3DD7A

Structure of doch66y in complex with the c-terminal domain of phd
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
123
Chain Sequence
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGYIFNDANKRTALNSALLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death on curing protein
publication title Doc of Prophage P1 Is Inhibited by Its Antitoxin Partner Phd through Fold Complementation
pubmed doi rcsb
source organism Enterobacteria phage p1
molecule tags Ribosome inhibitor
total genus 46
structure length 123
sequence length 123
chains with identical sequence C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1870 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dd7A00
3DD7A 3K33A 3KH2A
chains in the Genus database with same CATH superfamily
4U5GA 3GM2A 2XLVA 1VB5A 3EHMA 1V4AA 2L7AA 1KNYA 2NSFA 2P61A 2R05A 3EZHA 1VYIA 3JT1A 1TWAA 4XWJA 4IARA 3HNIA 2W9YA 5E2QA 3AG3C 5TJ5E 4XLNF 1TR2A 2EPKX 4PACA 2KQ9A 3HNJA 1C02A 1HMOA 1ZZPA 1A7DA 4U5EE 3L0IA 1NBBA 2LFDA 3TK0A 3LAYA 5L3VA 1M2VB 1FMVA 4IAOA 4G7HF 3ZC4A 1E83A 3FOOA 1FFHA 4JW1A 4DXWA 1A0BA 2IXOA 2Y3HA 3TQOA 4DOZA 2H7BA 3JSZA 3K6BA 2R7XA 2LD6A 1TKNA 3V5XA 4KNVA 2WL8A 4XPWA 2XL6A 3SZRA 5K0IA 1YYJA 2XM0A 4GQHA 4WJ0A 4E17A 1K40A 4CS9C 4N06A 3IPMO 2LIGA 4AE4A 3GODA 1RKEA 3TOLA 1FFTC 3C8GD 2Q3TA 1C03A 2LCHA 3JSEO 2G3VA 4CDAA 5KYXB 1ORYA 5KYWA 3H65A 3PMRA 4D4XA 5A6AA 3DJUB 3AQBA 1ZHXA 4WGZA 4JKVA 1QPUA 3O10A 1OXBA 3BEHA 3MFNA 4G0HA 4YT4A 5L0IA 1T6QA 2Y39A 2Y69C 3KYJA 4EBBA 4XTKA 1BBHA 3X1OA 5BQHA 2XLWA 1B68A 1JMWA 2BE5F 1ZHYA 5D92A 3T6BA 3TJ5A 2VCCA 2J45A 4JCHA 4R32A 3ZWIA 4Z9HA 4YL3A 1LIHA 2PBEA 4I1MA 2XLEA 4RBNA 4DBRA 3CQZA 1GM5A 3SXYA 3TULA 2W4MA 2Q00A 1M57C 2GWWA 2PF4E 3NMKA 4I3MA 3WG7C 3L8JA 4CX9A 2P7VA 5JVEA 4YL1A 3O55A 1OR2A 1MMGA 4U5BE 4XPYA 5L0FA 1VTMP 5L3QA 5GPGB 2VASA 5A6BA 3RIPA 3ABKC 3EQLF 3K1HA 4FX5A 3LEVA 3AG1C 4P6IC 3GEEA 4MS2A 4MVUA 4PR9A 3DE8A 3E70C 3SNHA 2C04A 1FMWA 3UR3C 1H7IA 3AJMA 3UNGC 4JURI 3CZ6A 3U8VA 2Q4FA 3KPHA 1F1MA 2R7QA 1UFBA 3HNKA 4K0DA 2EILC 3R7CA 3ZQYA 2V26A 3W8HA 2H7VC 4KI2A 4O6YA 1CPQA 2AWYA 1HMDA 1K05A 1NFNA 4YN0B 2IXNA 1D0YA 2XSEA 2AP3A 2KYHA 4U5DE 3J06A 1ZHWA 4J7TA 2HZ8A 5JRAA 4CDVA 4G7OF 2OEVA 1LE2A 3PCVA 1OXKA 3I4UA 3QTHA 2IBFA 1XWJA 4CBEA 2IYLD 4O7GA 3TJ6A 3U9JA 3C63A 3RYLA 3U2LA 3T6JA 2A0UA 4CJOA 4N6HA 1O87A 3KMIA 2R7OA 2YZSA 2W45A 1IW7F 1FTSA 3W2VA 1GS9A 1YAUO 2YL7A 3JZ0A 3RF3A 1JRAA 2F22A 3OA1A 3FDQA 4MVSA 1TFOB 1D1CA 3SXMA 3V7OA 3IQ5A 4YWQA 2A0BA 2PX0A 1U0BB 4I1OB 2OEXA 4NTBA 1RJ9A 4ZLCA 3DD7A 1AUEA 2XXAA 5A6JA 1HW2A 3DJNB 3KL4A 1T5OA 1L7CA 1YJGA 3CAXA 4PJLA 2B0JA 1Q0FA 2OJED 3ASOC 2WZGA 3Q6MA 4WGYA 1LVKA 3ECSA 3RQEA 3GWNA 4ONSA 1O3UA 3M15A 3RW0A 5KYUB 1MNEA 2A69F 2YLIA 4BG0A 4HFKB 5FCLA 4L6RA 1XZPA 3W4YA 4XPXA 1T6UA 3I5PA 3H2VA 3S27A 3JTLO 2PP4A 4NCQA 3ABLC 2RSEB 3N2ZB 4JEAA 4EUKB 4E7ZA 1A41A 2WVOA 1LPEA 2LSEA 4BJTA 1T9KA 4P9FA 3RVYA 1HE1A 2IM8A 3MLGA 1EKYA 3U3BA 2A6HF 1NU7D 3UMHA 2HUJA 2OCCC 4HEAJ 1OKKA 4CS7A 1RMVA 5IY5C 4GYTA 1N1CA 2HSBA 2YL0A 3B71A 4ANJA 3IQTA 5T1DB 4X0RA 4MQ9F 1E84A 4PFPA 4E0HA 1Z3IX 4PJJA 3TOMA 2WVQA 4KBLA 3G4ZA 2XLHA 1V54C 2ASRA 3B0PA 2R7TA 5COFA 1ZHZA 3KH2A 2R7SA 1I4YA 2DGJA 3DZAA 4G7ZF 2CNWA 4DVZA 2Y3GA 2VB6A 2WZFA 4YL0A 4CJGA 3Q7LA 2VC9A 4JC7A 3EGXA 3QW0A 1G4US 1U6HA 5COMA 2J46A 3RH3A 3VM6A 3VYWA 3OEOA 4DVYP 1HW1A 2IXMA 1NLXA 3EJNA 4O6MA 1BZ4A 1ZW2A 1CGME 2YLGA 3U8PA 1MMNA 3LS0A 4AE4B 3O6XA 1T01A 4BEJA 4I44A 1YZAA 1NFOA 2YWAA 2O9XA 1QLEC 3CEXA 2XLDA 3EH2A 1NSGB 3NKDA 4IRUA 3ITFA 4JJFA 1YZCA 2EIMC 5T3TA 3ZIBA 3FHDA 1D1BA 3AG2C 2R03A 3NKEA 1PD0A 3U3FA 2A1DD 5JUAA 2NG1A 4A2NB 2PNOA 3M79A 2WVNA 4EIYA 4LDKA 1OR3A 2A6EF 2LFFA 4H4KC 1OW6A 3SP1A 2CW0F 2TMVP 1NU9C 2EPLX 2FGYA 1G4WR 4J7YA 4AL0A 2G3KA 4BJ1A 3NYJA 2X0CA 4NTAA 1BR2A 3C8GA 3L1MA 3QZCA 2ZXWC 2RD9A 4LERA 1QZXA 1Z5ZA 1D0ZA 2QTVA 2Y3BA 3K7DA 4CSAA 1VLTA 3PDMP 1A7VA 1RXQA 2OU6A 3QMKA 5CI9A 4NY3A 3POVA 4OIRF 1MQVA 5DLJA 3FAPB 1D1AA 2R25A 1AVOB 1SYQA 3FVYA 1IZMA 4B6IA 5L0JA 1YVIA 3IHUA 1VK5A 4EHPA 2DB4A 5KYXA 5KYYA 1KU2A 1R5ID 2WZLA 3UGOA 2YRFA 3DI5A 1FR0A 2DYRC 1MMAA 1OQCA 4YT2A 1WWPA 1BR4A 2NUPA 4DJ9A 1VLSA 1E86A 1K04A 3JCUQ 2YL1A 3EFOB 3V5ZA 4MTOA 2JD3A 5F28E 3VF0A 1I4ZA 4H54A 1TWCA 3NRHA 2LK4A 4O79A 2Q9BA 2KC3A 4PFOA 5DS5A 2EIKC 1UG7A 4F4BA 1OCRC 5DQTA 5EK0A 3DMDA 3ABMC 3ZDLA 4CDYA 2MWQA 3AG4C 1OW8A 2OOCA 2C03A 4Q5SF 2E87A 2W4BA 2L6HA 2QY9A 3DKAA 2XS1A 5JSLA 4CIHA 1Z63A 4JZAA 1S05A 3S9OA 4AL1A 2HMQA 4IJJA 1LM3B 2NUTB 2HV7A 3GEIA 3DXJF 2HMZA 3HKKA 1SF8A 3O39A 1V74B 3C7JA 2YKZA 4FWVA 4Z9JA 2KW3C 4IGGA 3IQCA 4LDRA 3S29A 1MNDA 1TFKB 1FAPB 4DBQA 2R7RA 1MMDA 3LUTB 4OIPF 5F5FA 3SYNA 3UMKA 4MTFA 3EG9B 4U9DA 3EGDB 1YYXA 3K66A 1CGOA 1BR1A 2NSGA 2JX0A 3AGUA 4GEHA 1DOWA 3S90A 2GFHA 2J0XA 1E85A 4JCZA 5AC4A 2Q9AA 3UGPA 2HJ3A 3LLIA 3RQFA 3GANA 3UMIA 3C8ZA 2QUPA 4M63A 1QSPA 2CGEA 3G4XA 3W8IA 3ZQVA 5HV9A 4OIQF 3CSKA 1Z23A 3FMSA 1SR2A 4FAPB 5EGYA 4XEKA 1JPJA 1T6IA 2ZXOA 1WTYA 2EIJC 2L9JA 4MW3A 1VMAA 4OD5A 1Z6AA 2HKVA 1XZQA 5DVWA 4HE8D 2EINC 1JR8A 1Q0DA 1ZVZA 2EPOA 2H7OA 2J9WA 4U5HA 4MVMA 2I15A 4XQ1A 2R02A 5E3CA 2XLOA 5B1AC 5FZTA 3FAJA 4U5FE 3U9MA 2EPMX 4BEMJ 1V55C 4U9EA 1OCZC 4JJGA 3QVYA 2J9BA 4C7OA 2YL3A 3AQCA 5L0HA 3F46A 2D4UA 256BA 2J7PD 2YVKA 2KK1A 3WODF 2P0NA 3F47A 5HSWA 3NG1A 5KYUA 2QE9A 1NZEA 2ZD9A 3VRCA 2HS5A 2R7VA 2L6FA 2EPNA 3RVZA 1PCXA 3B9QA 1LKXA 1O5HA 1NG1A 3C18A 4JIOA 1H9GA 4KNWA 4N4WA 1QKRA 4OIOF 3JYHA 4BJ5A 4MW8A 4IB4A 5CI8A 4OINF 1YDIA 2DI3A 1EQ1A 1QQ3A 4Q4ZF 1HE9A 3I5QA 4LACB 2V3CC 3MX3A 2HV6A 2LQGA 4DRJB 1ZW3A 4CS8A 2UUIA 3M1CB 3S28A 4K1OA 1L3PA 1JPNA 2PX3A 3FOPA 3B0VC 1RKEB 3GORA 3AGTA 4C3DA 4JTAB 2B0HA 2CDQA 3HJCA 2KNHA 3GM3A 2J9UA 3OWTA 3Q6NA 2WB7A 2Q7RA 1CPRA 5BQIA 3ASNC 3DM5A 3K1IA 3NDBB 1EI7A 2BC5A 1PV3A 2R7WA 4XLPF 3SXZA 2I8BA 3L8IA 3V5YA 1RCPA 3LNMB 3SXKA 3ATPA 4MNDA 4E0IA 5B3SC 1KTMA 2Y3DA 2L6GA 1Q0KA 3FXHA 3NMJA 2R9RB 3R2PA 4MVOA 3W2WA 3LS1A 2MHRA 1E2XA 1YLMA 4YT5A 1QVXA 3JRMO 3C8GB 1LE4A 2Z15A 3U2MA 2NPUA 3US6A 3IEEA 2DYSC 2UUHA 3G50A 1JAFA 1M2VA 4RDAA 3EHNA 3ZSUA 2AWCA 2M4EA 4Z9IA 1AEPA 4UDVA 1J8YF 3E9VA 3X2QC 2AU5A 2GAQA 2J0WA 1ORJA 1FNTc 3L34A 2FFHA 2GA0A 3T9OA 1ZU5A 2J9VA 4EBJA 4CIPA 1OCCC 2ZXPA 2P6VA 2XL4A 4JTCB 2IXPA 2VH3A 2XRHA 5B3IA 4U5CE 1Q0GA 3QVZA 4BJ5C 5DS4A 5KYYB 4W8PA 3B0UX 5JP7A 2M64A 1VOMA 5JS5A 1Q0MA 4BJ6A 2FAPB 2CCYA 3RQGA 1TWGA 4CS8C 4ULVA 1WATA 4J32B 3U5SA 3ZVRA 4A4AA 1OW7A 2P1AA 4PJNA 4YK5A 2NUPB 2KSFA 4JRZA 4JTDB 1Y6DA 2KJGA 3MBGA 3RFYA 3B29A 4FESA 3K1IC 3LNRA 1ZU4A 5A6BD 3EH1A 1G8XA 2AVKA 2PFDA 4MVZA 5KYWB 5F5HA 2IOQA 3AOUA 3ZG1A 4AK9A 3T4RA 3H2UA 3ZTMA 5A6KA 1SMYF 2HJMA 1M6TA 3DM9B 3LLKA 2XS8A 4EBKA 4N6CA 5E3AA 4NTFA 3SEOA 1S7ZA 2ICWG 2JPUA 3NMIA 2QNLA 1I5NA 5DS6A 2QLAA 3LEOA 4NC3A 4W8KA 3DAGA 2ETSA 1CGNA 4ZLDA 2GDCA 4YJWA 2XL8A 3M4CA 5EHHA 3S84A 4IWBA 1ZYRF 4EKWA 3EPVA 4PJMA 4D4NA 5D91A 4JVSA 1RJ9B 2CYDA 1D0XA 5E33A 3KYIA 3Q7GA 5L0GA 4QI0A 4OD4A 1WOLA 4BPMA 2XXAB 1TWHA 4CSAC 5DQZA 2YHSA 5A69A 2L81A 3QW1A 3VAYA 5BUOA 1WGWA 1M2OA 2MYSA 4C3EA 3DE9A 2OG2A 4IAQA 4P9TA 1HY5A 3NYLA 1ST6A 2OKUA 1Z7Qc 1GGQA 1R4TA 2H8AA 4Q7CA 4JEBA 3PHF2 3K33A 2A68F 4O6NA 4BJ6C 5JT4A 5CIVA 4LLEA 4DRIB 3M4BA 4E18A 3MYIA 4J30B 2X51A 1EA8A 1YA7O 3EFOA 2VCAA 3HTKC 4NQFA 4EWCA 4WABA 1ZHTA 2ZPAA 3DAFA 4XEVA 3DWWA 2XM4A 4E7SA 2D5RB 1OCOC 1TQGA 4ULWA 1WASA 4HFFB 4JE9A 5T3WA 3WAQA 5KYNA 3U0CA 4XEFA 1LI5A 2OQMA 1C17M 1APCA 4LLCA 5AC5A 2KGOA 1LI7A 2HFIA 1U89A 1ORSC 4KC9A 1DOVA 1LS1A 1WN0A 2YQYA 3A11A 3HLZA 3BRJA 3JRTA 3LESA 4C7OB 3GEHA 3TD7A 2NUTA 3GWLA 4G78A 4RD9A 5L0CA 1OKKD 4DRHB 1W2WA 4MTGA 3IQ6A 1GQAA 4PK4A 5AGFA 3C62A 5B1BC 5BQGA 1J8MF 3N0TA 2ZXRA 3RKOF 5L0DA 5COGA 3A9CA 3JYYA 2YLDA 2OJQA 3GM1A 3ZTZA 2Q9CA 1G5ZA 1JOGA 2BL2A 4ER9A 4QI2A 1A7EA 2G62A 3EGXB 3N24A 3EG9A 3NYMA 3EGDA 3WHNA 1H9TA 1YA9A 4CS9A 2J8WA 3T6GB 1VYKA 1SZIA 1BDJB 2YEVA 1YARO 2VCBA 4K7BA 1M56C 3EZIA 4LDQA 3S0XA 2R7UA 3LJBA 3HNLA 1PD1A 1Y4CA 1H6GA 4MVQA 2LP4A 4QDLA 2XLMA 4MVRA 4C3BA 2CNWD 4AX2A 1RKCA 3MYFA 1LS4A 5JLIA 2J7PA 3KKBA 4YT8A 2HSQA
chains in the Genus database with same CATH topology
4U5GA 3EHMA 3EZHA 3JT1A 1VYIA 1TWAA 4XWJA 2W9YA 5E2QA 3AG3C 4XLNF 1TR2A 2KQ9A 4U5EE 3L0IA 3LAYA 5L3VA 1M2VB 1FMVA 4IAOA 4G7HF 3ZC4A 4JW1A 1FFHA 2IXOA 2Y3HA 4DOZA 2H7BA 3JSZA 3K6BA 2R7XA 1TKNA 4KNVA 2WL8A 3SZRA 4WJ0A 4CS9C 4N06A 4AE4A 3GODA 1FFTC 2Q3TA 2G3VA 5KYXB 5KYWA 3H65A 3PMRA 3DJUB 3AQBA 1ZHXA 4G0HA 4YT4A 2Y39A 2Y69C 4EBBA 4XTKA 3X1OA 2BE5F 1ZHYA 5D92A 3T6BA 2J45A 4JCHA 4I1MA 4DBRA 4RBNA 3CQZA 2W4MA 3WG7C 1M57C 2PF4E 4I3MA 2P7VA 1MMGA 4U5BE 2VASA 3RIPA 3ABKC 3EQLF 3K1HA 4FX5A 3LEVA 3AG1C 4P6IC 3UR3C 3E70C 3SNHA 3UNGC 2C04A 1FMWA 5L3QA 4JURI 3CZ6A 2R7QA 4K0DA 2EILC 2V26A 3W8HA 2H7VC 4KI2A 4O6YA 4YN0B 2IXNA 1D0YA 2XSEA 4U5DE 1ZHWA 4G7OF 3I4UA 4CBEA 2IYLD 4O7GA 3RYLA 3T6JA 1O87A 3KMIA 2R7OA 2YZSA 2W45A 1IW7F 1FTSA 3W2VA 3OA1A 3FDQA 1D1CA 3V7OA 4YWQA 2PX0A 4I1OB 1RJ9A 4ZLCA 3DD7A 2XXAA 3DJNB 3KL4A 4PJLA 2B0JA 3ASOC 2WZGA 3Q6MA 1LVKA 3ECSA 5KYUB 1MNEA 2A69F 4BG0A 4HFKB 5FCLA 3I5PA 3S27A 2PP4A 3ABLC 3N2ZB 4E7ZA 2WVOA 2LSEA 4BJTA 3MLGA 2A6HF 1NU7D 3UMHA 4HEAJ 2OCCC 4CS7A 1OKKA 5IY5C 4GYTA 1N1CA 4ANJA 5T1DB 4X0RA 4MQ9F 4PFPA 1Z3IX 4PJJA 2WVQA 4KBLA 1V54C 3B0PA 2R7TA 1ZHZA 3KH2A 2R7SA 2DGJA 3DZAA 4G7ZF 2CNWA 4DVZA 2Y3GA 2VB6A 2WZFA 3Q7LA 3EGXA 2J46A 3RH3A 3VYWA 3OEOA 4DVYP 2IXMA 3EJNA 4O6MA 1MMNA 3LS0A 4AE4B 3O6XA 4BEJA 4I44A 2O9XA 1QLEC 3EH2A 3NKDA 4IRUA 4JJFA 3ZIBA 5KYWB 3ITFA 5T3TA 2EIMC 3FHDA 1D1BA 3AG2C 3NKEA 1PD0A 2A1DD 2NG1A 4A2NB 2WVNA 2A6EF 4H4KC 3SP1A 2CW0F 1NU9C 2FGYA 2G3KA 4BJ1A 3NYJA 1BR2A 3QZCA 2ZXWC 4LERA 1QZXA 1Z5ZA 1D0ZA 2QTVA 2Y3BA 3K7DA 4CSAA 3QMKA 5CI9A 4NY3A 3POVA 4OIRF 5DLJA 1D1AA 3FVYA 1IZMA 4B6IA 1VK5A 5KYXA 5KYYA 1KU2A 2WZLA 3UGOA 2DYRC 1MMAA 4YT2A 1BR4A 2NUPA 3JCUQ 3EFOB 2JD3A 1TWCA 3NRHA 4O79A 2Q9BA 4PFOA 5DS5A 2EIKC 4F4BA 1OCRC 5DQTA 3DMDA 3ABMC 2MWQA 3AG4C 2C03A 4Q5SF 2E87A 2W4BA 2QY9A 4CIHA 1Z63A 4JZAA 4IJJA 2NUTB 2HV7A 3DXJF 3O39A 1SF8A 4FWVA 2KW3C 3S29A 1MNDA 4DBQA 2R7RA 1MMDA 4OIPF 5F5FA 3SYNA 3UMKA 3EG9B 3EGDB 3K66A 4GEHA 1BR1A 2GFHA 2J0XA 2Q9AA 3UGPA 3LLIA 3GANA 3UMIA 4M63A 3W8IA 2CGEA 4OIQF 3CSKA 1Z23A 5EGYA 1JPJA 2ZXOA 2EIJC 2L9JA 1VMAA 4OD5A 1Z6AA 5DVWA 4HE8D 2EINC 2H7OA 2J9WA 5E3CA 5B1AC 4U5HA 3FAJA 4U5FE 1V55C 1OCZC 4JJGA 4C7OA 3AQCA 3F46A 2J7PD 3WODF 3F47A 5HSWA 3NG1A 5KYUA 2R7VA 1NZEA 1PCXA 3B9QA 1LKXA 1O5HA 1NG1A 4KNWA 4OIOF 3JYHA 4BJ5A 5CI8A 4OINF 4Q4ZF 4LACB 3I5QA 2V3CC 3MX3A 2HV6A 4CS8A 3S28A 3M1CB 1JPNA 2PX3A 3B0VC 4C3DA 2CDQA 3HJCA 2KNHA 3Q6NA 2J9UA 3OWTA 3NDBB 2WB7A 3ASNC 3DM5A 2R7WA 4XLPF 2I8BA 4MNDA 5B3SC 2Y3DA 3W2WA 3LS1A 4YT5A 2Z15A 3IEEA 2DYSC 1M2VA 4RDAA 3EHNA 3ZSUA 2M4EA 1J8YF 3E9VA 3X2QC 2J0WA 3L34A 2FFHA 1ZU5A 2J9VA 1OCCC 2ZXPA 2P6VA 2XL4A 2IXPA 2VH3A 2XRHA 4U5CE 5DS4A 4BJ5C 5KYYB 3B0UX 1VOMA 4BJ6A 1TWGA 4CS8C 4J32B 3ZVRA 4PJNA 2NUPB 2KJGA 3RFYA 4FESA 3K1IC 3LNRA 1ZU4A 3EH1A 1G8XA 2PFDA 5F5HA 2IOQA 3ZG1A 4AK9A 3T4RA 1SMYF 3DM9B 3LLKA 5E3AA 3SEOA 1S7ZA 5DS6A 4W8KA 3DAGA 4ZLDA 4YJWA 5EHHA 4IWBA 1ZYRF 3EPVA 4PJMA 5D91A 4JVSA 1RJ9B 1D0XA 5E33A 3Q7GA 4QI0A 4OD4A 2XXAB 1TWHA 4CSAC 5DQZA 2YHSA 2L81A 3VAYA 5BUOA 1WGWA 1M2OA 2MYSA 4C3EA 2OG2A 3NYLA 1ST6A 4Q7CA 3PHF2 3K33A 2A68F 4O6NA 4BJ6C 4LLEA 4J30B 2X51A 3EFOA 3HTKC 4EWCA 1ZHTA 2ZPAA 3DAFA 4E7SA 2D5RB 1OCOC 4ULWA 5T3WA 5KYNA 4HFFB 4LLCA 2KGOA 4KC9A 1LS1A 3JRTA 3HLZA 3LESA 4C7OB 3TD7A 2NUTA 4RD9A 1OKKD 1W2WA 4PK4A 5B1BC 1J8MF 3N0TA 2ZXRA 3RKOF 4QI2A 2Q9CA 3EGXB 2G62A 3N24A 3EG9A 3NYMA 3EGDA 4CS9A 1VYKA 1SZIA 2YEVA 4K7BA 1M56C 3EZIA 3S0XA 2R7UA 3LJBA 1PD1A 4C3BA 4QDLA 2CNWD 4AX2A 2J7PA 3KKBA 4YT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DD7 A;  3K33 A;  3KH2 A; 
#chains in the Genus database with same CATH topology
 4U5G A;  3GM2 A;  2XLV A;  1VB5 A;  3EHM A;  1V4A A;  2L7A A;  1KNY A;  2NSF A;  2P61 A;  2R05 A;  3EZH A;  1VYI A;  3JT1 A;  1TWA A;  4XWJ A;  4IAR A;  3HNI A;  2W9Y A;  5E2Q A;  3AG3 C;  5TJ5 E;  4XLN F;  1TR2 A;  2EPK X;  4PAC A;  2KQ9 A;  3HNJ A;  1C02 A;  1HMO A;  1ZZP A;  1A7D A;  4U5E E;  3L0I A;  1NBB A;  2LFD A;  3TK0 A;  3LAY A;  5L3V A;  1M2V B;  1FMV A;  4IAO A;  4G7H F;  3ZC4 A;  1E83 A;  3FOO A;  1FFH A;  4JW1 A;  4DXW A;  1A0B A;  2IXO A;  2Y3H A;  3TQO A;  4DOZ A;  2H7B A;  3JSZ A;  3K6B A;  2R7X A;  2LD6 A;  1TKN A;  3V5X A;  4KNV A;  2WL8 A;  4XPW A;  2XL6 A;  3SZR A;  5K0I A;  1YYJ A;  2XM0 A;  4GQH A;  4WJ0 A;  4E17 A;  1K40 A;  4CS9 C;  4N06 A;  3IPM O;  2LIG A;  4AE4 A;  3GOD A;  1RKE A;  3TOL A;  1FFT C;  3C8G D;  2Q3T A;  1C03 A;  2LCH A;  3JSE O;  2G3V A;  4CDA A;  5KYX B;  1ORY A;  5KYW A;  3H65 A;  3PMR A;  4D4X A;  5A6A A;  3DJU B;  3AQB A;  1ZHX A;  4WGZ A;  4JKV A;  1QPU A;  3O10 A;  1OXB A;  3BEH A;  3MFN A;  4G0H A;  4YT4 A;  5L0I A;  1T6Q A;  2Y39 A;  2Y69 C;  3KYJ A;  4EBB A;  4XTK A;  1BBH A;  3X1O A;  5BQH A;  2XLW A;  1B68 A;  1JMW A;  2BE5 F;  1ZHY A;  5D92 A;  3T6B A;  3TJ5 A;  2VCC A;  2J45 A;  4JCH A;  4R32 A;  3ZWI A;  4Z9H A;  4YL3 A;  1LIH A;  2PBE A;  4I1M A;  2XLE A;  4RBN A;  4DBR A;  3CQZ A;  1GM5 A;  3SXY A;  3TUL A;  2W4M A;  2Q00 A;  1M57 C;  2GWW A;  2PF4 E;  3NMK A;  4I3M A;  3WG7 C;  3L8J A;  4CX9 A;  2P7V A;  5JVE A;  4YL1 A;  3O55 A;  1OR2 A;  1MMG A;  4U5B E;  4XPY A;  5L0F A;  1VTM P;  5L3Q A;  5GPG B;  2VAS A;  5A6B A;  3RIP A;  3ABK C;  3EQL F;  3K1H A;  4FX5 A;  3LEV A;  3AG1 C;  4P6I C;  3GEE A;  4MS2 A;  4MVU A;  4PR9 A;  3DE8 A;  3E70 C;  3SNH A;  2C04 A;  1FMW A;  3UR3 C;  1H7I A;  3AJM A;  3UNG C;  4JUR I;  3CZ6 A;  3U8V A;  2Q4F A;  3KPH A;  1F1M A;  2R7Q A;  1UFB A;  3HNK A;  4K0D A;  2EIL C;  3R7C A;  3ZQY A;  2V26 A;  3W8H A;  2H7V C;  4KI2 A;  4O6Y A;  1CPQ A;  2AWY A;  1HMD A;  1K05 A;  1NFN A;  4YN0 B;  2IXN A;  1D0Y A;  2XSE A;  2AP3 A;  2KYH A;  4U5D E;  3J06 A;  1ZHW A;  4J7T A;  2HZ8 A;  5JRA A;  4CDV A;  4G7O F;  2OEV A;  1LE2 A;  3PCV A;  1OXK A;  3I4U A;  3QTH A;  2IBF A;  1XWJ A;  4CBE A;  2IYL D;  4O7G A;  3TJ6 A;  3U9J A;  3C63 A;  3RYL A;  3U2L A;  3T6J A;  2A0U A;  4CJO A;  4N6H A;  1O87 A;  3KMI A;  2R7O A;  2YZS A;  2W45 A;  1IW7 F;  1FTS A;  3W2V A;  1GS9 A;  1YAU O;  2YL7 A;  3JZ0 A;  3RF3 A;  1JRA A;  2F22 A;  3OA1 A;  3FDQ A;  4MVS A;  1TFO B;  1D1C A;  3SXM A;  3V7O A;  3IQ5 A;  4YWQ A;  2A0B A;  2PX0 A;  1U0B B;  4I1O B;  2OEX A;  4NTB A;  1RJ9 A;  4ZLC A;  3DD7 A;  1AUE A;  2XXA A;  5A6J A;  1HW2 A;  3DJN B;  3KL4 A;  1T5O A;  1L7C A;  1YJG A;  3CAX A;  4PJL A;  2B0J A;  1Q0F A;  2OJE D;  3ASO C;  2WZG A;  3Q6M A;  4WGY A;  1LVK A;  3ECS A;  3RQE A;  3GWN A;  4ONS A;  1O3U A;  3M15 A;  3RW0 A;  5KYU B;  1MNE A;  2A69 F;  2YLI A;  4BG0 A;  4HFK B;  5FCL A;  4L6R A;  1XZP A;  3W4Y A;  4XPX A;  1T6U A;  3I5P A;  3H2V A;  3S27 A;  3JTL O;  2PP4 A;  4NCQ A;  3ABL C;  2RSE B;  3N2Z B;  4JEA A;  4EUK B;  4E7Z A;  1A41 A;  2WVO A;  1LPE A;  2LSE A;  4BJT A;  1T9K A;  4P9F A;  3RVY A;  1HE1 A;  2IM8 A;  3MLG A;  1EKY A;  3U3B A;  2A6H F;  1NU7 D;  3UMH A;  2HUJ A;  2OCC C;  4HEA J;  1OKK A;  4CS7 A;  1RMV A;  5IY5 C;  4GYT A;  1N1C A;  2HSB A;  2YL0 A;  3B71 A;  4ANJ A;  3IQT A;  5T1D B;  4X0R A;  4MQ9 F;  1E84 A;  4PFP A;  4E0H A;  1Z3I X;  4PJJ A;  3TOM A;  2WVQ A;  4KBL A;  3G4Z A;  2XLH A;  1V54 C;  2ASR A;  3B0P A;  2R7T A;  5COF A;  1ZHZ A;  3KH2 A;  2R7S A;  1I4Y A;  2DGJ A;  3DZA A;  4G7Z F;  2CNW A;  4DVZ A;  2Y3G A;  2VB6 A;  2WZF A;  4YL0 A;  4CJG A;  3Q7L A;  2VC9 A;  4JC7 A;  3EGX A;  3QW0 A;  1G4U S;  1U6H A;  5COM A;  2J46 A;  3RH3 A;  3VM6 A;  3VYW A;  3OEO A;  4DVY P;  1HW1 A;  2IXM A;  1NLX A;  3EJN A;  4O6M A;  1BZ4 A;  1ZW2 A;  1CGM E;  2YLG A;  3U8P A;  1MMN A;  3LS0 A;  4AE4 B;  3O6X A;  1T01 A;  4BEJ A;  4I44 A;  1YZA A;  1NFO A;  2YWA A;  2O9X A;  1QLE C;  3CEX A;  2XLD A;  3EH2 A;  1NSG B;  3NKD A;  4IRU A;  3ITF A;  4JJF A;  1YZC A;  2EIM C;  5T3T A;  3ZIB A;  3FHD A;  1D1B A;  3AG2 C;  2R03 A;  3NKE A;  1PD0 A;  3U3F A;  2A1D D;  5JUA A;  2NG1 A;  4A2N B;  2PNO A;  3M79 A;  2WVN A;  4EIY A;  4LDK A;  1OR3 A;  2A6E F;  2LFF A;  4H4K C;  1OW6 A;  3SP1 A;  2CW0 F;  2TMV P;  1NU9 C;  2EPL X;  2FGY A;  1G4W R;  4J7Y A;  4AL0 A;  2G3K A;  4BJ1 A;  3NYJ A;  2X0C A;  4NTA A;  1BR2 A;  3C8G A;  3L1M A;  3QZC A;  2ZXW C;  2RD9 A;  4LER A;  1QZX A;  1Z5Z A;  1D0Z A;  2QTV A;  2Y3B A;  3K7D A;  4CSA A;  1VLT A;  3PDM P;  1A7V A;  1RXQ A;  2OU6 A;  3QMK A;  5CI9 A;  4NY3 A;  3POV A;  4OIR F;  1MQV A;  5DLJ A;  3FAP B;  1D1A A;  2R25 A;  1AVO B;  1SYQ A;  3FVY A;  1IZM A;  4B6I A;  5L0J A;  1YVI A;  3IHU A;  1VK5 A;  4EHP A;  2DB4 A;  5KYX A;  5KYY A;  1KU2 A;  1R5I D;  2WZL A;  3UGO A;  2YRF A;  3DI5 A;  1FR0 A;  2DYR C;  1MMA A;  1OQC A;  4YT2 A;  1WWP A;  1BR4 A;  2NUP A;  4DJ9 A;  1VLS A;  1E86 A;  1K04 A;  3JCU Q;  2YL1 A;  3EFO B;  3V5Z A;  4MTO A;  2JD3 A;  5F28 E;  3VF0 A;  1I4Z A;  4H54 A;  1TWC A;  3NRH A;  2LK4 A;  4O79 A;  2Q9B A;  2KC3 A;  4PFO A;  5DS5 A;  2EIK C;  1UG7 A;  4F4B A;  1OCR C;  5DQT A;  5EK0 A;  3DMD A;  3ABM C;  3ZDL A;  4CDY A;  2MWQ A;  3AG4 C;  1OW8 A;  2OOC A;  2C03 A;  4Q5S F;  2E87 A;  2W4B A;  2L6H A;  2QY9 A;  3DKA A;  2XS1 A;  5JSL A;  4CIH A;  1Z63 A;  4JZA A;  1S05 A;  3S9O A;  4AL1 A;  2HMQ A;  4IJJ A;  1LM3 B;  2NUT B;  2HV7 A;  3GEI A;  3DXJ F;  2HMZ A;  3HKK A;  1SF8 A;  3O39 A;  1V74 B;  3C7J A;  2YKZ A;  4FWV A;  4Z9J A;  2KW3 C;  4IGG A;  3IQC A;  4LDR A;  3S29 A;  1MND A;  1TFK B;  1FAP B;  4DBQ A;  2R7R A;  1MMD A;  3LUT B;  4OIP F;  5F5F A;  3SYN A;  3UMK A;  4MTF A;  3EG9 B;  4U9D A;  3EGD B;  1YYX A;  3K66 A;  1CGO A;  1BR1 A;  2NSG A;  2JX0 A;  3AGU A;  4GEH A;  1DOW A;  3S90 A;  2GFH A;  2J0X A;  1E85 A;  4JCZ A;  5AC4 A;  2Q9A A;  3UGP A;  2HJ3 A;  3LLI A;  3RQF A;  3GAN A;  3UMI A;  3C8Z A;  2QUP A;  4M63 A;  1QSP A;  2CGE A;  3G4X A;  3W8I A;  3ZQV A;  5HV9 A;  4OIQ F;  3CSK A;  1Z23 A;  3FMS A;  1SR2 A;  4FAP B;  5EGY A;  4XEK A;  1JPJ A;  1T6I A;  2ZXO A;  1WTY A;  2EIJ C;  2L9J A;  4MW3 A;  1VMA A;  4OD5 A;  1Z6A A;  2HKV A;  1XZQ A;  5DVW A;  4HE8 D;  2EIN C;  1JR8 A;  1Q0D A;  1ZVZ A;  2EPO A;  2H7O A;  2J9W A;  4U5H A;  4MVM A;  2I15 A;  4XQ1 A;  2R02 A;  5E3C A;  2XLO A;  5B1A C;  5FZT A;  3FAJ A;  4U5F E;  3U9M A;  2EPM X;  4BEM J;  1V55 C;  4U9E A;  1OCZ C;  4JJG A;  3QVY A;  2J9B A;  4C7O A;  2YL3 A;  3AQC A;  5L0H A;  3F46 A;  2D4U A;  256B A;  2J7P D;  2YVK A;  2KK1 A;  3WOD F;  2P0N A;  3F47 A;  5HSW A;  3NG1 A;  5KYU A;  2QE9 A;  1NZE A;  2ZD9 A;  3VRC A;  2HS5 A;  2R7V A;  2L6F A;  2EPN A;  3RVZ A;  1PCX A;  3B9Q A;  1LKX A;  1O5H A;  1NG1 A;  3C18 A;  4JIO A;  1H9G A;  4KNW A;  4N4W A;  1QKR A;  4OIO F;  3JYH A;  4BJ5 A;  4MW8 A;  4IB4 A;  5CI8 A;  4OIN F;  1YDI A;  2DI3 A;  1EQ1 A;  1QQ3 A;  4Q4Z F;  1HE9 A;  3I5Q A;  4LAC B;  2V3C C;  3MX3 A;  2HV6 A;  2LQG A;  4DRJ B;  1ZW3 A;  4CS8 A;  2UUI A;  3M1C B;  3S28 A;  4K1O A;  1L3P A;  1JPN A;  2PX3 A;  3FOP A;  3B0V C;  1RKE B;  3GOR A;  3AGT A;  4C3D A;  4JTA B;  2B0H A;  2CDQ A;  3HJC A;  2KNH A;  3GM3 A;  2J9U A;  3OWT A;  3Q6N A;  2WB7 A;  2Q7R A;  1CPR A;  5BQI A;  3ASN C;  3DM5 A;  3K1I A;  3NDB B;  1EI7 A;  2BC5 A;  1PV3 A;  2R7W A;  4XLP F;  3SXZ A;  2I8B A;  3L8I A;  3V5Y A;  1RCP A;  3LNM B;  3SXK A;  3ATP A;  4MND A;  4E0I A;  5B3S C;  1KTM A;  2Y3D A;  2L6G A;  1Q0K A;  3FXH A;  3NMJ A;  2R9R B;  3R2P A;  4MVO A;  3W2W A;  3LS1 A;  2MHR A;  1E2X A;  1YLM A;  4YT5 A;  1QVX A;  3JRM O;  3C8G B;  1LE4 A;  2Z15 A;  3U2M A;  2NPU A;  3US6 A;  3IEE A;  2DYS C;  2UUH A;  3G50 A;  1JAF A;  1M2V A;  4RDA A;  3EHN A;  3ZSU A;  2AWC A;  2M4E A;  4Z9I A;  1AEP A;  4UDV A;  1J8Y F;  3E9V A;  3X2Q C;  2AU5 A;  2GAQ A;  2J0W A;  1ORJ A;  1FNT c;  3L34 A;  2FFH A;  2GA0 A;  3T9O A;  1ZU5 A;  2J9V A;  4EBJ A;  4CIP A;  1OCC C;  2ZXP A;  2P6V A;  2XL4 A;  4JTC B;  2IXP A;  2VH3 A;  2XRH A;  5B3I A;  4U5C E;  1Q0G A;  3QVZ A;  4BJ5 C;  5DS4 A;  5KYY B;  4W8P A;  3B0U X;  5JP7 A;  2M64 A;  1VOM A;  5JS5 A;  1Q0M A;  4BJ6 A;  2FAP B;  2CCY A;  3RQG A;  1TWG A;  4CS8 C;  4ULV A;  1WAT A;  4J32 B;  3U5S A;  3ZVR A;  4A4A A;  1OW7 A;  2P1A A;  4PJN A;  4YK5 A;  2NUP B;  2KSF A;  4JRZ A;  4JTD B;  1Y6D A;  2KJG A;  3MBG A;  3RFY A;  3B29 A;  4FES A;  3K1I C;  3LNR A;  1ZU4 A;  5A6B D;  3EH1 A;  1G8X A;  2AVK A;  2PFD A;  4MVZ A;  5KYW B;  5F5H A;  2IOQ A;  3AOU A;  3ZG1 A;  4AK9 A;  3T4R A;  3H2U A;  3ZTM A;  5A6K A;  1SMY F;  2HJM A;  1M6T A;  3DM9 B;  3LLK A;  2XS8 A;  4EBK A;  4N6C A;  5E3A A;  4NTF A;  3SEO A;  1S7Z A;  2ICW G;  2JPU A;  3NMI A;  2QNL A;  1I5N A;  5DS6 A;  2QLA A;  3LEO A;  4NC3 A;  4W8K A;  3DAG A;  2ETS A;  1CGN A;  4ZLD A;  2GDC A;  4YJW A;  2XL8 A;  3M4C A;  5EHH A;  3S84 A;  4IWB A;  1ZYR F;  4EKW A;  3EPV A;  4PJM A;  4D4N A;  5D91 A;  4JVS A;  1RJ9 B;  2CYD A;  1D0X A;  5E33 A;  3KYI A;  3Q7G A;  5L0G A;  4QI0 A;  4OD4 A;  1WOL A;  4BPM A;  2XXA B;  1TWH A;  4CSA C;  5DQZ A;  2YHS A;  5A69 A;  2L81 A;  3QW1 A;  3VAY A;  5BUO A;  1WGW A;  1M2O A;  2MYS A;  4C3E A;  3DE9 A;  2OG2 A;  4IAQ A;  4P9T A;  1HY5 A;  3NYL A;  1ST6 A;  2OKU A;  1Z7Q c;  1GGQ A;  1R4T A;  2H8A A;  4Q7C A;  4JEB A;  3PHF 2;  3K33 A;  2A68 F;  4O6N A;  4BJ6 C;  5JT4 A;  5CIV A;  4LLE A;  4DRI B;  3M4B A;  4E18 A;  3MYI A;  4J30 B;  2X51 A;  1EA8 A;  1YA7 O;  3EFO A;  2VCA A;  3HTK C;  4NQF A;  4EWC A;  4WAB A;  1ZHT A;  2ZPA A;  3DAF A;  4XEV A;  3DWW A;  2XM4 A;  4E7S A;  2D5R B;  1OCO C;  1TQG A;  4ULW A;  1WAS A;  4HFF B;  4JE9 A;  5T3W A;  3WAQ A;  5KYN A;  3U0C A;  4XEF A;  1LI5 A;  2OQM A;  1C17 M;  1APC A;  4LLC A;  5AC5 A;  2KGO A;  1LI7 A;  2HFI A;  1U89 A;  1ORS C;  4KC9 A;  1DOV A;  1LS1 A;  1WN0 A;  2YQY A;  3A11 A;  3HLZ A;  3BRJ A;  3JRT A;  3LES A;  4C7O B;  3GEH A;  3TD7 A;  2NUT A;  3GWL A;  4G78 A;  4RD9 A;  5L0C A;  1OKK D;  4DRH B;  1W2W A;  4MTG A;  3IQ6 A;  1GQA A;  4PK4 A;  5AGF A;  3C62 A;  5B1B C;  5BQG A;  1J8M F;  3N0T A;  2ZXR A;  3RKO F;  5L0D A;  5COG A;  3A9C A;  3JYY A;  2YLD A;  2OJQ A;  3GM1 A;  3ZTZ A;  2Q9C A;  1G5Z A;  1JOG A;  2BL2 A;  4ER9 A;  4QI2 A;  1A7E A;  2G62 A;  3EGX B;  3N24 A;  3EG9 A;  3NYM A;  3EGD A;  3WHN A;  1H9T A;  1YA9 A;  4CS9 A;  2J8W A;  3T6G B;  1VYK A;  1SZI A;  1BDJ B;  2YEV A;  1YAR O;  2VCB A;  4K7B A;  1M56 C;  3EZI A;  4LDQ A;  3S0X A;  2R7U A;  3LJB A;  3HNL A;  1PD1 A;  1Y4C A;  1H6G A;  4MVQ A;  2LP4 A;  4QDL A;  2XLM A;  4MVR A;  4C3B A;  2CNW D;  4AX2 A;  1RKC A;  3MYF A;  1LS4 A;  5JLI A;  2J7P A;  3KKB A;  4YT8 A;  2HSQ A; 
#chains in the Genus database with same CATH homology
 4U5G A;  3EHM A;  3EZH A;  3JT1 A;  1VYI A;  1TWA A;  4XWJ A;  2W9Y A;  5E2Q A;  3AG3 C;  4XLN F;  1TR2 A;  2KQ9 A;  4U5E E;  3L0I A;  3LAY A;  5L3V A;  1M2V B;  1FMV A;  4IAO A;  4G7H F;  3ZC4 A;  4JW1 A;  1FFH A;  2IXO A;  2Y3H A;  4DOZ A;  2H7B A;  3JSZ A;  3K6B A;  2R7X A;  1TKN A;  4KNV A;  2WL8 A;  3SZR A;  4WJ0 A;  4CS9 C;  4N06 A;  4AE4 A;  3GOD A;  1FFT C;  2Q3T A;  2G3V A;  5KYX B;  5KYW A;  3H65 A;  3PMR A;  3DJU B;  3AQB A;  1ZHX A;  4G0H A;  4YT4 A;  2Y39 A;  2Y69 C;  4EBB A;  4XTK A;  3X1O A;  2BE5 F;  1ZHY A;  5D92 A;  3T6B A;  2J45 A;  4JCH A;  4I1M A;  4DBR A;  4RBN A;  3CQZ A;  2W4M A;  3WG7 C;  1M57 C;  2PF4 E;  4I3M A;  2P7V A;  1MMG A;  4U5B E;  2VAS A;  3RIP A;  3ABK C;  3EQL F;  3K1H A;  4FX5 A;  3LEV A;  3AG1 C;  4P6I C;  3UR3 C;  3E70 C;  3SNH A;  3UNG C;  2C04 A;  1FMW A;  5L3Q A;  4JUR I;  3CZ6 A;  2R7Q A;  4K0D A;  2EIL C;  2V26 A;  3W8H A;  2H7V C;  4KI2 A;  4O6Y A;  4YN0 B;  2IXN A;  1D0Y A;  2XSE A;  4U5D E;  1ZHW A;  4G7O F;  3I4U A;  4CBE A;  2IYL D;  4O7G A;  3RYL A;  3T6J A;  1O87 A;  3KMI A;  2R7O A;  2YZS A;  2W45 A;  1IW7 F;  1FTS A;  3W2V A;  3OA1 A;  3FDQ A;  1D1C A;  3V7O A;  4YWQ A;  2PX0 A;  4I1O B;  1RJ9 A;  4ZLC A;  3DD7 A;  2XXA A;  3DJN B;  3KL4 A;  4PJL A;  2B0J A;  3ASO C;  2WZG A;  3Q6M A;  1LVK A;  3ECS A;  5KYU B;  1MNE A;  2A69 F;  4BG0 A;  4HFK B;  5FCL A;  3I5P A;  3S27 A;  2PP4 A;  3ABL C;  3N2Z B;  4E7Z A;  2WVO A;  2LSE A;  4BJT A;  3MLG A;  2A6H F;  1NU7 D;  3UMH A;  4HEA J;  2OCC C;  4CS7 A;  1OKK A;  5IY5 C;  4GYT A;  1N1C A;  4ANJ A;  5T1D B;  4X0R A;  4MQ9 F;  4PFP A;  1Z3I X;  4PJJ A;  2WVQ A;  4KBL A;  1V54 C;  3B0P A;  2R7T A;  1ZHZ A;  3KH2 A;  2R7S A;  2DGJ A;  3DZA A;  4G7Z F;  2CNW A;  4DVZ A;  2Y3G A;  2VB6 A;  2WZF A;  3Q7L A;  3EGX A;  2J46 A;  3RH3 A;  3VYW A;  3OEO A;  4DVY P;  2IXM A;  3EJN A;  4O6M A;  1MMN A;  3LS0 A;  4AE4 B;  3O6X A;  4BEJ A;  4I44 A;  2O9X A;  1QLE C;  3EH2 A;  3NKD A;  4IRU A;  4JJF A;  3ZIB A;  5KYW B;  3ITF A;  5T3T A;  2EIM C;  3FHD A;  1D1B A;  3AG2 C;  3NKE A;  1PD0 A;  2A1D D;  2NG1 A;  4A2N B;  2WVN A;  2A6E F;  4H4K C;  3SP1 A;  2CW0 F;  1NU9 C;  2FGY A;  2G3K A;  4BJ1 A;  3NYJ A;  1BR2 A;  3QZC A;  2ZXW C;  4LER A;  1QZX A;  1Z5Z A;  1D0Z A;  2QTV A;  2Y3B A;  3K7D A;  4CSA A;  3QMK A;  5CI9 A;  4NY3 A;  3POV A;  4OIR F;  5DLJ A;  1D1A A;  3FVY A;  1IZM A;  4B6I A;  1VK5 A;  5KYX A;  5KYY A;  1KU2 A;  2WZL A;  3UGO A;  2DYR C;  1MMA A;  4YT2 A;  1BR4 A;  2NUP A;  3JCU Q;  3EFO B;  2JD3 A;  1TWC A;  3NRH A;  4O79 A;  2Q9B A;  4PFO A;  5DS5 A;  2EIK C;  4F4B A;  1OCR C;  5DQT A;  3DMD A;  3ABM C;  2MWQ A;  3AG4 C;  2C03 A;  4Q5S F;  2E87 A;  2W4B A;  2QY9 A;  4CIH A;  1Z63 A;  4JZA A;  4IJJ A;  2NUT B;  2HV7 A;  3DXJ F;  3O39 A;  1SF8 A;  4FWV A;  2KW3 C;  3S29 A;  1MND A;  4DBQ A;  2R7R A;  1MMD A;  4OIP F;  5F5F A;  3SYN A;  3UMK A;  3EG9 B;  3EGD B;  3K66 A;  4GEH A;  1BR1 A;  2GFH A;  2J0X A;  2Q9A A;  3UGP A;  3LLI A;  3GAN A;  3UMI A;  4M63 A;  3W8I A;  2CGE A;  4OIQ F;  3CSK A;  1Z23 A;  5EGY A;  1JPJ A;  2ZXO A;  2EIJ C;  2L9J A;  1VMA A;  4OD5 A;  1Z6A A;  5DVW A;  4HE8 D;  2EIN C;  2H7O A;  2J9W A;  5E3C A;  5B1A C;  4U5H A;  3FAJ A;  4U5F E;  1V55 C;  1OCZ C;  4JJG A;  4C7O A;  3AQC A;  3F46 A;  2J7P D;  3WOD F;  3F47 A;  5HSW A;  3NG1 A;  5KYU A;  2R7V A;  1NZE A;  1PCX A;  3B9Q A;  1LKX A;  1O5H A;  1NG1 A;  4KNW A;  4OIO F;  3JYH A;  4BJ5 A;  5CI8 A;  4OIN F;  4Q4Z F;  4LAC B;  3I5Q A;  2V3C C;  3MX3 A;  2HV6 A;  4CS8 A;  3S28 A;  3M1C B;  1JPN A;  2PX3 A;  3B0V C;  4C3D A;  2CDQ A;  3HJC A;  2KNH A;  3Q6N A;  2J9U A;  3OWT A;  3NDB B;  2WB7 A;  3ASN C;  3DM5 A;  2R7W A;  4XLP F;  2I8B A;  4MND A;  5B3S C;  2Y3D A;  3W2W A;  3LS1 A;  4YT5 A;  2Z15 A;  3IEE A;  2DYS C;  1M2V A;  4RDA A;  3EHN A;  3ZSU A;  2M4E A;  1J8Y F;  3E9V A;  3X2Q C;  2J0W A;  3L34 A;  2FFH A;  1ZU5 A;  2J9V A;  1OCC C;  2ZXP A;  2P6V A;  2XL4 A;  2IXP A;  2VH3 A;  2XRH A;  4U5C E;  5DS4 A;  4BJ5 C;  5KYY B;  3B0U X;  1VOM A;  4BJ6 A;  1TWG A;  4CS8 C;  4J32 B;  3ZVR A;  4PJN A;  2NUP B;  2KJG A;  3RFY A;  4FES A;  3K1I C;  3LNR A;  1ZU4 A;  3EH1 A;  1G8X A;  2PFD A;  5F5H A;  2IOQ A;  3ZG1 A;  4AK9 A;  3T4R A;  1SMY F;  3DM9 B;  3LLK A;  5E3A A;  3SEO A;  1S7Z A;  5DS6 A;  4W8K A;  3DAG A;  4ZLD A;  4YJW A;  5EHH A;  4IWB A;  1ZYR F;  3EPV A;  4PJM A;  5D91 A;  4JVS A;  1RJ9 B;  1D0X A;  5E33 A;  3Q7G A;  4QI0 A;  4OD4 A;  2XXA B;  1TWH A;  4CSA C;  5DQZ A;  2YHS A;  2L81 A;  3VAY A;  5BUO A;  1WGW A;  1M2O A;  2MYS A;  4C3E A;  2OG2 A;  3NYL A;  1ST6 A;  4Q7C A;  3PHF 2;  3K33 A;  2A68 F;  4O6N A;  4BJ6 C;  4LLE A;  4J30 B;  2X51 A;  3EFO A;  3HTK C;  4EWC A;  1ZHT A;  2ZPA A;  3DAF A;  4E7S A;  2D5R B;  1OCO C;  4ULW A;  5T3W A;  5KYN A;  4HFF B;  4LLC A;  2KGO A;  4KC9 A;  1LS1 A;  3JRT A;  3HLZ A;  3LES A;  4C7O B;  3TD7 A;  2NUT A;  4RD9 A;  1OKK D;  1W2W A;  4PK4 A;  5B1B C;  1J8M F;  3N0T A;  2ZXR A;  3RKO F;  4QI2 A;  2Q9C A;  3EGX B;  2G62 A;  3N24 A;  3EG9 A;  3NYM A;  3EGD A;  4CS9 A;  1VYK A;  1SZI A;  2YEV A;  4K7B A;  1M56 C;  3EZI A;  3S0X A;  2R7U A;  3LJB A;  1PD1 A;  4C3B A;  4QDL A;  2CNW D;  4AX2 A;  2J7P A;  3KKB A;  4YT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...