3S84A

Dimeric apoa-iv
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
239
structure length
239
Chain Sequence
b'DSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apolipoprotein A-IV
publication title The Structure of Dimeric Apolipoprotein A-IV and Its Mechanism of Self-Association.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 101
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 3s84A02
1GS9A 1AEPA 1H7IA 1NFNA 1YA9A 3R2PA 1EA8A 1B68A 1BZ4A 1OR2A 2KC3A 1LE4A 1LE2A 1NFOA 1OR3A 1EQ1A 1LS4A 1LPEA 3S84A
chains in the Genus database with same CATH superfamily
4CIPA 4OD4A 3EH2A 4OD5A 3DAGA 3AGTA 3JSZA 2LSEA 2PP4A 3HNKA 2XLOA 1M2VA 1R4TA 3EGDB 3VAYA 3B0VC 5JSLA 4DRJB 1FMVA 2J9VA 1M56C 2LFFA 2V26A 3DE9A 4GQHA 4XWJA 1K40A 4NC3A 5DQTA 2VCAA 4U5DE 1SZIA 4GEHA 3TK0A 2YLDA 3O55A 2YL7A 2C03A 2J45A 4MVZA 4MVSA 3U5SA 1YYJA 1BR2A 4I1OB 4JKVA 2P7VA 3U2LA 5L3VA 4NCQA 1L7CA 1ZW3A 2CW0F 4JCZA 1FAPB 2HMQA 2IOQA 4BEMJ 1Q0FA 1ORYA 2KSFA 2IXPA 2A6HF 5JVEA 2NUPB 4QI0A 2LP4A 4AX2A 2KYHA 2R25A 2AVKA 3CSKA 3GM2A 2A68F 4G78A 3L8JA 4MVQA 1H9GA 5EK0A 3ZSUA 3EG9B 1CPRA 1LS1A 2R7WA 2L7AA 1TKNA 3EGXA 3HTKC 3R2PA 3TD7A 2M64A 4DBQA 1Z7Qc 1APCA 3DAFA 2HJMA 3EZIA 4AE4B 3GWNA 4Q5SF 2XLEA 3EJNA 2MHRA 1NU7D 1FTSA 1HW1A 2MWQA 1M2VB 3E70C 3K1HA 3M79A 2AU5A 1V74B 1QQ3A 1ZHYA 3WHNA 4P6IC 1NFOA 4D4XA 1YZCA 2FAPB 1SR2A 2L6GA 1UG7A 3W8HA 1QVXA 1QKRA 4C3EA 2Q4FA 4CS9A 5AC5A 1EQ1A 4RD9A 1H6GA 4MTFA 3QW0A 2KNHA 3AGUA 1FR0A 3TOLA 4E17A 3M4CA 2Q00A 3L8IA 4G7OF 4N06A 4ANJA 3V7OA 3C63A 5CI9A 3Q7GA 1YAUO 1D0XA 4QDLA 3NG1A 3BRJA 3ECSA 1JPJA 1Z5ZA 2XLWA 4WJ0A 3QW1A 3RH3A 1V54C 1WN0A 5A6JA 5D91A 1A7EA 4W8KA 5L0JA 2X0CA 1B68A 2J0WA 4PACA 4DOZA 1BR4A 4DVZA 1HMOA 5T3WA 4J30B 1LI5A 3RF3A 3QZCA 4BJ6A 2P61A 2W45A 1D0ZA 4X0RA 3T6JA 2Y3DA 3VM6A 3H2VA 2IYLD 3S0XA 4QI2A 1ZYRF 3ASOC 2XM0A 4RBNA 3MYFA 1DOWA 3SZRA 3ZQYA 4IRUA 4XTKA 3GM1A 1QSPA 2CGEA 2PX3A 3UGPA 2HSBA 2J9WA 1EI7A 2J0XA 1TWAA 2J9BA 2KGOA 3EH1A 1FFHA 3L0IA 4PJNA 5GPGB 4XPXA 5L0HA 2LQGA 3DWWA 2EPKX 4ULWA 4C7OB 2HKVA 2AP3A 3FOPA 3K1IC 3LUTB 1I4ZA 1VYIA 1HY5A 1TWCA 4JE9A 3GORA 5JT4A 2FGYA 4IARA 5JP7A 1JMWA 3Q6NA 3U3FA 5HSWA 1QZXA 1I5NA 3SNHA 3VF0A 4CX9A 2Y3GA 4YT4A 4MS2A 2OKUA 1T6UA 2IXMA 4H54A 2EPMX 2XLMA 4CDVA 1BZ4A 1VB5A 3C62A 2EILC 3CQZA 3POVA 1LM3B 4JEAA 4JW1A 1VTMP 1SMYF 1Y6DA 3EZHA 1NZEA 2Q9BA 2FFHA 3DD7A 3LNMB 1GGQA 4IAOA 1OCOC 4C3BA 3LAYA 3O10A 4JZAA 1BDJB 2A0UA 2HFIA 4IAQA 2OJQA 3PCVA 2RD9A 1JPNA 4DRIB 5L3QA 3H2UA 3FAPB 1C17M 3C8GB 3HNLA 2H7OA 4CIHA 2Y3BA 3G4XA 3RQEA 3O39A 3WG7C 4KNWA 5K0IA 4XPWA 1WOLA 4JJFA 2R7VA 1D1BA 1U6HA 2C04A 2H8AA 4JIOA 5KYUA 3EFOA 3RW0A 5KYXA 5A6BD 3MLGA 4CJGA 4CSAA 4I3MA 3KYJA 3U8VA 4CS8A 3JCUQ 1A0BA 2OOCA 1XWJA 2YEVA 2L6HA 3S29A 1QLEC 2LK4A 4CBEA 4K7BA 2R03A 3RYLA 3I5QA 2R7XA 3GANA 3FDQA 3UR3C 3RQGA 1EKYA 5BUOA 3ZTZA 2L6FA 2J46A 5DS5A 3U9MA 4N4WA 1V55C 5EGYA 1G4WR 3SEOA 3MX3A 5KYWA 3OWTA 4MW8A 4U5BE 4XEFA 4EBKA 1VYKA 1LVKA 3QVYA 3K33A 1OQCA 1CGME 1AEPA 3GEIA 3KL4A 4P9TA 1WWPA 4OIRF 3RVZA 3UMKA 4N6HA 2R7UA 2VB6A 2ZXWC 1ZU5A 1PD1A 3IHUA 1C03A 2CDQA 4XLPF 2HS5A 3CZ6A 1I4YA 2Y3HA 3EQLF 2XS8A 3NMKA 1ZZPA 2AWYA 2YWAA 4U5HA 3B71A 1SF8A 2WZFA 4OIOF 3AOUA 1G8XA 3GM3A 3KH2A 4BG0A 4PFOA 1MMAA 1OCRC 1OW8A 2XLDA 3FOOA 1M6TA 3LEVA 4NTFA 4Z9IA 3SYNA 1O87A 1TQGA 3L1MA 4ER9A 2BE5F 2H7VC 1TWGA 2VCCA 1OR3A 3DZAA 4A2NB 3ZC4A 2OEVA 3JYHA 3GWLA 3HJCA 4LERA 2GAQA 5L0DA 1RMVA 3DM9B 2XSEA 2XL4A 1YYXA 4JEBA 5F5HA 1NSGB 3I5PA 4B6IA 3N2ZB 3NMJA 3K1IA 1J8YF 4EBBA 1RKCA 4JCHA 2WVQA 1RKEA 3V5ZA 2A0BA 2A69F 2YL1A 3FMSA 3U3BA 3ZQVA 1O5HA 4EWCA 2CNWA 3GEHA 5T3TA 5BQGA 2DGJA 3AG3C 4NTAA 4PK4A 1RJ9A 4XPYA 2UUHA 2KC3A 3HNIA 3M15A 3I4UA 3MYIA 1WTYA 3O6XA 4WGYA 1ZHXA 3LLKA 3SXYA 5B3IA 2BC5A 1GM5A 1H9TA 4MTGA 3ABKC 3N0TA 2NUTA 3K66A 3MBGA 4YJWA 3UGOA 2CNWD 2OQMA 4J7TA 3EPVA 2PX0A 2YKZA 4AK9A 3FVYA 3EHMA 3NYLA 4O6MA 4O79A 1MMNA 4DBRA 5E33A 4G0HA 2DB4A 2YLGA 2NG1A 3QVZA 5A69A 1L3PA 3B9QA 5BQIA 5E3CA 5B1AC 1HE1A 3K7DA 3NYMA 4LDKA 1H7IA 2R7OA 2ZXOA 2R05A 2NPUA 4HEAJ 2VH3A 3BEHA 1YA9A 2IXNA 2P0NA 3PMRA 3X1OA 1F1MA 3OA1A 4EHPA 1Z3IX 2Z15A 3W4YA 4MVRA 1SYQA 1LE4A 1TFOB 2ZD9A 4CS7A 4HE8D 3C18A 3EGXB 2B0HA 4Z9JA 1VK5A 4KBLA 1BBHA 4AL0A 4Q4ZF 2R7RA 2YL0A 1J8MF 3S28A 4OIQF 4E7SA 1Y4CA 2XS1A 4FWVA 3QTHA 5E2QA 5E3AA 4BJ1A 1GS9A 3S90A 2BL2A 5AC4A 1JRAA 2NUTB 4EKWA 1N1CA 4I44A 1OCZC 3A9CA 3UMHA 2ZXPA 1DOVA 4BJ5C 2DYRC 3LLIA 5FCLA 3TJ5A 4K0DA 2A6EF 2E87A 1ST6A 3LS1A 4E0IA 3B29A 2ETSA 2OEXA 3U9JA 1OR2A 3C8ZA 2G62A 3LEOA 4U9EA 5JS5A 4LLEA 2WL8A 4RDAA 4ONSA 2QNLA 1LE2A 3ITFA 1A41A 2W4MA 4YT8A 2W9YA 1PCXA 4FX5A 4H4KC 1T5OA 2ASRA 1HE9A 4DRHB 1YA7O 3E9VA 3RFYA 4LDRA 4N6CA 2PFDA 1HW2A 4OINF 2D5RB 2OG2A 1LPEA 2PF4E 3A11A 3M1CB 5COMA 3VYWA 1BR1A 2QY9A 2I8BA 4WABA 2VASA 3RVYA 1CGOA 1FMWA 2XXAA 1W2WA 2LD6A 4U5EE 2KJGA 3JRMO 5KYYA 4G7ZF 2LFDA 2R7SA 4KC9A 2EPOA 3WODF 3RIPA 3FHDA 5L0FA 3DI5A 1ORJA 2YRFA 1JAFA 1Q0KA 2NSGA 3LNRA 3Q6MA 4AL1A 1R5ID 2VCBA 5T1DB 1HMDA 4BEJA 1OKKA 1Z23A 1MNEA 4JTAB 2GA0A 5JLIA 1U0BB 2LCHA 2F22A 3ASNC 5L0CA 1TR2A 1XZQA 2Y69C 2XRHA 2EIJC 2R7TA 1KTMA 4CS9C 5BQHA 2GFHA 4PR9A 4E7ZA 4IJJA 2ZXRA 4NTBA 2PBEA 2P6VA 4Z9HA 3OEOA 4R32A 1VLSA 3ZVRA 3JT1A 4BPMA 1OKKD 5HV9A 2CYDA 3U8PA 4IWBA 1QPUA 5JRAA 3IQTA 4MVOA 3ZWIA 1OXKA 2MYSA 4JURI 4O7GA 3LJBA 4GYTA 2WZLA 3G50A 4PJLA 3MFNA 1VMAA 3U2MA 1WASA 1M2OA 1YJGA 3Q7LA 1D0YA 1EA8A 1Z63A 4BJ6C 2QE9A 3ZG1A 1ZHTA 4LLCA 3AG2C 5DVWA 5AGFA 3V5YA 4U5FE 1S05A 3UNGC 2NUPA 4OIPF 2UUIA 3TQOA 3W2WA 1G4US 3GEEA 4LDQA 2D4UA 5KYUB 4L6RA 3EFOB 2YZSA 5KYXB 3GODA 4XEKA 3EG9A 4WGZA 3JYYA 4M63A 5COGA 3V5XA 1ZW2A 4I1MA 3H65A 2JPUA 4YK5A 1LKXA 2Y39A 3JSEO 4MNDA 2XLVA 1T01A 3RQFA 1OW7A 4AE4A 3FAJA 1A7VA 3NMIA 3DMDA 1LIHA 4J7YA 1E2XA 3FXHA 1YDIA 2XL6A 3IQ5A 4YWQA 1MMDA 5DLJA 4BJ5A 5F5FA 1PV3A 5KYWB 2VC9A 1NU9C 5A6AA 2H7BA 3PDMP 4YN0B 2XLHA 3ATPA 3N24A 1D1AA 4YL3A 1OW6A 5FZTA 2JX0A 3DXJF 1XZPA 4U5GA 2YHSA 1TFKB 3X2QC 1ZVZA 256BA 2Q3TA 2X51A 4XLNF 2O9XA 3DKAA 3NYJA 4U9DA 4MTOA 2WVOA 1PD0A 4IB4A 2HV7A 2OU6A 2Q9AA 3WAQA 1E86A 2NSFA 2HJ3A 3EHNA 3JRTA 4MW3A 2V3CC 4KI2A 1T6QA 4DJ9A 1VLTA 3ZIBA 1ZHZA 1ZHWA 1Q0MA 3L34A 4HFFB 4E18A 3HLZA 1YVIA 1YZAA 5F28E 4CSAC 3AQCA 4CS8C 4MVUA 1IZMA 2IXOA 4CDYA 4C3DA 3B0UX 5DS6A 1NFNA 3NKDA 5L0GA 4ZLCA 4NY3A 3DM5A 3S27A 1UFBA 3AJMA 3SXKA 5DQZA 3KPHA 3LESA 4DVYP 1E83A 4XQ1A 3ABMC 2EIMC 2GDCA 3F46A 4YT5A 3SXMA 4C7OA 4EUKB 2M4EA 2OCCC 1Q0GA 1RKEB 1MQVA 2A1DD 3K6BA 4D4NA 1A7DA 4O6NA 2R9RB 4PJMA 4E0HA 4YL0A 4YL1A 3QMKA 3AG1C 4JJGA 4PFPA 1M57C 1RJ9B 2J8WA 3W2VA 1FFTC 2OJED 3B0PA 2G3VA 1NLXA 3IPMO 3R7CA 2TMVP 2L81A 4JTCB 5IY5C 3HNJA 4G7HF 4EBJA 3AQBA 3JZ0A 3ZDLA 1CPQA 5DS4A 4FAPB 1Q0DA 2QTVA 3T6GB 4JRZA 4U5CE 2W4BA 2ICWG 3JTLO 4JVSA 4CDAA 2EINC 2ZPAA 4W8PA 3C8GA 2YLIA 4FESA 1YARO 4P9FA 5B3SC 1ZU4A 3F47A 2XXAB 4XEVA 1OXBA 1WATA 1JOGA 5CIVA 3U0CA 1MMGA 1CGNA 2HSQA 3G4ZA 2CCYA 2YQYA 2Q7RA 3CAXA 1V4AA 3AG4C 4UDVA 3C8GD 1NBBA 5KYNA 3US6A 1JR8A 3HKKA 1D1CA 1C02A 1T6IA 2JD3A 2XM4A 3C7JA 2QLAA 2HV6A 5A6KA 2EPLX 2XL8A 1AVOB 5COFA 1WGWA 3IQCA 3VRCA 2KW3C 2GWWA 4YT2A 2P1AA 3S9OA 2YVKA 3LS0A 3DE8A 2WB7A 5EHHA 1E84A 3CEXA 1KNYA 2KK1A 2AWCA 1RXQA 3NDBB 1LI7A 4JC7A 5L0IA 1FNTc 2WVNA 4IGGA 3SXZA 2HUJA 2J7PA 1NG1A 3IQ6A 5A6BA 4NQFA 5B1BC 4DXWA 5CI8A 4J32B 3EGDA 2IBFA 3KMIA 2EPNA 4Q7CA 2YL3A 1E85A 3TULA 4EIYA 2L9JA 4BJTA 3PHF2 1ORSC 3J06A 3S84A 1YLMA 4K1OA 1U89A 4JTDB 4CJOA 3UMIA 5JUAA 2J7PD 2IM8A 3DJUB 3NRHA 1AUEA 3RKOF 1KU2A 2QUPA 3SP1A 3T6BA 2I15A 2DI3A 3W8IA 2Q9CA 1MNDA 2LIGA 2PNOA 4ULVA 2HMZA 3KYIA 4KNVA 1IW7F 1OCCC 1TWHA 5D92A 2R7QA 3ABLC 4HFKB 4MVMA 4LACB 3T4RA 2HZ8A 3TJ6A 3TOMA 4MQ9F 2B0JA 4A4AA 4F4BA 3T9OA 1T9KA 5KYYB 1GQAA 1O3UA 3KKBA 2J9UA 2WZGA 2EIKC 2KQ9A 1S7ZA 2R02A 3M4BA 4O6YA 5TJ5E 1G5ZA 1VOMA 1LS4A 2RSEB 2DYSC 3IEEA 4PJJA 1K05A 1Z6AA 2G3KA 3DJNB 1K04A 3ZTMA 1RCPA 3NKEA 4ZLDA
chains in the Genus database with same CATH topology
1GS9A 1AEPA 1H7IA 1NFNA 1YA9A 3R2PA 1EA8A 1B68A 1BZ4A 1OR2A 2KC3A 1LE4A 1LE2A 1NFOA 1OR3A 1EQ1A 1LS4A 1LPEA 3S84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GS9 A;  1AEP A;  1H7I A;  1NFN A;  1YA9 A;  3R2P A;  1EA8 A;  1B68 A;  1BZ4 A;  1OR2 A;  2KC3 A;  1LE4 A;  1LE2 A;  1NFO A;  1OR3 A;  1EQ1 A;  1LS4 A;  1LPE A;  3S84 A; 
#chains in the Genus database with same CATH topology
 4CIP A;  4OD4 A;  3EH2 A;  4OD5 A;  3DAG A;  3AGT A;  3JSZ A;  2LSE A;  2PP4 A;  3HNK A;  2XLO A;  1M2V A;  1R4T A;  3EGD B;  3VAY A;  3B0V C;  5JSL A;  4DRJ B;  1FMV A;  2J9V A;  1M56 C;  2LFF A;  2V26 A;  3DE9 A;  4GQH A;  4XWJ A;  1K40 A;  4NC3 A;  5DQT A;  2VCA A;  4U5D E;  1SZI A;  4GEH A;  3TK0 A;  2YLD A;  3O55 A;  2YL7 A;  2C03 A;  2J45 A;  4MVZ A;  4MVS A;  3U5S A;  1YYJ A;  1BR2 A;  4I1O B;  4JKV A;  2P7V A;  3U2L A;  5L3V A;  4NCQ A;  1L7C A;  1ZW3 A;  2CW0 F;  4JCZ A;  1FAP B;  2HMQ A;  2IOQ A;  4BEM J;  1Q0F A;  1ORY A;  2KSF A;  2IXP A;  2A6H F;  5JVE A;  2NUP B;  4QI0 A;  2LP4 A;  4AX2 A;  2KYH A;  2R25 A;  2AVK A;  3CSK A;  3GM2 A;  2A68 F;  4G78 A;  3L8J A;  4MVQ A;  1H9G A;  5EK0 A;  3ZSU A;  3EG9 B;  1CPR A;  1LS1 A;  2R7W A;  2L7A A;  1TKN A;  3EGX A;  3HTK C;  3R2P A;  3TD7 A;  2M64 A;  4DBQ A;  1Z7Q c;  1APC A;  3DAF A;  2HJM A;  3EZI A;  4AE4 B;  3GWN A;  4Q5S F;  2XLE A;  3EJN A;  2MHR A;  1NU7 D;  1FTS A;  1HW1 A;  2MWQ A;  1M2V B;  3E70 C;  3K1H A;  3M79 A;  2AU5 A;  1V74 B;  1QQ3 A;  1ZHY A;  3WHN A;  4P6I C;  1NFO A;  4D4X A;  1YZC A;  2FAP B;  1SR2 A;  2L6G A;  1UG7 A;  3W8H A;  1QVX A;  1QKR A;  4C3E A;  2Q4F A;  4CS9 A;  5AC5 A;  1EQ1 A;  4RD9 A;  1H6G A;  4MTF A;  3QW0 A;  2KNH A;  3AGU A;  1FR0 A;  3TOL A;  4E17 A;  3M4C A;  2Q00 A;  3L8I A;  4G7O F;  4N06 A;  4ANJ A;  3V7O A;  3C63 A;  5CI9 A;  3Q7G A;  1YAU O;  1D0X A;  4QDL A;  3NG1 A;  3BRJ A;  3ECS A;  1JPJ A;  1Z5Z A;  2XLW A;  4WJ0 A;  3QW1 A;  3RH3 A;  1V54 C;  1WN0 A;  5A6J A;  5D91 A;  1A7E A;  4W8K A;  5L0J A;  2X0C A;  1B68 A;  2J0W A;  4PAC A;  4DOZ A;  1BR4 A;  4DVZ A;  1HMO A;  5T3W A;  4J30 B;  1LI5 A;  3RF3 A;  3QZC A;  4BJ6 A;  2P61 A;  2W45 A;  1D0Z A;  4X0R A;  3T6J A;  2Y3D A;  3VM6 A;  3H2V A;  2IYL D;  3S0X A;  4QI2 A;  1ZYR F;  3ASO C;  2XM0 A;  4RBN A;  3MYF A;  1DOW A;  3SZR A;  3ZQY A;  4IRU A;  4XTK A;  3GM1 A;  1QSP A;  2CGE A;  2PX3 A;  3UGP A;  2HSB A;  2J9W A;  1EI7 A;  2J0X A;  1TWA A;  2J9B A;  2KGO A;  3EH1 A;  1FFH A;  3L0I A;  4PJN A;  5GPG B;  4XPX A;  5L0H A;  2LQG A;  3DWW A;  2EPK X;  4ULW A;  4C7O B;  2HKV A;  2AP3 A;  3FOP A;  3K1I C;  3LUT B;  1I4Z A;  1VYI A;  1HY5 A;  1TWC A;  4JE9 A;  3GOR A;  5JT4 A;  2FGY A;  4IAR A;  5JP7 A;  1JMW A;  3Q6N A;  3U3F A;  5HSW A;  1QZX A;  1I5N A;  3SNH A;  3VF0 A;  4CX9 A;  2Y3G A;  4YT4 A;  4MS2 A;  2OKU A;  1T6U A;  2IXM A;  4H54 A;  2EPM X;  2XLM A;  4CDV A;  1BZ4 A;  1VB5 A;  3C62 A;  2EIL C;  3CQZ A;  3POV A;  1LM3 B;  4JEA A;  4JW1 A;  1VTM P;  1SMY F;  1Y6D A;  3EZH A;  1NZE A;  2Q9B A;  2FFH A;  3DD7 A;  3LNM B;  1GGQ A;  4IAO A;  1OCO C;  4C3B A;  3LAY A;  3O10 A;  4JZA A;  1BDJ B;  2A0U A;  2HFI A;  4IAQ A;  2OJQ A;  3PCV A;  2RD9 A;  1JPN A;  4DRI B;  5L3Q A;  3H2U A;  3FAP B;  1C17 M;  3C8G B;  3HNL A;  2H7O A;  4CIH A;  2Y3B A;  3G4X A;  3RQE A;  3O39 A;  3WG7 C;  4KNW A;  5K0I A;  4XPW A;  1WOL A;  4JJF A;  2R7V A;  1D1B A;  1U6H A;  2C04 A;  2H8A A;  4JIO A;  5KYU A;  3EFO A;  3RW0 A;  5KYX A;  5A6B D;  3MLG A;  4CJG A;  4CSA A;  4I3M A;  3KYJ A;  3U8V A;  4CS8 A;  3JCU Q;  1A0B A;  2OOC A;  1XWJ A;  2YEV A;  2L6H A;  3S29 A;  1QLE C;  2LK4 A;  4CBE A;  4K7B A;  2R03 A;  3RYL A;  3I5Q A;  2R7X A;  3GAN A;  3FDQ A;  3UR3 C;  3RQG A;  1EKY A;  5BUO A;  3ZTZ A;  2L6F A;  2J46 A;  5DS5 A;  3U9M A;  4N4W A;  1V55 C;  5EGY A;  1G4W R;  3SEO A;  3MX3 A;  5KYW A;  3OWT A;  4MW8 A;  4U5B E;  4XEF A;  4EBK A;  1VYK A;  1LVK A;  3QVY A;  3K33 A;  1OQC A;  1CGM E;  1AEP A;  3GEI A;  3KL4 A;  4P9T A;  1WWP A;  4OIR F;  3RVZ A;  3UMK A;  4N6H A;  2R7U A;  2VB6 A;  2ZXW C;  1ZU5 A;  1PD1 A;  3IHU A;  1C03 A;  2CDQ A;  4XLP F;  2HS5 A;  3CZ6 A;  1I4Y A;  2Y3H A;  3EQL F;  2XS8 A;  3NMK A;  1ZZP A;  2AWY A;  2YWA A;  4U5H A;  3B71 A;  1SF8 A;  2WZF A;  4OIO F;  3AOU A;  1G8X A;  3GM3 A;  3KH2 A;  4BG0 A;  4PFO A;  1MMA A;  1OCR C;  1OW8 A;  2XLD A;  3FOO A;  1M6T A;  3LEV A;  4NTF A;  4Z9I A;  3SYN A;  1O87 A;  1TQG A;  3L1M A;  4ER9 A;  2BE5 F;  2H7V C;  1TWG A;  2VCC A;  1OR3 A;  3DZA A;  4A2N B;  3ZC4 A;  2OEV A;  3JYH A;  3GWL A;  3HJC A;  4LER A;  2GAQ A;  5L0D A;  1RMV A;  3DM9 B;  2XSE A;  2XL4 A;  1YYX A;  4JEB A;  5F5H A;  1NSG B;  3I5P A;  4B6I A;  3N2Z B;  3NMJ A;  3K1I A;  1J8Y F;  4EBB A;  1RKC A;  4JCH A;  2WVQ A;  1RKE A;  3V5Z A;  2A0B A;  2A69 F;  2YL1 A;  3FMS A;  3U3B A;  3ZQV A;  1O5H A;  4EWC A;  2CNW A;  3GEH A;  5T3T A;  5BQG A;  2DGJ A;  3AG3 C;  4NTA A;  4PK4 A;  1RJ9 A;  4XPY A;  2UUH A;  2KC3 A;  3HNI A;  3M15 A;  3I4U A;  3MYI A;  1WTY A;  3O6X A;  4WGY A;  1ZHX A;  3LLK A;  3SXY A;  5B3I A;  2BC5 A;  1GM5 A;  1H9T A;  4MTG A;  3ABK C;  3N0T A;  2NUT A;  3K66 A;  3MBG A;  4YJW A;  3UGO A;  2CNW D;  2OQM A;  4J7T A;  3EPV A;  2PX0 A;  2YKZ A;  4AK9 A;  3FVY A;  3EHM A;  3NYL A;  4O6M A;  4O79 A;  1MMN A;  4DBR A;  5E33 A;  4G0H A;  2DB4 A;  2YLG A;  2NG1 A;  3QVZ A;  5A69 A;  1L3P A;  3B9Q A;  5BQI A;  5E3C A;  5B1A C;  1HE1 A;  3K7D A;  3NYM A;  4LDK A;  1H7I A;  2R7O A;  2ZXO A;  2R05 A;  2NPU A;  4HEA J;  2VH3 A;  3BEH A;  1YA9 A;  2IXN A;  2P0N A;  3PMR A;  3X1O A;  1F1M A;  3OA1 A;  4EHP A;  1Z3I X;  2Z15 A;  3W4Y A;  4MVR A;  1SYQ A;  1LE4 A;  1TFO B;  2ZD9 A;  4CS7 A;  4HE8 D;  3C18 A;  3EGX B;  2B0H A;  4Z9J A;  1VK5 A;  4KBL A;  1BBH A;  4AL0 A;  4Q4Z F;  2R7R A;  2YL0 A;  1J8M F;  3S28 A;  4OIQ F;  4E7S A;  1Y4C A;  2XS1 A;  4FWV A;  3QTH A;  5E2Q A;  5E3A A;  4BJ1 A;  1GS9 A;  3S90 A;  2BL2 A;  5AC4 A;  1JRA A;  2NUT B;  4EKW A;  1N1C A;  4I44 A;  1OCZ C;  3A9C A;  3UMH A;  2ZXP A;  1DOV A;  4BJ5 C;  2DYR C;  3LLI A;  5FCL A;  3TJ5 A;  4K0D A;  2A6E F;  2E87 A;  1ST6 A;  3LS1 A;  4E0I A;  3B29 A;  2ETS A;  2OEX A;  3U9J A;  1OR2 A;  3C8Z A;  2G62 A;  3LEO A;  4U9E A;  5JS5 A;  4LLE A;  2WL8 A;  4RDA A;  4ONS A;  2QNL A;  1LE2 A;  3ITF A;  1A41 A;  2W4M A;  4YT8 A;  2W9Y A;  1PCX A;  4FX5 A;  4H4K C;  1T5O A;  2ASR A;  1HE9 A;  4DRH B;  1YA7 O;  3E9V A;  3RFY A;  4LDR A;  4N6C A;  2PFD A;  1HW2 A;  4OIN F;  2D5R B;  2OG2 A;  1LPE A;  2PF4 E;  3A11 A;  3M1C B;  5COM A;  3VYW A;  1BR1 A;  2QY9 A;  2I8B A;  4WAB A;  2VAS A;  3RVY A;  1CGO A;  1FMW A;  2XXA A;  1W2W A;  2LD6 A;  4U5E E;  2KJG A;  3JRM O;  5KYY A;  4G7Z F;  2LFD A;  2R7S A;  4KC9 A;  2EPO A;  3WOD F;  3RIP A;  3FHD A;  5L0F A;  3DI5 A;  1ORJ A;  2YRF A;  1JAF A;  1Q0K A;  2NSG A;  3LNR A;  3Q6M A;  4AL1 A;  1R5I D;  2VCB A;  5T1D B;  1HMD A;  4BEJ A;  1OKK A;  1Z23 A;  1MNE A;  4JTA B;  2GA0 A;  5JLI A;  1U0B B;  2LCH A;  2F22 A;  3ASN C;  5L0C A;  1TR2 A;  1XZQ A;  2Y69 C;  2XRH A;  2EIJ C;  2R7T A;  1KTM A;  4CS9 C;  5BQH A;  2GFH A;  4PR9 A;  4E7Z A;  4IJJ A;  2ZXR A;  4NTB A;  2PBE A;  2P6V A;  4Z9H A;  3OEO A;  4R32 A;  1VLS A;  3ZVR A;  3JT1 A;  4BPM A;  1OKK D;  5HV9 A;  2CYD A;  3U8P A;  4IWB A;  1QPU A;  5JRA A;  3IQT A;  4MVO A;  3ZWI A;  1OXK A;  2MYS A;  4JUR I;  4O7G A;  3LJB A;  4GYT A;  2WZL A;  3G50 A;  4PJL A;  3MFN A;  1VMA A;  3U2M A;  1WAS A;  1M2O A;  1YJG A;  3Q7L A;  1D0Y A;  1EA8 A;  1Z63 A;  4BJ6 C;  2QE9 A;  3ZG1 A;  1ZHT A;  4LLC A;  3AG2 C;  5DVW A;  5AGF A;  3V5Y A;  4U5F E;  1S05 A;  3UNG C;  2NUP A;  4OIP F;  2UUI A;  3TQO A;  3W2W A;  1G4U S;  3GEE A;  4LDQ A;  2D4U A;  5KYU B;  4L6R A;  3EFO B;  2YZS A;  5KYX B;  3GOD A;  4XEK A;  3EG9 A;  4WGZ A;  3JYY A;  4M63 A;  5COG A;  3V5X A;  1ZW2 A;  4I1M A;  3H65 A;  2JPU A;  4YK5 A;  1LKX A;  2Y39 A;  3JSE O;  4MND A;  2XLV A;  1T01 A;  3RQF A;  1OW7 A;  4AE4 A;  3FAJ A;  1A7V A;  3NMI A;  3DMD A;  1LIH A;  4J7Y A;  1E2X A;  3FXH A;  1YDI A;  2XL6 A;  3IQ5 A;  4YWQ A;  1MMD A;  5DLJ A;  4BJ5 A;  5F5F A;  1PV3 A;  5KYW B;  2VC9 A;  1NU9 C;  5A6A A;  2H7B A;  3PDM P;  4YN0 B;  2XLH A;  3ATP A;  3N24 A;  1D1A A;  4YL3 A;  1OW6 A;  5FZT A;  2JX0 A;  3DXJ F;  1XZP A;  4U5G A;  2YHS A;  1TFK B;  3X2Q C;  1ZVZ A;  256B A;  2Q3T A;  2X51 A;  4XLN F;  2O9X A;  3DKA A;  3NYJ A;  4U9D A;  4MTO A;  2WVO A;  1PD0 A;  4IB4 A;  2HV7 A;  2OU6 A;  2Q9A A;  3WAQ A;  1E86 A;  2NSF A;  2HJ3 A;  3EHN A;  3JRT A;  4MW3 A;  2V3C C;  4KI2 A;  1T6Q A;  4DJ9 A;  1VLT A;  3ZIB A;  1ZHZ A;  1ZHW A;  1Q0M A;  3L34 A;  4HFF B;  4E18 A;  3HLZ A;  1YVI A;  1YZA A;  5F28 E;  4CSA C;  3AQC A;  4CS8 C;  4MVU A;  1IZM A;  2IXO A;  4CDY A;  4C3D A;  3B0U X;  5DS6 A;  1NFN A;  3NKD A;  5L0G A;  4ZLC A;  4NY3 A;  3DM5 A;  3S27 A;  1UFB A;  3AJM A;  3SXK A;  5DQZ A;  3KPH A;  3LES A;  4DVY P;  1E83 A;  4XQ1 A;  3ABM C;  2EIM C;  2GDC A;  3F46 A;  4YT5 A;  3SXM A;  4C7O A;  4EUK B;  2M4E A;  2OCC C;  1Q0G A;  1RKE B;  1MQV A;  2A1D D;  3K6B A;  4D4N A;  1A7D A;  4O6N A;  2R9R B;  4PJM A;  4E0H A;  4YL0 A;  4YL1 A;  3QMK A;  3AG1 C;  4JJG A;  4PFP A;  1M57 C;  1RJ9 B;  2J8W A;  3W2V A;  1FFT C;  2OJE D;  3B0P A;  2G3V A;  1NLX A;  3IPM O;  3R7C A;  2TMV P;  2L81 A;  4JTC B;  5IY5 C;  3HNJ A;  4G7H F;  4EBJ A;  3AQB A;  3JZ0 A;  3ZDL A;  1CPQ A;  5DS4 A;  4FAP B;  1Q0D A;  2QTV A;  3T6G B;  4JRZ A;  4U5C E;  2W4B A;  2ICW G;  3JTL O;  4JVS A;  4CDA A;  2EIN C;  2ZPA A;  4W8P A;  3C8G A;  2YLI A;  4FES A;  1YAR O;  4P9F A;  5B3S C;  1ZU4 A;  3F47 A;  2XXA B;  4XEV A;  1OXB A;  1WAT A;  1JOG A;  5CIV A;  3U0C A;  1MMG A;  1CGN A;  2HSQ A;  3G4Z A;  2CCY A;  2YQY A;  2Q7R A;  3CAX A;  1V4A A;  3AG4 C;  4UDV A;  3C8G D;  1NBB A;  5KYN A;  3US6 A;  1JR8 A;  3HKK A;  1D1C A;  1C02 A;  1T6I A;  2JD3 A;  2XM4 A;  3C7J A;  2QLA A;  2HV6 A;  5A6K A;  2EPL X;  2XL8 A;  1AVO B;  5COF A;  1WGW A;  3IQC A;  3VRC A;  2KW3 C;  2GWW A;  4YT2 A;  2P1A A;  3S9O A;  2YVK A;  3LS0 A;  3DE8 A;  2WB7 A;  5EHH A;  1E84 A;  3CEX A;  1KNY A;  2KK1 A;  2AWC A;  1RXQ A;  3NDB B;  1LI7 A;  4JC7 A;  5L0I A;  1FNT c;  2WVN A;  4IGG A;  3SXZ A;  2HUJ A;  2J7P A;  1NG1 A;  3IQ6 A;  5A6B A;  4NQF A;  5B1B C;  4DXW A;  5CI8 A;  4J32 B;  3EGD A;  2IBF A;  3KMI A;  2EPN A;  4Q7C A;  2YL3 A;  1E85 A;  3TUL A;  4EIY A;  2L9J A;  4BJT A;  3PHF 2;  1ORS C;  3J06 A;  3S84 A;  1YLM A;  4K1O A;  1U89 A;  4JTD B;  4CJO A;  3UMI A;  5JUA A;  2J7P D;  2IM8 A;  3DJU B;  3NRH A;  1AUE A;  3RKO F;  1KU2 A;  2QUP A;  3SP1 A;  3T6B A;  2I15 A;  2DI3 A;  3W8I A;  2Q9C A;  1MND A;  2LIG A;  2PNO A;  4ULV A;  2HMZ A;  3KYI A;  4KNV A;  1IW7 F;  1OCC C;  1TWH A;  5D92 A;  2R7Q A;  3ABL C;  4HFK B;  4MVM A;  4LAC B;  3T4R A;  2HZ8 A;  3TJ6 A;  3TOM A;  4MQ9 F;  2B0J A;  4A4A A;  4F4B A;  3T9O A;  1T9K A;  5KYY B;  1GQA A;  1O3U A;  3KKB A;  2J9U A;  2WZG A;  2EIK C;  2KQ9 A;  1S7Z A;  2R02 A;  3M4B A;  4O6Y A;  5TJ5 E;  1G5Z A;  1VOM A;  1LS4 A;  2RSE B;  2DYS C;  3IEE A;  4PJJ A;  1K05 A;  1Z6A A;  2G3K A;  3DJN B;  1K04 A;  3ZTM A;  1RCP A;  3NKE A;  4ZLD A; 
#chains in the Genus database with same CATH homology
 1GS9 A;  1AEP A;  1H7I A;  1NFN A;  1YA9 A;  3R2P A;  1EA8 A;  1B68 A;  1BZ4 A;  1OR2 A;  2KC3 A;  1LE4 A;  1LE2 A;  1NFO A;  1OR3 A;  1EQ1 A;  1LS4 A;  1LPE A;  3S84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...