3S84A

Dimeric apoa-iv
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
239
structure length
239
Chain Sequence
DSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Dimeric Apolipoprotein A-IV and Its Mechanism of Self-Association.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Apolipoprotein A-IV
total genus 101
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 3s84A02
3R2PA 1OR2A 1LS4A 1EA8A 1H7IA 1LPEA 1EQ1A 1LE4A 1GS9A 1AEPA 1OR3A 1NFNA 1B68A 1LE2A 1NFOA 1YA9A 2KC3A 3S84A 1BZ4A
chains in the Genus database with same CATH superfamily
5CI9A 1SZIA 4N6HA 1IW7F 2DI3A 4OD5A 3T9OA 5T1DB 4GEHA 2X0CA 4XPXA 3DE8A 1HY5A 1FR0A 3POVA 4Q7CA 3KH2A 4U9DA 3Q6MA 4HE8D 3AQBA 2M64A 3M1CB 2IM8A 4UDVA 1M56C 3KYJA 3W8IA 5A6JA 1T5OA 2UUHA 2NSGA 1LIHA 3DM5A 3HNJA 2YEVA 2WL8A 3RW0A 4PFPA 5A6KA 3K7DA 2WZLA 1U6HA 1VYKA 1ZHYA 2R7XA 4JURI 2YLDA 3JYYA 4F4BA 3AOUA 3EH2A 3LJBA 2OJED 4MW8A 3GEIA 3SP1A 2YWAA 3V5ZA 3EG9A 2R7UA 3F46A 3FHDA 4IWBA 2R03A 4YK5A 2E87A 1ZHXA 2HUJA 1R4TA 1KU2A 3HKKA 2J7PA 3QW1A 5T3TA 3IQTA 4JEAA 3GEHA 1RKEA 4I1OB 4MTGA 4RBNA 3DI5A 4BJ5C 2W9YA 4IB4A 1YJGA 2WZFA 2I8BA 3E70C 3FOOA 1AUEA 3O55A 5L0JA 3RYLA 2RD9A 4YL1A 4G7HF 2PP4A 5JSLA 3RIPA 1ZHZA 2G3KA 1JPJA 1TKNA 2OU6A 1NBBA 5JS5A 4JKVA 5JUAA 3Q7GA 2VB6A 1HW2A 2J9UA 3JRTA 1NSGB 4DVYP 4H4KC 3R7CA 2MHRA 3DAFA 4KC9A 2WVOA 2LFDA 4KBLA 3T4RA 1LM3B 1LI5A 4PR9A 4XPWA 3NRHA 4C3EA 3SXZA 1ORSC 1TR2A 1K40A 4JC7A 2Y3DA 3DKAA 3C62A 2I15A 3W2WA 2J8WA 3A11A 3WG7C 2NUTB 1OR2A 1PV3A 2XL8A 2CW0F 3L0IA 3K1HA 2DYSC 2PNOA 3IEEA 2A6HF 3LLIA 3C8GD 3EHNA 2L7AA 2Q4FA 4A4AA 4YT8A 4Q4ZF 2Q9AA 2AU5A 2B0JA 2YZSA 5KYYA 4BEMJ 1M2OA 2PX0A 3ZG1A 1YDIA 5EGYA 1SMYF 3AGTA 5B3SC 3LNMB 1V54C 2EPLX 1PD0A 1QZXA 2ZXOA 1VLTA 2XSEA 1O87A 5D91A 4EBJA 1D0XA 1BR2A 4OD4A 2ZXRA 3HTKC 4YJWA 2HMQA 2R7OA 4PJLA 3MFNA 1EQ1A 1E85A 1EI7A 1FMVA 2OQMA 2VCCA 3JSZA 1TWGA 4YL3A 3SXKA 4CIHA 1S7ZA 2J0WA 1LS4A 1H6GA 1T9KA 4CS8C 4HFKB 2KJGA 4KNWA 1CGNA 5DS4A 5JT4A 1IZMA 4CJGA 3H2UA 4FX5A 3PHF2 3AQCA 5F5FA 2R7VA 4CSAC 1D1BA 1QLEC 3H2VA 2RSEB 3RF3A 3S27A 2GA0A 3I4UA 4RD9A 4CS9C 2XRHA 3HNLA 4DOZA 2AWCA 4MVOA 4NTAA 5COFA 2DGJA 2H7VC 2VCAA 5DS5A 4O7GA 5B1AC 5L0CA 1VYIA 4EBBA 3EGDB 3O10A 5DQTA 4E7ZA 4DBQA 4ZLCA 4QI2A 3N0TA 4BJ5A 3K1IC 3NDBB 2A0UA 1Q0GA 2P1AA 2XXAB 3JT1A 3KPHA 3S9OA 2A6EF 4BPMA 3GM1A 3V7OA 5COGA 1CGME 5DS6A 1E83A 4HFFB 4JCHA 2BE5F 4AX2A 2QTVA 3V5YA 1QQ3A 3U8PA 4L6RA 3W4YA 5IY5C 1VLSA 2H7OA 1A7DA 1W2WA 1A41A 2ASRA 1ST6A 4LDKA 2CCYA 4IARA 2CDQA 2OOCA 3EQLF 3EZIA 3IQ5A 3LS0A 3S29A 2NUPA 4NQFA 3TQOA 2HZ8A 2ETSA 1XZPA 2H7BA 4YWQA 2Y3HA 1ZVZA 3X2QC 3B29A 3GODA 2JD3A 4J7TA 5L0IA 1L3PA 2LK4A 2YL0A 2YVKA 3LESA 1YYJA 5E3AA 3ZQYA 3JYHA 3ZTZA 1Z6AA 3TD7A 5KYWB 1E86A 3NG1A 1SR2A 3ECSA 4NCQA 1ZW2A 2IBFA 2B0HA 4Q5SF 3NMJA 2G62A 4I44A 1T01A 3UGOA 4H54A 3TK0A 2GWWA 2J45A 1EKYA 3JZ0A 4WGYA 5COMA 1NG1A 3GORA 5A6BA 1M2VB 4YT5A 3RQEA 2PFDA 4FESA 1FMWA 5CIVA 4GYTA 3ZQVA 1C17M 1MNDA 4MVRA 2LD6A 4XPYA 3FDQA 1WASA 3CAXA 3C8GA 1RJ9A 3EGXB 3KYIA 3Q6NA 3L1MA 3TJ6A 3U8VA 4XEFA 1WTYA 4XWJA 1YARO 3IHUA 4NC3A 3DZAA 2QNLA 1ZU4A 4J32B 2CNWD 3UGPA 3QTHA 5KYXA 1LKXA 1C03A 4FWVA 3DM9B 3ZTMA 4BEJA 3SEOA 1JR8A 1Q0FA 3AG4C 4A2NB 4C3DA 3WAQA 3JRMO 3N2ZB 4OIQF 4U5HA 2YLGA 1G5ZA 4BG0A 3OA1A 5JLIA 3UMHA 3DWWA 1I5NA 4MVQA 3U3FA 1NLXA 3VRCA 5BQGA 4D4XA 3HJCA 2P61A 3L8JA 4DXWA 4E18A 1O3UA 3EJNA 3EH1A 4MNDA 4Z9IA 2O9XA 2X51A 5F5HA 5A69A 3NYMA 1J8YF 4IGGA 1MMDA 2OJQA 1YA9A 5E33A 5KYUB 1XZQA 1VTMP 4AK9A 3ABLC 1GQAA 1JRAA 1HE1A 1H7IA 2KC3A 1FAPB 4DRJB 1Z63A 1RMVA 2PBEA 3MYIA 1T6QA 2YL3A 3AG1C 2IXOA 1WWPA 3EZHA 3PCVA 1V4AA 2KW3C 3GANA 1B68A 2KK1A 2UUIA 4BJ6A 2Y3BA 3ATPA 4MW3A 2EINC 1ZHWA 2IYLD 3B9QA 4E0HA 1ZW3A 4B6IA 3TOMA 1KTMA 2YLIA 3GM3A 3M79A 5L0DA 1CPRA 2EPNA 3LEVA 2F22A 1WGWA 2MWQA 5D92A 3GWNA 3L8IA 4J7YA 3G4XA 5L3VA 3MBGA 2NG1A 3DXJF 3EFOA 3RH3A 5FZTA 1YZCA 1OQCA 2ZXPA 1HW1A 3LNRA 2R7QA 4N06A 4YN0B 2H8AA 4YT2A 4Z9JA 3ZIBA 4C7OB 3W2VA 1TWAA 2GFHA 2J0XA 2WZGA 3DD7A 3L34A 2IXNA 4G7ZF 1R5ID 1Q0KA 3QW0A 4MTOA 1MNEA 4LACB 3G4ZA 2PX3A 2P7VA 2VASA 2BL2A 3C63A 4P9FA 3JCUQ 3NMKA 1K05A 1AEPA 4AE4A 3MYFA 2J9BA 3CQZA 4O6NA 2R7SA 2AP3A 2XM4A 2EPMX 3NKDA 2M4EA 4MQ9F 1CPQA 3NYLA 2JPUA 1FTSA 4P6IC 2EIMC 3M4CA 3W8HA 4EUKB 1E84A 5L0GA 3DMDA 3VM6A 5JVEA 4U5BE 4XLPF 2KGOA 2IXMA 1T6UA 1QSPA 2OEXA 2QY9A 256BA 1JAFA 1TWCA 2J9VA 1Z3IX 4XLNF 3S90A 1C02A 3ABKC 2XM0A 1YA7O 1D0ZA 2Q7RA 3MX3A 4CJOA 3BEHA 2YHSA 3DJNB 1OXKA 4RDAA 2R7RA 2PF4E 3WODF 1D1CA 3RQGA 4AL1A 1Z5ZA 2L81A 2D5RB 2MYSA 2HKVA 2W4MA 3PMRA 3ZC4A 1QVXA 1WOLA 1A0BA 2C04A 3KKBA 2AVKA 2HV6A 3QVZA 1NZEA 2HMZA 3IPMO 4MS2A 5F28E 2Q9CA 1Z7Qc 4FAPB 2YL7A 1ORJA 3MLGA 4JTAB 3RFYA 1BR4A 1SYQA 3LLKA 5AC5A 3SZRA 3WHNA 1RCPA 5HV9A 1APCA 2HSBA 4XTKA 1M57C 1LVKA 4PK4A 3ABMC 1A7VA 5TJ5E 2TMVP 1I4YA 1LE2A 1FNTc 4U5GA 1VB5A 5A6BD 5L0HA 5EHHA 2P0NA 1PD1A 1KNYA 3FAPB 3ITFA 4JRZA 5T3WA 1JOGA 3U2MA 3HNKA 1G4WR 3AG2C 1GM5A 3FVYA 1OCZC 1I4ZA 2P6VA 2V26A 3U0CA 3SNHA 2R02A 2Q3TA 1K04A 3OEOA 3Q7LA 2DB4A 2FFHA 1OCCC 5E3CA 1O5HA 1G8XA 4U5DE 3CZ6A 2LQGA 4D4NA 2OG2A 3C7JA 2HJ3A 3VAYA 2XL6A 3V5XA 3TJ5A 2L6HA 1OR3A 3F47A 4K0DA 1RXQA 1SF8A 2HV7A 2EIJC 4MTFA 3EGDA 4WJ0A 3U9JA 3U2LA 2NPUA 1UG7A 1OW7A 3FXHA 1Q0DA 1HMOA 3FOPA 2XXAA 4PACA 3SYNA 2R9RB 2G3VA 2KNHA 2QE9A 4PFOA 3G50A 1HE9A 1QPUA 3C18A 4U9EA 2Q00A 3ZVRA 3LUTB 3DJUB 3TOLA 1UFBA 5K0IA 3ZDLA 4WABA 2EPOA 2WVNA 3EG9B 3QZCA 1PCXA 3HLZA 2WB7A 1MQVA 3LS1A 3CSKA 5A6AA 2YQYA 3HNIA 1V55C 1FFTC 4MVMA 5DLJA 2KQ9A 2ICWG 4MVUA 2V3CC 3LEOA 3ASOC 2NUPB 1RKEB 3K33A 1TQGA 3E9VA 3K1IA 1Q0MA 4K1OA 3C8ZA 4CX9A 4OIPF 1RKCA 1LI7A 1OCRC 1OCOC 4PJJA 5KYWA 2XL4A 2A1DD 4JEBA 1EA8A 4IAOA 4O6YA 4ER9A 2R25A 5KYNA 4ULVA 3AJMA 2ZXWC 4DJ9A 3K66A 4XEKA 3TULA 4IRUA 1L7CA 1Y6DA 4G7OF 4OIRF 3OWTA 4EWCA 4ONSA 3NKEA 1M2VA 1WATA 4GQHA 3M4BA 1ZYRF 3H65A 3J06A 1HMDA 1JMWA 1TWHA 2XLVA 2Z15A 3EHMA 1YYXA 2W45A 3I5PA 3JSEO 1DOVA 2NUTA 2YL1A 2VCBA 1F1MA 2GAQA 2OEVA 1MMGA 1RJ9B 3CEXA 3EGXA 3US6A 2LCHA 4G78A 3T6JA 1Z23A 2XLMA 2HSQA 2YKZA 4J30B 5KYYB 4IAQA 3FMSA 2D4UA 2EPKX 2XLDA 5DVWA 5FCLA 4JTDB 4R32A 4LDRA 4JCZA 1JPNA 4XEVA 3GM2A 2ZD9A 5JP7A 4C3BA 4NY3A 1D0YA 1J8MF 3UNGC 4M63A 1FFHA 2J7PD 2Y39A 3B71A 3S0XA 3PDMP 4ZLDA 3RVZA 5AGFA 1NFOA 2EIKC 3B0UX 4E17A 3N24A 4LLEA 3FAJA 4W8KA 4QDLA 5B3IA 4QI0A 2KYHA 1M6TA 1S05A 1WN0A 5JRAA 4LERA 2R05A 2NSFA 2XLEA 1MMAA 1QKRA 4G0HA 4HEAJ 4CDYA 1OKKA 4MVZA 2BC5A 4E0IA 1MMNA 4BJ1A 1BDJB 2XS1A 4PJMA 2A69F 1CGOA 3EPVA 2OCCC 2J9WA 1OKKD 1BZ4A 3JTLO 3QMKA 4JZAA 3K6BA 5CI8A 4DBRA 1TFOB 5BQHA 1YLMA 2A0BA 1D1AA 2J46A 2XLHA 3B0PA 1ZU5A 1E2XA 1VK5A 2LFFA 1H9TA 1TFKB 4Z9HA 4DVZA 2LSEA 1GGQA 2AWYA 4U5CE 3UR3C 4DRIB 2XLWA 3U9MA 2OKUA 3LAYA 2DYRC 3UMIA 3GEEA 2YRFA 4JVSA 4OIOF 4O6MA 2XS8A 3EFOB 3I5QA 4BJTA 4C7OA 1AVOB 3T6GB 2HJMA 2CGEA 2JX0A 1GS9A 1NFNA 3QVYA 4PJNA 3RVYA 2HS5A 4LDQA 3U3BA 4CIPA 1V74B 3ASNC 1U89A 1G4US 3R2PA 3U5SA 2GDCA 3IQCA 4U5FE 2VC9A 2LIGA 4AE4B 3NYJA 2VH3A 4OINF 2HFIA 3RKOF 1NU7D 1OW6A 2Y3GA 3AG3C 1OW8A 4WGZA 5HSWA 4NTFA 4KNVA 5L0FA 1LE4A 4EKWA 1ZHTA 3NMIA 3SXYA 3O6XA 5DQZA 2Y69C 1BR1A 1LS1A 3BRJA 4XQ1A 3A9CA 1VOMA 4JIOA 1BBHA 2A68F 2L6FA 4N4WA 3KL4A 4NTBA 3O39A 5L3QA 1T6IA 4JJGA 2CYDA 4CDAA 1NU9C 3C8GB 1YAUO 3IQ6A 3S84A 3ZSUA 5EK0A 1DOWA 3VF0A 1XWJA 1A7EA 2Q9BA 1N1CA 1YZAA 2LP4A 4N6CA 4JTCB 4ULWA 2IOQA 2KSFA 5KYXB 4YL0A 4CS7A 2QUPA 1ORYA 4P9TA 4O79A 5B1BC 1H9GA 1ZZPA 4LLCA 3ZWIA 5GPGB 2L9JA 4JJFA 2XLOA 1VMAA 2QLAA 2R7TA 2EILC 4EBKA 1YVIA 1OXBA 4IJJA 4K7BA 3S28A 4CS9A 3B0VC 4I1MA 4CBEA 1U0BB 5AC4A 3X1OA 3T6BA 3UMKA 2WVQA 2CNWA 4E7SA 2FAPB 3KMIA 4U5EE 4JW1A 4JE9A 4X0RA 4I3MA 5KYUA 4CDVA 4CS8A 4EIYA 4KI2A 3DAGA 3RQFA 4EHPA 2C03A 1LPEA 2ZPAA 4MVSA 4ANJA 2W4BA 4AL0A 2R7WA 3M15A 3AGUA 1Y4CA 2FGYA 4CSAA 4W8PA 2IXPA 3SXMA 4YT4A 5E2QA 3VYWA 4DRHB 2L6GA 3DE9A 3GWLA 5BUOA 5BQIA 4BJ6C
chains in the Genus database with same CATH topology
3R2PA 1OR2A 1LS4A 1EA8A 1H7IA 1LPEA 1EQ1A 1LE4A 1GS9A 1AEPA 1OR3A 1NFNA 1B68A 1LE2A 1NFOA 1YA9A 2KC3A 3S84A 1BZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2P A;  1OR2 A;  1LS4 A;  1EA8 A;  1H7I A;  1LPE A;  1EQ1 A;  1LE4 A;  1GS9 A;  1AEP A;  1OR3 A;  1NFN A;  1B68 A;  1LE2 A;  1NFO A;  1YA9 A;  2KC3 A;  3S84 A;  1BZ4 A; 
#chains in the Genus database with same CATH topology
 5CI9 A;  1SZI A;  4N6H A;  1IW7 F;  2DI3 A;  4OD5 A;  3T9O A;  5T1D B;  4GEH A;  2X0C A;  4XPX A;  3DE8 A;  1HY5 A;  1FR0 A;  3POV A;  4Q7C A;  3KH2 A;  4U9D A;  3Q6M A;  4HE8 D;  3AQB A;  2M64 A;  3M1C B;  2IM8 A;  4UDV A;  1M56 C;  3KYJ A;  3W8I A;  5A6J A;  1T5O A;  2UUH A;  2NSG A;  1LIH A;  3DM5 A;  3HNJ A;  2YEV A;  2WL8 A;  3RW0 A;  4PFP A;  5A6K A;  3K7D A;  2WZL A;  1U6H A;  1VYK A;  1ZHY A;  2R7X A;  4JUR I;  2YLD A;  3JYY A;  4F4B A;  3AOU A;  3EH2 A;  3LJB A;  2OJE D;  4MW8 A;  3GEI A;  3SP1 A;  2YWA A;  3V5Z A;  3EG9 A;  2R7U A;  3F46 A;  3FHD A;  4IWB A;  2R03 A;  4YK5 A;  2E87 A;  1ZHX A;  2HUJ A;  1R4T A;  1KU2 A;  3HKK A;  2J7P A;  3QW1 A;  5T3T A;  3IQT A;  4JEA A;  3GEH A;  1RKE A;  4I1O B;  4MTG A;  4RBN A;  3DI5 A;  4BJ5 C;  2W9Y A;  4IB4 A;  1YJG A;  2WZF A;  2I8B A;  3E70 C;  3FOO A;  1AUE A;  3O55 A;  5L0J A;  3RYL A;  2RD9 A;  4YL1 A;  4G7H F;  2PP4 A;  5JSL A;  3RIP A;  1ZHZ A;  2G3K A;  1JPJ A;  1TKN A;  2OU6 A;  1NBB A;  5JS5 A;  4JKV A;  5JUA A;  3Q7G A;  2VB6 A;  1HW2 A;  2J9U A;  3JRT A;  1NSG B;  4DVY P;  4H4K C;  3R7C A;  2MHR A;  3DAF A;  4KC9 A;  2WVO A;  2LFD A;  4KBL A;  3T4R A;  1LM3 B;  1LI5 A;  4PR9 A;  4XPW A;  3NRH A;  4C3E A;  3SXZ A;  1ORS C;  1TR2 A;  1K40 A;  4JC7 A;  2Y3D A;  3DKA A;  3C62 A;  2I15 A;  3W2W A;  2J8W A;  3A11 A;  3WG7 C;  2NUT B;  1OR2 A;  1PV3 A;  2XL8 A;  2CW0 F;  3L0I A;  3K1H A;  2DYS C;  2PNO A;  3IEE A;  2A6H F;  3LLI A;  3C8G D;  3EHN A;  2L7A A;  2Q4F A;  4A4A A;  4YT8 A;  4Q4Z F;  2Q9A A;  2AU5 A;  2B0J A;  2YZS A;  5KYY A;  4BEM J;  1M2O A;  2PX0 A;  3ZG1 A;  1YDI A;  5EGY A;  1SMY F;  3AGT A;  5B3S C;  3LNM B;  1V54 C;  2EPL X;  1PD0 A;  1QZX A;  2ZXO A;  1VLT A;  2XSE A;  1O87 A;  5D91 A;  4EBJ A;  1D0X A;  1BR2 A;  4OD4 A;  2ZXR A;  3HTK C;  4YJW A;  2HMQ A;  2R7O A;  4PJL A;  3MFN A;  1EQ1 A;  1E85 A;  1EI7 A;  1FMV A;  2OQM A;  2VCC A;  3JSZ A;  1TWG A;  4YL3 A;  3SXK A;  4CIH A;  1S7Z A;  2J0W A;  1LS4 A;  1H6G A;  1T9K A;  4CS8 C;  4HFK B;  2KJG A;  4KNW A;  1CGN A;  5DS4 A;  5JT4 A;  1IZM A;  4CJG A;  3H2U A;  4FX5 A;  3PHF 2;  3AQC A;  5F5F A;  2R7V A;  4CSA C;  1D1B A;  1QLE C;  3H2V A;  2RSE B;  3RF3 A;  3S27 A;  2GA0 A;  3I4U A;  4RD9 A;  4CS9 C;  2XRH A;  3HNL A;  4DOZ A;  2AWC A;  4MVO A;  4NTA A;  5COF A;  2DGJ A;  2H7V C;  2VCA A;  5DS5 A;  4O7G A;  5B1A C;  5L0C A;  1VYI A;  4EBB A;  3EGD B;  3O10 A;  5DQT A;  4E7Z A;  4DBQ A;  4ZLC A;  4QI2 A;  3N0T A;  4BJ5 A;  3K1I C;  3NDB B;  2A0U A;  1Q0G A;  2P1A A;  2XXA B;  3JT1 A;  3KPH A;  3S9O A;  2A6E F;  4BPM A;  3GM1 A;  3V7O A;  5COG A;  1CGM E;  5DS6 A;  1E83 A;  4HFF B;  4JCH A;  2BE5 F;  4AX2 A;  2QTV A;  3V5Y A;  1QQ3 A;  3U8P A;  4L6R A;  3W4Y A;  5IY5 C;  1VLS A;  2H7O A;  1A7D A;  1W2W A;  1A41 A;  2ASR A;  1ST6 A;  4LDK A;  2CCY A;  4IAR A;  2CDQ A;  2OOC A;  3EQL F;  3EZI A;  3IQ5 A;  3LS0 A;  3S29 A;  2NUP A;  4NQF A;  3TQO A;  2HZ8 A;  2ETS A;  1XZP A;  2H7B A;  4YWQ A;  2Y3H A;  1ZVZ A;  3X2Q C;  3B29 A;  3GOD A;  2JD3 A;  4J7T A;  5L0I A;  1L3P A;  2LK4 A;  2YL0 A;  2YVK A;  3LES A;  1YYJ A;  5E3A A;  3ZQY A;  3JYH A;  3ZTZ A;  1Z6A A;  3TD7 A;  5KYW B;  1E86 A;  3NG1 A;  1SR2 A;  3ECS A;  4NCQ A;  1ZW2 A;  2IBF A;  2B0H A;  4Q5S F;  3NMJ A;  2G62 A;  4I44 A;  1T01 A;  3UGO A;  4H54 A;  3TK0 A;  2GWW A;  2J45 A;  1EKY A;  3JZ0 A;  4WGY A;  5COM A;  1NG1 A;  3GOR A;  5A6B A;  1M2V B;  4YT5 A;  3RQE A;  2PFD A;  4FES A;  1FMW A;  5CIV A;  4GYT A;  3ZQV A;  1C17 M;  1MND A;  4MVR A;  2LD6 A;  4XPY A;  3FDQ A;  1WAS A;  3CAX A;  3C8G A;  1RJ9 A;  3EGX B;  3KYI A;  3Q6N A;  3L1M A;  3TJ6 A;  3U8V A;  4XEF A;  1WTY A;  4XWJ A;  1YAR O;  3IHU A;  4NC3 A;  3DZA A;  2QNL A;  1ZU4 A;  4J32 B;  2CNW D;  3UGP A;  3QTH A;  5KYX A;  1LKX A;  1C03 A;  4FWV A;  3DM9 B;  3ZTM A;  4BEJ A;  3SEO A;  1JR8 A;  1Q0F A;  3AG4 C;  4A2N B;  4C3D A;  3WAQ A;  3JRM O;  3N2Z B;  4OIQ F;  4U5H A;  2YLG A;  1G5Z A;  4BG0 A;  3OA1 A;  5JLI A;  3UMH A;  3DWW A;  1I5N A;  4MVQ A;  3U3F A;  1NLX A;  3VRC A;  5BQG A;  4D4X A;  3HJC A;  2P61 A;  3L8J A;  4DXW A;  4E18 A;  1O3U A;  3EJN A;  3EH1 A;  4MND A;  4Z9I A;  2O9X A;  2X51 A;  5F5H A;  5A69 A;  3NYM A;  1J8Y F;  4IGG A;  1MMD A;  2OJQ A;  1YA9 A;  5E33 A;  5KYU B;  1XZQ A;  1VTM P;  4AK9 A;  3ABL C;  1GQA A;  1JRA A;  1HE1 A;  1H7I A;  2KC3 A;  1FAP B;  4DRJ B;  1Z63 A;  1RMV A;  2PBE A;  3MYI A;  1T6Q A;  2YL3 A;  3AG1 C;  2IXO A;  1WWP A;  3EZH A;  3PCV A;  1V4A A;  2KW3 C;  3GAN A;  1B68 A;  2KK1 A;  2UUI A;  4BJ6 A;  2Y3B A;  3ATP A;  4MW3 A;  2EIN C;  1ZHW A;  2IYL D;  3B9Q A;  4E0H A;  1ZW3 A;  4B6I A;  3TOM A;  1KTM A;  2YLI A;  3GM3 A;  3M79 A;  5L0D A;  1CPR A;  2EPN A;  3LEV A;  2F22 A;  1WGW A;  2MWQ A;  5D92 A;  3GWN A;  3L8I A;  4J7Y A;  3G4X A;  5L3V A;  3MBG A;  2NG1 A;  3DXJ F;  3EFO A;  3RH3 A;  5FZT A;  1YZC A;  1OQC A;  2ZXP A;  1HW1 A;  3LNR A;  2R7Q A;  4N06 A;  4YN0 B;  2H8A A;  4YT2 A;  4Z9J A;  3ZIB A;  4C7O B;  3W2V A;  1TWA A;  2GFH A;  2J0X A;  2WZG A;  3DD7 A;  3L34 A;  2IXN A;  4G7Z F;  1R5I D;  1Q0K A;  3QW0 A;  4MTO A;  1MNE A;  4LAC B;  3G4Z A;  2PX3 A;  2P7V A;  2VAS A;  2BL2 A;  3C63 A;  4P9F A;  3JCU Q;  3NMK A;  1K05 A;  1AEP A;  4AE4 A;  3MYF A;  2J9B A;  3CQZ A;  4O6N A;  2R7S A;  2AP3 A;  2XM4 A;  2EPM X;  3NKD A;  2M4E A;  4MQ9 F;  1CPQ A;  3NYL A;  2JPU A;  1FTS A;  4P6I C;  2EIM C;  3M4C A;  3W8H A;  4EUK B;  1E84 A;  5L0G A;  3DMD A;  3VM6 A;  5JVE A;  4U5B E;  4XLP F;  2KGO A;  2IXM A;  1T6U A;  1QSP A;  2OEX A;  2QY9 A;  256B A;  1JAF A;  1TWC A;  2J9V A;  1Z3I X;  4XLN F;  3S90 A;  1C02 A;  3ABK C;  2XM0 A;  1YA7 O;  1D0Z A;  2Q7R A;  3MX3 A;  4CJO A;  3BEH A;  2YHS A;  3DJN B;  1OXK A;  4RDA A;  2R7R A;  2PF4 E;  3WOD F;  1D1C A;  3RQG A;  4AL1 A;  1Z5Z A;  2L81 A;  2D5R B;  2MYS A;  2HKV A;  2W4M A;  3PMR A;  3ZC4 A;  1QVX A;  1WOL A;  1A0B A;  2C04 A;  3KKB A;  2AVK A;  2HV6 A;  3QVZ A;  1NZE A;  2HMZ A;  3IPM O;  4MS2 A;  5F28 E;  2Q9C A;  1Z7Q c;  4FAP B;  2YL7 A;  1ORJ A;  3MLG A;  4JTA B;  3RFY A;  1BR4 A;  1SYQ A;  3LLK A;  5AC5 A;  3SZR A;  3WHN A;  1RCP A;  5HV9 A;  1APC A;  2HSB A;  4XTK A;  1M57 C;  1LVK A;  4PK4 A;  3ABM C;  1A7V A;  5TJ5 E;  2TMV P;  1I4Y A;  1LE2 A;  1FNT c;  4U5G A;  1VB5 A;  5A6B D;  5L0H A;  5EHH A;  2P0N A;  1PD1 A;  1KNY A;  3FAP B;  3ITF A;  4JRZ A;  5T3W A;  1JOG A;  3U2M A;  3HNK A;  1G4W R;  3AG2 C;  1GM5 A;  3FVY A;  1OCZ C;  1I4Z A;  2P6V A;  2V26 A;  3U0C A;  3SNH A;  2R02 A;  2Q3T A;  1K04 A;  3OEO A;  3Q7L A;  2DB4 A;  2FFH A;  1OCC C;  5E3C A;  1O5H A;  1G8X A;  4U5D E;  3CZ6 A;  2LQG A;  4D4N A;  2OG2 A;  3C7J A;  2HJ3 A;  3VAY A;  2XL6 A;  3V5X A;  3TJ5 A;  2L6H A;  1OR3 A;  3F47 A;  4K0D A;  1RXQ A;  1SF8 A;  2HV7 A;  2EIJ C;  4MTF A;  3EGD A;  4WJ0 A;  3U9J A;  3U2L A;  2NPU A;  1UG7 A;  1OW7 A;  3FXH A;  1Q0D A;  1HMO A;  3FOP A;  2XXA A;  4PAC A;  3SYN A;  2R9R B;  2G3V A;  2KNH A;  2QE9 A;  4PFO A;  3G50 A;  1HE9 A;  1QPU A;  3C18 A;  4U9E A;  2Q00 A;  3ZVR A;  3LUT B;  3DJU B;  3TOL A;  1UFB A;  5K0I A;  3ZDL A;  4WAB A;  2EPO A;  2WVN A;  3EG9 B;  3QZC A;  1PCX A;  3HLZ A;  2WB7 A;  1MQV A;  3LS1 A;  3CSK A;  5A6A A;  2YQY A;  3HNI A;  1V55 C;  1FFT C;  4MVM A;  5DLJ A;  2KQ9 A;  2ICW G;  4MVU A;  2V3C C;  3LEO A;  3ASO C;  2NUP B;  1RKE B;  3K33 A;  1TQG A;  3E9V A;  3K1I A;  1Q0M A;  4K1O A;  3C8Z A;  4CX9 A;  4OIP F;  1RKC A;  1LI7 A;  1OCR C;  1OCO C;  4PJJ A;  5KYW A;  2XL4 A;  2A1D D;  4JEB A;  1EA8 A;  4IAO A;  4O6Y A;  4ER9 A;  2R25 A;  5KYN A;  4ULV A;  3AJM A;  2ZXW C;  4DJ9 A;  3K66 A;  4XEK A;  3TUL A;  4IRU A;  1L7C A;  1Y6D A;  4G7O F;  4OIR F;  3OWT A;  4EWC A;  4ONS A;  3NKE A;  1M2V A;  1WAT A;  4GQH A;  3M4B A;  1ZYR F;  3H65 A;  3J06 A;  1HMD A;  1JMW A;  1TWH A;  2XLV A;  2Z15 A;  3EHM A;  1YYX A;  2W45 A;  3I5P A;  3JSE O;  1DOV A;  2NUT A;  2YL1 A;  2VCB A;  1F1M A;  2GAQ A;  2OEV A;  1MMG A;  1RJ9 B;  3CEX A;  3EGX A;  3US6 A;  2LCH A;  4G78 A;  3T6J A;  1Z23 A;  2XLM A;  2HSQ A;  2YKZ A;  4J30 B;  5KYY B;  4IAQ A;  3FMS A;  2D4U A;  2EPK X;  2XLD A;  5DVW A;  5FCL A;  4JTD B;  4R32 A;  4LDR A;  4JCZ A;  1JPN A;  4XEV A;  3GM2 A;  2ZD9 A;  5JP7 A;  4C3B A;  4NY3 A;  1D0Y A;  1J8M F;  3UNG C;  4M63 A;  1FFH A;  2J7P D;  2Y39 A;  3B71 A;  3S0X A;  3PDM P;  4ZLD A;  3RVZ A;  5AGF A;  1NFO A;  2EIK C;  3B0U X;  4E17 A;  3N24 A;  4LLE A;  3FAJ A;  4W8K A;  4QDL A;  5B3I A;  4QI0 A;  2KYH A;  1M6T A;  1S05 A;  1WN0 A;  5JRA A;  4LER A;  2R05 A;  2NSF A;  2XLE A;  1MMA A;  1QKR A;  4G0H A;  4HEA J;  4CDY A;  1OKK A;  4MVZ A;  2BC5 A;  4E0I A;  1MMN A;  4BJ1 A;  1BDJ B;  2XS1 A;  4PJM A;  2A69 F;  1CGO A;  3EPV A;  2OCC C;  2J9W A;  1OKK D;  1BZ4 A;  3JTL O;  3QMK A;  4JZA A;  3K6B A;  5CI8 A;  4DBR A;  1TFO B;  5BQH A;  1YLM A;  2A0B A;  1D1A A;  2J46 A;  2XLH A;  3B0P A;  1ZU5 A;  1E2X A;  1VK5 A;  2LFF A;  1H9T A;  1TFK B;  4Z9H A;  4DVZ A;  2LSE A;  1GGQ A;  2AWY A;  4U5C E;  3UR3 C;  4DRI B;  2XLW A;  3U9M A;  2OKU A;  3LAY A;  2DYR C;  3UMI A;  3GEE A;  2YRF A;  4JVS A;  4OIO F;  4O6M A;  2XS8 A;  3EFO B;  3I5Q A;  4BJT A;  4C7O A;  1AVO B;  3T6G B;  2HJM A;  2CGE A;  2JX0 A;  1GS9 A;  1NFN A;  3QVY A;  4PJN A;  3RVY A;  2HS5 A;  4LDQ A;  3U3B A;  4CIP A;  1V74 B;  3ASN C;  1U89 A;  1G4U S;  3R2P A;  3U5S A;  2GDC A;  3IQC A;  4U5F E;  2VC9 A;  2LIG A;  4AE4 B;  3NYJ A;  2VH3 A;  4OIN F;  2HFI A;  3RKO F;  1NU7 D;  1OW6 A;  2Y3G A;  3AG3 C;  1OW8 A;  4WGZ A;  5HSW A;  4NTF A;  4KNV A;  5L0F A;  1LE4 A;  4EKW A;  1ZHT A;  3NMI A;  3SXY A;  3O6X A;  5DQZ A;  2Y69 C;  1BR1 A;  1LS1 A;  3BRJ A;  4XQ1 A;  3A9C A;  1VOM A;  4JIO A;  1BBH A;  2A68 F;  2L6F A;  4N4W A;  3KL4 A;  4NTB A;  3O39 A;  5L3Q A;  1T6I A;  4JJG A;  2CYD A;  4CDA A;  1NU9 C;  3C8G B;  1YAU O;  3IQ6 A;  3S84 A;  3ZSU A;  5EK0 A;  1DOW A;  3VF0 A;  1XWJ A;  1A7E A;  2Q9B A;  1N1C A;  1YZA A;  2LP4 A;  4N6C A;  4JTC B;  4ULW A;  2IOQ A;  2KSF A;  5KYX B;  4YL0 A;  4CS7 A;  2QUP A;  1ORY A;  4P9T A;  4O79 A;  5B1B C;  1H9G A;  1ZZP A;  4LLC A;  3ZWI A;  5GPG B;  2L9J A;  4JJF A;  2XLO A;  1VMA A;  2QLA A;  2R7T A;  2EIL C;  4EBK A;  1YVI A;  1OXB A;  4IJJ A;  4K7B A;  3S28 A;  4CS9 A;  3B0V C;  4I1M A;  4CBE A;  1U0B B;  5AC4 A;  3X1O A;  3T6B A;  3UMK A;  2WVQ A;  2CNW A;  4E7S A;  2FAP B;  3KMI A;  4U5E E;  4JW1 A;  4JE9 A;  4X0R A;  4I3M A;  5KYU A;  4CDV A;  4CS8 A;  4EIY A;  4KI2 A;  3DAG A;  3RQF A;  4EHP A;  2C03 A;  1LPE A;  2ZPA A;  4MVS A;  4ANJ A;  2W4B A;  4AL0 A;  2R7W A;  3M15 A;  3AGU A;  1Y4C A;  2FGY A;  4CSA A;  4W8P A;  2IXP A;  3SXM A;  4YT4 A;  5E2Q A;  3VYW A;  4DRH B;  2L6G A;  3DE9 A;  3GWL A;  5BUO A;  5BQI A;  4BJ6 C; 
#chains in the Genus database with same CATH homology
 3R2P A;  1OR2 A;  1LS4 A;  1EA8 A;  1H7I A;  1LPE A;  1EQ1 A;  1LE4 A;  1GS9 A;  1AEP A;  1OR3 A;  1NFN A;  1B68 A;  1LE2 A;  1NFO A;  1YA9 A;  2KC3 A;  3S84 A;  1BZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...