3S84A

Dimeric apoa-iv
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
239
structure length
239
Chain Sequence
DSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apolipoprotein A-IV
publication title The Structure of Dimeric Apolipoprotein A-IV and Its Mechanism of Self-Association.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 101
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 3s84A02
1LE4A 2KC3A 1H7IA 1LE2A 1BZ4A 1OR2A 1B68A 3R2PA 1LPEA 1OR3A 3S84A 1AEPA 1EQ1A 1EA8A 1NFNA 1LS4A 1YA9A 1NFOA 1GS9A
chains in the Genus database with same CATH superfamily
1BR2A 4K1OA 3LJBA 2WZLA 3K1IC 3SXKA 1YAUO 3S28A 2OCCC 2F22A 1CPQA 1FR0A 1Y4CA 1G4WR 4FWVA 2A69F 1JMWA 1TR2A 3DWWA 2VCBA 4G0HA 4WJ0A 1CGME 4I44A 2QE9A 2CW0F 2VCCA 2XL8A 256BA 4JJGA 4OD5A 3RW0A 3TOMA 1MNEA 1ZW2A 2AVKA 2HMZA 2YWAA 4XEFA 1YYJA 3G50A 5KYWA 1TFOB 1NG1A 1OXBA 2KQ9A 4NC3A 5COMA 3T9OA 3S84A 2PX3A 3U0CA 2HSQA 1LIHA 2R25A 1YA7O 4DRHB 4PACA 3U9JA 3ABMC 3CAXA 2P0NA 1QVXA 2XM4A 4WGYA 3EFOA 1VYKA 3JTLO 4RBNA 2YLDA 2NUTA 2OEVA 3IEEA 2DGJA 1AUEA 3O10A 2EIJC 4JCZA 2ZXRA 3Q7GA 2IM8A 1SF8A 2Y3HA 4K0DA 2ICWG 3PMRA 3QMKA 1MMAA 2ZPAA 3JRMO 3KYJA 2X0CA 1EI7A 2GFHA 5A6JA 4LERA 1MQVA 3FOOA 3OA1A 4HEAJ 4AX2A 4PJNA 4U9DA 1ZU5A 2J7PA 2Y39A 3DZAA 4PJMA 5DLJA 4BJ6C 1QPUA 2A6HF 3ZC4A 4DBQA 1ST6A 2IXOA 1RXQA 3FAJA 4OIOF 1NBBA 3HTKC 1J8YF 3NYLA 1NSGB 3TK0A 3CSKA 1NLXA 4XWJA 2MYSA 2Q7RA 4K7BA 4C3DA 3DXJF 3GORA 4DJ9A 3AGTA 3A9CA 4Z9JA 2XRHA 1NFOA 2NPUA 4YL1A 2BE5F 1T01A 1VK5A 1MMGA 2YRFA 1I5NA 4H4KC 4PFPA 4ULVA 3LUTB 5COFA 2JD3A 2KC3A 4O6NA 3U3BA 1K04A 2DB4A 1E85A 2V3CC 1T5OA 1A7DA 2LIGA 3QVYA 3SYNA 2LCHA 2R7TA 3S90A 2Q9AA 4L6RA 1EKYA 1WOLA 3KH2A 2EIKC 1A41A 3PHF2 2MWQA 2HS5A 1HE9A 1HW1A 3IHUA 4CBEA 1YZCA 1LPEA 1CGOA 4U5DE 1Y6DA 4NTAA 4XEVA 2CNWD 5L3QA 3UGOA 4ZLDA 3QW0A 3V5ZA 1FFTC 4XPXA 1GQAA 2RSEB 2P1AA 3AG4C 4DXWA 1YA9A 2WZFA 3AG2C 2H7BA 2LP4A 4JCHA 5AGFA 4J30B 1HY5A 3AG3C 1FAPB 4ULWA 3AJMA 4P9FA 2TMVP 1D1CA 4EWCA 1LKXA 5A6KA 4W8KA 2X51A 2QLAA 4PK4A 1PCXA 3GEIA 3S9OA 1LI7A 4EBKA 5BQHA 4G7ZF 2YEVA 3B29A 3C63A 3R7CA 4BJ6A 1APCA 3O55A 4XLNF 5A6BA 3DD7A 4EBJA 5TJ5E 4BJ1A 4R32A 4C7OB 3B9QA 4WGZA 3TOLA 3W8HA 2XSEA 1VLSA 3EFOB 1KTMA 4HFKB 1O3UA 3ABLC 2NUTB 3HNKA 4MTFA 4MVOA 2PFDA 3AGUA 4I1MA 4YK5A 3C8GB 4U9EA 2JPUA 5DVWA 5JLIA 4CSAC 2XXAA 3EGDA 3FHDA 3ITFA 1ZHTA 4EUKB 3IQ6A 1MMDA 2OJQA 2AWYA 1ORJA 2IBFA 1PD1A 3OWTA 3PCVA 5CI8A 3RIPA 4ZLCA 3TJ5A 1YJGA 1ZHXA 2A0BA 4MW8A 1RKEB 1SMYF 1UG7A 1JPNA 2AWCA 2GAQA 4LLEA 1OCZC 5L0IA 3NDBB 1ZZPA 2GA0A 2UUHA 3KYIA 5CIVA 4BJ5C 3ZDLA 3DJNB 1XWJA 4J32B 3ZQYA 3UGPA 2ZXOA 1T6IA 2C04A 2YHSA 2OU6A 2DYSC 3DM5A 4JVSA 1M6TA 5COGA 5EGYA 2EPMX 2EPOA 4JTDB 4DRJB 2WVOA 3EQLF 1A7VA 3SZRA 1V55C 2W4MA 3SXMA 2LQGA 4U5HA 3SXYA 5EK0A 5L0DA 2L6FA 5HV9A 3WAQA 4C3EA 4JURI 1NU7D 4IAOA 1KU2A 2HFIA 2R7WA 5E3CA 4YN0B 2W4BA 2YKZA 4D4XA 2Y3BA 1OKKA 1BR1A 2I15A 1JRAA 1YARO 4IARA 4CDVA 1VTMP 1GM5A 4DOZA 1G4US 1JPJA 1H7IA 1LE2A 1VB5A 1TWAA 2DYRC 3I5PA 4LDRA 5A69A 3EHMA 2YL0A 4HE8D 4U5CE 3LEOA 3KKBA 2YQYA 1W2WA 3EH2A 2JX0A 3U8PA 4KI2A 2BC5A 3ASNC 4EIYA 1JOGA 3Q6MA 2WL8A 3AQCA 1JAFA 2OKUA 2Y69C 2C03A 2EILC 3ZQVA 4CSAA 1T6QA 4E18A 2KK1A 3HKKA 3RQGA 3JSEO 4QI2A 3JRTA 1Z23A 3DKAA 4ONSA 1ZW3A 1QQ3A 5F5HA 4JKVA 4BJTA 2MHRA 4EHPA 3ZTMA 3KPHA 3BRJA 5HSWA 1LVKA 3MYFA 4C7OA 3E9VA 1C17M 3G4XA 3GANA 3ZSUA 2L9JA 2A0UA 3GM3A 1TKNA 1OW7A 3I4UA 2CDQA 3ZWIA 4BJ5A 3T6GB 5DQTA 3RQFA 5KYYB 4XTKA 4MTOA 4XPYA 3C8GA 4OIQF 4NCQA 2IXNA 3DI5A 3MX3A 5KYXB 3NKDA 3QVZA 2H7VC 3RH3A 2LFDA 4JC7A 3AOUA 4JE9A 2XXAB 1A0BA 1RKCA 4O6YA 3EGDB 1OCOC 3NYMA 4PJJA 2M64A 1ZVZA 3BEHA 4FAPB 1YLMA 1VOMA 1RKEA 1TWHA 2R9RB 1JR8A 3RVZA 3UNGC 3GWNA 3T6BA 2B0HA 2XLVA 1C03A 1BDJB 1I4ZA 3RF3A 2J9UA 1M2VB 3KL4A 4JIOA 3JYYA 3VRCA 3W2WA 5L3VA 4XQ1A 3JCUQ 4J7YA 2J46A 3IQCA 5D91A 2Y3DA 1M2OA 4IJJA 3EJNA 3LAYA 1RJ9A 5JT4A 1M56C 4CDYA 5FCLA 3EGXB 1Q0KA 1H6GA 4DBRA 3B0UX 1D1AA 1I4YA 1S7ZA 5A6AA 3FVYA 2R7UA 5JP7A 4G7HF 2IYLD 4F4BA 5KYNA 2Q4FA 2AU5A 3EG9A 3GM1A 1HMDA 4AE4B 3US6A 2PBEA 1N1CA 4Q4ZF 3JT1A 1J8MF 1QZXA 3M1CB 2YL1A 3DE9A 1WASA 5JUAA 5B1BC 4AK9A 3DAGA 3MFNA 4MVMA 2EPKX 2P6VA 2XL4A 3CEXA 2XLWA 4YJWA 4YT4A 2QNLA 4E0IA 4KNWA 2J0XA 3LESA 3T4RA 1D0XA 2LK4A 3M4CA 4U5EE 2Z15A 3O39A 5KYUA 5DQZA 3B0VC 2DI3A 1L7CA 2WB7A 3RYLA 3X2QC 2OQMA 2EIMC 2D5RB 2VC9A 2XLEA 3PDMP 3JSZA 1G5ZA 2WVNA 4O79A 2R7VA 2H8AA 4MQ9F 1FMWA 3SXZA 4CX9A 5JS5A 1OR2A 1OQCA 1YYXA 2HUJA 2KW3C 3TJ6A 3U9MA 2EPNA 3ATPA 1ZYRF 4LACB 1FFHA 1AVOB 1OXKA 4QI0A 5L0CA 2GWWA 4MVUA 5DS4A 2NUPB 3LEVA 1CPRA 1TQGA 1RCPA 4O7GA 3H65A 4RD9A 5GPGB 5DS5A 4BPMA 4E17A 1O87A 2J0WA 4MVZA 1QLEC 5KYYA 1OR3A 3WODF 1VYIA 1E2XA 4KC9A 4MVQA 4Z9HA 3JYHA 1Q0FA 3L1MA 3EZIA 4QDLA 4YT2A 3U2MA 3FDQA 4A4AA 1AEPA 4CIPA 2OOCA 2RD9A 3VAYA 5KYXA 4KNVA 1U6HA 4UDVA 2J9WA 3LNRA 5AC5A 3C62A 3ZTZA 2CGEA 3K7DA 1U89A 4NTBA 1HE1A 2W9YA 4I1OB 3TQOA 4BG0A 2J9BA 2IXMA 2FAPB 3RVYA 1L3PA 3IQTA 4BEMJ 2Q3TA 1V4AA 5BQGA 4PJLA 1B68A 3ZVRA 3ZG1A 1M2VA 4AL0A 4CIHA 1Z63A 4YL3A 3QZCA 2KYHA 1SYQA 3HJCA 3L8JA 3HNJA 3V5YA 2J45A 1OCRC 3S29A 2A6EF 2IXPA 4YT8A 4XLPF 1ORYA 3EGXA 3L8IA 1R4TA 1RJ9B 3K6BA 3KMIA 5B3IA 2YL7A 5B1AC 3X1OA 2OG2A 2UUIA 4GYTA 1SZIA 3EZHA 3QW1A 3DJUB 1NFNA 2PF4E 3H2UA 4ANJA 3JZ0A 1E83A 3N0TA 4AE4A 1PD0A 2H7OA 1Z3IX 3AG1C 2R7QA 4JEBA 4M63A 4U5BE 4CDAA 1A7EA 2L81A 3EG9B 3G4ZA 4CJOA 4CS8C 3VYWA 5B3SC 2VCAA 1WATA 4P6IC 1E86A 2A68F 3LLKA 3MLGA 4E7ZA 4H54A 1FTSA 4MW3A 4O6MA 2KSFA 3EPVA 1VMAA 4J7TA 2PP4A 3DMDA 1IW7F 1TWCA 4KBLA 3V5XA 1HW2A 1O5HA 1Z6AA 3OEOA 1BBHA 4N6HA 2R7OA 3QTHA 1DOWA 4AL1A 3U2LA 4E0HA 3HNLA 5EHHA 5KYUB 2QTVA 4NY3A 4NQFA 5JVEA 5F5FA 3FAPB 2WVQA 5JSLA 3HNIA 1FNTc 2R7RA 4JZAA 3POVA 2EPLX 4GEHA 2NUPA 5K0IA 5L0GA 4G7OF 1QKRA 2VASA 5JRAA 1GS9A 1KNYA 2KNHA 4JRZA 1G8XA 1ZU4A 4OD4A 5F28E 2V26A 1F1MA 4EKWA 2XLDA 3ASOC 3HLZA 2ETSA 2XS8A 4EBBA 1BZ4A 4X0RA 1RMVA 2E87A 3NRHA 3L0IA 4JTCB 3S27A 4ER9A 3VM6A 3RFYA 3C8GD 2ASRA 2ZXWC 1D0ZA 2XLHA 3Q7LA 2FGYA 3IPMO 1OCCC 3SNHA 2HMQA 2KJGA 3T6JA 4JJFA 3EH1A 2Q00A 2J7PD 1E84A 1PV3A 3C7JA 2ZD9A 2CCYA 4YL0A 1K40A 2WZGA 3I5QA 2OJED 2QY9A 4CS8A 4YWQA 3C8ZA 2Y3GA 5T1DB 3F46A 4A2NB 3GODA 1ORSC 1V74B 1WN0A 2L6HA 1D0YA 4IGGA 3ZIBA 3O6XA 1LE4A 3N24A 5E2QA 1UFBA 3L34A 3IQ5A 5AC4A 2P7VA 1SR2A 2HKVA 2GDCA 2PX0A 3GWLA 2HJ3A 3B71A 3N2ZB 3NMJA 4FX5A 4G78A 4NTFA 1IZMA 3NMKA 1R5ID 3VF0A 2HSBA 4DVZA 2XLMA 4BEJA 1YZAA 1LI5A 5T3TA 1H9GA 4OINF 3M79A 4PR9A 4IRUA 4N6CA 4CS9C 1V54C 4I3MA 4OIPF 1C02A 1XZPA 4PFOA 2IOQA 1GGQA 4MS2A 1MNDA 1YDIA 2P61A 5E3AA 2R7XA 1ZHYA 3K1IA 4MNDA 1S05A 4U5FE 3GEHA 3M15A 1H9TA 4GQHA 3W8IA 2W45A 3K33A 2R02A 2I8BA 3K66A 3UR3C 5DS6A 2R03A 1K05A 3NG1A 3S0XA 2Q9CA 4YT5A 3DM9B 1Q0MA 2YVKA 1LM3B 1XZQA 3GM2A 3K1HA 3E70C 2L6GA 1T6UA 2LFFA 5D92A 3W4YA 2VB6A 3CQZA 3U5SA 4Z9IA 4Q7CA 1NU9C 2XL6A 2CYDA 1CGNA 4IB4A 5A6BD 3TD7A 1FMVA 3UMKA 2CNWA 2HJMA 3ABKC 1M57C 1OW8A 2YLGA 3FXHA 2NSFA 4W8PA 2NSGA 2BL2A 5L0FA 3H2VA 1LS1A 4CS7A 1U0BB 1VLTA 1EA8A 1EQ1A 3Q6NA 1Q0DA 2XS1A 1TFKB 3EHNA 4HFFB 1Z7Qc 1DOVA 2OEXA 2PNOA 5L0JA 2G3VA 4LDKA 2D4UA 5KYWB 4U5GA 1TWGA 4OIRF 4MVSA 1QSPA 2L7AA 2O9XA 4CJGA 4LDQA 4C3BA 5L0HA 1WWPA 1YVIA 1Z5ZA 4MTGA 4WABA 4CS9A 2LSEA 3LNMB 4IAQA 2NG1A 4JEAA 4N06A 3FMSA 2G3KA 5FZTA 3NYJA 2J8WA 3NKEA 5T3WA 1WGWA 3RQEA 4DVYP 3B0PA 3UMIA 5BQIA 4N4WA 3M4BA 1BR4A 4FESA 3WHNA 3F47A 2HZ8A 1Q0GA 2J9VA 3LLIA 3LS0A 4XEKA 1LS4A 3U8VA 4Q5SF 2YZSA 3RKOF 1NZEA 2HV7A 5E33A 3AQBA 3SEOA 2QUPA 4JW1A 5IY5C 3A11A 1OKKD 2FFHA 2YL3A 3NMIA 2M4EA 4RDAA 1D1BA 1T9KA 2LD6A 5BUOA 3UMHA 4DRIB 2EINC 2XM0A 3V7OA 2R7SA 4D4NA 1OW6A 2Q9BA 3SP1A 4MVRA 4B6IA 3TULA 3J06A 3FOPA 3R2PA 4P9TA 2VH3A 3LS1A 4XPWA 2B0JA 3DAFA 2ZXPA 3WG7C 4IWBA 3ECSA 4LLCA 3U3FA 5CI9A 1ZHZA 3C18A 2AP3A 4E7SA 1MMNA 2YLIA 3W2VA 2G62A 2XLOA 3MBGA 4JTAB 2R05A 3CZ6A 3DE8A 2HV6A 1WTYA 2KGOA 1HMOA 3MYIA 2A1DD 3GEEA 1ZHWA
chains in the Genus database with same CATH topology
1LE4A 2KC3A 1H7IA 1LE2A 1BZ4A 1OR2A 1B68A 3R2PA 1LPEA 1OR3A 3S84A 1AEPA 1EQ1A 1EA8A 1NFNA 1LS4A 1YA9A 1NFOA 1GS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LE4 A;  2KC3 A;  1H7I A;  1LE2 A;  1BZ4 A;  1OR2 A;  1B68 A;  3R2P A;  1LPE A;  1OR3 A;  3S84 A;  1AEP A;  1EQ1 A;  1EA8 A;  1NFN A;  1LS4 A;  1YA9 A;  1NFO A;  1GS9 A; 
#chains in the Genus database with same CATH topology
 1BR2 A;  4K1O A;  3LJB A;  2WZL A;  3K1I C;  3SXK A;  1YAU O;  3S28 A;  2OCC C;  2F22 A;  1CPQ A;  1FR0 A;  1Y4C A;  1G4W R;  4FWV A;  2A69 F;  1JMW A;  1TR2 A;  3DWW A;  2VCB A;  4G0H A;  4WJ0 A;  1CGM E;  4I44 A;  2QE9 A;  2CW0 F;  2VCC A;  2XL8 A;  256B A;  4JJG A;  4OD5 A;  3RW0 A;  3TOM A;  1MNE A;  1ZW2 A;  2AVK A;  2HMZ A;  2YWA A;  4XEF A;  1YYJ A;  3G50 A;  5KYW A;  1TFO B;  1NG1 A;  1OXB A;  2KQ9 A;  4NC3 A;  5COM A;  3T9O A;  3S84 A;  2PX3 A;  3U0C A;  2HSQ A;  1LIH A;  2R25 A;  1YA7 O;  4DRH B;  4PAC A;  3U9J A;  3ABM C;  3CAX A;  2P0N A;  1QVX A;  2XM4 A;  4WGY A;  3EFO A;  1VYK A;  3JTL O;  4RBN A;  2YLD A;  2NUT A;  2OEV A;  3IEE A;  2DGJ A;  1AUE A;  3O10 A;  2EIJ C;  4JCZ A;  2ZXR A;  3Q7G A;  2IM8 A;  1SF8 A;  2Y3H A;  4K0D A;  2ICW G;  3PMR A;  3QMK A;  1MMA A;  2ZPA A;  3JRM O;  3KYJ A;  2X0C A;  1EI7 A;  2GFH A;  5A6J A;  4LER A;  1MQV A;  3FOO A;  3OA1 A;  4HEA J;  4AX2 A;  4PJN A;  4U9D A;  1ZU5 A;  2J7P A;  2Y39 A;  3DZA A;  4PJM A;  5DLJ A;  4BJ6 C;  1QPU A;  2A6H F;  3ZC4 A;  4DBQ A;  1ST6 A;  2IXO A;  1RXQ A;  3FAJ A;  4OIO F;  1NBB A;  3HTK C;  1J8Y F;  3NYL A;  1NSG B;  3TK0 A;  3CSK A;  1NLX A;  4XWJ A;  2MYS A;  2Q7R A;  4K7B A;  4C3D A;  3DXJ F;  3GOR A;  4DJ9 A;  3AGT A;  3A9C A;  4Z9J A;  2XRH A;  1NFO A;  2NPU A;  4YL1 A;  2BE5 F;  1T01 A;  1VK5 A;  1MMG A;  2YRF A;  1I5N A;  4H4K C;  4PFP A;  4ULV A;  3LUT B;  5COF A;  2JD3 A;  2KC3 A;  4O6N A;  3U3B A;  1K04 A;  2DB4 A;  1E85 A;  2V3C C;  1T5O A;  1A7D A;  2LIG A;  3QVY A;  3SYN A;  2LCH A;  2R7T A;  3S90 A;  2Q9A A;  4L6R A;  1EKY A;  1WOL A;  3KH2 A;  2EIK C;  1A41 A;  3PHF 2;  2MWQ A;  2HS5 A;  1HE9 A;  1HW1 A;  3IHU A;  4CBE A;  1YZC A;  1LPE A;  1CGO A;  4U5D E;  1Y6D A;  4NTA A;  4XEV A;  2CNW D;  5L3Q A;  3UGO A;  4ZLD A;  3QW0 A;  3V5Z A;  1FFT C;  4XPX A;  1GQA A;  2RSE B;  2P1A A;  3AG4 C;  4DXW A;  1YA9 A;  2WZF A;  3AG2 C;  2H7B A;  2LP4 A;  4JCH A;  5AGF A;  4J30 B;  1HY5 A;  3AG3 C;  1FAP B;  4ULW A;  3AJM A;  4P9F A;  2TMV P;  1D1C A;  4EWC A;  1LKX A;  5A6K A;  4W8K A;  2X51 A;  2QLA A;  4PK4 A;  1PCX A;  3GEI A;  3S9O A;  1LI7 A;  4EBK A;  5BQH A;  4G7Z F;  2YEV A;  3B29 A;  3C63 A;  3R7C A;  4BJ6 A;  1APC A;  3O55 A;  4XLN F;  5A6B A;  3DD7 A;  4EBJ A;  5TJ5 E;  4BJ1 A;  4R32 A;  4C7O B;  3B9Q A;  4WGZ A;  3TOL A;  3W8H A;  2XSE A;  1VLS A;  3EFO B;  1KTM A;  4HFK B;  1O3U A;  3ABL C;  2NUT B;  3HNK A;  4MTF A;  4MVO A;  2PFD A;  3AGU A;  4I1M A;  4YK5 A;  3C8G B;  4U9E A;  2JPU A;  5DVW A;  5JLI A;  4CSA C;  2XXA A;  3EGD A;  3FHD A;  3ITF A;  1ZHT A;  4EUK B;  3IQ6 A;  1MMD A;  2OJQ A;  2AWY A;  1ORJ A;  2IBF A;  1PD1 A;  3OWT A;  3PCV A;  5CI8 A;  3RIP A;  4ZLC A;  3TJ5 A;  1YJG A;  1ZHX A;  2A0B A;  4MW8 A;  1RKE B;  1SMY F;  1UG7 A;  1JPN A;  2AWC A;  2GAQ A;  4LLE A;  1OCZ C;  5L0I A;  3NDB B;  1ZZP A;  2GA0 A;  2UUH A;  3KYI A;  5CIV A;  4BJ5 C;  3ZDL A;  3DJN B;  1XWJ A;  4J32 B;  3ZQY A;  3UGP A;  2ZXO A;  1T6I A;  2C04 A;  2YHS A;  2OU6 A;  2DYS C;  3DM5 A;  4JVS A;  1M6T A;  5COG A;  5EGY A;  2EPM X;  2EPO A;  4JTD B;  4DRJ B;  2WVO A;  3EQL F;  1A7V A;  3SZR A;  1V55 C;  2W4M A;  3SXM A;  2LQG A;  4U5H A;  3SXY A;  5EK0 A;  5L0D A;  2L6F A;  5HV9 A;  3WAQ A;  4C3E A;  4JUR I;  1NU7 D;  4IAO A;  1KU2 A;  2HFI A;  2R7W A;  5E3C A;  4YN0 B;  2W4B A;  2YKZ A;  4D4X A;  2Y3B A;  1OKK A;  1BR1 A;  2I15 A;  1JRA A;  1YAR O;  4IAR A;  4CDV A;  1VTM P;  1GM5 A;  4DOZ A;  1G4U S;  1JPJ A;  1H7I A;  1LE2 A;  1VB5 A;  1TWA A;  2DYR C;  3I5P A;  4LDR A;  5A69 A;  3EHM A;  2YL0 A;  4HE8 D;  4U5C E;  3LEO A;  3KKB A;  2YQY A;  1W2W A;  3EH2 A;  2JX0 A;  3U8P A;  4KI2 A;  2BC5 A;  3ASN C;  4EIY A;  1JOG A;  3Q6M A;  2WL8 A;  3AQC A;  1JAF A;  2OKU A;  2Y69 C;  2C03 A;  2EIL C;  3ZQV A;  4CSA A;  1T6Q A;  4E18 A;  2KK1 A;  3HKK A;  3RQG A;  3JSE O;  4QI2 A;  3JRT A;  1Z23 A;  3DKA A;  4ONS A;  1ZW3 A;  1QQ3 A;  5F5H A;  4JKV A;  4BJT A;  2MHR A;  4EHP A;  3ZTM A;  3KPH A;  3BRJ A;  5HSW A;  1LVK A;  3MYF A;  4C7O A;  3E9V A;  1C17 M;  3G4X A;  3GAN A;  3ZSU A;  2L9J A;  2A0U A;  3GM3 A;  1TKN A;  1OW7 A;  3I4U A;  2CDQ A;  3ZWI A;  4BJ5 A;  3T6G B;  5DQT A;  3RQF A;  5KYY B;  4XTK A;  4MTO A;  4XPY A;  3C8G A;  4OIQ F;  4NCQ A;  2IXN A;  3DI5 A;  3MX3 A;  5KYX B;  3NKD A;  3QVZ A;  2H7V C;  3RH3 A;  2LFD A;  4JC7 A;  3AOU A;  4JE9 A;  2XXA B;  1A0B A;  1RKC A;  4O6Y A;  3EGD B;  1OCO C;  3NYM A;  4PJJ A;  2M64 A;  1ZVZ A;  3BEH A;  4FAP B;  1YLM A;  1VOM A;  1RKE A;  1TWH A;  2R9R B;  1JR8 A;  3RVZ A;  3UNG C;  3GWN A;  3T6B A;  2B0H A;  2XLV A;  1C03 A;  1BDJ B;  1I4Z A;  3RF3 A;  2J9U A;  1M2V B;  3KL4 A;  4JIO A;  3JYY A;  3VRC A;  3W2W A;  5L3V A;  4XQ1 A;  3JCU Q;  4J7Y A;  2J46 A;  3IQC A;  5D91 A;  2Y3D A;  1M2O A;  4IJJ A;  3EJN A;  3LAY A;  1RJ9 A;  5JT4 A;  1M56 C;  4CDY A;  5FCL A;  3EGX B;  1Q0K A;  1H6G A;  4DBR A;  3B0U X;  1D1A A;  1I4Y A;  1S7Z A;  5A6A A;  3FVY A;  2R7U A;  5JP7 A;  4G7H F;  2IYL D;  4F4B A;  5KYN A;  2Q4F A;  2AU5 A;  3EG9 A;  3GM1 A;  1HMD A;  4AE4 B;  3US6 A;  2PBE A;  1N1C A;  4Q4Z F;  3JT1 A;  1J8M F;  1QZX A;  3M1C B;  2YL1 A;  3DE9 A;  1WAS A;  5JUA A;  5B1B C;  4AK9 A;  3DAG A;  3MFN A;  4MVM A;  2EPK X;  2P6V A;  2XL4 A;  3CEX A;  2XLW A;  4YJW A;  4YT4 A;  2QNL A;  4E0I A;  4KNW A;  2J0X A;  3LES A;  3T4R A;  1D0X A;  2LK4 A;  3M4C A;  4U5E E;  2Z15 A;  3O39 A;  5KYU A;  5DQZ A;  3B0V C;  2DI3 A;  1L7C A;  2WB7 A;  3RYL A;  3X2Q C;  2OQM A;  2EIM C;  2D5R B;  2VC9 A;  2XLE A;  3PDM P;  3JSZ A;  1G5Z A;  2WVN A;  4O79 A;  2R7V A;  2H8A A;  4MQ9 F;  1FMW A;  3SXZ A;  4CX9 A;  5JS5 A;  1OR2 A;  1OQC A;  1YYX A;  2HUJ A;  2KW3 C;  3TJ6 A;  3U9M A;  2EPN A;  3ATP A;  1ZYR F;  4LAC B;  1FFH A;  1AVO B;  1OXK A;  4QI0 A;  5L0C A;  2GWW A;  4MVU A;  5DS4 A;  2NUP B;  3LEV A;  1CPR A;  1TQG A;  1RCP A;  4O7G A;  3H65 A;  4RD9 A;  5GPG B;  5DS5 A;  4BPM A;  4E17 A;  1O87 A;  2J0W A;  4MVZ A;  1QLE C;  5KYY A;  1OR3 A;  3WOD F;  1VYI A;  1E2X A;  4KC9 A;  4MVQ A;  4Z9H A;  3JYH A;  1Q0F A;  3L1M A;  3EZI A;  4QDL A;  4YT2 A;  3U2M A;  3FDQ A;  4A4A A;  1AEP A;  4CIP A;  2OOC A;  2RD9 A;  3VAY A;  5KYX A;  4KNV A;  1U6H A;  4UDV A;  2J9W A;  3LNR A;  5AC5 A;  3C62 A;  3ZTZ A;  2CGE A;  3K7D A;  1U89 A;  4NTB A;  1HE1 A;  2W9Y A;  4I1O B;  3TQO A;  4BG0 A;  2J9B A;  2IXM A;  2FAP B;  3RVY A;  1L3P A;  3IQT A;  4BEM J;  2Q3T A;  1V4A A;  5BQG A;  4PJL A;  1B68 A;  3ZVR A;  3ZG1 A;  1M2V A;  4AL0 A;  4CIH A;  1Z63 A;  4YL3 A;  3QZC A;  2KYH A;  1SYQ A;  3HJC A;  3L8J A;  3HNJ A;  3V5Y A;  2J45 A;  1OCR C;  3S29 A;  2A6E F;  2IXP A;  4YT8 A;  4XLP F;  1ORY A;  3EGX A;  3L8I A;  1R4T A;  1RJ9 B;  3K6B A;  3KMI A;  5B3I A;  2YL7 A;  5B1A C;  3X1O A;  2OG2 A;  2UUI A;  4GYT A;  1SZI A;  3EZH A;  3QW1 A;  3DJU B;  1NFN A;  2PF4 E;  3H2U A;  4ANJ A;  3JZ0 A;  1E83 A;  3N0T A;  4AE4 A;  1PD0 A;  2H7O A;  1Z3I X;  3AG1 C;  2R7Q A;  4JEB A;  4M63 A;  4U5B E;  4CDA A;  1A7E A;  2L81 A;  3EG9 B;  3G4Z A;  4CJO A;  4CS8 C;  3VYW A;  5B3S C;  2VCA A;  1WAT A;  4P6I C;  1E86 A;  2A68 F;  3LLK A;  3MLG A;  4E7Z A;  4H54 A;  1FTS A;  4MW3 A;  4O6M A;  2KSF A;  3EPV A;  1VMA A;  4J7T A;  2PP4 A;  3DMD A;  1IW7 F;  1TWC A;  4KBL A;  3V5X A;  1HW2 A;  1O5H A;  1Z6A A;  3OEO A;  1BBH A;  4N6H A;  2R7O A;  3QTH A;  1DOW A;  4AL1 A;  3U2L A;  4E0H A;  3HNL A;  5EHH A;  5KYU B;  2QTV A;  4NY3 A;  4NQF A;  5JVE A;  5F5F A;  3FAP B;  2WVQ A;  5JSL A;  3HNI A;  1FNT c;  2R7R A;  4JZA A;  3POV A;  2EPL X;  4GEH A;  2NUP A;  5K0I A;  5L0G A;  4G7O F;  1QKR A;  2VAS A;  5JRA A;  1GS9 A;  1KNY A;  2KNH A;  4JRZ A;  1G8X A;  1ZU4 A;  4OD4 A;  5F28 E;  2V26 A;  1F1M A;  4EKW A;  2XLD A;  3ASO C;  3HLZ A;  2ETS A;  2XS8 A;  4EBB A;  1BZ4 A;  4X0R A;  1RMV A;  2E87 A;  3NRH A;  3L0I A;  4JTC B;  3S27 A;  4ER9 A;  3VM6 A;  3RFY A;  3C8G D;  2ASR A;  2ZXW C;  1D0Z A;  2XLH A;  3Q7L A;  2FGY A;  3IPM O;  1OCC C;  3SNH A;  2HMQ A;  2KJG A;  3T6J A;  4JJF A;  3EH1 A;  2Q00 A;  2J7P D;  1E84 A;  1PV3 A;  3C7J A;  2ZD9 A;  2CCY A;  4YL0 A;  1K40 A;  2WZG A;  3I5Q A;  2OJE D;  2QY9 A;  4CS8 A;  4YWQ A;  3C8Z A;  2Y3G A;  5T1D B;  3F46 A;  4A2N B;  3GOD A;  1ORS C;  1V74 B;  1WN0 A;  2L6H A;  1D0Y A;  4IGG A;  3ZIB A;  3O6X A;  1LE4 A;  3N24 A;  5E2Q A;  1UFB A;  3L34 A;  3IQ5 A;  5AC4 A;  2P7V A;  1SR2 A;  2HKV A;  2GDC A;  2PX0 A;  3GWL A;  2HJ3 A;  3B71 A;  3N2Z B;  3NMJ A;  4FX5 A;  4G78 A;  4NTF A;  1IZM A;  3NMK A;  1R5I D;  3VF0 A;  2HSB A;  4DVZ A;  2XLM A;  4BEJ A;  1YZA A;  1LI5 A;  5T3T A;  1H9G A;  4OIN F;  3M79 A;  4PR9 A;  4IRU A;  4N6C A;  4CS9 C;  1V54 C;  4I3M A;  4OIP F;  1C02 A;  1XZP A;  4PFO A;  2IOQ A;  1GGQ A;  4MS2 A;  1MND A;  1YDI A;  2P61 A;  5E3A A;  2R7X A;  1ZHY A;  3K1I A;  4MND A;  1S05 A;  4U5F E;  3GEH A;  3M15 A;  1H9T A;  4GQH A;  3W8I A;  2W45 A;  3K33 A;  2R02 A;  2I8B A;  3K66 A;  3UR3 C;  5DS6 A;  2R03 A;  1K05 A;  3NG1 A;  3S0X A;  2Q9C A;  4YT5 A;  3DM9 B;  1Q0M A;  2YVK A;  1LM3 B;  1XZQ A;  3GM2 A;  3K1H A;  3E70 C;  2L6G A;  1T6U A;  2LFF A;  5D92 A;  3W4Y A;  2VB6 A;  3CQZ A;  3U5S A;  4Z9I A;  4Q7C A;  1NU9 C;  2XL6 A;  2CYD A;  1CGN A;  4IB4 A;  5A6B D;  3TD7 A;  1FMV A;  3UMK A;  2CNW A;  2HJM A;  3ABK C;  1M57 C;  1OW8 A;  2YLG A;  3FXH A;  2NSF A;  4W8P A;  2NSG A;  2BL2 A;  5L0F A;  3H2V A;  1LS1 A;  4CS7 A;  1U0B B;  1VLT A;  1EA8 A;  1EQ1 A;  3Q6N A;  1Q0D A;  2XS1 A;  1TFK B;  3EHN A;  4HFF B;  1Z7Q c;  1DOV A;  2OEX A;  2PNO A;  5L0J A;  2G3V A;  4LDK A;  2D4U A;  5KYW B;  4U5G A;  1TWG A;  4OIR F;  4MVS A;  1QSP A;  2L7A A;  2O9X A;  4CJG A;  4LDQ A;  4C3B A;  5L0H A;  1WWP A;  1YVI A;  1Z5Z A;  4MTG A;  4WAB A;  4CS9 A;  2LSE A;  3LNM B;  4IAQ A;  2NG1 A;  4JEA A;  4N06 A;  3FMS A;  2G3K A;  5FZT A;  3NYJ A;  2J8W A;  3NKE A;  5T3W A;  1WGW A;  3RQE A;  4DVY P;  3B0P A;  3UMI A;  5BQI A;  4N4W A;  3M4B A;  1BR4 A;  4FES A;  3WHN A;  3F47 A;  2HZ8 A;  1Q0G A;  2J9V A;  3LLI A;  3LS0 A;  4XEK A;  1LS4 A;  3U8V A;  4Q5S F;  2YZS A;  3RKO F;  1NZE A;  2HV7 A;  5E33 A;  3AQB A;  3SEO A;  2QUP A;  4JW1 A;  5IY5 C;  3A11 A;  1OKK D;  2FFH A;  2YL3 A;  3NMI A;  2M4E A;  4RDA A;  1D1B A;  1T9K A;  2LD6 A;  5BUO A;  3UMH A;  4DRI B;  2EIN C;  2XM0 A;  3V7O A;  2R7S A;  4D4N A;  1OW6 A;  2Q9B A;  3SP1 A;  4MVR A;  4B6I A;  3TUL A;  3J06 A;  3FOP A;  3R2P A;  4P9T A;  2VH3 A;  3LS1 A;  4XPW A;  2B0J A;  3DAF A;  2ZXP A;  3WG7 C;  4IWB A;  3ECS A;  4LLC A;  3U3F A;  5CI9 A;  1ZHZ A;  3C18 A;  2AP3 A;  4E7S A;  1MMN A;  2YLI A;  3W2V A;  2G62 A;  2XLO A;  3MBG A;  4JTA B;  2R05 A;  3CZ6 A;  3DE8 A;  2HV6 A;  1WTY A;  2KGO A;  1HMO A;  3MYI A;  2A1D D;  3GEE A;  1ZHW A; 
#chains in the Genus database with same CATH homology
 1LE4 A;  2KC3 A;  1H7I A;  1LE2 A;  1BZ4 A;  1OR2 A;  1B68 A;  3R2P A;  1LPE A;  1OR3 A;  3S84 A;  1AEP A;  1EQ1 A;  1EA8 A;  1NFN A;  1LS4 A;  1YA9 A;  1NFO A;  1GS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...