5MHTA 2IPAB 1NMYA 3TNDA 1KI4A 4WN9B 4BQRA 2RGAA 4WW0A 4O2BF 3M3HA 3UK7A 1QH9A 1V9CA 4A4DA 4XWAA 1XF9A 5DLDA 2Z43A 5KQLA 3AVXA 3NP7A 5FPPA 3X2QC 1JF8A 3H9BA 2FW6A 2DSNA 5FBZA 4YLGA 2C7OA 5A3JA 4NE2A 5C32A 5CA1A 3QWAA 2GJ8A 4XTKA 4R68A 4OKNA 1KJQA 2AUTA 4ARVA 3GFQA 3RFXA 5ALXA 4GP7A 1BX1A 4IVPA 1ULBA 3QNWA 1CZHA 4BPMA 1RWOA 2Z57A 4KG7A 4GR4A 4KSBA 2DPLA 3DVQX 4O6VA 3U9JA 1D2AA 3V4SA 4CSAC 4CMJA 1XX6A 2DFNA 2V3WA 1ZSNA 3AG6A 4LJAA 4AG5A 2W45A 4HQNA 5M7EA 4LJ5A 2BBWA 4MUJA 3A1EA 3DCNA 3AIMA 1U4OA 2CNWD 4B8WA 2D3WA 3DA8A 4K87A 3J7AC 3KRTA 3U56A 4PR9A 4Y2UA 4K86A 1Y5RA 4E12A 3KKPA 3GV0A 1EFDN 4C0JA 3AG1C 3CNBA 1FUEA 5F51A 1QS0A 5LQNA 1G20A 1TEHA 1SQ0A 2ONJA 4BJ5C 2RG7A 1B93A 4W5JA 3HVKA 1ZYUA 4RSHA 3ZCSA 1YBFA 4XLTA 5BNTA 4I14A 3N87A 4QOFA 5EKTA 1I4OA 4OJYA 5JSLA 5LQDA 5DTMA 5E0OA 2BI8A 3EJ6A 3CPHA 3IUSA 3D5QA 4N03A 2PFGA 4EITA 3E35A 1G0NA 5E3JA 4YUAA 3C5HA 2XQFA 4B3SB 3IEPA 4W99A 3BE5A 1PGNA 2Z6QA 3HKCB 3EHMA 3KQWA 3OE4A 4URWR 1IL0A 1W35A 2PRZA 5CT4A 3PDIB 4HLQB 2P3OA 2BVNA 4A16A 3W9BA 4G81A 4DCCA 1JLSA 3TZLA 1A9QA 4Q9HA 2Z9CA 1L4HA 4MROA 3TVDA 3I3SR 3KJZA 5K20A 2VAVA 2FUG6 4BC0A 4TXMA 4B6FA 3OPVA 1QU2A 4IQGA 3D6MA 1F0NA 4MCHA 2E7ZA 1E6WA 3FUVA 2HCBA 4KQMA 1MZVA 1WEKA 1XVAA 3S2SA 4EKDA 4PXYA 1A9PA 1HGXA 2O06A 4O2AB 2WB7A 1C1DB 1EQAA 1QDUA 4TLAA 3G9TA 2R2GA 4Y3UA 3ND5A 4V24A 5DVWA 1Y5MA 3U4MA 2FE4A 3KT6A 2K5UA 1ZA1A 1SUEA 2UUPA 1LPOA 1Y1RA 2BJWA 3PQEA 4DM3A 3NHRA 3KD2A 1AQJA 3JWPA 4QC2A 2FFJA 4Z4QA 5IAAA 1Q0TA 2A88A 4EKGA 1AMOA 4OOFA 3RU3A 1KK1A 3A4YA 2NO6A 1W30A 3FZEA 3KEGA 4UTRA 1X7YB 1Z82A 2NZ2A 1BSVA 5C81A 4OD0A 2I5PO 2CDNA 3WLRA 4IS3A 3PX7A 3KVRA 2CLMB 1Z0JA 1KA9H 5TPWB 5JYBA 1X70A 3VR6H 2QI9C 1PKEA 3E7FA 2BLNA 2G5GX 2XWPA 3EFOB 2PQ6A 1U2RA 3NB0A 1HR0B 3REOA 3N07A 2WV7A 1SFRA 3NM5A 4ZYVA 2CL0X 2MWMA 3DEZA 3FFBA 4IEFB 4YIKA 3GN2A 3ZG1A 4LEIA 2JVKA 1D0ZA 3D81A 4GLJA 3SXPA 4A1FA 4K6KA 3Q3CA 4GWKA 4YFVA 4K2AA 1JE0A 3QPUA 2XLEA 1YOVB 3E3MA 1E7MA 1VLSA 2J8ZA 3DD1A 2BJHA 2Z08A 4IO0A 3U26A 4B4KA 4QARA 4D8WA 3VZPA 2HU2A 2A2ZA 1LRJA 1NI4A 2YOGA 2JBAA 3KVYA 4X45A 3NBFA 3CQ9A 4BMYA 1T6NA 2HKIA 5G4KB 3BQMB 4WZ6A 4Q4JA 4NJEA 4Q7CA 4PZ9A 3GAMA 4FX2A 2GH1A 2D5AA 4XPYA 2VNHA 4ML3A 4WACA 2YCLA 2FZEA 5AW1A 4LTDA 1JQDA 4KV7A 4RFSB 2P91A 1CUIA 2QQEA 1XALA 5CJ2A 3DZ8A 4DBVO 1TYAE 1NQVA 4XM0A 1A5ZA 5GM1A 3SS8A 1UDCA 4L78A 4M8SA 4NKRA 2J0QA 1MNDA 4EVQA 1VP3A 3QVTA 2YWBA 2HI0A 5ILQA 2BTEA 1KJ8A 3OX2A 4FCCA 1P6UA 2YIVX 2GERA 1I2MA 3FYSA 3LI2A 1VDMA 1VKJA 3AOGA 4DLKA 4P2BA 1P29A 4YO7A 4UFNA 3RTCA 2J5RA 4RLFA 3GOQA 1JEAA 4OIPF 2Y0PA 4XX1A 1CRPA 1BH2A 3ICCA 3HCBA 5IZCC 1L5GB 4L8FA 3PC2A 4XDYA 1TZCA 3K8YA 1WHSB 4IFTA 3IOCA 2C7VA 1PFWA 5LC1A 4ESVA 5FWXA 1RHJA 5L6MB 5A7GA 4POAA 3IMEA 3BD9A 1HEYA 4G67A 3BGWA 5HSGA 1X13A 5GJCA 2WG1A 4Y30A 3KSMA 3MS7A 3M2TA 2FX2A 1CK4A 4TTSA 4FYXA 4MX8A 1UJ6A 3NG1A 1B42A 2C2YA 4FMDF 4BLWA 1DWUA 3FR7A 3HYRA 2V1XA 1TMOA 4ZI3A 1YFKA 4MUIA 5M2QA 1Z2AA 4Q00A 2G71A 3BRQA 5MDHA 4K81B 5LP6C 3UMKA 4IJ5A 5H81A 3ZZ1A 2J3IA 3FDZA 3TIGA 4KOAA 4C9BA 2B7BA 1PJQA 1DARA 1NBOA 4F6LA 1D2HA 1LK5A 3C1TA 4M9QA 2OHFA 1XU9A 2D06A 3U7GA 2GESA 1WLYA 3PEUA 7YASA 1Z6ZA 4BTVA 2OXIA 1N2XA 1ICEA 1UXOA 1PSWA 1G59A 3QJGA 1EXNA 4Y2QA 2IY9A 4LC1A 4R9SA 2UUCB 1UMCA 3EFHA 4GOND 2PMKA 3ATPA 1HI9A 3L0CA 4IZOA 4O2LA 2GEDA 4AUMA 1N78A 1Q0UA 1Z8DA 5THKA 1I5OA 3KKMA 3AIKA 3IMFA 3SFVA 3V2IA 3V1LA 1X3SA 3F8SA 5KAMA 5IPFA 2XM4A 4IJKA 2FMIA 2X6RA 1T26A 5TR9A 2O8CB 1Y4UA 4RZIA 1KEPA 3LXUX 4MEAA 2GM5A 2P7HA 5M5BA 1ZG3A 2XCLA 4IPTA 2H57A 2I6FA 4OXNA 2DBQA 4NBLA 4X7MA 1LS4A 1E3WA 4XIIA 1V1MB 2CUZA 4MAFA 1U2TA 2LW7A 1DVRA 4D26A 2GCGA 2R25B 1J7KA 2P77A 2WHPA 3LHFA 3NT5A 3O82A 4US0R 1N2CE 3B89A 5FUQA 3UXHA 2YWEA 1FXWF 2ASVA 1NPYA 3WE7A 2ZRGA 3WNQA 2MIIA 3A6HA 3AERA 2GXAA 4N39A 2B4KA 5KSWB 2Q1XA 3DLIA 2Z30A 1Y33E 3PNQA 3RYHA 4E7SA 1EP3B 1LS1A 1F8XA 1K6JA 3NT2A 1B0ZA 4BLUA 1CUSA 1QFMA 2GK7A 4GRAA 5A5FA 1UOEA 4BQQA 2WJGA 5EMLA 4KBFA 1J42A 1TRHA 3QEBZ 3KL4A 3TI9A 4ZZ1A 1T25A 4RDHA 1TEVA 4N6GA 4Z5XA 5IJZA 1YZHA 1JTEA 4PPNA 2Z8YA 4OHWA 2QX6A 4HL6A 3FFAA 5LSAA 1RYHA 1AHIA 1LKZA 4JC7A 4ZYYA 1N4DA 5LQJA 1EFAA 3QVGA 5EXEA 3NX4A 3JZIA 4UUNA 1OGIA 3RK0A 3SZUA 4OUKX 4ENPA 2BMWA 3ODGA 1JDTA 4FR2A 2X5XA 4MQUA 1S3SA 2WSIA 4HEAJ 4HZUB 1X74A 5TMEA 3KP1A 5CW1A 3VVMA 1KHHA 1ND5A 3K8QA 1O0SA 1NW5A 3Q87B 1OJ7A 5F3WB 1K6MA 1H23A 4QO8A 1X1BA 4OHZA 4I8DA 1SEVA 5CX4A 4KSYA 4H1VA 4L4XA 3MAGA 2B4RO 4OM8A 1JHUA 5DLQC 5DH9A 1SMYF 3PNYA 1XTUA 4O5OA 4GW3A 1HW2A 4UVIA 3ZY3A 4MQ6A 3LKBA 3KHUA 3SE7A 2Z2YA 2YV4A 3I0MA 4IOKA 3S1AB 1X7WB 3L0IB 2WJYA 2C3PA 5LA6B 4A2PA 2QD5A 2DR0A 5TEVA 3H5LA 1IPFA 4FQ7A 1HYHA 2COKA 5CXSA 4G1VA 3MWKA 3ETNA 1Q11A 1QO9A 4TLEA 3WBKA 4X1KA 4I50A 1DKRA 4IIDA 1IE3A 2H1VA 5HHTA 1K7EB 1MOZA 2VF7A 3NHBA 4UHKA 1BNCA 3ELDA 1P7ZA 1GAQA 4P6IC 1FYDA 1HFWA 4V02A 1XZIA 1EK0A 2H5JA 2O1WA 2CXTA 5FT9A 2UUBB 4Z9BA 1O96A 3ITNA 1AUEA 1YMQA 1PR5A 3OAAD 3ANNA 3GGJA 2DF8A 2KJQA 1HDCA 3SC3A 2AKAB 3X2EA 3DLAA 5TT0A 1A88A 5EZSA 3JARB 3T4PA 4GDMA 4LHSA 3N8NA 2VNIA 2A5GA 2YHUA 2WSLA 5CA1F 3RTAA 4OHVA 1GCUA 3BS4A 3ND8A 3GLIA 1OT3A 3U5TA 2R7KA 3LU1A 3CLRD 1ZHTA 3GC6A 1FFDA 4M2LA 3BZBA 3W2EA 5D7NA 4XGQA 4E09A 5DHSA 3IRUA 1ZWLA 4MQ9F 2XZTA 4A2QA 3UB2A 2D0PB 2QNRA 2JJYA 2YOHA 4KOEC 1FTSA 4OBXA 4I3HA 5J4KA 3WLJA 5C7IO 2IIBA 1YI8A 3KFLA 5FRDA 2PZBA 3BWBA 521PA 3ZGYA 3CRMA 4C7OB 5DLPA 4TN5A 4FFMA 3AVWA 1MO5A 1CP2A 1PIWA 2QP9X 1N1GA 1HE9A 2IXNA 3LNMB 4J6EA 3PDJA 4YGYA 4EDFA 4YT2A 3B36A 4UOEA 2RGDA 1XKTA 1E2HA 1O6ZA 3ZZ0A 2PX3A 3RHFA 4JZYA 1DAMA 4RJLA 3HXKA 3RUCA 3O5AA 5DHQA 3M5WA 4Q4DA 4V03A 2P2GA 3QV1A 2PL5A 1SHTX 1X8XA 2CDCA 3IAM1 3QVKA 4UCWA 1QH1B 1ECFA 3DCIA 4MW7A 3KT8A 3DT6A 2O8DA 2WJJA 1D6NA 3T3DA 2PVCA 4MUBA 3CKLA 5U9CA 5HRAA 3G2OA 2G8LA 3QVSA 1L5FA 1P4GA 4ONEA 4RXTA 5H3CA 3MTQA 2FB9A 5TJ5E 2X0DA 3RYTC 2PSEA 1SQGA 3BQ9A 2P3QA 2AA3A 1IEQA 5JDCC 721PA 3LHKA 1E85A 3JRXA 4CL0A 3G7SA 3L7IA 4K9DA 4WHMA 1UJ2A 1CY0A 1NULA 2GZ2A 3K2QA 2AC7A 4Q0MA 4RQAA 3RVDA 3C3JA 2Q2QA 1GG8A 3TGWA 1HE2A 1F0YA 1F51E 4WK0B 4Y7DA 1Z06A 2Y0CA 5IC6A 3D54D 2XLWA 2POCA 3QFHA 2XRYA 1KARA 4UU0A 5AHXA 1SU6A 4L0CA 1E83A 4G5HA 4DJEC 4ZWNA 4RDAA 5DTQA 4BVKA 3V4LA 4AULA 1N8NA 4ULVA 2QAIA 4LISA 4OX9B 3LDUA 1UBRS 5K0BA 3RUIA 3VR3A 2N46A 5C8ZA 4TUYA 2QKYA 3D6JA 3LVQE 1CVRA 4MRMA 1WDWB 5L8VA 4YXWD 3L9XA 3K92A 1VSQA 3WOVA 4YMGA 4FOPA 1UDBA 3B2NA 3VPXA 1FMFA 3B3FA 4A8JA 3EGDB 1AMNA 3KAQA 1OW8A 1GL9B 4QBHA 2F8TA 1QX3A 2VHYA 4PWYA 2YNMD 3D0OA 4M53A 1RQGA 4JGBA 2FX5A 3PQ4A 2NZUG 3ABMC 4RHUA 4YBZA 3CH6A 4FEEA 3S0XA 2GAOA 2FU5C 3IMGA 2OM2A 2PMEA 4QATA 2ZS8A 3WBBA 3ZW8A 3WGKA 4OQPA 1GD1O 1EGQA 1M2GA 2GF9A 3EPPA 4MS2A 1OX5A 4W5NA 3SLKA 3E3NA 3H1EA 3M3PA 4BNHA 3A1TA 2H8KA 4BJHB 5HXAA 4BYMA 3OFJA 2FWBA 3E05A 4DBLE 4IILA 3PQ2A 4PHGA 3TH5A 2G9UA 3T7CA 1K5GA 5EPEA 1PFYA 5JADA 1E5TA 3WP1B 1EFPB 2GNPA 1XVIA 3FPEA 4KRYA 3R20A 2HSWA 2JL1A 3EHDA 1F4LA 4IJUA 1Z07A 3OUZA 3FRJA 3N8HA 4YLYA 5GADl 5JJ5A 4JJ6A 1L9KA 2VZ8A 3MILA 2RSLA 3OJ0A 3UWKA 2IHBA 4EJSC 1WCIA 4QUJA 4M21A 3J7TA 3PYLA 4GR9A 4YAIA 1QVRA 3G50A 2ZUFA 2OXEA 3PXGA 1EI9A 4UHEA 4ARSA 3FPBA 1DNPA 4KPEC 4K40A 4B2IA 5CDYA 2Y9PB 3TTWA 1Y6RA 1E2KA 5BQXA 2B3TA 2VHZA 2DUJA 4LK2A 1NJ5A 2W7TA 4TRJA 3BCHA 5DM60 1SXGA 2JIQA 1GQQA 4EYQA 3NCTA 1XJQA 5HRUA 4OV6B 5EESA 5KDDA 4GI5A 3WSVA 4TS1A 4X62B 1M2VA 1GHTA 3RG8A 1E9BA 4LWOA 3TMYA 2G07A 4JYCA 1KMIY 1ZITA 2OA0A 5CA0B 4MYTA 1LM3B 4DMFA 4ROSA 4UREA 4JBIA 4RX1A 3A1UA 2QIOA 3I23A 5KTRA 4DQKA 1P91A 2NSDA 5EQDA 1WQ1R 1HG1A 2Q1YA 1Z8HA 3DT8A 2YXPX 2OZKA 4WY8A 1SG0A 3QLVA 1IBMB 4W5QA 3GO4A 1KEZA 2BGTA 3DBLB 2EX4A 2G80A 1CW2B 1JG4A 4OU4A 5ADVA 3WO1A 2M2IA 3C62A 2EYQA 4A1OA 4OH7A 5L6LB 2OQIA 3EDRA 1Y42X 2NLOA 2ZR8A 3IUBA 1Q0HA 4P8RA 4H1WA 2GEBA 3JCUQ 1M56C 5GONA 4RIFA 3KOWA 2RB5A 3KMIA 3N75A 4QL3A 3AG5A 3MTBA 1RLUA 3HSSA 1YRHA 4IMPA 4YJ3B 4Q7QA 2C4WA 2NP6A 2FVYA 4BE9A 3LT0A 2EW1A 2WD9A 4KGXA 4ZALA 3CPSA 3PFHA 3B38A 5ALGA 2P1AA 1G64A 4GOKA 1J5EB 2XB9A 5AYVA 1CJUC 3GYGA 4NTFA 4JKVA 4F56A 4WUTA 1ZOLA 2Y2UA 1WNFA 3ZTYA 1X1QA 1Z0ZA 3RDPA 3USCS 1YR6A 3A1VA 3K1YA 1TYZA 2FPGB 3LWZA 4YJWA 2CF5A 4PLFA 3QI2A 1FNCA 3CRNA 3FOWA 5CFLA 1MG0A 4IDFA 4DWWA 4NCQA 1DCTA 2B35A 2CNOA 4P3YA 4IIEA 1JG7A 2QSYA 2B1JA 3TBFA 4AF8A 4IGGA 2H1WA 5FUVA 1NT2A 3OU2A 5HM8A 5EXPA 4QX6A 1WVMA 2QM0A 1P6XA 2V6FA 1QRRA 3AYZB 3A9UA 3GM1A 2IQ5A 4BNGA 2FUCA 3RJ9A 4O6NA 4NJOA 3M7IA 3PC8C 3U0BA 3CT6A 1VECA 2ZWVA 1KJNA 5AHWA 4MKZA 2F59A 4J7UA 3RADC 5DGHA 1IEVA 1M5RA 1B3BA 1T36A 1L4MA 1J49A 1MX5A 1CGOA 4NS1A 4TYWA 2G3KA 4G0YA 2AN9A 4L4ZA 5JZ9A 5I9IA 2QWXA 1MMFB 1UM8A 5T7BA 2ZYDA 3NOVA 2H5EA 4CGYA 1LW7A 3EWNA 1X15A 3O4GA 1S96A 2Y4OA 5B1DA 4TXJA 2JZOA 1Z23A 2CCYA 2VYVA 1C29B 1UK7A 3R5KA 5HUJA 4I8IA 3IDSA 3U4QA 2R7WA 3TSYA 5EGNA 4K6HA 4JV5B 2R7QA 2R7XA 3UHJA 2QLMA 1O4WA 2PZMA 5CAEB 1KKLA 3WMXA 5K45A 4HEA6 1WDLA 5DGCA 4NLLA 4EBFA 1G5PA 3MGGA 3B71A 1ZU4A 4LZWA 2ZB2A 1TW2A 2R44A 3NYQA 1SZPA 1A72A 4Y8VA 1PG0A 4PQGA 1P2UA 1CLEA 4UE3S 2JZNA 3V4ZA 5JH7B 5IARA 5CEJA 1CYEA 5FH9A 3UWPA 3TZKA 4JNKA 5CI8A 3I4LA 4GS5A 2LKDA 1FXUA 3H3JA 4PQYA 5DULA 4IIHA 1ZH0A 4CMEA 2PFKA 1XMJA 1IQUA 1Q95A 4ISCA 1YTUA 1HH4A 3GQVA 4ZCPA 2WD8A 2ZYIA 4XRGA 2YFYA 3OI7A 1E2FA 3RFTA 2H31A 5KREA 4CMCA 1F2UB 2I7XA 3PCRB 2JGFA 1Z29A 4QYMA 4BQIA 3N6VA 2WWFA 5I7HA 4JC8A 2YCBA 4G5GA 3GCWA 4L28A 3WL5A 2FGJA 4EO7A 1T5BA 2CGEA 2QZSA 4YMHA 3KEQA 2AOXA 2ORYA 3WNBA 3UZUA 1ZD3A 4Z9YA 1P7YA 2Q07A 4MVJA 1L7QA 3K31A 2XBMA 2HNKA 4PN7A 1PTJA 2B0JA 5E7QA 4MHOA 3DE7X 5E38A 3WL7A 1J56A 4LE0A 4LZAA 3QGMA 3JR3A 1O95C 4CEJA 5FTJA 4FZRA 1U7HA 3K6SA 2FSSA 2OV4A 2A9VA 5CM2Z 1RZ3A 4EK9A 3EVEA 2ZI4A 1Y5NA 2HCTA 5DNEA 4B09A 3M6AA 4XUDA 2HO4A 3ZTWA 1KQPA 3LK7A 3SNHA 2AF3C 5CDGA 3OA0A 3QPDA 1WHTA 4JI1B 2ZYWX 4I50F 4BLSA 1FFXA 1W8DA 3ON5A 4FBGA 4JT4A 4LHVA 4GPZA 4I1YA 4O4JA 2PV7A 4ND3A 4Z1MA 4BBAA 5FLEX 3UV6A 4YYEA 1QP0A 3G8DA 1YHYA 1AQLA 1QTNA 1VGQA 2ORIA 3QVUA 3SMQA 3WYCA 3H13A 1T6BY 3ST7A 2EPLX 4DLZA 4ZCMA 1XTKA 4GC5A 1AK2A 5I3CA 3LW7A 2NPUA 4ZK2A 1SBQA 4KXMA 3MF4A 1VJ0A 4FMCF 2BF4A 3DFUA 1L5YA 2LCIA 3KHKA 4BVBA 5AVKA 2CJWB 1PT6A 2L6FA 3H05A 4HRAA 2GDJA 3JYQA 3M33A 3HK2A 3BN3A 3QNMA 4HB4A 3UJPA 3M1YA 5JUAA 5J4HA 4P86A 3G2LA 5KX5B