3S84A

Dimeric apoa-iv
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
239
structure length
239
Chain Sequence
b'DSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apolipoprotein A-IV
molecule tags Transport protein
source organism Homo sapiens
publication title The Structure of Dimeric Apolipoprotein A-IV and Its Mechanism of Self-Association.
pubmed doi rcsb
total genus 101
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 3s84A02
1EA8A 1LS4A 1LE2A 1OR3A 1GS9A 1YA9A 3S84A 1EQ1A 2KC3A 1NFNA 3R2PA 1NFOA 1B68A 1AEPA 1LE4A 1OR2A 1BZ4A 1H7IA 1LPEA
chains in the Genus database with same CATH superfamily
2W4MA 1JOGA 1Q0FA 3C8GD 2XRHA 1HMOA 5BUOA 4CS9C 2LSEA 4C7OB 3GWLA 3GANA 4YWQA 2DI3A 1LKXA 1TWCA 2YZSA 3VRCA 2XLHA 2ZXPA 4N6CA 4AL0A 1HE9A 4U5BE 4YL0A 3A9CA 2HKVA 5DQZA 3SP1A 4Q4ZF 2W9YA 2OU6A 1NG1A 3AG4C 4C3BA 2NUPA 2FFHA 1YYJA 2EINC 2M4EA 2J9BA 2NUTB 3JRMO 3O10A 4DBQA 5HSWA 5D92A 2J9VA 1HMDA 4D4XA 1M2VA 5COMA 3FXHA 2HV7A 2HS5A 4CDYA 1BZ4A 4YT2A 2UUIA 3LUTB 1W2WA 1G5ZA 4JJGA 3A11A 4LACB 4CS8C 1G4WR 3LEOA 2O9XA 3POVA 3I4UA 3LLIA 3E9VA 4ULWA 3UR3C 3EQLF 3VF0A 1H9GA 5KYUA 2JD3A 1A41A 2LK4A 1OR3A 5JT4A 1ZHXA 2P6VA 2D4UA 1ZHTA 4BJ6A 4O7GA 4QI0A 3PHF2 1U89A 1ORYA 2QE9A 3DWWA 1LM3B 3EZIA 4Q5SF 3AQCA 1D1CA 3F47A 3O6XA 2NSFA 2Q9AA 5AGFA 3UGPA 1OXBA 2L6GA 2YLIA 1NBBA 4MVRA 3DAGA 2X0CA 3T6BA 1QSPA 1DOWA 5EK0A 1FMWA 1TWHA 2EILC 3W8HA 3ABMC 3FHDA 4F4BA 1PD1A 4G7HF 2EIKC 1OW6A 4RD9A 4QDLA 4ANJA 1HW2A 2XLEA 2JX0A 1S05A 3CEXA 1DOVA 3GWNA 2VB6A 4M63A 4YJWA 2EIJC 3G50A 2YWAA 3QW0A 2MHRA 1Q0DA 2A0BA 3AG1C 2F22A 3RW0A 2HSBA 3ZQVA 1AUEA 3QW1A 4MQ9F 2BC5A 3EJNA 4O79A 1VTMP 5CI9A 3U0CA 2Q3TA 1JPNA 2Y3DA 2VCCA 5JS5A 3IQ6A 1FTSA 1LE4A 2CW0F 1LI7A 2MYSA 3CQZA 3TOMA 3FDQA 1BDJB 1RCPA 1C03A 2VH3A 4YT8A 5FCLA 3M15A 2HMZA 2EIMC 4C7OA 1M6TA 1PD0A 1VOMA 1LVKA 5T3WA 4FWVA 2IXMA 5AC4A 4UDVA 3L8IA 2DYRC 2WL8A 1LPEA 1LS4A 3DM5A 4JCZA 3GEEA 3TD7A 1H6GA 3VM6A 3OWTA 3MX3A 2KYHA 1XZQA 3GM1A 2R03A 1BR1A 1MQVA 1WWPA 2OKUA 3HJCA 3JYHA 4IB4A 2H7OA 1OCZC 2OG2A 1T6QA 4U5GA 3ZVRA 3RVZA 4AK9A 1ZHYA 2OEVA 2NUPB 1E86A 2R7TA 4QI2A 4DJ9A 4HFFB 3UMKA 1OCCC 2J0WA 4A2NB 1B68A 4AX2A 4BJ6C 2CGEA 2XLOA 4CX9A 1TWGA 4PK4A 2IBFA 1J8YF 4XPYA 2C03A 4HE8D 4DXWA 3TK0A 1D0YA 4ZLCA 4YL3A 1E83A 1E84A 4RDAA 4MW3A 5JVEA 2I8BA 4WGZA 1WOLA 2EPOA 5E3CA 5JSLA 1Z5ZA 1CGME 1OW7A 2IOQA 3LJBA 3O39A 2IXNA 2H8AA 3DKAA 2J46A 2LIGA 1WASA 4OD4A 2R05A 3SEOA 1JRAA 5A6AA 3UGOA 1T6IA 3LLKA 3W4YA 3L8JA 4E17A 2XM4A 3DE8A 3MYFA 3QTHA 4JZAA 3GM3A 2OCCC 2Y3BA 3NMKA 4FX5A 1G4US 3CSKA 3B0VC 1GM5A 2R25A 3HNKA 3Q7GA 2R7UA 3EFOB 4LDQA 5KYXA 5KYYA 4NCQA 5L0DA 2L6HA 2Z15A 3BRJA 3B0UX 3MYIA 1Z7Qc 3Q6NA 1RKEB 1QKRA 1RXQA 3LAYA 2PP4A 2YKZA 2YL7A 1TWAA 2HJMA 5COGA 3HNLA 2GDCA 1ZZPA 3RQFA 1LS1A 1TR2A 4IRUA 1ORSC 3FAJA 5CI8A 2ICWG 3SYNA 1I4ZA 3LNMB 1RKCA 1F1MA 4CS9A 4PFPA 4OIQF 1R4TA 3M79A 4JE9A 4JTCB 1OKKD 3AGUA 2YL0A 4Q7CA 1I4YA 4BG0A 4EUKB 2A6EF 4DRJB 1BR2A 1BR4A 3GEHA 2IXPA 4BJ1A 1WTYA 2IYLD 2WVQA 2XS8A 3KKBA 4U9EA 4BJ5C 3ZG1A 2YRFA 5L0IA 2KQ9A 5TJ5E 2YQYA 2XM0A 2L6FA 4I44A 1JR8A 4I1OB 3RVYA 3K6BA 2WZLA 3JCUQ 5DS5A 2AU5A 2G3VA 2EPKX 3ASNC 3G4XA 5AC5A 3V7OA 1YZCA 2M64A 3CAXA 1ZU4A 3JYYA 4XPXA 2QY9A 4JC7A 2DYSC 1Z3IX 1H9TA 3LEVA 3AQBA 2UUHA 4MVUA 5L0GA 3ZTZA 2PFDA 3K1IA 3K7DA 5F5HA 4D4NA 1RJ9B 1L7CA 2NG1A 3S27A 4EBBA 2XLMA 3U8VA 4XPWA 3DAFA 1K05A 3RIPA 2PF4E 2WB7A 2V26A 4N6HA 1VB5A 4X0RA 2I15A 4JURI 3WODF 2B0HA 4XEVA 4DVZA 4EKWA 2B0JA 2A1DD 4JRZA 2AWCA 3V5YA 4NQFA 3SXKA 2Q9CA 3DD7A 3EGDB 4XLNF 2KC3A 4CSAC 1WGWA 3ZC4A 2KSFA 4MNDA 1VLTA 3J06A 3W2VA 5IY5C 1C17M 4MVMA 4PJLA 5F5FA 1YAUO 2L81A 3AG2C 3ZDLA 5DS6A 3RF3A 2LQGA 2R9RB 4B6IA 4DOZA 1WATA 2R7XA 3Q6MA 4CSAA 2RD9A 1JAFA 2H7BA 2J8WA 1GS9A 3SXMA 4DRHB 2A0UA 3QZCA 3ZTMA 4DRIB 1IZMA 2A69F 2RSEB 3ABLC 3N24A 1RKEA 1EA8A 1MNEA 3B9QA 4JTAB 4A4AA 1M57C 3LS1A 4KI2A 2GA0A 3IHUA 2WVOA 1OR2A 1LIHA 4OIOF 3DM9B 2NSGA 2VCAA 4JCHA 3IQCA 3K1IC 1U0BB 3AG3C 4W8KA 2J0XA 4H54A 4NTAA 5FZTA 2GFHA 1A0BA 2YHSA 4N4WA 4BEJA 4CDAA 1YVIA 4NY3A 1A7DA 1CGNA 3EG9B 4P9FA 1D1AA 3ATPA 3C7JA 2HV6A 2Q4FA 2QLAA 4MTOA 2YL3A 3B0PA 3NYMA 5JLIA 1EKYA 1QVXA 1OCRC 1LI5A 3EZHA 3JRTA 1Y6DA 4H4KC 3VAYA 3AOUA 3S29A 4JTDB 2CNWD 5KYNA 2J7PA 4CS8A 2AVKA 1KU2A 3LS0A 3C8GA 4EBKA 4XEKA 2R7WA 2P61A 1Z6AA 3DI5A 4XEFA 3HKKA 3LNRA 1Z63A 5E3AA 3W8IA 3TQOA 3WAQA 2EPMX 3FVYA 4LERA 1RJ9A 3CZ6A 1A7VA 2JPUA 1OQCA 1NZEA 4G0HA 4LLCA 5L0HA 5DVWA 2DB4A 3U2MA 3RFYA 2IXOA 3ABKC 2WZGA 4JIOA 4U9DA 1UG7A 5DQTA 3GEIA 3QVZA 1E2XA 1PCXA 1FAPB 4MS2A 2XLDA 3VYWA 1EQ1A 4OINF 3HNIA 4YN0B 3R2PA 2R7RA 3JSZA 4E7ZA 2FGYA 2YL1A 5B3IA 1H7IA 3OEOA 1O87A 2GWWA 1HW1A 5A6KA 4DVYP 2WZFA 1D0ZA 3U9MA 5A69A 1XWJA 2XS1A 3RYLA 4EIYA 1ORJA 1HE1A 1K40A 1SMYF 4BPMA 1R5ID 5COFA 4K7BA 2R7SA 3LESA 3H2VA 4L6RA 1IW7F 4WGYA 2GAQA 4O6YA 3F46A 3U3FA 1SF8A 1FNTc 1M56C 4U5CE 5T1DB 5D91A 5KYWA 1V55C 3DJNB 4ONSA 2J9UA 3OA1A 4PJNA 2A6HF 1Y4CA 2R7OA 3ITFA 3GORA 3JT1A 2QNLA 3NYLA 4IAOA 5EHHA 3U3BA 2XL6A 4EBJA 2CNWA 4C3DA 2E87A 5BQIA 1OKKA 4IJJA 2YEVA 2PBEA 4KC9A 5L3QA 4HFKB 3RKOF 2XXAB 5DLJA 3B71A 4PJMA 1NSGB 3NMIA 3T6JA 5L0CA 3NYJA 4R32A 1L3PA 3EG9A 3PCVA 4W8PA 2Q7RA 2PX0A 3US6A 2OQMA 2R7QA 3L34A 1OCOC 1E85A 2KGOA 3TJ5A 2FAPB 3NRHA 1SYQA 4N06A 1YLMA 4K0DA 2KNHA 1T01A 4IWBA 4RBNA 1BBHA 4EHPA 1FR0A 1LE2A 1MMNA 2J45A 3C62A 3FOOA 4CJOA 1YZAA 2G62A 3HLZA 1KNYA 2KW3C 1U6HA 4E0HA 2XSEA 4MVQA 3IEEA 1WN0A 3K33A 4I1MA 3JTLO 4U5FE 1ST6A 1T5OA 3DE9A 3NKEA 1N1CA 1APCA 1JPJA 2KK1A 4CDVA 2V3CC 3DXJF 3WHNA 2L9JA 2BE5F 2YLGA 1NU9C 1T6UA 4U5EE 5B1BC 5K0IA 3TULA 1NU7D 1QLEC 5E33A 3SZRA 1MMAA 2YVKA 3UNGC 1Z23A 3RQEA 4OIRF 3UMHA 1Q0KA 2HJ3A 4J32B 2XLWA 4U5HA 4XWJA 2R7VA 1VYIA 2VC9A 2NPUA 3L1MA 1G8XA 1OXKA 2D5RB 4E0IA 3ECSA 4BEMJ 5BQGA 2ZXOA 1D1BA 2W4BA 3BEHA 4PJJA 3ZSUA 1T9KA 4E7SA 1O3UA 3U8PA 1RMVA 1QPUA 4JEAA 4CBEA 4Z9HA 1I5NA 4ZLDA 3EGDA 3IQ5A 2ZD9A 3MLGA 1QZXA 3EH2A 3V5XA 2HFIA 4FAPB 2Y3HA 5KYUB 1OW8A 3FMSA 1EI7A 4GYTA 4ER9A 5KYWB 2OJED 5E2QA 3I5PA 5JUAA 2WVNA 1PV3A 1MMGA 3WG7C 4G7ZF 4XTKA 4JVSA 2ZXWC 1FMVA 2QUPA 4Z9JA 3B29A 4MTGA 4PFOA 5L3VA 4CS7A 2Y3GA 2BL2A 2KJGA 5T3TA 2AWYA 4AL1A 4BJTA 1K04A 3ASOC 3Q7LA 4ULVA 1TKNA 1ZW2A 2P7VA 2HSQA 2J9WA 3G4ZA 3KL4A 1MMDA 3QVYA 3RH3A 1JMWA 1A7EA 2CDQA 3C63A 3KYJA 1C02A 3NMJA 1TFOB 4NTFA 3KH2A 5EGYA 3TOLA 3S28A 4AE4B 1J8MF 3JZ0A 4LDRA 4G78A 5GPGB 3T4RA 4P6IC 5F28E 4EWCA 4YT4A 4YT5A 1S7ZA 4Z9IA 5CIVA 3SNHA 1V74B 3M4CA 4HEAJ 4XLPF 1XZPA 1UFBA 1NFNA 2A68F 2ZPAA 3EGXA 3GM2A 3I5QA 4IGGA 1D0XA 4P9TA 1YA7O 1TQGA 2Q00A 2J7PD 2H7VC 3DMDA 3MBGA 5L0JA 2LFFA 2LP4A 3EH1A 4K1OA 2ETSA 3S90A 2ZXRA 1V54C 4PR9A 1HY5A 4O6NA 3C8ZA 1MNDA 1CGOA 4IARA 3V5ZA 4NC3A 3DZAA 3E70C 2TMVP 3C8GB 4U5DE 4MW8A 4CIPA 3HTKC 5A6JA 4JEBA 1CPQA 2LD6A 2VASA 1QQ3A 4J30B 3JSEO 3DJUB 256BA 4G7OF 4LLEA 1AEPA 2L7AA 2ASRA 2PNOA 4C3EA 3K66A 3EHMA 2P1AA 1ZHZA 3SXZA 4FESA 3AJMA 1SZIA 1YDIA 2Q9BA 1YJGA 1YYXA 2DGJA 3FAPB 3L0IA 4J7TA 5JRAA 2W45A 2LFDA 3T9OA 1AVOB 3SXYA 1YA9A 2PX3A 3AGTA 3PDMP 1M2OA 5B1AC 3O55A 1ZVZA 3TJ6A 5KYYB 1KTMA 2G3KA 2HMQA 2NUTA 4IAQA 5BQHA 4JKVA 2OEXA 1GGQA 3NG1A 4MVOA 4JJFA 1SR2A 5B3SC 1M2VB 1FFTC 2X51A 1GQAA 4OD5A 3FOPA 2EPLX 3NDBB 2OJQA 3N2ZB 3EPVA 5L0FA 3MFNA 2Y69C 3EFOA 3KYIA 5KYXB 3S0XA 4GQHA 3H2UA 2R02A 2AP3A 4JW1A 3T6GB 3U2LA 3M4BA 5HV9A 2VCBA 4GEHA 1Q0MA 2LCHA 2Y39A 5JP7A 3R7CA 1FFHA 3M1CB 4I3MA 2CCYA 2MWQA 4YK5A 3U5SA 3U9JA 3EHNA 5A6BA 1VYKA 3N0TA 3H65A 3ZIBA 4BJ5A 2EPNA 4J7YA 2QTVA 3HNJA 3GODA 1VK5A 3KMIA 4KNVA 1VLSA 3KPHA 4AE4A 1O5HA 4MVSA 4MVZA 2XL4A 3RQGA 4CJGA 3NKDA 4YL1A 1NFOA 4WJ0A 4O6MA 3S84A 4LDKA 2XXAA 1Q0GA 4XQ1A 1YARO 4CIHA 4NTBA 2HUJA 4PACA 3EGXB 3S9OA 4KBLA 4WABA 1ZU5A 2XLVA 3W2WA 1ZHWA 4DBRA 5A6BD 3IPMO 2OOCA 2CYDA 2HZ8A 1ZYRF 4OIPF 1CPRA 1ZW3A 5DS4A 3IQTA 3K1HA 2XL8A 2P0NA 4KNWA 2IM8A 3QMKA 4MTFA 4E18A 3X2QC 1V4AA 1VMAA 2YLDA 1NLXA 3C18A 3PMRA 3UMIA 3X1OA 3ZQYA 3ZWIA 2C04A 1TFKB
chains in the Genus database with same CATH topology
1EA8A 1LS4A 1LE2A 1OR3A 1GS9A 1YA9A 3S84A 1EQ1A 2KC3A 1NFNA 3R2PA 1NFOA 1B68A 1AEPA 1LE4A 1OR2A 1BZ4A 1H7IA 1LPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EA8 A;  1LS4 A;  1LE2 A;  1OR3 A;  1GS9 A;  1YA9 A;  3S84 A;  1EQ1 A;  2KC3 A;  1NFN A;  3R2P A;  1NFO A;  1B68 A;  1AEP A;  1LE4 A;  1OR2 A;  1BZ4 A;  1H7I A;  1LPE A; 
#chains in the Genus database with same CATH topology
 2W4M A;  1JOG A;  1Q0F A;  3C8G D;  2XRH A;  1HMO A;  5BUO A;  4CS9 C;  2LSE A;  4C7O B;  3GWL A;  3GAN A;  4YWQ A;  2DI3 A;  1LKX A;  1TWC A;  2YZS A;  3VRC A;  2XLH A;  2ZXP A;  4N6C A;  4AL0 A;  1HE9 A;  4U5B E;  4YL0 A;  3A9C A;  2HKV A;  5DQZ A;  3SP1 A;  4Q4Z F;  2W9Y A;  2OU6 A;  1NG1 A;  3AG4 C;  4C3B A;  2NUP A;  2FFH A;  1YYJ A;  2EIN C;  2M4E A;  2J9B A;  2NUT B;  3JRM O;  3O10 A;  4DBQ A;  5HSW A;  5D92 A;  2J9V A;  1HMD A;  4D4X A;  1M2V A;  5COM A;  3FXH A;  2HV7 A;  2HS5 A;  4CDY A;  1BZ4 A;  4YT2 A;  2UUI A;  3LUT B;  1W2W A;  1G5Z A;  4JJG A;  3A11 A;  4LAC B;  4CS8 C;  1G4W R;  3LEO A;  2O9X A;  3POV A;  3I4U A;  3LLI A;  3E9V A;  4ULW A;  3UR3 C;  3EQL F;  3VF0 A;  1H9G A;  5KYU A;  2JD3 A;  1A41 A;  2LK4 A;  1OR3 A;  5JT4 A;  1ZHX A;  2P6V A;  2D4U A;  1ZHT A;  4BJ6 A;  4O7G A;  4QI0 A;  3PHF 2;  1U89 A;  1ORY A;  2QE9 A;  3DWW A;  1LM3 B;  3EZI A;  4Q5S F;  3AQC A;  1D1C A;  3F47 A;  3O6X A;  2NSF A;  2Q9A A;  5AGF A;  3UGP A;  1OXB A;  2L6G A;  2YLI A;  1NBB A;  4MVR A;  3DAG A;  2X0C A;  3T6B A;  1QSP A;  1DOW A;  5EK0 A;  1FMW A;  1TWH A;  2EIL C;  3W8H A;  3ABM C;  3FHD A;  4F4B A;  1PD1 A;  4G7H F;  2EIK C;  1OW6 A;  4RD9 A;  4QDL A;  4ANJ A;  1HW2 A;  2XLE A;  2JX0 A;  1S05 A;  3CEX A;  1DOV A;  3GWN A;  2VB6 A;  4M63 A;  4YJW A;  2EIJ C;  3G50 A;  2YWA A;  3QW0 A;  2MHR A;  1Q0D A;  2A0B A;  3AG1 C;  2F22 A;  3RW0 A;  2HSB A;  3ZQV A;  1AUE A;  3QW1 A;  4MQ9 F;  2BC5 A;  3EJN A;  4O79 A;  1VTM P;  5CI9 A;  3U0C A;  2Q3T A;  1JPN A;  2Y3D A;  2VCC A;  5JS5 A;  3IQ6 A;  1FTS A;  1LE4 A;  2CW0 F;  1LI7 A;  2MYS A;  3CQZ A;  3TOM A;  3FDQ A;  1BDJ B;  1RCP A;  1C03 A;  2VH3 A;  4YT8 A;  5FCL A;  3M15 A;  2HMZ A;  2EIM C;  4C7O A;  1M6T A;  1PD0 A;  1VOM A;  1LVK A;  5T3W A;  4FWV A;  2IXM A;  5AC4 A;  4UDV A;  3L8I A;  2DYR C;  2WL8 A;  1LPE A;  1LS4 A;  3DM5 A;  4JCZ A;  3GEE A;  3TD7 A;  1H6G A;  3VM6 A;  3OWT A;  3MX3 A;  2KYH A;  1XZQ A;  3GM1 A;  2R03 A;  1BR1 A;  1MQV A;  1WWP A;  2OKU A;  3HJC A;  3JYH A;  4IB4 A;  2H7O A;  1OCZ C;  2OG2 A;  1T6Q A;  4U5G A;  3ZVR A;  3RVZ A;  4AK9 A;  1ZHY A;  2OEV A;  2NUP B;  1E86 A;  2R7T A;  4QI2 A;  4DJ9 A;  4HFF B;  3UMK A;  1OCC C;  2J0W A;  4A2N B;  1B68 A;  4AX2 A;  4BJ6 C;  2CGE A;  2XLO A;  4CX9 A;  1TWG A;  4PK4 A;  2IBF A;  1J8Y F;  4XPY A;  2C03 A;  4HE8 D;  4DXW A;  3TK0 A;  1D0Y A;  4ZLC A;  4YL3 A;  1E83 A;  1E84 A;  4RDA A;  4MW3 A;  5JVE A;  2I8B A;  4WGZ A;  1WOL A;  2EPO A;  5E3C A;  5JSL A;  1Z5Z A;  1CGM E;  1OW7 A;  2IOQ A;  3LJB A;  3O39 A;  2IXN A;  2H8A A;  3DKA A;  2J46 A;  2LIG A;  1WAS A;  4OD4 A;  2R05 A;  3SEO A;  1JRA A;  5A6A A;  3UGO A;  1T6I A;  3LLK A;  3W4Y A;  3L8J A;  4E17 A;  2XM4 A;  3DE8 A;  3MYF A;  3QTH A;  4JZA A;  3GM3 A;  2OCC C;  2Y3B A;  3NMK A;  4FX5 A;  1G4U S;  3CSK A;  3B0V C;  1GM5 A;  2R25 A;  3HNK A;  3Q7G A;  2R7U A;  3EFO B;  4LDQ A;  5KYX A;  5KYY A;  4NCQ A;  5L0D A;  2L6H A;  2Z15 A;  3BRJ A;  3B0U X;  3MYI A;  1Z7Q c;  3Q6N A;  1RKE B;  1QKR A;  1RXQ A;  3LAY A;  2PP4 A;  2YKZ A;  2YL7 A;  1TWA A;  2HJM A;  5COG A;  3HNL A;  2GDC A;  1ZZP A;  3RQF A;  1LS1 A;  1TR2 A;  4IRU A;  1ORS C;  3FAJ A;  5CI8 A;  2ICW G;  3SYN A;  1I4Z A;  3LNM B;  1RKC A;  1F1M A;  4CS9 A;  4PFP A;  4OIQ F;  1R4T A;  3M79 A;  4JE9 A;  4JTC B;  1OKK D;  3AGU A;  2YL0 A;  4Q7C A;  1I4Y A;  4BG0 A;  4EUK B;  2A6E F;  4DRJ B;  1BR2 A;  1BR4 A;  3GEH A;  2IXP A;  4BJ1 A;  1WTY A;  2IYL D;  2WVQ A;  2XS8 A;  3KKB A;  4U9E A;  4BJ5 C;  3ZG1 A;  2YRF A;  5L0I A;  2KQ9 A;  5TJ5 E;  2YQY A;  2XM0 A;  2L6F A;  4I44 A;  1JR8 A;  4I1O B;  3RVY A;  3K6B A;  2WZL A;  3JCU Q;  5DS5 A;  2AU5 A;  2G3V A;  2EPK X;  3ASN C;  3G4X A;  5AC5 A;  3V7O A;  1YZC A;  2M64 A;  3CAX A;  1ZU4 A;  3JYY A;  4XPX A;  2QY9 A;  4JC7 A;  2DYS C;  1Z3I X;  1H9T A;  3LEV A;  3AQB A;  2UUH A;  4MVU A;  5L0G A;  3ZTZ A;  2PFD A;  3K1I A;  3K7D A;  5F5H A;  4D4N A;  1RJ9 B;  1L7C A;  2NG1 A;  3S27 A;  4EBB A;  2XLM A;  3U8V A;  4XPW A;  3DAF A;  1K05 A;  3RIP A;  2PF4 E;  2WB7 A;  2V26 A;  4N6H A;  1VB5 A;  4X0R A;  2I15 A;  4JUR I;  3WOD F;  2B0H A;  4XEV A;  4DVZ A;  4EKW A;  2B0J A;  2A1D D;  4JRZ A;  2AWC A;  3V5Y A;  4NQF A;  3SXK A;  2Q9C A;  3DD7 A;  3EGD B;  4XLN F;  2KC3 A;  4CSA C;  1WGW A;  3ZC4 A;  2KSF A;  4MND A;  1VLT A;  3J06 A;  3W2V A;  5IY5 C;  1C17 M;  4MVM A;  4PJL A;  5F5F A;  1YAU O;  2L81 A;  3AG2 C;  3ZDL A;  5DS6 A;  3RF3 A;  2LQG A;  2R9R B;  4B6I A;  4DOZ A;  1WAT A;  2R7X A;  3Q6M A;  4CSA A;  2RD9 A;  1JAF A;  2H7B A;  2J8W A;  1GS9 A;  3SXM A;  4DRH B;  2A0U A;  3QZC A;  3ZTM A;  4DRI B;  1IZM A;  2A69 F;  2RSE B;  3ABL C;  3N24 A;  1RKE A;  1EA8 A;  1MNE A;  3B9Q A;  4JTA B;  4A4A A;  1M57 C;  3LS1 A;  4KI2 A;  2GA0 A;  3IHU A;  2WVO A;  1OR2 A;  1LIH A;  4OIO F;  3DM9 B;  2NSG A;  2VCA A;  4JCH A;  3IQC A;  3K1I C;  1U0B B;  3AG3 C;  4W8K A;  2J0X A;  4H54 A;  4NTA A;  5FZT A;  2GFH A;  1A0B A;  2YHS A;  4N4W A;  4BEJ A;  4CDA A;  1YVI A;  4NY3 A;  1A7D A;  1CGN A;  3EG9 B;  4P9F A;  1D1A A;  3ATP A;  3C7J A;  2HV6 A;  2Q4F A;  2QLA A;  4MTO A;  2YL3 A;  3B0P A;  3NYM A;  5JLI A;  1EKY A;  1QVX A;  1OCR C;  1LI5 A;  3EZH A;  3JRT A;  1Y6D A;  4H4K C;  3VAY A;  3AOU A;  3S29 A;  4JTD B;  2CNW D;  5KYN A;  2J7P A;  4CS8 A;  2AVK A;  1KU2 A;  3LS0 A;  3C8G A;  4EBK A;  4XEK A;  2R7W A;  2P61 A;  1Z6A A;  3DI5 A;  4XEF A;  3HKK A;  3LNR A;  1Z63 A;  5E3A A;  3W8I A;  3TQO A;  3WAQ A;  2EPM X;  3FVY A;  4LER A;  1RJ9 A;  3CZ6 A;  1A7V A;  2JPU A;  1OQC A;  1NZE A;  4G0H A;  4LLC A;  5L0H A;  5DVW A;  2DB4 A;  3U2M A;  3RFY A;  2IXO A;  3ABK C;  2WZG A;  4JIO A;  4U9D A;  1UG7 A;  5DQT A;  3GEI A;  3QVZ A;  1E2X A;  1PCX A;  1FAP B;  4MS2 A;  2XLD A;  3VYW A;  1EQ1 A;  4OIN F;  3HNI A;  4YN0 B;  3R2P A;  2R7R A;  3JSZ A;  4E7Z A;  2FGY A;  2YL1 A;  5B3I A;  1H7I A;  3OEO A;  1O87 A;  2GWW A;  1HW1 A;  5A6K A;  4DVY P;  2WZF A;  1D0Z A;  3U9M A;  5A69 A;  1XWJ A;  2XS1 A;  3RYL A;  4EIY A;  1ORJ A;  1HE1 A;  1K40 A;  1SMY F;  4BPM A;  1R5I D;  5COF A;  4K7B A;  2R7S A;  3LES A;  3H2V A;  4L6R A;  1IW7 F;  4WGY A;  2GAQ A;  4O6Y A;  3F46 A;  3U3F A;  1SF8 A;  1FNT c;  1M56 C;  4U5C E;  5T1D B;  5D91 A;  5KYW A;  1V55 C;  3DJN B;  4ONS A;  2J9U A;  3OA1 A;  4PJN A;  2A6H F;  1Y4C A;  2R7O A;  3ITF A;  3GOR A;  3JT1 A;  2QNL A;  3NYL A;  4IAO A;  5EHH A;  3U3B A;  2XL6 A;  4EBJ A;  2CNW A;  4C3D A;  2E87 A;  5BQI A;  1OKK A;  4IJJ A;  2YEV A;  2PBE A;  4KC9 A;  5L3Q A;  4HFK B;  3RKO F;  2XXA B;  5DLJ A;  3B71 A;  4PJM A;  1NSG B;  3NMI A;  3T6J A;  5L0C A;  3NYJ A;  4R32 A;  1L3P A;  3EG9 A;  3PCV A;  4W8P A;  2Q7R A;  2PX0 A;  3US6 A;  2OQM A;  2R7Q A;  3L34 A;  1OCO C;  1E85 A;  2KGO A;  3TJ5 A;  2FAP B;  3NRH A;  1SYQ A;  4N06 A;  1YLM A;  4K0D A;  2KNH A;  1T01 A;  4IWB A;  4RBN A;  1BBH A;  4EHP A;  1FR0 A;  1LE2 A;  1MMN A;  2J45 A;  3C62 A;  3FOO A;  4CJO A;  1YZA A;  2G62 A;  3HLZ A;  1KNY A;  2KW3 C;  1U6H A;  4E0H A;  2XSE A;  4MVQ A;  3IEE A;  1WN0 A;  3K33 A;  4I1M A;  3JTL O;  4U5F E;  1ST6 A;  1T5O A;  3DE9 A;  3NKE A;  1N1C A;  1APC A;  1JPJ A;  2KK1 A;  4CDV A;  2V3C C;  3DXJ F;  3WHN A;  2L9J A;  2BE5 F;  2YLG A;  1NU9 C;  1T6U A;  4U5E E;  5B1B C;  5K0I A;  3TUL A;  1NU7 D;  1QLE C;  5E33 A;  3SZR A;  1MMA A;  2YVK A;  3UNG C;  1Z23 A;  3RQE A;  4OIR F;  3UMH A;  1Q0K A;  2HJ3 A;  4J32 B;  2XLW A;  4U5H A;  4XWJ A;  2R7V A;  1VYI A;  2VC9 A;  2NPU A;  3L1M A;  1G8X A;  1OXK A;  2D5R B;  4E0I A;  3ECS A;  4BEM J;  5BQG A;  2ZXO A;  1D1B A;  2W4B A;  3BEH A;  4PJJ A;  3ZSU A;  1T9K A;  4E7S A;  1O3U A;  3U8P A;  1RMV A;  1QPU A;  4JEA A;  4CBE A;  4Z9H A;  1I5N A;  4ZLD A;  3EGD A;  3IQ5 A;  2ZD9 A;  3MLG A;  1QZX A;  3EH2 A;  3V5X A;  2HFI A;  4FAP B;  2Y3H A;  5KYU B;  1OW8 A;  3FMS A;  1EI7 A;  4GYT A;  4ER9 A;  5KYW B;  2OJE D;  5E2Q A;  3I5P A;  5JUA A;  2WVN A;  1PV3 A;  1MMG A;  3WG7 C;  4G7Z F;  4XTK A;  4JVS A;  2ZXW C;  1FMV A;  2QUP A;  4Z9J A;  3B29 A;  4MTG A;  4PFO A;  5L3V A;  4CS7 A;  2Y3G A;  2BL2 A;  2KJG A;  5T3T A;  2AWY A;  4AL1 A;  4BJT A;  1K04 A;  3ASO C;  3Q7L A;  4ULV A;  1TKN A;  1ZW2 A;  2P7V A;  2HSQ A;  2J9W A;  3G4Z A;  3KL4 A;  1MMD A;  3QVY A;  3RH3 A;  1JMW A;  1A7E A;  2CDQ A;  3C63 A;  3KYJ A;  1C02 A;  3NMJ A;  1TFO B;  4NTF A;  3KH2 A;  5EGY A;  3TOL A;  3S28 A;  4AE4 B;  1J8M F;  3JZ0 A;  4LDR A;  4G78 A;  5GPG B;  3T4R A;  4P6I C;  5F28 E;  4EWC A;  4YT4 A;  4YT5 A;  1S7Z A;  4Z9I A;  5CIV A;  3SNH A;  1V74 B;  3M4C A;  4HEA J;  4XLP F;  1XZP A;  1UFB A;  1NFN A;  2A68 F;  2ZPA A;  3EGX A;  3GM2 A;  3I5Q A;  4IGG A;  1D0X A;  4P9T A;  1YA7 O;  1TQG A;  2Q00 A;  2J7P D;  2H7V C;  3DMD A;  3MBG A;  5L0J A;  2LFF A;  2LP4 A;  3EH1 A;  4K1O A;  2ETS A;  3S90 A;  2ZXR A;  1V54 C;  4PR9 A;  1HY5 A;  4O6N A;  3C8Z A;  1MND A;  1CGO A;  4IAR A;  3V5Z A;  4NC3 A;  3DZA A;  3E70 C;  2TMV P;  3C8G B;  4U5D E;  4MW8 A;  4CIP A;  3HTK C;  5A6J A;  4JEB A;  1CPQ A;  2LD6 A;  2VAS A;  1QQ3 A;  4J30 B;  3JSE O;  3DJU B;  256B A;  4G7O F;  4LLE A;  1AEP A;  2L7A A;  2ASR A;  2PNO A;  4C3E A;  3K66 A;  3EHM A;  2P1A A;  1ZHZ A;  3SXZ A;  4FES A;  3AJM A;  1SZI A;  1YDI A;  2Q9B A;  1YJG A;  1YYX A;  2DGJ A;  3FAP B;  3L0I A;  4J7T A;  5JRA A;  2W45 A;  2LFD A;  3T9O A;  1AVO B;  3SXY A;  1YA9 A;  2PX3 A;  3AGT A;  3PDM P;  1M2O A;  5B1A C;  3O55 A;  1ZVZ A;  3TJ6 A;  5KYY B;  1KTM A;  2G3K A;  2HMQ A;  2NUT A;  4IAQ A;  5BQH A;  4JKV A;  2OEX A;  1GGQ A;  3NG1 A;  4MVO A;  4JJF A;  1SR2 A;  5B3S C;  1M2V B;  1FFT C;  2X51 A;  1GQA A;  4OD5 A;  3FOP A;  2EPL X;  3NDB B;  2OJQ A;  3N2Z B;  3EPV A;  5L0F A;  3MFN A;  2Y69 C;  3EFO A;  3KYI A;  5KYX B;  3S0X A;  4GQH A;  3H2U A;  2R02 A;  2AP3 A;  4JW1 A;  3T6G B;  3U2L A;  3M4B A;  5HV9 A;  2VCB A;  4GEH A;  1Q0M A;  2LCH A;  2Y39 A;  5JP7 A;  3R7C A;  1FFH A;  3M1C B;  4I3M A;  2CCY A;  2MWQ A;  4YK5 A;  3U5S A;  3U9J A;  3EHN A;  5A6B A;  1VYK A;  3N0T A;  3H65 A;  3ZIB A;  4BJ5 A;  2EPN A;  4J7Y A;  2QTV A;  3HNJ A;  3GOD A;  1VK5 A;  3KMI A;  4KNV A;  1VLS A;  3KPH A;  4AE4 A;  1O5H A;  4MVS A;  4MVZ A;  2XL4 A;  3RQG A;  4CJG A;  3NKD A;  4YL1 A;  1NFO A;  4WJ0 A;  4O6M A;  3S84 A;  4LDK A;  2XXA A;  1Q0G A;  4XQ1 A;  1YAR O;  4CIH A;  4NTB A;  2HUJ A;  4PAC A;  3EGX B;  3S9O A;  4KBL A;  4WAB A;  1ZU5 A;  2XLV A;  3W2W A;  1ZHW A;  4DBR A;  5A6B D;  3IPM O;  2OOC A;  2CYD A;  2HZ8 A;  1ZYR F;  4OIP F;  1CPR A;  1ZW3 A;  5DS4 A;  3IQT A;  3K1H A;  2XL8 A;  2P0N A;  4KNW A;  2IM8 A;  3QMK A;  4MTF A;  4E18 A;  3X2Q C;  1V4A A;  1VMA A;  2YLD A;  1NLX A;  3C18 A;  3PMR A;  3UMI A;  3X1O A;  3ZQY A;  3ZWI A;  2C04 A;  1TFK B; 
#chains in the Genus database with same CATH homology
 1EA8 A;  1LS4 A;  1LE2 A;  1OR3 A;  1GS9 A;  1YA9 A;  3S84 A;  1EQ1 A;  2KC3 A;  1NFN A;  3R2P A;  1NFO A;  1B68 A;  1AEP A;  1LE4 A;  1OR2 A;  1BZ4 A;  1H7I A;  1LPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...