3DD7A

Structure of doch66y in complex with the c-terminal domain of phd
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
123
Chain Sequence
b'MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGYIFNDANKRTALNSALLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death on curing protein
publication title Doc of Prophage P1 Is Inhibited by Its Antitoxin Partner Phd through Fold Complementation
pubmed doi rcsb
source organism Enterobacteria phage p1
molecule tags Ribosome inhibitor
total genus 46
structure length 123
sequence length 123
chains with identical sequence C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1870 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dd7A00
3KH2A 3K33A 3DD7A
chains in the Genus database with same CATH superfamily
2HSBA 5EK0A 4W8PA 5BQHA 1J8YF 1ZVZA 3TK0A 2EPOA 3QZCA 3W4YA 4E0HA 2NG1A 3KL4A 4PFPA 3M15A 2CYDA 1VB5A 2DB4A 2XS1A 3W8HA 3JSEO 3ITFA 2CNWA 3ASOC 3U0CA 4G7HF 4U5CE 5AGFA 4BJ5C 5F5HA 4DBRA 2R05A 3CZ6A 1LIHA 3DXJF 1Z3IX 4M63A 1OKKD 2HMZA 4O6MA 3HNKA 1LKXA 1LI7A 4CS8C 2AVKA 5DQZA 2WVQA 2H7BA 3VF0A 4A2NB 5KYYA 2YL1A 4LLEA 4YK5A 2R7UA 3DAGA 1MMAA 2ZXWC 4NTAA 2O9XA 1G5ZA 3KYIA 4CBEA 1QLEC 3H2VA 4CIHA 2EPKX 2XL6A 2UUHA 3DI5A 4RBNA 3ZDLA 2ZXOA 3GODA 3AG1C 3SEOA 2J0WA 1MNDA 2VB6A 3G50A 4MVZA 4Q7CA 5BQIA 2P7VA 1PD0A 5A6BA 2PX3A 3AQCA 4ULWA 1Y6DA 1ST6A 1GS9A 1KTMA 2OOCA 3SXYA 1AVOB 4IRUA 4PJLA 1IW7F 1Q0KA 1OW8A 5IY5C 3GM2A 2I8BA 3NYLA 5E2QA 4MW3A 3RQEA 3K33A 3E9VA 4FWVA 5JUAA 1HE9A 3T4RA 1ZU5A 4XPWA 3JYYA 2YL7A 1BR2A 2G3KA 2QLAA 2L6GA 4EUKB 4A4AA 3NKEA 4H4KC 2B0HA 2Q3TA 2YZSA 3K1HA 4O6YA 2ETSA 3AG2C 3EG9B 2DI3A 3DAFA 1WATA 4OIPF 1HE1A 2MHRA 3M4CA 1T6QA 4I1OB 4QI0A 4BEMJ 3OA1A 3DJUB 4B6IA 4CS9C 3M79A 2XLMA 1T9KA 2RD9A 1YYJA 3ZIBA 3MFNA 2KSFA 2J9VA 1HMOA 2OU6A 4YWQA 1LI5A 2D4UA 1I4YA 5K0IA 1ZU4A 3AOUA 5T3WA 4CS7A 2BE5F 3LUTB 1E83A 1SZIA 2XLEA 5KYWA 3LS0A 1ORJA 2J8WA 1FMWA 1M57C 1RKEB 2AP3A 2XLHA 2Y3GA 2YLDA 4J7YA 4JJFA 4LERA 2LK4A 1LE4A 4IAOA 2EIJC 4H54A 1NFNA 1Q0MA 4DOZA 1U89A 4Z9JA 2EILC 3JZ0A 3RFYA 2I15A 1YZAA 2WZLA 1PD1A 2H8AA 1JPNA 3DJNB 3C62A 4BJ1A 2J0XA 4WGYA 1JR8A 1YA9A 4N6HA 3S28A 4ZLCA 3GANA 4MTOA 2KYHA 1OKKA 2J9WA 4U9DA 2XM4A 5JP7A 1TFKB 3O39A 4MVQA 2XXAB 4JTDB 1D0YA 1NU9C 1SYQA 3AG4C 3ASNC 4UDVA 4CS9A 2AWCA 3CQZA 5COMA 4CDYA 1EQ1A 2PBEA 2XL4A 1OR3A 4OIQF 1TWAA 2EIKC 1OXBA 2R7RA 2VCAA 4IAQA 4W8KA 5KYNA 3ZQYA 3UGOA 4R32A 1JAFA 1RJ9A 1V54C 1M2VB 1YYXA 3GEEA 5B1AC 3NDBB 2WL8A 5FCLA 5A6JA 3FDQA 1C17M 3ABLC 1T5OA 2P1AA 2ZXPA 3LS1A 1D0ZA 2DYSC 2X0CA 2OEXA 1IZMA 2IM8A 1TKNA 5A69A 3EJNA 1ZHXA 5F28E 3PHF2 4FAPB 2PF4E 3QTHA 2DYRC 3EHMA 3F46A 2HJ3A 1J8MF 5B3SC 3AGTA 2L7AA 1QVXA 4RD9A 4Z9HA 2XS8A 3M1CB 3U9JA 5DS6A 2XM0A 4OINF 1BR1A 3HLZA 1AUEA 1K40A 2ZXRA 2P61A 2IXNA 4DVZA 2R25A 2TMVP 1C03A 1QPUA 3FMSA 3NYJA 3RH3A 3W2WA 1R4TA 4K1OA 3FAJA 1BDJB 3KH2A 3WODF 4NCQA 4Q4ZF 1H6GA 4XLNF 2WVNA 2UUIA 3W2VA 1YVIA 2IXOA 2A0UA 3HJCA 3U9MA 3ABKC 1WTYA 1BR4A 1WGWA 2FFHA 3LNRA 1GGQA 2YRFA 4WJ0A 4DBQA 3HNLA 1D1CA 1HY5A 3EFOB 2OJQA 1D1AA 1KU2A 2DGJA 1Z5ZA 4LDRA 3WHNA 3RW0A 2Q9BA 4NY3A 4C3BA 2QE9A 2EIMC 1CPQA 4JC7A 2KW3C 3X1OA 3S84A 1T6IA 3JCUQ 3FXHA 3JSZA 4HE8D 3U8VA 4E17A 4F4BA 1E85A 5JS5A 5GPGB 3RQGA 3T6BA 1UG7A 3RVYA 4CJOA 3PDMP 3UGPA 1A0BA 1FFHA 1U6HA 2CCYA 1O5HA 2NUPB 4MQ9F 4XWJA 5L0DA 1B68A 4NC3A 4AE4B 4ULVA 2YHSA 1CGME 1A7DA 5B1BC 2HV6A 2CDQA 4N6CA 3NYMA 2HMQA 4P9TA 1ZHYA 2ASRA 2HUJA 4U5GA 2W4MA 3IQCA 2R7XA 2OQMA 1VLTA 2XLDA 5L0CA 4QI2A 1ZW2A 4KNVA 2R7QA 1A7VA 2QUPA 3V5YA 1O87A 2VASA 1R5ID 3AQBA 1TWCA 1GQAA 3LNMB 4CDVA 2Y3DA 1FTSA 2JX0A 3SNHA 1MMNA 2L6FA 2A68F 1WASA 5TJ5E 1RXQA 1EKYA 1FR0A 2IXPA 3S29A 1N1CA 2HSQA 2LSEA 5DVWA 2F22A 2GAQA 3RKOF 1YARO 2VH3A 4CX9A 5BQGA 5KYUA 4MVSA 4K0DA 3EZIA 1UFBA 3GORA 4U5HA 2LQGA 2XXAA 1EA8A 5COFA 2LIGA 4MVMA 2OCCC 1M56C 3KPHA 4IWBA 3JTLO 1FFTC 3DM9B 3C7JA 3VRCA 3NG1A 1D0XA 1ZZPA 4PR9A 4U5EE 5EGYA 4D4XA 2IYLD 2OKUA 4ER9A 3B0UX 5EHHA 1O3UA 3S90A 2MWQA 1MNEA 2A0BA 2A6EF 2NPUA 1OW7A 3NKDA 1VTMP 2H7OA 4NTBA 2ICWG 2JD3A 2NSFA 2YL3A 3GM1A 3MLGA 1HMDA 2YWAA 3O10A 2EPMX 3U3BA 3RYLA 3FAPB 1F1MA 4PJMA 3W8IA 4L6RA 3VYWA 3C63A 1A7EA 1Z23A 3IQ6A 3BEHA 5E3AA 2R7SA 3AGUA 4E7SA 3UMHA 3GM3A 1LVKA 1YZCA 2J7PA 3FHDA 3ZWIA 2YKZA 1RCPA 2Y39A 3G4ZA 3O55A 1CGOA 4WGZA 1G8XA 3SZRA 5DLJA 2HZ8A 3TJ6A 3S0XA 4ZLDA 2RSEB 3IQ5A 4HEAJ 2XL8A 1Z7Qc 3EGDB 1APCA 2NUTA 3C8GB 3VM6A 3EHNA 4MVOA 5A6KA 4JCZA 5DS4A 2FAPB 5D91A 3SXZA 4JKVA 1JPJA 3L1MA 4YT4A 2Z15A 2KK1A 2L6HA 1KNYA 3QMKA 3QW0A 5HSWA 4MTFA 1E84A 2WZGA 2PFDA 4BEJA 3Q7GA 1TFOB 2NSGA 2MYSA 2P6VA 3AG3C 3NMKA 3R7CA 2VC9A 4NTFA 1TQGA 4U5BE 3J06A 3UMKA 1OXKA 5AC4A 4O7GA 3ZTZA 3MBGA 5JVEA 3F47A 5KYYB 1I5NA 2A69F 3HKKA 4DXWA 3S27A 2WB7A 4C3DA 4IB4A 3K1IC 3KKBA 3QVYA 4JCHA 2HS5A 4KI2A 2LP4A 2J46A 1OCCC 3Q7LA 4OD5A 1FAPB 4RDAA 1JRAA 2YL0A 4JE9A 4LDQA 4ONSA 4YJWA 4YN0B 3V5ZA 5F5FA 2KGOA 3UR3C 1MQVA 3TOLA 2YEVA 3TD7A 1JMWA 3KYJA 3N2ZB 3B0VC 2PP4A 1S7ZA 2P0NA 3SYNA 5L0HA 5KYXB 3H65A 2HFIA 2KC3A 2HJMA 3U8PA 1CGNA 2C04A 1HW2A 2XRHA 3V7OA 4Z9IA 2ZD9A 2PX0A 3GEHA 4O79A 1QKRA 3L8IA 4LDKA 4YL1A 3MYFA 5E3CA 2A1DD 2KNHA 3WAQA 2L9JA 5JLIA 4DRJB 3DM5A 4E18A 5JRAA 2D5RB 2XLVA 3CSKA 2EINC 1YAUO 3NRHA 4FX5A 4U5DE 2J7PD 4J30B 1HW1A 2IOQA 3EPVA 3K1IA 3POVA 3EG9A 2J9BA 4JTCB 2H7VC 1VYIA 4MVRA 3EGXB 1PCXA 3I5PA 3O6XA 5DQTA 4JIOA 2GA0A 4J7TA 3PCVA 1OCOC 1TWHA 4IGGA 3Q6NA 3ZG1A 1W2WA 2YVKA 1VYKA 3U2LA 1OCRC 2G62A 1OCZC 5CIVA 4GQHA 4NQFA 1OR2A 4P9FA 1M2OA 4MVUA 3DMDA 5DS5A 4E0IA 2HV7A 3NMJA 4JJGA 3JT1A 4YL3A 5L0JA 5L0FA 1Z63A 4C7OB 3AJMA 1Y4CA 2FGYA 4KC9A 4PACA 1YA7O 3B9QA 4OIRF 4BG0A 4DRHB 1RKEA 2OJED 2OG2A 2J45A 2R7WA 2Q9AA 3LLIA 4U9EA 3PMRA 3MYIA 5HV9A 3I4UA 4KNWA 1I4ZA 3TOMA 3CEXA 3LEOA 3C8GA 2E87A 2LFFA 4I44A 1VOMA 3KMIA 3DZAA 5L3VA 3M4BA 1E86A 1MMDA 2V3CC 2EPNA 4FESA 1RJ9B 4C3EA 2BC5A 3EQLF 5L0GA 1L3PA 3K6BA 2JPUA 1YJGA 1ZYRF 5D92A 3ZTMA 4JW1A 4JTAB 1LS1A 3K7DA 4CSAA 2G3VA 2V26A 3ATPA 1QZXA 4J32B 3DE9A 1G4WR 3B0PA 5T3TA 1FMVA 4I1MA 1SR2A 1RMVA 1D1BA 3OEOA 3DE8A 1BZ4A 4BJ6A 1NZEA 4X0RA 1M2VA 3RVZA 3RIPA 1K04A 1OQCA 3U5SA 3B29A 1BBHA 1WN0A 5BUOA 1XZPA 3FVYA 5A6AA 1ORSC 2Q4FA 1NBBA 3E70C 3G4XA 4GYTA 4MS2A 3SXKA 3C18A 2C03A 3ECSA 3OWTA 5AC5A 4XPXA 4XEKA 2WVOA 5CI9A 5B3IA 1LPEA 4DJ9A 2Y69C 4BPMA 3UMIA 4YL0A 2LD6A 5KYXA 2R7VA 2QNLA 4JRZA 2KJGA 3DWWA 1Q0GA 3QVZA 3EZHA 4AL1A 3QW1A 3S9OA 4KBLA 1ZW3A 1U0BB 5CI8A 2PNOA 1SMYF 4CDAA 1RKCA 4BJ5A 4AK9A 2LCHA 3I5QA 4DVYP 4P6IC 4G7ZF 2Y3BA 4Q5SF 1LS4A 4PK4A 1Z6AA 2OEVA 3HTKC 3T6GB 4PJNA 4YT2A 3SXMA 4CS8A 2M4EA 4JEBA 1DOVA 4JURI 4U5FE 4XPYA 4LLCA 2XLWA 1YDIA 1A41A 3GEIA 4QDLA 3EFOA 4BJTA 3GWNA 3HNJA 3JRTA 2Q9CA 2VCBA 2X51A 3HNIA 2BL2A 3EH2A 4MTGA 1T01A 1WOLA 2GDCA 4N06A 4XEVA 3LEVA 5FZTA 3T9OA 4E7ZA 2W4BA 2M64A 3UNGC 4OIOF 3EGXA 2CGEA 3TULA 4EIYA 1VMAA 2NUPA 3VAYA 3U2MA 3GWLA 4AE4A 1LM3B 1OW6A 1YLMA 3TJ5A 4GEHA 3C8GD 3IEEA 4PFOA 4EBJA 1NLXA 4EWCA 4EKWA 3RF3A 2R7TA 1V4AA 3ZSUA 3H2UA 1FNTc 3LJBA 5L0IA 1NU7D 2XLOA 4YT5A 1H7IA 4G7OF 2CNWD 2R7OA 2Q7RA 5T1DB 4C7OA 2WZFA 1NFOA 2YQYA 4XQ1A 4HFFB 2KQ9A 5KYUB 1M6TA 3SP1A 1SF8A 2IBFA 3NMIA 4EBKA 3ZQVA 1C02A 1K05A 3L0IA 1E2XA 3L34A 4XLPF 1WWPA 1AEPA 1H9TA 2R9RB 3V5XA 2W9YA 1GM5A 2LFDA 3LLKA 4JZAA 5JT4A 3A11A 3IHUA 4JEAA 4YT8A 1MMGA 2J9UA 4AL0A 4PJJA 4CJGA 5L3QA 2A6HF 4N4WA 3R2PA 3MX3A 1EI7A 4ANJA 1ZHTA 2XSEA 3Q6MA 4EHPA 5A6BD 2Y3HA 2R02A 5JSLA 256BA 1QSPA 4MW8A 4DRIB 3A9CA 4K7BA 3CAXA 2GWWA 3FOPA 5COGA 3JRMO 3ABMC 4OD4A 1Q0FA 2AU5A 3ZVRA 1S05A 2YLGA 4G0HA 4O6NA 3ZC4A 2W45A 3B71A 4JVSA 1V74B 1VK5A 3X2QC 2CW0F 3BRJA 3JYHA 4XTKA 4CSAC 3US6A 2QY9A 3U3FA 1LE2A 3DKAA 1H9GA 1XZQA 1QQ3A 4WABA 2GFHA 3LAYA 2Q00A 3DD7A 1T6UA 4D4NA 5KYWB 1CPRA 2B0JA 4I3MA 3IPMO 1ZHZA 2YLIA 2ZPAA 3C8ZA 3IQTA 3N24A 1TR2A 4BJ6C 2HKVA 2L81A 1TWGA 1XWJA 3N0TA 2AWYA 2R03A 4XEFA 1ORYA 2NUTB 4EBBA 3TQOA 4IARA 1DOWA 2VCCA 3L8JA 4IJJA 3T6JA 2IXMA 3LESA 1VLSA 1ZHWA 3WG7C 1V55C 4MNDA 3K66A 1L7CA 4LACB 1Q0DA 4G78A 2QTVA 5E33A 3RQFA 1PV3A 1NSGB 4AX2A 4CIPA 3EGDA 1NG1A 2EPLX 3FOOA 1G4US 1JOGA 3EH1A 4HFKB
chains in the Genus database with same CATH topology
1J8YF 3QZCA 2NG1A 3KL4A 4PFPA 3W8HA 3ITFA 2CNWA 3ASOC 4G7HF 4U5CE 4BJ5C 4DBRA 5F5HA 3CZ6A 4M63A 3DXJF 1Z3IX 1OKKD 4O6MA 1LKXA 4CS8C 5DQZA 2WVQA 2H7BA 4A2NB 5KYYA 4LLEA 2R7UA 3DAGA 1MMAA 2ZXWC 2O9XA 2R7SA 4CIHA 4CBEA 1QLEC 4RBNA 2ZXOA 3GODA 3AG1C 3SEOA 2J0WA 1MNDA 2VB6A 4Q7CA 2P7VA 1PD0A 2PX3A 3AQCA 4ULWA 1ST6A 4IRUA 4PJLA 1IW7F 5IY5C 2I8BA 3NYLA 5E2QA 3K33A 3E9VA 4FWVA 3T4RA 1ZU5A 1BR2A 2G3KA 3NKEA 4H4KC 3K1HA 2Q3TA 2YZSA 4O6YA 3AG2C 3EG9B 3DAFA 4OIPF 4I1OB 4QI0A 3OA1A 3DJUB 4B6IA 4CS9C 3ZIBA 2J9VA 4YWQA 1ZU4A 5T3WA 4CS7A 2BE5F 1SZIA 5KYWA 3LS0A 1FMWA 1M57C 2Y3GA 4LERA 4JJFA 4IAOA 2EIJC 4DOZA 3RFYA 2EILC 2WZLA 1PD1A 1JPNA 3DJNB 4BJ1A 2J0XA 3S28A 4ZLCA 3GANA 1OKKA 2J9WA 3O39A 2XXAB 1D0YA 1NU9C 3AG4C 3ASNC 4CS9A 3CQZA 2XL4A 4OIQF 1TWAA 2EIKC 2R7RA 4W8KA 3UGOA 5KYNA 1RJ9A 1V54C 1M2VB 5B1AC 3NDBB 2WL8A 5FCLA 3FDQA 3ABLC 2ZXPA 3LS1A 1D0ZA 2DYSC 1IZMA 1TKNA 3EJNA 1ZHXA 3PHF2 2PF4E 2DYRC 3EHMA 3F46A 1J8MF 5B3SC 4RD9A 3M1CB 5DS6A 4OINF 1BR1A 3HLZA 2ZXRA 2IXNA 4DVZA 3NYJA 3RH3A 3W2WA 3FAJA 3KH2A 3WODF 4Q4ZF 4XLNF 2WVNA 3W2VA 2IXOA 3HJCA 3ABKC 2FFHA 1BR4A 1WGWA 3LNRA 4WJ0A 4DBQA 1D1CA 3EFOB 1D1AA 1KU2A 2DGJA 1Z5ZA 2Q9BA 4NY3A 4C3BA 2EIMC 2KW3C 3X1OA 3JCUQ 3JSZA 4HE8D 4F4BA 3T6BA 3UGPA 1FFHA 2NUPB 4XWJA 1O5HA 4MQ9F 4AE4B 2YHSA 5B1BC 2HV6A 2CDQA 3NYMA 1ZHYA 4U5GA 2W4MA 2R7XA 4QI2A 4KNVA 2R7QA 1O87A 2VASA 3AQBA 1TWCA 2Y3DA 1FTSA 3SNHA 1MMNA 2A68F 2IXPA 3S29A 1N1CA 2LSEA 5DVWA 3RKOF 2VH3A 5KYUA 4K0DA 3EZIA 4U5HA 2XXAA 2OCCC 1M56C 4IWBA 1FFTC 3DM9B 3NG1A 1D0XA 4U5EE 5EGYA 2IYLD 3B0UX 5EHHA 2MWQA 1MNEA 2A6EF 3NKDA 2H7OA 2JD3A 3MLGA 4OIOF 3RYLA 4PJMA 3W8IA 3VYWA 1Z23A 5E3AA 4E7SA 3UMHA 1LVKA 2J7PA 3FHDA 2Y39A 3SZRA 1G8XA 5DLJA 3S0XA 4ZLDA 4HEAJ 3EGDB 2NUTA 3EHNA 5DS4A 5D91A 1JPJA 4YT4A 2Z15A 3QMKA 5HSWA 2WZGA 2PFDA 4BEJA 3Q7GA 2MYSA 2P6VA 3AG3C 4U5BE 3UMKA 5KYYB 4O7GA 3F47A 2A69F 3S27A 2WB7A 4C3DA 3K1IC 3KKBA 4JCHA 4KI2A 2J46A 1OCCC 3Q7LA 4OD5A 4RDAA 4YJWA 4YN0B 5F5FA 2KGOA 3UR3C 2YEVA 3TD7A 3N2ZB 3B0VC 2PP4A 1S7ZA 5KYXB 3SYNA 3H65A 2C04A 2XRHA 3V7OA 2PX0A 4O79A 5E3CA 2A1DD 2KNHA 2L9JA 3DM5A 2D5RB 3CSKA 2EINC 3NRHA 4FX5A 4U5DE 2J7PD 4J30B 2IOQA 3EPVA 3POVA 3EG9A 2H7VC 1VYIA 3EGXB 1PCXA 3I5PA 3O6XA 5DQTA 1OCOC 1TWHA 3Q6NA 3ZG1A 1W2WA 1VYKA 1OCRC 2G62A 1OCZC 1M2OA 3DMDA 5DS5A 2HV7A 4JJGA 3JT1A 1Z63A 4C7OB 2FGYA 4KC9A 4OIRF 3B9QA 4BG0A 2OG2A 2J45A 2R7WA 2Q9AA 3LLIA 3PMRA 3I4UA 4KNWA 2E87A 4I44A 1VOMA 3KMIA 3DZAA 5L3VA 1MMDA 2V3CC 4FESA 1RJ9B 4C3EA 3EQLF 3K6BA 5D92A 1ZYRF 4CSAA 4JW1A 1LS1A 3K7DA 2G3VA 2V26A 1QZXA 4J32B 3B0PA 5T3TA 1FMVA 4I1MA 1D1BA 3OEOA 4BJ6A 1NZEA 4X0RA 1M2VA 3RIPA 5BUOA 3FVYA 4GYTA 3E70C 3OWTA 2C03A 3ECSA 2WVOA 5CI9A 2Y69C 3UMIA 5KYXA 2R7VA 2KJGA 3EZHA 4KBLA 5CI8A 1SMYF 4BJ5A 4AK9A 3I5QA 4DVYP 4P6IC 4G7ZF 2Y3BA 4Q5SF 4PK4A 1Z6AA 4YT2A 3HTKC 4PJNA 4CS8A 2M4EA 4JURI 4U5FE 4LLCA 4QDLA 4BJTA 3EFOA 3JRTA 2Q9CA 2X51A 3EH2A 4N06A 3LEVA 4E7ZA 2W4BA 3UNGC 3EGXA 2CGEA 1VMAA 2NUPA 3VAYA 4AE4A 4GEHA 3IEEA 4PFOA 4EWCA 2R7TA 3ZSUA 3LJBA 1NU7D 4YT5A 4G7OF 2CNWD 2R7OA 4C7OA 5T1DB 2WZFA 4HFFB 2KQ9A 5KYUB 3SP1A 1SF8A 3L0IA 3L34A 4XLPF 2W9YA 3LLKA 4JZAA 4YT8A 5L3QA 1MMGA 2J9UA 4PJJA 2A6HF 3MX3A 4ANJA 1ZHTA 2XSEA 3Q6MA 2Y3HA 4K7BA 3ABMC 4OD4A 3ZVRA 4G0HA 4O6NA 3ZC4A 2W45A 4JVSA 1VK5A 3X2QC 2CW0F 3JYHA 4XTKA 4CSAC 2QY9A 2GFHA 3LAYA 3DD7A 5KYWB 2B0JA 4I3MA 1ZHZA 2ZPAA 3N24A 1TR2A 4BJ6C 2L81A 1TWGA 3N0TA 2NUTB 4EBBA 3T6JA 4IJJA 2IXMA 3LESA 1ZHWA 3WG7C 1V55C 4MNDA 3K66A 5E33A 4LACB 2QTVA 4AX2A 3EGDA 1NG1A 3EH1A 4HFKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KH2 A;  3K33 A;  3DD7 A; 
#chains in the Genus database with same CATH topology
 2HSB A;  5EK0 A;  4W8P A;  5BQH A;  1J8Y F;  1ZVZ A;  3TK0 A;  2EPO A;  3QZC A;  3W4Y A;  4E0H A;  2NG1 A;  3KL4 A;  4PFP A;  3M15 A;  2CYD A;  1VB5 A;  2DB4 A;  2XS1 A;  3W8H A;  3JSE O;  3ITF A;  2CNW A;  3ASO C;  3U0C A;  4G7H F;  4U5C E;  5AGF A;  4BJ5 C;  5F5H A;  4DBR A;  2R05 A;  3CZ6 A;  1LIH A;  3DXJ F;  1Z3I X;  4M63 A;  1OKK D;  2HMZ A;  4O6M A;  3HNK A;  1LKX A;  1LI7 A;  4CS8 C;  2AVK A;  5DQZ A;  2WVQ A;  2H7B A;  3VF0 A;  4A2N B;  5KYY A;  2YL1 A;  4LLE A;  4YK5 A;  2R7U A;  3DAG A;  1MMA A;  2ZXW C;  4NTA A;  2O9X A;  1G5Z A;  3KYI A;  4CBE A;  1QLE C;  3H2V A;  4CIH A;  2EPK X;  2XL6 A;  2UUH A;  3DI5 A;  4RBN A;  3ZDL A;  2ZXO A;  3GOD A;  3AG1 C;  3SEO A;  2J0W A;  1MND A;  2VB6 A;  3G50 A;  4MVZ A;  4Q7C A;  5BQI A;  2P7V A;  1PD0 A;  5A6B A;  2PX3 A;  3AQC A;  4ULW A;  1Y6D A;  1ST6 A;  1GS9 A;  1KTM A;  2OOC A;  3SXY A;  1AVO B;  4IRU A;  4PJL A;  1IW7 F;  1Q0K A;  1OW8 A;  5IY5 C;  3GM2 A;  2I8B A;  3NYL A;  5E2Q A;  4MW3 A;  3RQE A;  3K33 A;  3E9V A;  4FWV A;  5JUA A;  1HE9 A;  3T4R A;  1ZU5 A;  4XPW A;  3JYY A;  2YL7 A;  1BR2 A;  2G3K A;  2QLA A;  2L6G A;  4EUK B;  4A4A A;  3NKE A;  4H4K C;  2B0H A;  2Q3T A;  2YZS A;  3K1H A;  4O6Y A;  2ETS A;  3AG2 C;  3EG9 B;  2DI3 A;  3DAF A;  1WAT A;  4OIP F;  1HE1 A;  2MHR A;  3M4C A;  1T6Q A;  4I1O B;  4QI0 A;  4BEM J;  3OA1 A;  3DJU B;  4B6I A;  4CS9 C;  3M79 A;  2XLM A;  1T9K A;  2RD9 A;  1YYJ A;  3ZIB A;  3MFN A;  2KSF A;  2J9V A;  1HMO A;  2OU6 A;  4YWQ A;  1LI5 A;  2D4U A;  1I4Y A;  5K0I A;  1ZU4 A;  3AOU A;  5T3W A;  4CS7 A;  2BE5 F;  3LUT B;  1E83 A;  1SZI A;  2XLE A;  5KYW A;  3LS0 A;  1ORJ A;  2J8W A;  1FMW A;  1M57 C;  1RKE B;  2AP3 A;  2XLH A;  2Y3G A;  2YLD A;  4J7Y A;  4JJF A;  4LER A;  2LK4 A;  1LE4 A;  4IAO A;  2EIJ C;  4H54 A;  1NFN A;  1Q0M A;  4DOZ A;  1U89 A;  4Z9J A;  2EIL C;  3JZ0 A;  3RFY A;  2I15 A;  1YZA A;  2WZL A;  1PD1 A;  2H8A A;  1JPN A;  3DJN B;  3C62 A;  4BJ1 A;  2J0X A;  4WGY A;  1JR8 A;  1YA9 A;  4N6H A;  3S28 A;  4ZLC A;  3GAN A;  4MTO A;  2KYH A;  1OKK A;  2J9W A;  4U9D A;  2XM4 A;  5JP7 A;  1TFK B;  3O39 A;  4MVQ A;  2XXA B;  4JTD B;  1D0Y A;  1NU9 C;  1SYQ A;  3AG4 C;  3ASN C;  4UDV A;  4CS9 A;  2AWC A;  3CQZ A;  5COM A;  4CDY A;  1EQ1 A;  2PBE A;  2XL4 A;  1OR3 A;  4OIQ F;  1TWA A;  2EIK C;  1OXB A;  2R7R A;  2VCA A;  4IAQ A;  4W8K A;  5KYN A;  3ZQY A;  3UGO A;  4R32 A;  1JAF A;  1RJ9 A;  1V54 C;  1M2V B;  1YYX A;  3GEE A;  5B1A C;  3NDB B;  2WL8 A;  5FCL A;  5A6J A;  3FDQ A;  1C17 M;  3ABL C;  1T5O A;  2P1A A;  2ZXP A;  3LS1 A;  1D0Z A;  2DYS C;  2X0C A;  2OEX A;  1IZM A;  2IM8 A;  1TKN A;  5A69 A;  3EJN A;  1ZHX A;  5F28 E;  3PHF 2;  4FAP B;  2PF4 E;  3QTH A;  2DYR C;  3EHM A;  3F46 A;  2HJ3 A;  1J8M F;  5B3S C;  3AGT A;  2L7A A;  1QVX A;  4RD9 A;  4Z9H A;  2XS8 A;  3M1C B;  3U9J A;  5DS6 A;  2XM0 A;  4OIN F;  1BR1 A;  3HLZ A;  1AUE A;  1K40 A;  2ZXR A;  2P61 A;  2IXN A;  4DVZ A;  2R25 A;  2TMV P;  1C03 A;  1QPU A;  3FMS A;  3NYJ A;  3RH3 A;  3W2W A;  1R4T A;  4K1O A;  3FAJ A;  1BDJ B;  3KH2 A;  3WOD F;  4NCQ A;  4Q4Z F;  1H6G A;  4XLN F;  2WVN A;  2UUI A;  3W2V A;  1YVI A;  2IXO A;  2A0U A;  3HJC A;  3U9M A;  3ABK C;  1WTY A;  1BR4 A;  1WGW A;  2FFH A;  3LNR A;  1GGQ A;  2YRF A;  4WJ0 A;  4DBQ A;  3HNL A;  1D1C A;  1HY5 A;  3EFO B;  2OJQ A;  1D1A A;  1KU2 A;  2DGJ A;  1Z5Z A;  4LDR A;  3WHN A;  3RW0 A;  2Q9B A;  4NY3 A;  4C3B A;  2QE9 A;  2EIM C;  1CPQ A;  4JC7 A;  2KW3 C;  3X1O A;  3S84 A;  1T6I A;  3JCU Q;  3FXH A;  3JSZ A;  4HE8 D;  3U8V A;  4E17 A;  4F4B A;  1E85 A;  5JS5 A;  5GPG B;  3RQG A;  3T6B A;  1UG7 A;  3RVY A;  4CJO A;  3PDM P;  3UGP A;  1A0B A;  1FFH A;  1U6H A;  2CCY A;  1O5H A;  2NUP B;  4MQ9 F;  4XWJ A;  5L0D A;  1B68 A;  4NC3 A;  4AE4 B;  4ULV A;  2YHS A;  1CGM E;  1A7D A;  5B1B C;  2HV6 A;  2CDQ A;  4N6C A;  3NYM A;  2HMQ A;  4P9T A;  1ZHY A;  2ASR A;  2HUJ A;  4U5G A;  2W4M A;  3IQC A;  2R7X A;  2OQM A;  1VLT A;  2XLD A;  5L0C A;  4QI2 A;  1ZW2 A;  4KNV A;  2R7Q A;  1A7V A;  2QUP A;  3V5Y A;  1O87 A;  2VAS A;  1R5I D;  3AQB A;  1TWC A;  1GQA A;  3LNM B;  4CDV A;  2Y3D A;  1FTS A;  2JX0 A;  3SNH A;  1MMN A;  2L6F A;  2A68 F;  1WAS A;  5TJ5 E;  1RXQ A;  1EKY A;  1FR0 A;  2IXP A;  3S29 A;  1N1C A;  2HSQ A;  2LSE A;  5DVW A;  2F22 A;  2GAQ A;  3RKO F;  1YAR O;  2VH3 A;  4CX9 A;  5BQG A;  5KYU A;  4MVS A;  4K0D A;  3EZI A;  1UFB A;  3GOR A;  4U5H A;  2LQG A;  2XXA A;  1EA8 A;  5COF A;  2LIG A;  4MVM A;  2OCC C;  1M56 C;  3KPH A;  4IWB A;  3JTL O;  1FFT C;  3DM9 B;  3C7J A;  3VRC A;  3NG1 A;  1D0X A;  1ZZP A;  4PR9 A;  4U5E E;  5EGY A;  4D4X A;  2IYL D;  2OKU A;  4ER9 A;  3B0U X;  5EHH A;  1O3U A;  3S90 A;  2MWQ A;  1MNE A;  2A0B A;  2A6E F;  2NPU A;  1OW7 A;  3NKD A;  1VTM P;  2H7O A;  4NTB A;  2ICW G;  2JD3 A;  2NSF A;  2YL3 A;  3GM1 A;  3MLG A;  1HMD A;  2YWA A;  3O10 A;  2EPM X;  3U3B A;  3RYL A;  3FAP B;  1F1M A;  4PJM A;  3W8I A;  4L6R A;  3VYW A;  3C63 A;  1A7E A;  1Z23 A;  3IQ6 A;  3BEH A;  5E3A A;  2R7S A;  3AGU A;  4E7S A;  3UMH A;  3GM3 A;  1LVK A;  1YZC A;  2J7P A;  3FHD A;  3ZWI A;  2YKZ A;  1RCP A;  2Y39 A;  3G4Z A;  3O55 A;  1CGO A;  4WGZ A;  1G8X A;  3SZR A;  5DLJ A;  2HZ8 A;  3TJ6 A;  3S0X A;  4ZLD A;  2RSE B;  3IQ5 A;  4HEA J;  2XL8 A;  1Z7Q c;  3EGD B;  1APC A;  2NUT A;  3C8G B;  3VM6 A;  3EHN A;  4MVO A;  5A6K A;  4JCZ A;  5DS4 A;  2FAP B;  5D91 A;  3SXZ A;  4JKV A;  1JPJ A;  3L1M A;  4YT4 A;  2Z15 A;  2KK1 A;  2L6H A;  1KNY A;  3QMK A;  3QW0 A;  5HSW A;  4MTF A;  1E84 A;  2WZG A;  2PFD A;  4BEJ A;  3Q7G A;  1TFO B;  2NSG A;  2MYS A;  2P6V A;  3AG3 C;  3NMK A;  3R7C A;  2VC9 A;  4NTF A;  1TQG A;  4U5B E;  3J06 A;  3UMK A;  1OXK A;  5AC4 A;  4O7G A;  3ZTZ A;  3MBG A;  5JVE A;  3F47 A;  5KYY B;  1I5N A;  2A69 F;  3HKK A;  4DXW A;  3S27 A;  2WB7 A;  4C3D A;  4IB4 A;  3K1I C;  3KKB A;  3QVY A;  4JCH A;  2HS5 A;  4KI2 A;  2LP4 A;  2J46 A;  1OCC C;  3Q7L A;  4OD5 A;  1FAP B;  4RDA A;  1JRA A;  2YL0 A;  4JE9 A;  4LDQ A;  4ONS A;  4YJW A;  4YN0 B;  3V5Z A;  5F5F A;  2KGO A;  3UR3 C;  1MQV A;  3TOL A;  2YEV A;  3TD7 A;  1JMW A;  3KYJ A;  3N2Z B;  3B0V C;  2PP4 A;  1S7Z A;  2P0N A;  3SYN A;  5L0H A;  5KYX B;  3H65 A;  2HFI A;  2KC3 A;  2HJM A;  3U8P A;  1CGN A;  2C04 A;  1HW2 A;  2XRH A;  3V7O A;  4Z9I A;  2ZD9 A;  2PX0 A;  3GEH A;  4O79 A;  1QKR A;  3L8I A;  4LDK A;  4YL1 A;  3MYF A;  5E3C A;  2A1D D;  2KNH A;  3WAQ A;  2L9J A;  5JLI A;  4DRJ B;  3DM5 A;  4E18 A;  5JRA A;  2D5R B;  2XLV A;  3CSK A;  2EIN C;  1YAU O;  3NRH A;  4FX5 A;  4U5D E;  2J7P D;  4J30 B;  1HW1 A;  2IOQ A;  3EPV A;  3K1I A;  3POV A;  3EG9 A;  2J9B A;  4JTC B;  2H7V C;  1VYI A;  4MVR A;  3EGX B;  1PCX A;  3I5P A;  3O6X A;  5DQT A;  4JIO A;  2GA0 A;  4J7T A;  3PCV A;  1OCO C;  1TWH A;  4IGG A;  3Q6N A;  3ZG1 A;  1W2W A;  2YVK A;  1VYK A;  3U2L A;  1OCR C;  2G62 A;  1OCZ C;  5CIV A;  4GQH A;  4NQF A;  1OR2 A;  4P9F A;  1M2O A;  4MVU A;  3DMD A;  5DS5 A;  4E0I A;  2HV7 A;  3NMJ A;  4JJG A;  3JT1 A;  4YL3 A;  5L0J A;  5L0F A;  1Z63 A;  4C7O B;  3AJM A;  1Y4C A;  2FGY A;  4KC9 A;  4PAC A;  1YA7 O;  3B9Q A;  4OIR F;  4BG0 A;  4DRH B;  1RKE A;  2OJE D;  2OG2 A;  2J45 A;  2R7W A;  2Q9A A;  3LLI A;  4U9E A;  3PMR A;  3MYI A;  5HV9 A;  3I4U A;  4KNW A;  1I4Z A;  3TOM A;  3CEX A;  3LEO A;  3C8G A;  2E87 A;  2LFF A;  4I44 A;  1VOM A;  3KMI A;  3DZA A;  5L3V A;  3M4B A;  1E86 A;  1MMD A;  2V3C C;  2EPN A;  4FES A;  1RJ9 B;  4C3E A;  2BC5 A;  3EQL F;  5L0G A;  1L3P A;  3K6B A;  2JPU A;  1YJG A;  1ZYR F;  5D92 A;  3ZTM A;  4JW1 A;  4JTA B;  1LS1 A;  3K7D A;  4CSA A;  2G3V A;  2V26 A;  3ATP A;  1QZX A;  4J32 B;  3DE9 A;  1G4W R;  3B0P A;  5T3T A;  1FMV A;  4I1M A;  1SR2 A;  1RMV A;  1D1B A;  3OEO A;  3DE8 A;  1BZ4 A;  4BJ6 A;  1NZE A;  4X0R A;  1M2V A;  3RVZ A;  3RIP A;  1K04 A;  1OQC A;  3U5S A;  3B29 A;  1BBH A;  1WN0 A;  5BUO A;  1XZP A;  3FVY A;  5A6A A;  1ORS C;  2Q4F A;  1NBB A;  3E70 C;  3G4X A;  4GYT A;  4MS2 A;  3SXK A;  3C18 A;  2C03 A;  3ECS A;  3OWT A;  5AC5 A;  4XPX A;  4XEK A;  2WVO A;  5CI9 A;  5B3I A;  1LPE A;  4DJ9 A;  2Y69 C;  4BPM A;  3UMI A;  4YL0 A;  2LD6 A;  5KYX A;  2R7V A;  2QNL A;  4JRZ A;  2KJG A;  3DWW A;  1Q0G A;  3QVZ A;  3EZH A;  4AL1 A;  3QW1 A;  3S9O A;  4KBL A;  1ZW3 A;  1U0B B;  5CI8 A;  2PNO A;  1SMY F;  4CDA A;  1RKC A;  4BJ5 A;  4AK9 A;  2LCH A;  3I5Q A;  4DVY P;  4P6I C;  4G7Z F;  2Y3B A;  4Q5S F;  1LS4 A;  4PK4 A;  1Z6A A;  2OEV A;  3HTK C;  3T6G B;  4PJN A;  4YT2 A;  3SXM A;  4CS8 A;  2M4E A;  4JEB A;  1DOV A;  4JUR I;  4U5F E;  4XPY A;  4LLC A;  2XLW A;  1YDI A;  1A41 A;  3GEI A;  4QDL A;  3EFO A;  4BJT A;  3GWN A;  3HNJ A;  3JRT A;  2Q9C A;  2VCB A;  2X51 A;  3HNI A;  2BL2 A;  3EH2 A;  4MTG A;  1T01 A;  1WOL A;  2GDC A;  4N06 A;  4XEV A;  3LEV A;  5FZT A;  3T9O A;  4E7Z A;  2W4B A;  2M64 A;  3UNG C;  4OIO F;  3EGX A;  2CGE A;  3TUL A;  4EIY A;  1VMA A;  2NUP A;  3VAY A;  3U2M A;  3GWL A;  4AE4 A;  1LM3 B;  1OW6 A;  1YLM A;  3TJ5 A;  4GEH A;  3C8G D;  3IEE A;  4PFO A;  4EBJ A;  1NLX A;  4EWC A;  4EKW A;  3RF3 A;  2R7T A;  1V4A A;  3ZSU A;  3H2U A;  1FNT c;  3LJB A;  5L0I A;  1NU7 D;  2XLO A;  4YT5 A;  1H7I A;  4G7O F;  2CNW D;  2R7O A;  2Q7R A;  5T1D B;  4C7O A;  2WZF A;  1NFO A;  2YQY A;  4XQ1 A;  4HFF B;  2KQ9 A;  5KYU B;  1M6T A;  3SP1 A;  1SF8 A;  2IBF A;  3NMI A;  4EBK A;  3ZQV A;  1C02 A;  1K05 A;  3L0I A;  1E2X A;  3L34 A;  4XLP F;  1WWP A;  1AEP A;  1H9T A;  2R9R B;  3V5X A;  2W9Y A;  1GM5 A;  2LFD A;  3LLK A;  4JZA A;  5JT4 A;  3A11 A;  3IHU A;  4JEA A;  4YT8 A;  1MMG A;  2J9U A;  4AL0 A;  4PJJ A;  4CJG A;  5L3Q A;  2A6H F;  4N4W A;  3R2P A;  3MX3 A;  1EI7 A;  4ANJ A;  1ZHT A;  2XSE A;  3Q6M A;  4EHP A;  5A6B D;  2Y3H A;  2R02 A;  5JSL A;  256B A;  1QSP A;  4MW8 A;  4DRI B;  3A9C A;  4K7B A;  3CAX A;  2GWW A;  3FOP A;  5COG A;  3JRM O;  3ABM C;  4OD4 A;  1Q0F A;  2AU5 A;  3ZVR A;  1S05 A;  2YLG A;  4G0H A;  4O6N A;  3ZC4 A;  2W45 A;  3B71 A;  4JVS A;  1V74 B;  1VK5 A;  3X2Q C;  2CW0 F;  3BRJ A;  3JYH A;  4XTK A;  4CSA C;  3US6 A;  2QY9 A;  3U3F A;  1LE2 A;  3DKA A;  1H9G A;  1XZQ A;  1QQ3 A;  4WAB A;  2GFH A;  3LAY A;  2Q00 A;  3DD7 A;  1T6U A;  4D4N A;  5KYW B;  1CPR A;  2B0J A;  4I3M A;  3IPM O;  1ZHZ A;  2YLI A;  2ZPA A;  3C8Z A;  3IQT A;  3N24 A;  1TR2 A;  4BJ6 C;  2HKV A;  2L81 A;  1TWG A;  1XWJ A;  3N0T A;  2AWY A;  2R03 A;  4XEF A;  1ORY A;  2NUT B;  4EBB A;  3TQO A;  4IAR A;  1DOW A;  2VCC A;  3L8J A;  4IJJ A;  3T6J A;  2IXM A;  3LES A;  1VLS A;  1ZHW A;  3WG7 C;  1V55 C;  4MND A;  3K66 A;  1L7C A;  4LAC B;  1Q0D A;  4G78 A;  2QTV A;  5E33 A;  3RQF A;  1PV3 A;  1NSG B;  4AX2 A;  4CIP A;  3EGD A;  1NG1 A;  2EPL X;  3FOO A;  1G4U S;  1JOG A;  3EH1 A;  4HFK B; 
#chains in the Genus database with same CATH homology
 1J8Y F;  3QZC A;  2NG1 A;  3KL4 A;  4PFP A;  3W8H A;  3ITF A;  2CNW A;  3ASO C;  4G7H F;  4U5C E;  4BJ5 C;  4DBR A;  5F5H A;  3CZ6 A;  4M63 A;  3DXJ F;  1Z3I X;  1OKK D;  4O6M A;  1LKX A;  4CS8 C;  5DQZ A;  2WVQ A;  2H7B A;  4A2N B;  5KYY A;  4LLE A;  2R7U A;  3DAG A;  1MMA A;  2ZXW C;  2O9X A;  2R7S A;  4CIH A;  4CBE A;  1QLE C;  4RBN A;  2ZXO A;  3GOD A;  3AG1 C;  3SEO A;  2J0W A;  1MND A;  2VB6 A;  4Q7C A;  2P7V A;  1PD0 A;  2PX3 A;  3AQC A;  4ULW A;  1ST6 A;  4IRU A;  4PJL A;  1IW7 F;  5IY5 C;  2I8B A;  3NYL A;  5E2Q A;  3K33 A;  3E9V A;  4FWV A;  3T4R A;  1ZU5 A;  1BR2 A;  2G3K A;  3NKE A;  4H4K C;  3K1H A;  2Q3T A;  2YZS A;  4O6Y A;  3AG2 C;  3EG9 B;  3DAF A;  4OIP F;  4I1O B;  4QI0 A;  3OA1 A;  3DJU B;  4B6I A;  4CS9 C;  3ZIB A;  2J9V A;  4YWQ A;  1ZU4 A;  5T3W A;  4CS7 A;  2BE5 F;  1SZI A;  5KYW A;  3LS0 A;  1FMW A;  1M57 C;  2Y3G A;  4LER A;  4JJF A;  4IAO A;  2EIJ C;  4DOZ A;  3RFY A;  2EIL C;  2WZL A;  1PD1 A;  1JPN A;  3DJN B;  4BJ1 A;  2J0X A;  3S28 A;  4ZLC A;  3GAN A;  1OKK A;  2J9W A;  3O39 A;  2XXA B;  1D0Y A;  1NU9 C;  3AG4 C;  3ASN C;  4CS9 A;  3CQZ A;  2XL4 A;  4OIQ F;  1TWA A;  2EIK C;  2R7R A;  4W8K A;  3UGO A;  5KYN A;  1RJ9 A;  1V54 C;  1M2V B;  5B1A C;  3NDB B;  2WL8 A;  5FCL A;  3FDQ A;  3ABL C;  2ZXP A;  3LS1 A;  1D0Z A;  2DYS C;  1IZM A;  1TKN A;  3EJN A;  1ZHX A;  3PHF 2;  2PF4 E;  2DYR C;  3EHM A;  3F46 A;  1J8M F;  5B3S C;  4RD9 A;  3M1C B;  5DS6 A;  4OIN F;  1BR1 A;  3HLZ A;  2ZXR A;  2IXN A;  4DVZ A;  3NYJ A;  3RH3 A;  3W2W A;  3FAJ A;  3KH2 A;  3WOD F;  4Q4Z F;  4XLN F;  2WVN A;  3W2V A;  2IXO A;  3HJC A;  3ABK C;  2FFH A;  1BR4 A;  1WGW A;  3LNR A;  4WJ0 A;  4DBQ A;  1D1C A;  3EFO B;  1D1A A;  1KU2 A;  2DGJ A;  1Z5Z A;  2Q9B A;  4NY3 A;  4C3B A;  2EIM C;  2KW3 C;  3X1O A;  3JCU Q;  3JSZ A;  4HE8 D;  4F4B A;  3T6B A;  3UGP A;  1FFH A;  2NUP B;  4XWJ A;  1O5H A;  4MQ9 F;  4AE4 B;  2YHS A;  5B1B C;  2HV6 A;  2CDQ A;  3NYM A;  1ZHY A;  4U5G A;  2W4M A;  2R7X A;  4QI2 A;  4KNV A;  2R7Q A;  1O87 A;  2VAS A;  3AQB A;  1TWC A;  2Y3D A;  1FTS A;  3SNH A;  1MMN A;  2A68 F;  2IXP A;  3S29 A;  1N1C A;  2LSE A;  5DVW A;  3RKO F;  2VH3 A;  5KYU A;  4K0D A;  3EZI A;  4U5H A;  2XXA A;  2OCC C;  1M56 C;  4IWB A;  1FFT C;  3DM9 B;  3NG1 A;  1D0X A;  4U5E E;  5EGY A;  2IYL D;  3B0U X;  5EHH A;  2MWQ A;  1MNE A;  2A6E F;  3NKD A;  2H7O A;  2JD3 A;  3MLG A;  4OIO F;  3RYL A;  4PJM A;  3W8I A;  3VYW A;  1Z23 A;  5E3A A;  4E7S A;  3UMH A;  1LVK A;  2J7P A;  3FHD A;  2Y39 A;  3SZR A;  1G8X A;  5DLJ A;  3S0X A;  4ZLD A;  4HEA J;  3EGD B;  2NUT A;  3EHN A;  5DS4 A;  5D91 A;  1JPJ A;  4YT4 A;  2Z15 A;  3QMK A;  5HSW A;  2WZG A;  2PFD A;  4BEJ A;  3Q7G A;  2MYS A;  2P6V A;  3AG3 C;  4U5B E;  3UMK A;  5KYY B;  4O7G A;  3F47 A;  2A69 F;  3S27 A;  2WB7 A;  4C3D A;  3K1I C;  3KKB A;  4JCH A;  4KI2 A;  2J46 A;  1OCC C;  3Q7L A;  4OD5 A;  4RDA A;  4YJW A;  4YN0 B;  5F5F A;  2KGO A;  3UR3 C;  2YEV A;  3TD7 A;  3N2Z B;  3B0V C;  2PP4 A;  1S7Z A;  5KYX B;  3SYN A;  3H65 A;  2C04 A;  2XRH A;  3V7O A;  2PX0 A;  4O79 A;  5E3C A;  2A1D D;  2KNH A;  2L9J A;  3DM5 A;  2D5R B;  3CSK A;  2EIN C;  3NRH A;  4FX5 A;  4U5D E;  2J7P D;  4J30 B;  2IOQ A;  3EPV A;  3POV A;  3EG9 A;  2H7V C;  1VYI A;  3EGX B;  1PCX A;  3I5P A;  3O6X A;  5DQT A;  1OCO C;  1TWH A;  3Q6N A;  3ZG1 A;  1W2W A;  1VYK A;  1OCR C;  2G62 A;  1OCZ C;  1M2O A;  3DMD A;  5DS5 A;  2HV7 A;  4JJG A;  3JT1 A;  1Z63 A;  4C7O B;  2FGY A;  4KC9 A;  4OIR F;  3B9Q A;  4BG0 A;  2OG2 A;  2J45 A;  2R7W A;  2Q9A A;  3LLI A;  3PMR A;  3I4U A;  4KNW A;  2E87 A;  4I44 A;  1VOM A;  3KMI A;  3DZA A;  5L3V A;  1MMD A;  2V3C C;  4FES A;  1RJ9 B;  4C3E A;  3EQL F;  3K6B A;  5D92 A;  1ZYR F;  4CSA A;  4JW1 A;  1LS1 A;  3K7D A;  2G3V A;  2V26 A;  1QZX A;  4J32 B;  3B0P A;  5T3T A;  1FMV A;  4I1M A;  1D1B A;  3OEO A;  4BJ6 A;  1NZE A;  4X0R A;  1M2V A;  3RIP A;  5BUO A;  3FVY A;  4GYT A;  3E70 C;  3OWT A;  2C03 A;  3ECS A;  2WVO A;  5CI9 A;  2Y69 C;  3UMI A;  5KYX A;  2R7V A;  2KJG A;  3EZH A;  4KBL A;  5CI8 A;  1SMY F;  4BJ5 A;  4AK9 A;  3I5Q A;  4DVY P;  4P6I C;  4G7Z F;  2Y3B A;  4Q5S F;  4PK4 A;  1Z6A A;  4YT2 A;  3HTK C;  4PJN A;  4CS8 A;  2M4E A;  4JUR I;  4U5F E;  4LLC A;  4QDL A;  4BJT A;  3EFO A;  3JRT A;  2Q9C A;  2X51 A;  3EH2 A;  4N06 A;  3LEV A;  4E7Z A;  2W4B A;  3UNG C;  3EGX A;  2CGE A;  1VMA A;  2NUP A;  3VAY A;  4AE4 A;  4GEH A;  3IEE A;  4PFO A;  4EWC A;  2R7T A;  3ZSU A;  3LJB A;  1NU7 D;  4YT5 A;  4G7O F;  2CNW D;  2R7O A;  4C7O A;  5T1D B;  2WZF A;  4HFF B;  2KQ9 A;  5KYU B;  3SP1 A;  1SF8 A;  3L0I A;  3L34 A;  4XLP F;  2W9Y A;  3LLK A;  4JZA A;  4YT8 A;  5L3Q A;  1MMG A;  2J9U A;  4PJJ A;  2A6H F;  3MX3 A;  4ANJ A;  1ZHT A;  2XSE A;  3Q6M A;  2Y3H A;  4K7B A;  3ABM C;  4OD4 A;  3ZVR A;  4G0H A;  4O6N A;  3ZC4 A;  2W45 A;  4JVS A;  1VK5 A;  3X2Q C;  2CW0 F;  3JYH A;  4XTK A;  4CSA C;  2QY9 A;  2GFH A;  3LAY A;  3DD7 A;  5KYW B;  2B0J A;  4I3M A;  1ZHZ A;  2ZPA A;  3N24 A;  1TR2 A;  4BJ6 C;  2L81 A;  1TWG A;  3N0T A;  2NUT B;  4EBB A;  3T6J A;  4IJJ A;  2IXM A;  3LES A;  1ZHW A;  3WG7 C;  1V55 C;  4MND A;  3K66 A;  5E33 A;  4LAC B;  2QTV A;  4AX2 A;  3EGD A;  1NG1 A;  3EH1 A;  4HFK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...