3DD7A

Structure of doch66y in complex with the c-terminal domain of phd
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
123
Chain Sequence
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGYIFNDANKRTALNSALLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome inhibitor
molecule keywords Death on curing protein
publication title Doc of Prophage P1 Is Inhibited by Its Antitoxin Partner Phd through Fold Complementation
pubmed doi rcsb
source organism Enterobacteria phage p1
total genus 46
structure length 123
sequence length 123
chains with identical sequence C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1870 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dd7A00
3KH2A 3K33A 3DD7A
chains in the Genus database with same CATH superfamily
2LQGA 4YK5A 2XXAA 4O7GA 4YT4A 3TJ5A 1VLTA 3HJCA 1Y4CA 2E87A 1TWCA 1VMAA 1PCXA 1UFBA 2L6GA 3EZHA 2CCYA 3G4ZA 3KL4A 4LERA 3DMDA 4PACA 4MTFA 3Q6MA 2WZLA 1C17M 2QNLA 2XM4A 3IHUA 5F5HA 5L0IA 1RJ9A 2Y39A 3S29A 2YL0A 4CSAC 1ZU4A 3GORA 4OD5A 3LEVA 2KYHA 2AWCA 2LSEA 4DRHB 3FAJA 5A69A 3HNLA 4JVSA 1NBBA 2L6HA 2OJQA 2Q9AA 1J8MF 5KYUA 5T3TA 4CDAA 3ZQVA 3H2UA 2BC5A 2I8BA 4E0HA 5DS4A 2XLDA 5FZTA 1JPJA 2V3CC 4E7ZA 2P0NA 5L0GA 5L0DA 3TQOA 3K1IA 4MVRA 1Z6AA 4XWJA 4OIPF 2GWWA 2KSFA 4IJJA 4NTFA 1JRAA 3JT1A 4JEBA 3B0UX 3OEOA 4W8PA 4B6IA 4RBNA 3RQEA 4C3EA 3E70C 3SXZA 1ZYRF 4G78A 1U0BB 3LJBA 1M6TA 4DVZA 4KC9A 4EWCA 4LACB 5A6KA 4BEJA 5DS6A 3DKAA 5CIVA 3DWWA 2H7OA 4BJ6A 2Y69C 1HY5A 2PX3A 1CPRA 1NG1A 4PJLA 3S9OA 4C3BA 4EBJA 4O6YA 5FCLA 2NUTB 4QI2A 2HMQA 1OKKD 2IOQA 3RKOF 2B0JA 2KNHA 4PK4A 1I4ZA 1NFNA 3WHNA 4EKWA 2LIGA 2QUPA 1YARO 4P9FA 4CS8A 2IXNA 1PD0A 4PJNA 3AQBA 2G3VA 2P1AA 1OW6A 3ZTZA 1A0BA 3RQFA 2IYLD 2R02A 3U2LA 2DB4A 2J0XA 2AWYA 3ZC4A 2XL4A 4ZLDA 2DGJA 2HV6A 1WGWA 3AOUA 4C7OB 2D4UA 1CGNA 5HSWA 1GS9A 2F22A 3GM3A 2XLVA 3UMHA 3JCUQ 5COGA 4OIRF 1QVXA 2NUTA 1D0XA 5IY5C 2HV7A 1VTMP 1D1BA 2EPNA 4LDRA 1C02A 1FTSA 3EFOB 4DRIB 4N6CA 2IXOA 2RD9A 3ASOC 2OJED 4JJFA 2NG1A 1XZPA 3K1IC 3L8IA 2J9BA 5L0FA 2NSGA 3DZAA 3SXKA 1A7VA 2ZXOA 3M1CB 1BDJB 4C7OA 3M79A 2Q7RA 1YAUO 2XLOA 2R9RB 1W2WA 3C62A 4DBRA 1M56C 3A11A 1N1CA 4IARA 1WN0A 1Y6DA 3HNKA 3QW0A 2H7VC 2L6FA 4LLCA 3U3BA 3X1OA 4BJTA 4BG0A 5AC4A 2LCHA 4P9TA 1EKYA 4JZAA 4YN0B 1LS1A 3EFOA 3Q7LA 3FMSA 3QVYA 3I4UA 1G4US 2IM8A 2Q4FA 2WZGA 2R7OA 3TULA 4W8KA 1LS4A 2L9JA 4BJ6C 3R7CA 2R05A 1ZHZA 3GM1A 2OQMA 4P6IC 3I5PA 3JZ0A 3S28A 1VB5A 4E18A 1O87A 2GA0A 4MVUA 2IBFA 3QW1A 3IQ5A 3UMIA 2JPUA 3V7OA 4WJ0A 3L1MA 3KH2A 3V5YA 1YDIA 4IAOA 4ONSA 5JLIA 4XLPF 1QPUA 2G3KA 2YL3A 1D1CA 4FESA 2R7SA 1H9GA 1ZHXA 2J7PA 2DYSC 3NMKA 1E85A 2YHSA 4U5CE 5E3AA 2A6EF 4YJWA 4JRZA 2R7WA 1Q0FA 3B0VC 1SZIA 3S84A 4L6RA 3UNGC 1LIHA 5E33A 1JAFA 1BZ4A 1H7IA 1OKKA 2VCBA 2YEVA 4N06A 4AL0A 2R7RA 3GANA 1U6HA 1WASA 4FX5A 2A0UA 2UUIA 2HJ3A 4AE4B 3FDQA 3ZVRA 3C18A 1RXQA 2OU6A 4CS9A 1YYJA 3RVZA 4GYTA 4IAQA 2QY9A 3DJNB 1FMVA 5F5FA 2MWQA 4DRJB 3FOPA 4MNDA 3B0PA 3T6JA 1YYXA 2X51A 1LKXA 2W4BA 2LK4A 1SR2A 2J9VA 3QVZA 1O5HA 4ULVA 4JKVA 4K0DA 3Q7GA 1K05A 3C8ZA 3G4XA 4MVQA 2R03A 4OINF 4AL1A 4CBEA 4CDVA 4KBLA 4MVZA 4WGZA 1E86A 1M2OA 3NKDA 4CIPA 5DQTA 2Y3HA 3HNJA 5JSLA 5A6AA 1YZAA 2J8WA 4AE4A 1EA8A 2CW0F 2DI3A 2OOCA 2XLMA 3GM2A 1E83A 3B29A 1H6GA 4K1OA 2YWAA 3L0IA 1S05A 1RKEB 4H4KC 4CDYA 3RVYA 5L0CA 2ICWG 4JCZA 2HJMA 4N6HA 3EZIA 3QZCA 2CGEA 4O79A 1HE1A 1SYQA 2A1DD 2HFIA 5AC5A 1E84A 4G7OF 1KTMA 1ZVZA 1T01A 1BR2A 1NU9C 5B1AC 5DVWA 3PDMP 2ZXWC 5BUOA 4J7TA 3LEOA 1TWAA 2EINC 2Q00A 1A41A 1JPNA 2ZD9A 1TKNA 2X0CA 2WVNA 2C03A 1K04A 3ZTMA 2YLGA 2Y3GA 1VK5A 3HTKC 2HKVA 2ASRA 3TD7A 3T9OA 1OW7A 3CEXA 4H54A 2YLDA 1RKEA 4JEAA 1OCZC 3U2MA 3L34A 4Z9HA 3EPVA 3GEEA 3UMKA 2QTVA 3ZSUA 5EK0A 3SXYA 1T5OA 2NSFA 4XEFA 1MMAA 3QTHA 2KQ9A 4M63A 1GM5A 3AQCA 3DAGA 1APCA 1BR4A 4HEAJ 2Y3BA 3RQGA 3NYMA 3L8JA 4CS9C 2EPLX 3T6GB 4MW8A 4YWQA 2FGYA 2J7PD 3RH3A 5KYXB 2VCCA 3IQTA 1YVIA 3M4BA 4D4XA 1FMWA 1GQAA 1LI7A 4MVOA 3GWLA 1M57C 2H8AA 1OXBA 1RKCA 3BRJA 4WABA 5B3SC 1U89A 1FR0A 4CS8C 3JYHA 2JX0A 3B9QA 4XQ1A 2OG2A 2HUJA 2A6HF 1S7ZA 3IQCA 3ZIBA 4A2NB 4HFFB 2LFDA 1GGQA 3JRMO 2W9YA 2AP3A 3CAXA 4OD4A 2PP4A 4YL1A 3UR3C 2R7VA 1T6IA 3NKEA 1R5ID 2QLAA 3JTLO 1AEPA 3JYYA 3IEEA 2LD6A 2XS8A 4EIYA 2R7TA 4EHPA 3VRCA 1OQCA 3DD7A 5D91A 2EPOA 2EPMX 2VCAA 1TQGA 3EHMA 2WZFA 1DOVA 2ETSA 2ZXPA 3ASNC 3Q6NA 3U8VA 3S90A 4E17A 2L81A 3J06A 4ULWA 2FAPB 3U9JA 2TMVP 1V74B 3LNMB 3C63A 1AVOB 1RMVA 1LPEA 4MTOA 1T9KA 2Q3TA 2EILC 1KU2A 2A69F 4J30B 4U5HA 5DS5A 2KC3A 4XPYA 3DI5A 2CDQA 2PF4E 3AG3C 1WATA 3RIPA 1TWHA 2WVOA 4JCHA 1A7DA 1I4YA 1ZW3A 4DOZA 1J8YF 3S0XA 2GDCA 3ABMC 4MS2A 1WOLA 4JTCB 5BQGA 2R7XA 4DJ9A 3PMRA 2YQYA 1Z5ZA 4JTAB 4U9EA 4BEMJ 3EH2A 3R2PA 2LP4A 3CQZA 4J32B 4DXWA 1V54C 5HV9A 4MVMA 1C03A 2C04A 1MQVA 2KJGA 3AG4C 2VH3A 3GEIA 3O6XA 4K7BA 1PV3A 2W45A 3MYFA 3TOMA 3UGPA 4Q7CA 2BL2A 4GEHA 1BBHA 2NPUA 4F4BA 3DXJF 3NMJA 4X0RA 3CZ6A 3W8IA 2R25A 3A9CA 3G50A 3GODA 4PJMA 4UDVA 3C8GB 5CI8A 3ECSA 4DVYP 3W4YA 3ZQYA 2EIJC 4E0IA 4WGYA 2XS1A 5L0HA 3TK0A 2UUHA 3F46A 1VLSA 3VAYA 2HSQA 4MW3A 5KYNA 3SNHA 5L0JA 3UGOA 3WAQA 3ATPA 3DJUB 2V26A 4KNVA 3EGDB 3NRHA 5EHHA 1JR8A 2ZXRA 2GAQA 1JMWA 1KNYA 1HMOA 1XWJA 2JD3A 3LLIA 3MBGA 2P7VA 1LVKA 3EQLF 3V5ZA 2YLIA 4D4NA 1EQ1A 2XRHA 4HE8D 4I1MA 3FOOA 2WL8A 4JW1A 1VOMA 2J46A 3F47A 2LFFA 4JIOA 4O6NA 3LNRA 3NDBB 2YVKA 1F1MA 4JURI 1SMYF 3U3FA 3VF0A 4IB4A 3RF3A 3ABKC 5KYWB 5A6JA 4BJ5A 3EGDA 3EJNA 4IGGA 4U9DA 1A7EA 3OA1A 3WG7C 1MMDA 3KYIA 4I1OB 1OXKA 1RCPA 4BPMA 4I3MA 2R7QA 5B3IA 4CJGA 1Z3IX 1CGOA 1YLMA 2A0BA 3DE9A 3EGXB 3OWTA 4IWBA 1I5NA 1FNTc 3N24A 5T3WA 3AGTA 2HZ8A 256BA 4OIQF 3FHDA 1BR1A 1OR3A 1NZEA 3SZRA 2XLHA 5KYWA 2OEXA 1ZHYA 1L3PA 2PNOA 1FFHA 2XSEA 4O6MA 3US6A 4YT2A 3K66A 1ORSC 1YJGA 3QMKA 2R7UA 1XZQA 5B1BC 4EUKB 3V5XA 3DM5A 3LS0A 4CS7A 1OCCC 3ZDLA 2W4MA 3ABLC 2EIMC 3EGXA 3FVYA 5DLJA 3FXHA 3GWNA 2B0HA 2O9XA 5DQZA 1Q0MA 3LS1A 2CNWD 2P6VA 5JUAA 3RYLA 1Q0DA 4XTKA 4JJGA 1Q0KA 1D1AA 2IXPA 1OW8A 3PHF2 2J9UA 4XPWA 4YT5A 3VYWA 3K1HA 4C3DA 3JSEO 3S27A 5F28E 3U8PA 4MQ9F 4A4AA 2DYRC 2M64A 2OCCC 4G0HA 4IRUA 2YL1A 1NSGB 1E2XA 2VC9A 3ZG1A 4G7ZF 4N4WA 1MMNA 4XLNF 4Q5SF 1T6QA 3T4RA 2J9WA 1QKRA 1Q0GA 2VB6A 3AG1C 3HNIA 5TJ5E 3C8GD 3GEHA 3MLGA 3NG1A 4BJ5C 1ZZPA 2BE5F 5BQHA 1G8XA 1Z7Qc 5KYXA 4HFKB 3EHNA 1IW7F 1HMDA 2AU5A 4J7YA 1FFTC 1M2VB 2IXMA 3U9MA 1TR2A 5KYYB 2EIKC 3KMIA 3DM9B 1LE4A 4NQFA 3POVA 1SF8A 1V4AA 1Z63A 5AGFA 3NYLA 5T1DB 3U5SA 3O39A 1CPQA 1OCOC 5JS5A 1L7CA 4YT8A 3N0TA 2Q9BA 2D5RB 2G62A 3LAYA 4KI2A 2MHRA 3N2ZB 5A6BD 3LLKA 3SXMA 1YZCA 4RD9A 2MYSA 3AJMA 3BEHA 4ZLCA 4NCQA 3DE8A 4KNWA 2H7BA 1HE9A 2KK1A 5GPGB 3TOLA 4U5BE 3RFYA 3ITFA 3CSKA 4ANJA 2XL8A 1MMGA 3O10A 3IQ6A 1OCRC 1AUEA 1FAPB 1M2VA 1D0ZA 1WWPA 1Z23A 3KYJA 4XPXA 1ZW2A 5KYYA 4EBBA 3HKKA 5K0IA 3JSZA 2XLEA 3K7DA 1EI7A 4Q4ZF 2HSBA 3IPMO 1TFOB 4U5FE 1NLXA 4EBKA 4LLEA 5D92A 1WTYA 4U5GA 2ZPAA 1T6UA 1NU7D 4LDKA 1YA7O 4MTGA 2I15A 5COMA 3O55A 5BQIA 2KW3C 1OR2A 3H2VA 3VM6A 1YA9A 1TFKB 2YRFA 4NTAA 1QLEC 3AG2C 3W2WA 5JRAA 4QI0A 3C7JA 1R4TA 4XEVA 1ORJA 4QDLA 2OKUA 4CIHA 3NYJA 4NY3A 3T6BA 2J45A 1LM3B 1JOGA 1NFOA 5E2QA 2XL6A 3DAFA 3MFNA 4Z9IA 3B71A 4RDAA 3KPHA 1PD1A 4PR9A 2CNWA 1H9TA 5JVEA 2XLWA 4GQHA 1ST6A 1O3UA 2J0WA 4LDQA 1VYKA 3MYIA 4OIOF 3LESA 2XM0A 2YKZA 3AGUA 3I5QA 3W2VA 1CGME 2OEVA 2RSEB 2YZSA 2M4EA 3PCVA 5EGYA 1LE2A 4PFPA 1B68A 3K6BA 3EG9B 4CSAA 4FWVA 1V55C 3X2QC 4AK9A 4XEKA 3SEOA 2YL7A 3K33A 3MX3A 1DOWA 2WVQA 3KKBA 4NTBA 4PJJA 3EH1A 2L7AA 3C8GA 3FAPB 4JE9A 1QSPA 1QZXA 2WB7A 2GFHA 3SYNA 2FFHA 2EPKX 4R32A 4ER9A 4JTDB 3U0CA 2QE9A 5E3CA 4AX2A 4YL3A 2PBEA 4CX9A 4U5EE 3JRTA 3TJ6A 4BJ1A 2HS5A 3NMIA 4U5DE 3ZWIA 4DBQA 1G4WR 1UG7A 3EG9A 3E9VA 2VASA 4PFOA 5A6BA 4MVSA 2NUPB 3SP1A 1MNEA 5L3VA 5KYUB 1IZMA 1ZHWA 5COFA 1ZHTA 2HMZA 1D0YA 1K40A 5JT4A 2AVKA 2PFDA 2XXAB 4NC3A 4FAPB 4CJOA 1HW2A 3RW0A 3M15A 1LI5A 1ORYA 1HW1A 2P61A 3HLZA 5JP7A 4JC7A 3H65A 1RJ9B 4I44A 4G7HF 3LUTB 4Z9JA 1ZU5A 2Q9CA 2Z15A 4YL0A 1G5ZA 3M4CA 3WODF 5L3QA 2KGOA 2A68F 2Y3DA 5CI9A 1VYIA 1QQ3A 3W8HA 1MNDA 2CYDA 1TWGA 2NUPA 2PX0A 4E7SA
chains in the Genus database with same CATH topology
2XXAA 4O7GA 4YT4A 3HJCA 2E87A 1TWCA 1VMAA 1PCXA 3EZHA 3KL4A 4LERA 3DMDA 3Q6MA 2WZLA 5F5HA 1RJ9A 2Y39A 3S29A 4CSAC 1ZU4A 4OD5A 3LEVA 2LSEA 3FAJA 4JVSA 2Q9AA 1J8MF 5KYUA 5T3TA 2I8BA 5DS4A 2V3CC 1JPJA 4E7ZA 4OIPF 4XWJA 1Z6AA 4IJJA 3B0UX 3JT1A 3OEOA 4B6IA 4RBNA 4C3EA 3E70C 1ZYRF 3LJBA 4DVZA 4KC9A 4EWCA 4LACB 4BEJA 5DS6A 2H7OA 4BJ6A 2Y69C 2PX3A 1NG1A 4PJLA 4C3BA 4O6YA 5FCLA 2NUTB 4QI2A 2R7XA 1OKKD 2IOQA 3RKOF 2B0JA 2KNHA 4PK4A 4XLPF 2IXNA 1PD0A 4PJNA 3AQBA 2G3VA 2IYLD 2J0XA 3ZC4A 2XL4A 4ZLDA 2DGJA 2HV6A 1WGWA 4C7OB 5HSWA 3UMHA 3JCUQ 4OIRF 2NUTA 1D0XA 5IY5C 2HV7A 1D1BA 1FTSA 3EFOB 2IXOA 3ASOC 4JJFA 2NG1A 3K1IC 3DZAA 4C7OA 2ZXOA 3M1CB 4DBRA 1W2WA 1M56C 1N1CA 4LLCA 2H7VC 4BJTA 3X1OA 4JZAA 4YN0B 1LS1A 3EFOA 3Q7LA 3I4UA 2WZGA 2R7OA 4W8KA 2L9JA 4BJ6C 1ZHZA 4P6IC 3I5PA 3S28A 1O87A 3UMIA 3V7OA 4WJ0A 3KH2A 4IAOA 2G3KA 2R7SA 1D1CA 4FESA 1ZHXA 2J7PA 2DYSC 2YHSA 4U5CE 5E3AA 2A6EF 4YJWA 2R7WA 3B0VC 1SZIA 3UNGC 5E33A 4N06A 1OKKA 2YEVA 2R7RA 3GANA 4FX5A 4AE4B 3FDQA 3ZVRA 4CS9A 4GYTA 5F5FA 2QY9A 3DJNB 1FMVA 2MWQA 4MNDA 3T6JA 3B0PA 2X51A 1LKXA 2W4BA 2J9VA 1O5HA 4K0DA 3Q7GA 4OINF 4CS8A 4CBEA 4KBLA 1M2OA 3NKDA 5DQTA 2Y3HA 4AE4A 2CW0F 3L0IA 4H4KC 3EZIA 3QZCA 2CGEA 4O79A 4G7OF 2A1DD 1BR2A 1NU9C 5B1AC 5DVWA 2ZXWC 5BUOA 1TWAA 2EINC 1JPNA 1TKNA 2WVNA 2C03A 2Y3GA 1VK5A 3HTKC 3TD7A 1OCZC 3L34A 3EPVA 3ZSUA 3UMKA 2QTVA 1MMAA 2KQ9A 4M63A 3AQCA 3DAGA 1BR4A 4HEAJ 2Y3BA 3NYMA 4CS9C 5KYXB 4YWQA 2FGYA 2J7PD 3RH3A 1FMWA 1M57C 5B3SC 4CS8C 3JYHA 3B9QA 2OG2A 2A6HF 1S7ZA 3ZIBA 4A2NB 4HFFB 2W9YA 4OD4A 2PP4A 3UR3C 2R7VA 3NKEA 3IEEA 2R7TA 3DD7A 5D91A 3EHMA 2WZFA 3ASNC 2ZXPA 3Q6NA 2L81A 4ULWA 2Q3TA 2EILC 1KU2A 2A69F 4J30B 4U5HA 5DS5A 2PF4E 2CDQA 3AG3C 3RIPA 1TWHA 2WVOA 4JCHA 4DOZA 1J8YF 3S0XA 3ABMC 3PMRA 1Z5ZA 3EH2A 3CQZA 4J32B 1V54C 2C04A 2KJGA 3AG4C 3O6XA 2VH3A 3UGPA 4K7BA 2W45A 4Q7CA 4GEHA 4F4BA 3DXJF 4X0RA 3CZ6A 3W8IA 3GODA 4PJMA 5CI8A 3ECSA 4DVYP 2EIJC 3F46A 3VAYA 5KYNA 3SNHA 3UGOA 3DJUB 2V26A 4KNVA 3EGDB 3NRHA 5EHHA 2ZXRA 2JD3A 3LLIA 2P7VA 1LVKA 3EQLF 2XRHA 4HE8D 4I1MA 2WL8A 4JW1A 1VOMA 2J46A 3F47A 4O6NA 3LNRA 3NDBB 4JURI 1SMYF 5KYWB 3ABKC 4BJ5A 3EGDA 3EJNA 3OA1A 3WG7C 1MMDA 4I1OB 4I3MA 2R7QA 1Z3IX 4IWBA 3OWTA 3EGXB 3N24A 5T3WA 4OIQF 3FHDA 1BR1A 1NZEA 3SZRA 5KYWA 1ZHYA 2XSEA 1FFHA 4O6MA 4YT2A 3K66A 3QMKA 2R7UA 5B1BC 3DM5A 3LS0A 4CS7A 1OCCC 2W4MA 3ABLC 2EIMC 3EGXA 3FVYA 5DLJA 2O9XA 5DQZA 3LS1A 2CNWD 2P6VA 3RYLA 4XTKA 4JJGA 1D1AA 2IXPA 3PHF2 2J9UA 4YT5A 3VYWA 3K1HA 4C3DA 3S27A 4MQ9F 2DYRC 2OCCC 4IRUA 4G0HA 3ZG1A 4G7ZF 4XLNF 1MMNA 4Q5SF 3T4RA 2J9WA 2VB6A 3AG1C 4BJ5C 3MLGA 3NG1A 2BE5F 1G8XA 5KYXA 4HFKB 3EHNA 1IW7F 3WODF 1FFTC 1M2VB 2IXMA 5KYYB 1TR2A 2EIKC 3KMIA 3DM9B 3POVA 1SF8A 1Z63A 5T1DB 3NYLA 3O39A 1OCOC 4YT8A 3N0TA 2Q9BA 2D5RB 2G62A 3LAYA 4KI2A 3N2ZB 3LLKA 4RD9A 2MYSA 4ZLCA 4KNWA 2H7BA 4U5BE 3RFYA 3ITFA 3CSKA 4ANJA 1MMGA 1OCRC 1M2VA 1D0ZA 1Z23A 5KYYA 4EBBA 3JSZA 3K7DA 4Q4ZF 4U5FE 4LLEA 5D92A 4U5GA 2ZPAA 1NU7D 2KW3C 3W2WA 1QLEC 3AG2C 4QI0A 4QDLA 4CIHA 3NYJA 4NY3A 3T6BA 2J45A 4BG0A 5E2QA 3DAFA 4RDAA 1PD1A 2CNWA 1ST6A 2J0WA 4OIOF 1VYKA 3LESA 3W2VA 3I5QA 2YZSA 2M4EA 5EGYA 4PFPA 3K6BA 3EG9B 4CSAA 4FWVA 1V55C 3X2QC 4AK9A 3SEOA 3K33A 3MX3A 2WVQA 3KKBA 4PJJA 3EH1A 1QZXA 2WB7A 2GFHA 3SYNA 2FFHA 5E3CA 4AX2A 4U5EE 3JRTA 4BJ1A 4DBQA 4U5DE 3EG9A 3E9VA 2VASA 4PFOA 2NUPB 3SP1A 1MNEA 5L3VA 5KYUB 1IZMA 1ZHWA 1ZHTA 2XXAB 1D0YA 2PFDA 3HLZA 3H65A 1RJ9B 4I44A 4G7HF 1ZU5A 2Q9CA 2Z15A 5L3QA 2KGOA 2A68F 2Y3DA 5CI9A 1VYIA 3W8HA 1MNDA 2NUPA 1TWGA 2PX0A 4E7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KH2 A;  3K33 A;  3DD7 A; 
#chains in the Genus database with same CATH topology
 2LQG A;  4YK5 A;  2XXA A;  4O7G A;  4YT4 A;  3TJ5 A;  1VLT A;  3HJC A;  1Y4C A;  2E87 A;  1TWC A;  1VMA A;  1PCX A;  1UFB A;  2L6G A;  3EZH A;  2CCY A;  3G4Z A;  3KL4 A;  4LER A;  3DMD A;  4PAC A;  4MTF A;  3Q6M A;  2WZL A;  1C17 M;  2QNL A;  2XM4 A;  3IHU A;  5F5H A;  5L0I A;  1RJ9 A;  2Y39 A;  3S29 A;  2YL0 A;  4CSA C;  1ZU4 A;  3GOR A;  4OD5 A;  3LEV A;  2KYH A;  2AWC A;  2LSE A;  4DRH B;  3FAJ A;  5A69 A;  3HNL A;  4JVS A;  1NBB A;  2L6H A;  2OJQ A;  2Q9A A;  1J8M F;  5KYU A;  5T3T A;  4CDA A;  3ZQV A;  3H2U A;  2BC5 A;  2I8B A;  4E0H A;  5DS4 A;  2XLD A;  5FZT A;  1JPJ A;  2V3C C;  4E7Z A;  2P0N A;  5L0G A;  5L0D A;  3TQO A;  3K1I A;  4MVR A;  1Z6A A;  4XWJ A;  4OIP F;  2GWW A;  2KSF A;  4IJJ A;  4NTF A;  1JRA A;  3JT1 A;  4JEB A;  3B0U X;  3OEO A;  4W8P A;  4B6I A;  4RBN A;  3RQE A;  4C3E A;  3E70 C;  3SXZ A;  1ZYR F;  4G78 A;  1U0B B;  3LJB A;  1M6T A;  4DVZ A;  4KC9 A;  4EWC A;  4LAC B;  5A6K A;  4BEJ A;  5DS6 A;  3DKA A;  5CIV A;  3DWW A;  2H7O A;  4BJ6 A;  2Y69 C;  1HY5 A;  2PX3 A;  1CPR A;  1NG1 A;  4PJL A;  3S9O A;  4C3B A;  4EBJ A;  4O6Y A;  5FCL A;  2NUT B;  4QI2 A;  2HMQ A;  1OKK D;  2IOQ A;  3RKO F;  2B0J A;  2KNH A;  4PK4 A;  1I4Z A;  1NFN A;  3WHN A;  4EKW A;  2LIG A;  2QUP A;  1YAR O;  4P9F A;  4CS8 A;  2IXN A;  1PD0 A;  4PJN A;  3AQB A;  2G3V A;  2P1A A;  1OW6 A;  3ZTZ A;  1A0B A;  3RQF A;  2IYL D;  2R02 A;  3U2L A;  2DB4 A;  2J0X A;  2AWY A;  3ZC4 A;  2XL4 A;  4ZLD A;  2DGJ A;  2HV6 A;  1WGW A;  3AOU A;  4C7O B;  2D4U A;  1CGN A;  5HSW A;  1GS9 A;  2F22 A;  3GM3 A;  2XLV A;  3UMH A;  3JCU Q;  5COG A;  4OIR F;  1QVX A;  2NUT A;  1D0X A;  5IY5 C;  2HV7 A;  1VTM P;  1D1B A;  2EPN A;  4LDR A;  1C02 A;  1FTS A;  3EFO B;  4DRI B;  4N6C A;  2IXO A;  2RD9 A;  3ASO C;  2OJE D;  4JJF A;  2NG1 A;  1XZP A;  3K1I C;  3L8I A;  2J9B A;  5L0F A;  2NSG A;  3DZA A;  3SXK A;  1A7V A;  2ZXO A;  3M1C B;  1BDJ B;  4C7O A;  3M79 A;  2Q7R A;  1YAU O;  2XLO A;  2R9R B;  1W2W A;  3C62 A;  4DBR A;  1M56 C;  3A11 A;  1N1C A;  4IAR A;  1WN0 A;  1Y6D A;  3HNK A;  3QW0 A;  2H7V C;  2L6F A;  4LLC A;  3U3B A;  3X1O A;  4BJT A;  4BG0 A;  5AC4 A;  2LCH A;  4P9T A;  1EKY A;  4JZA A;  4YN0 B;  1LS1 A;  3EFO A;  3Q7L A;  3FMS A;  3QVY A;  3I4U A;  1G4U S;  2IM8 A;  2Q4F A;  2WZG A;  2R7O A;  3TUL A;  4W8K A;  1LS4 A;  2L9J A;  4BJ6 C;  3R7C A;  2R05 A;  1ZHZ A;  3GM1 A;  2OQM A;  4P6I C;  3I5P A;  3JZ0 A;  3S28 A;  1VB5 A;  4E18 A;  1O87 A;  2GA0 A;  4MVU A;  2IBF A;  3QW1 A;  3IQ5 A;  3UMI A;  2JPU A;  3V7O A;  4WJ0 A;  3L1M A;  3KH2 A;  3V5Y A;  1YDI A;  4IAO A;  4ONS A;  5JLI A;  4XLP F;  1QPU A;  2G3K A;  2YL3 A;  1D1C A;  4FES A;  2R7S A;  1H9G A;  1ZHX A;  2J7P A;  2DYS C;  3NMK A;  1E85 A;  2YHS A;  4U5C E;  5E3A A;  2A6E F;  4YJW A;  4JRZ A;  2R7W A;  1Q0F A;  3B0V C;  1SZI A;  3S84 A;  4L6R A;  3UNG C;  1LIH A;  5E33 A;  1JAF A;  1BZ4 A;  1H7I A;  1OKK A;  2VCB A;  2YEV A;  4N06 A;  4AL0 A;  2R7R A;  3GAN A;  1U6H A;  1WAS A;  4FX5 A;  2A0U A;  2UUI A;  2HJ3 A;  4AE4 B;  3FDQ A;  3ZVR A;  3C18 A;  1RXQ A;  2OU6 A;  4CS9 A;  1YYJ A;  3RVZ A;  4GYT A;  4IAQ A;  2QY9 A;  3DJN B;  1FMV A;  5F5F A;  2MWQ A;  4DRJ B;  3FOP A;  4MND A;  3B0P A;  3T6J A;  1YYX A;  2X51 A;  1LKX A;  2W4B A;  2LK4 A;  1SR2 A;  2J9V A;  3QVZ A;  1O5H A;  4ULV A;  4JKV A;  4K0D A;  3Q7G A;  1K05 A;  3C8Z A;  3G4X A;  4MVQ A;  2R03 A;  4OIN F;  4AL1 A;  4CBE A;  4CDV A;  4KBL A;  4MVZ A;  4WGZ A;  1E86 A;  1M2O A;  3NKD A;  4CIP A;  5DQT A;  2Y3H A;  3HNJ A;  5JSL A;  5A6A A;  1YZA A;  2J8W A;  4AE4 A;  1EA8 A;  2CW0 F;  2DI3 A;  2OOC A;  2XLM A;  3GM2 A;  1E83 A;  3B29 A;  1H6G A;  4K1O A;  2YWA A;  3L0I A;  1S05 A;  1RKE B;  4H4K C;  4CDY A;  3RVY A;  5L0C A;  2ICW G;  4JCZ A;  2HJM A;  4N6H A;  3EZI A;  3QZC A;  2CGE A;  4O79 A;  1HE1 A;  1SYQ A;  2A1D D;  2HFI A;  5AC5 A;  1E84 A;  4G7O F;  1KTM A;  1ZVZ A;  1T01 A;  1BR2 A;  1NU9 C;  5B1A C;  5DVW A;  3PDM P;  2ZXW C;  5BUO A;  4J7T A;  3LEO A;  1TWA A;  2EIN C;  2Q00 A;  1A41 A;  1JPN A;  2ZD9 A;  1TKN A;  2X0C A;  2WVN A;  2C03 A;  1K04 A;  3ZTM A;  2YLG A;  2Y3G A;  1VK5 A;  3HTK C;  2HKV A;  2ASR A;  3TD7 A;  3T9O A;  1OW7 A;  3CEX A;  4H54 A;  2YLD A;  1RKE A;  4JEA A;  1OCZ C;  3U2M A;  3L34 A;  4Z9H A;  3EPV A;  3GEE A;  3UMK A;  2QTV A;  3ZSU A;  5EK0 A;  3SXY A;  1T5O A;  2NSF A;  4XEF A;  1MMA A;  3QTH A;  2KQ9 A;  4M63 A;  1GM5 A;  3AQC A;  3DAG A;  1APC A;  1BR4 A;  4HEA J;  2Y3B A;  3RQG A;  3NYM A;  3L8J A;  4CS9 C;  2EPL X;  3T6G B;  4MW8 A;  4YWQ A;  2FGY A;  2J7P D;  3RH3 A;  5KYX B;  2VCC A;  3IQT A;  1YVI A;  3M4B A;  4D4X A;  1FMW A;  1GQA A;  1LI7 A;  4MVO A;  3GWL A;  1M57 C;  2H8A A;  1OXB A;  1RKC A;  3BRJ A;  4WAB A;  5B3S C;  1U89 A;  1FR0 A;  4CS8 C;  3JYH A;  2JX0 A;  3B9Q A;  4XQ1 A;  2OG2 A;  2HUJ A;  2A6H F;  1S7Z A;  3IQC A;  3ZIB A;  4A2N B;  4HFF B;  2LFD A;  1GGQ A;  3JRM O;  2W9Y A;  2AP3 A;  3CAX A;  4OD4 A;  2PP4 A;  4YL1 A;  3UR3 C;  2R7V A;  1T6I A;  3NKE A;  1R5I D;  2QLA A;  3JTL O;  1AEP A;  3JYY A;  3IEE A;  2LD6 A;  2XS8 A;  4EIY A;  2R7T A;  4EHP A;  3VRC A;  1OQC A;  3DD7 A;  5D91 A;  2EPO A;  2EPM X;  2VCA A;  1TQG A;  3EHM A;  2WZF A;  1DOV A;  2ETS A;  2ZXP A;  3ASN C;  3Q6N A;  3U8V A;  3S90 A;  4E17 A;  2L81 A;  3J06 A;  4ULW A;  2FAP B;  3U9J A;  2TMV P;  1V74 B;  3LNM B;  3C63 A;  1AVO B;  1RMV A;  1LPE A;  4MTO A;  1T9K A;  2Q3T A;  2EIL C;  1KU2 A;  2A69 F;  4J30 B;  4U5H A;  5DS5 A;  2KC3 A;  4XPY A;  3DI5 A;  2CDQ A;  2PF4 E;  3AG3 C;  1WAT A;  3RIP A;  1TWH A;  2WVO A;  4JCH A;  1A7D A;  1I4Y A;  1ZW3 A;  4DOZ A;  1J8Y F;  3S0X A;  2GDC A;  3ABM C;  4MS2 A;  1WOL A;  4JTC B;  5BQG A;  2R7X A;  4DJ9 A;  3PMR A;  2YQY A;  1Z5Z A;  4JTA B;  4U9E A;  4BEM J;  3EH2 A;  3R2P A;  2LP4 A;  3CQZ A;  4J32 B;  4DXW A;  1V54 C;  5HV9 A;  4MVM A;  1C03 A;  2C04 A;  1MQV A;  2KJG A;  3AG4 C;  2VH3 A;  3GEI A;  3O6X A;  4K7B A;  1PV3 A;  2W45 A;  3MYF A;  3TOM A;  3UGP A;  4Q7C A;  2BL2 A;  4GEH A;  1BBH A;  2NPU A;  4F4B A;  3DXJ F;  3NMJ A;  4X0R A;  3CZ6 A;  3W8I A;  2R25 A;  3A9C A;  3G50 A;  3GOD A;  4PJM A;  4UDV A;  3C8G B;  5CI8 A;  3ECS A;  4DVY P;  3W4Y A;  3ZQY A;  2EIJ C;  4E0I A;  4WGY A;  2XS1 A;  5L0H A;  3TK0 A;  2UUH A;  3F46 A;  1VLS A;  3VAY A;  2HSQ A;  4MW3 A;  5KYN A;  3SNH A;  5L0J A;  3UGO A;  3WAQ A;  3ATP A;  3DJU B;  2V26 A;  4KNV A;  3EGD B;  3NRH A;  5EHH A;  1JR8 A;  2ZXR A;  2GAQ A;  1JMW A;  1KNY A;  1HMO A;  1XWJ A;  2JD3 A;  3LLI A;  3MBG A;  2P7V A;  1LVK A;  3EQL F;  3V5Z A;  2YLI A;  4D4N A;  1EQ1 A;  2XRH A;  4HE8 D;  4I1M A;  3FOO A;  2WL8 A;  4JW1 A;  1VOM A;  2J46 A;  3F47 A;  2LFF A;  4JIO A;  4O6N A;  3LNR A;  3NDB B;  2YVK A;  1F1M A;  4JUR I;  1SMY F;  3U3F A;  3VF0 A;  4IB4 A;  3RF3 A;  3ABK C;  5KYW B;  5A6J A;  4BJ5 A;  3EGD A;  3EJN A;  4IGG A;  4U9D A;  1A7E A;  3OA1 A;  3WG7 C;  1MMD A;  3KYI A;  4I1O B;  1OXK A;  1RCP A;  4BPM A;  4I3M A;  2R7Q A;  5B3I A;  4CJG A;  1Z3I X;  1CGO A;  1YLM A;  2A0B A;  3DE9 A;  3EGX B;  3OWT A;  4IWB A;  1I5N A;  1FNT c;  3N24 A;  5T3W A;  3AGT A;  2HZ8 A;  256B A;  4OIQ F;  3FHD A;  1BR1 A;  1OR3 A;  1NZE A;  3SZR A;  2XLH A;  5KYW A;  2OEX A;  1ZHY A;  1L3P A;  2PNO A;  1FFH A;  2XSE A;  4O6M A;  3US6 A;  4YT2 A;  3K66 A;  1ORS C;  1YJG A;  3QMK A;  2R7U A;  1XZQ A;  5B1B C;  4EUK B;  3V5X A;  3DM5 A;  3LS0 A;  4CS7 A;  1OCC C;  3ZDL A;  2W4M A;  3ABL C;  2EIM C;  3EGX A;  3FVY A;  5DLJ A;  3FXH A;  3GWN A;  2B0H A;  2O9X A;  5DQZ A;  1Q0M A;  3LS1 A;  2CNW D;  2P6V A;  5JUA A;  3RYL A;  1Q0D A;  4XTK A;  4JJG A;  1Q0K A;  1D1A A;  2IXP A;  1OW8 A;  3PHF 2;  2J9U A;  4XPW A;  4YT5 A;  3VYW A;  3K1H A;  4C3D A;  3JSE O;  3S27 A;  5F28 E;  3U8P A;  4MQ9 F;  4A4A A;  2DYR C;  2M64 A;  2OCC C;  4G0H A;  4IRU A;  2YL1 A;  1NSG B;  1E2X A;  2VC9 A;  3ZG1 A;  4G7Z F;  4N4W A;  1MMN A;  4XLN F;  4Q5S F;  1T6Q A;  3T4R A;  2J9W A;  1QKR A;  1Q0G A;  2VB6 A;  3AG1 C;  3HNI A;  5TJ5 E;  3C8G D;  3GEH A;  3MLG A;  3NG1 A;  4BJ5 C;  1ZZP A;  2BE5 F;  5BQH A;  1G8X A;  1Z7Q c;  5KYX A;  4HFK B;  3EHN A;  1IW7 F;  1HMD A;  2AU5 A;  4J7Y A;  1FFT C;  1M2V B;  2IXM A;  3U9M A;  1TR2 A;  5KYY B;  2EIK C;  3KMI A;  3DM9 B;  1LE4 A;  4NQF A;  3POV A;  1SF8 A;  1V4A A;  1Z63 A;  5AGF A;  3NYL A;  5T1D B;  3U5S A;  3O39 A;  1CPQ A;  1OCO C;  5JS5 A;  1L7C A;  4YT8 A;  3N0T A;  2Q9B A;  2D5R B;  2G62 A;  3LAY A;  4KI2 A;  2MHR A;  3N2Z B;  5A6B D;  3LLK A;  3SXM A;  1YZC A;  4RD9 A;  2MYS A;  3AJM A;  3BEH A;  4ZLC A;  4NCQ A;  3DE8 A;  4KNW A;  2H7B A;  1HE9 A;  2KK1 A;  5GPG B;  3TOL A;  4U5B E;  3RFY A;  3ITF A;  3CSK A;  4ANJ A;  2XL8 A;  1MMG A;  3O10 A;  3IQ6 A;  1OCR C;  1AUE A;  1FAP B;  1M2V A;  1D0Z A;  1WWP A;  1Z23 A;  3KYJ A;  4XPX A;  1ZW2 A;  5KYY A;  4EBB A;  3HKK A;  5K0I A;  3JSZ A;  2XLE A;  3K7D A;  1EI7 A;  4Q4Z F;  2HSB A;  3IPM O;  1TFO B;  4U5F E;  1NLX A;  4EBK A;  4LLE A;  5D92 A;  1WTY A;  4U5G A;  2ZPA A;  1T6U A;  1NU7 D;  4LDK A;  1YA7 O;  4MTG A;  2I15 A;  5COM A;  3O55 A;  5BQI A;  2KW3 C;  1OR2 A;  3H2V A;  3VM6 A;  1YA9 A;  1TFK B;  2YRF A;  4NTA A;  1QLE C;  3AG2 C;  3W2W A;  5JRA A;  4QI0 A;  3C7J A;  1R4T A;  4XEV A;  1ORJ A;  4QDL A;  2OKU A;  4CIH A;  3NYJ A;  4NY3 A;  3T6B A;  2J45 A;  1LM3 B;  1JOG A;  1NFO A;  5E2Q A;  2XL6 A;  3DAF A;  3MFN A;  4Z9I A;  3B71 A;  4RDA A;  3KPH A;  1PD1 A;  4PR9 A;  2CNW A;  1H9T A;  5JVE A;  2XLW A;  4GQH A;  1ST6 A;  1O3U A;  2J0W A;  4LDQ A;  1VYK A;  3MYI A;  4OIO F;  3LES A;  2XM0 A;  2YKZ A;  3AGU A;  3I5Q A;  3W2V A;  1CGM E;  2OEV A;  2RSE B;  2YZS A;  2M4E A;  3PCV A;  5EGY A;  1LE2 A;  4PFP A;  1B68 A;  3K6B A;  3EG9 B;  4CSA A;  4FWV A;  1V55 C;  3X2Q C;  4AK9 A;  4XEK A;  3SEO A;  2YL7 A;  3K33 A;  3MX3 A;  1DOW A;  2WVQ A;  3KKB A;  4NTB A;  4PJJ A;  3EH1 A;  2L7A A;  3C8G A;  3FAP B;  4JE9 A;  1QSP A;  1QZX A;  2WB7 A;  2GFH A;  3SYN A;  2FFH A;  2EPK X;  4R32 A;  4ER9 A;  4JTD B;  3U0C A;  2QE9 A;  5E3C A;  4AX2 A;  4YL3 A;  2PBE A;  4CX9 A;  4U5E E;  3JRT A;  3TJ6 A;  4BJ1 A;  2HS5 A;  3NMI A;  4U5D E;  3ZWI A;  4DBQ A;  1G4W R;  1UG7 A;  3EG9 A;  3E9V A;  2VAS A;  4PFO A;  5A6B A;  4MVS A;  2NUP B;  3SP1 A;  1MNE A;  5L3V A;  5KYU B;  1IZM A;  1ZHW A;  5COF A;  1ZHT A;  2HMZ A;  1D0Y A;  1K40 A;  5JT4 A;  2AVK A;  2PFD A;  2XXA B;  4NC3 A;  4FAP B;  4CJO A;  1HW2 A;  3RW0 A;  3M15 A;  1LI5 A;  1ORY A;  1HW1 A;  2P61 A;  3HLZ A;  5JP7 A;  4JC7 A;  3H65 A;  1RJ9 B;  4I44 A;  4G7H F;  3LUT B;  4Z9J A;  1ZU5 A;  2Q9C A;  2Z15 A;  4YL0 A;  1G5Z A;  3M4C A;  3WOD F;  5L3Q A;  2KGO A;  2A68 F;  2Y3D A;  5CI9 A;  1VYI A;  1QQ3 A;  3W8H A;  1MND A;  2CYD A;  1TWG A;  2NUP A;  2PX0 A;  4E7S A; 
#chains in the Genus database with same CATH homology
 2XXA A;  4O7G A;  4YT4 A;  3HJC A;  2E87 A;  1TWC A;  1VMA A;  1PCX A;  3EZH A;  3KL4 A;  4LER A;  3DMD A;  3Q6M A;  2WZL A;  5F5H A;  1RJ9 A;  2Y39 A;  3S29 A;  4CSA C;  1ZU4 A;  4OD5 A;  3LEV A;  2LSE A;  3FAJ A;  4JVS A;  2Q9A A;  1J8M F;  5KYU A;  5T3T A;  2I8B A;  5DS4 A;  2V3C C;  1JPJ A;  4E7Z A;  4OIP F;  4XWJ A;  1Z6A A;  4IJJ A;  3B0U X;  3JT1 A;  3OEO A;  4B6I A;  4RBN A;  4C3E A;  3E70 C;  1ZYR F;  3LJB A;  4DVZ A;  4KC9 A;  4EWC A;  4LAC B;  4BEJ A;  5DS6 A;  2H7O A;  4BJ6 A;  2Y69 C;  2PX3 A;  1NG1 A;  4PJL A;  4C3B A;  4O6Y A;  5FCL A;  2NUT B;  4QI2 A;  2R7X A;  1OKK D;  2IOQ A;  3RKO F;  2B0J A;  2KNH A;  4PK4 A;  4XLP F;  2IXN A;  1PD0 A;  4PJN A;  3AQB A;  2G3V A;  2IYL D;  2J0X A;  3ZC4 A;  2XL4 A;  4ZLD A;  2DGJ A;  2HV6 A;  1WGW A;  4C7O B;  5HSW A;  3UMH A;  3JCU Q;  4OIR F;  2NUT A;  1D0X A;  5IY5 C;  2HV7 A;  1D1B A;  1FTS A;  3EFO B;  2IXO A;  3ASO C;  4JJF A;  2NG1 A;  3K1I C;  3DZA A;  4C7O A;  2ZXO A;  3M1C B;  4DBR A;  1W2W A;  1M56 C;  1N1C A;  4LLC A;  2H7V C;  4BJT A;  3X1O A;  4JZA A;  4YN0 B;  1LS1 A;  3EFO A;  3Q7L A;  3I4U A;  2WZG A;  2R7O A;  4W8K A;  2L9J A;  4BJ6 C;  1ZHZ A;  4P6I C;  3I5P A;  3S28 A;  1O87 A;  3UMI A;  3V7O A;  4WJ0 A;  3KH2 A;  4IAO A;  2G3K A;  2R7S A;  1D1C A;  4FES A;  1ZHX A;  2J7P A;  2DYS C;  2YHS A;  4U5C E;  5E3A A;  2A6E F;  4YJW A;  2R7W A;  3B0V C;  1SZI A;  3UNG C;  5E33 A;  4N06 A;  1OKK A;  2YEV A;  2R7R A;  3GAN A;  4FX5 A;  4AE4 B;  3FDQ A;  3ZVR A;  4CS9 A;  4GYT A;  5F5F A;  2QY9 A;  3DJN B;  1FMV A;  2MWQ A;  4MND A;  3T6J A;  3B0P A;  2X51 A;  1LKX A;  2W4B A;  2J9V A;  1O5H A;  4K0D A;  3Q7G A;  4OIN F;  4CS8 A;  4CBE A;  4KBL A;  1M2O A;  3NKD A;  5DQT A;  2Y3H A;  4AE4 A;  2CW0 F;  3L0I A;  4H4K C;  3EZI A;  3QZC A;  2CGE A;  4O79 A;  4G7O F;  2A1D D;  1BR2 A;  1NU9 C;  5B1A C;  5DVW A;  2ZXW C;  5BUO A;  1TWA A;  2EIN C;  1JPN A;  1TKN A;  2WVN A;  2C03 A;  2Y3G A;  1VK5 A;  3HTK C;  3TD7 A;  1OCZ C;  3L34 A;  3EPV A;  3ZSU A;  3UMK A;  2QTV A;  1MMA A;  2KQ9 A;  4M63 A;  3AQC A;  3DAG A;  1BR4 A;  4HEA J;  2Y3B A;  3NYM A;  4CS9 C;  5KYX B;  4YWQ A;  2FGY A;  2J7P D;  3RH3 A;  1FMW A;  1M57 C;  5B3S C;  4CS8 C;  3JYH A;  3B9Q A;  2OG2 A;  2A6H F;  1S7Z A;  3ZIB A;  4A2N B;  4HFF B;  2W9Y A;  4OD4 A;  2PP4 A;  3UR3 C;  2R7V A;  3NKE A;  3IEE A;  2R7T A;  3DD7 A;  5D91 A;  3EHM A;  2WZF A;  3ASN C;  2ZXP A;  3Q6N A;  2L81 A;  4ULW A;  2Q3T A;  2EIL C;  1KU2 A;  2A69 F;  4J30 B;  4U5H A;  5DS5 A;  2PF4 E;  2CDQ A;  3AG3 C;  3RIP A;  1TWH A;  2WVO A;  4JCH A;  4DOZ A;  1J8Y F;  3S0X A;  3ABM C;  3PMR A;  1Z5Z A;  3EH2 A;  3CQZ A;  4J32 B;  1V54 C;  2C04 A;  2KJG A;  3AG4 C;  3O6X A;  2VH3 A;  3UGP A;  4K7B A;  2W45 A;  4Q7C A;  4GEH A;  4F4B A;  3DXJ F;  4X0R A;  3CZ6 A;  3W8I A;  3GOD A;  4PJM A;  5CI8 A;  3ECS A;  4DVY P;  2EIJ C;  3F46 A;  3VAY A;  5KYN A;  3SNH A;  3UGO A;  3DJU B;  2V26 A;  4KNV A;  3EGD B;  3NRH A;  5EHH A;  2ZXR A;  2JD3 A;  3LLI A;  2P7V A;  1LVK A;  3EQL F;  2XRH A;  4HE8 D;  4I1M A;  2WL8 A;  4JW1 A;  1VOM A;  2J46 A;  3F47 A;  4O6N A;  3LNR A;  3NDB B;  4JUR I;  1SMY F;  5KYW B;  3ABK C;  4BJ5 A;  3EGD A;  3EJN A;  3OA1 A;  3WG7 C;  1MMD A;  4I1O B;  4I3M A;  2R7Q A;  1Z3I X;  4IWB A;  3OWT A;  3EGX B;  3N24 A;  5T3W A;  4OIQ F;  3FHD A;  1BR1 A;  1NZE A;  3SZR A;  5KYW A;  1ZHY A;  2XSE A;  1FFH A;  4O6M A;  4YT2 A;  3K66 A;  3QMK A;  2R7U A;  5B1B C;  3DM5 A;  3LS0 A;  4CS7 A;  1OCC C;  2W4M A;  3ABL C;  2EIM C;  3EGX A;  3FVY A;  5DLJ A;  2O9X A;  5DQZ A;  3LS1 A;  2CNW D;  2P6V A;  3RYL A;  4XTK A;  4JJG A;  1D1A A;  2IXP A;  3PHF 2;  2J9U A;  4YT5 A;  3VYW A;  3K1H A;  4C3D A;  3S27 A;  4MQ9 F;  2DYR C;  2OCC C;  4IRU A;  4G0H A;  3ZG1 A;  4G7Z F;  4XLN F;  1MMN A;  4Q5S F;  3T4R A;  2J9W A;  2VB6 A;  3AG1 C;  4BJ5 C;  3MLG A;  3NG1 A;  2BE5 F;  1G8X A;  5KYX A;  4HFK B;  3EHN A;  1IW7 F;  3WOD F;  1FFT C;  1M2V B;  2IXM A;  5KYY B;  1TR2 A;  2EIK C;  3KMI A;  3DM9 B;  3POV A;  1SF8 A;  1Z63 A;  5T1D B;  3NYL A;  3O39 A;  1OCO C;  4YT8 A;  3N0T A;  2Q9B A;  2D5R B;  2G62 A;  3LAY A;  4KI2 A;  3N2Z B;  3LLK A;  4RD9 A;  2MYS A;  4ZLC A;  4KNW A;  2H7B A;  4U5B E;  3RFY A;  3ITF A;  3CSK A;  4ANJ A;  1MMG A;  1OCR C;  1M2V A;  1D0Z A;  1Z23 A;  5KYY A;  4EBB A;  3JSZ A;  3K7D A;  4Q4Z F;  4U5F E;  4LLE A;  5D92 A;  4U5G A;  2ZPA A;  1NU7 D;  2KW3 C;  3W2W A;  1QLE C;  3AG2 C;  4QI0 A;  4QDL A;  4CIH A;  3NYJ A;  4NY3 A;  3T6B A;  2J45 A;  4BG0 A;  5E2Q A;  3DAF A;  4RDA A;  1PD1 A;  2CNW A;  1ST6 A;  2J0W A;  4OIO F;  1VYK A;  3LES A;  3W2V A;  3I5Q A;  2YZS A;  2M4E A;  5EGY A;  4PFP A;  3K6B A;  3EG9 B;  4CSA A;  4FWV A;  1V55 C;  3X2Q C;  4AK9 A;  3SEO A;  3K33 A;  3MX3 A;  2WVQ A;  3KKB A;  4PJJ A;  3EH1 A;  1QZX A;  2WB7 A;  2GFH A;  3SYN A;  2FFH A;  5E3C A;  4AX2 A;  4U5E E;  3JRT A;  4BJ1 A;  4DBQ A;  4U5D E;  3EG9 A;  3E9V A;  2VAS A;  4PFO A;  2NUP B;  3SP1 A;  1MNE A;  5L3V A;  5KYU B;  1IZM A;  1ZHW A;  1ZHT A;  2XXA B;  1D0Y A;  2PFD A;  3HLZ A;  3H65 A;  1RJ9 B;  4I44 A;  4G7H F;  1ZU5 A;  2Q9C A;  2Z15 A;  5L3Q A;  2KGO A;  2A68 F;  2Y3D A;  5CI9 A;  1VYI A;  3W8H A;  1MND A;  2NUP A;  1TWG A;  2PX0 A;  4E7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...