3IHUA

Crystal structure of dna binding protein (yp_298823.1) from ralstonia eutropha jmp134 at 1.92 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
205
structure length
205
Chain Sequence
SASDTVFFGIMSGLELGTFVPGQRLVETDLVAHFGVGRNSVREALQRLAAEGIVDLQRHRGAVIRRLSLQETLDVLDVAERMTGLLARAATRGSGNQPQVQALRASVQALVAAEKAQDGETFSNARRHFYRTLLEMGDNRELRRLFPTIHMPIVHAQHRLASLRQMRLDDYRRIATAVLAGEPDAAEAAGAAHVKNVRGAILDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of DNA binding protein (YP_298823.1) from Ralstonia eutropha JMP134 at 1.92 A resolution
rcsb
source organism Ralstonia eutropha
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, GntR family
total genus 80
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ihuA01
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3ihuA02
1IXCA 3FM3A 2DAOA 2ADUA 1I6XA 3V4GA 2A6HF 2VT3A 3H92A 4BH9A 3J81Z 4HW0A 4MTEA 2K86A 2XRNA 3TOBA 2IW5A 3JW4A 2F5FA 3IC7A 1ON1A 3WTUC 2V9VA 2ZO4A 1U3EM 2ZCWA 3F72A 4HLXA 3M1EA 4LG0B 1U78A 1F5TA 3M8EA 3Q9SA 1YS7A 2EFPA 2NYXA 3F8CA 1USTA 2KRFA 3BPXA 1MJ9A 1T39A 5CVUA 4I09A 4E70A 1BC8C 1KYWA 4M72A 4G7HF 2R7FA 2FE3A 2M1BA 1FBSA 3I53A 4ENNA 4Y17A 2ETHA 1B59A 1OR7A 1XDUA 4UXNA 5LGTA 1J0RA 1KU7A 2RV8A 3IL2A 1IXRC 3I0TA 4OIRF 2STWA 1ZGJA 1PP7U 2RDPA 1EV7A 4EGZA 4PGGA 5CJ9A 2BBYA 1FWZA 1ZG1A 2P7VB 1ZH5A 4OIQF 1WI9A 2QENA 4EGYA 1Z1DA 2KJCA 3SXZA 2K02A 1OYIA 5D6EA 1XDSA 4L5JA 1SMTA 2DK5A 2MH2A 4LG0A 3KFWX 1ZRCA 1O7FA 1L3LA 4U7DA 4B09A 1PDNC 4H0EA 2FBHA 2C6YA 1D3YA 3N97A 1FYLA 5KK1A 3C3WA 4Q47A 1TQIA 2AS5F 3MEXA 1F9NA 2DQLA 1LDDA 2MLKA 1E2XA 2GAUA 3LA3A 1JE8A 3WTVC 4CXFA 1SFUA 1HW2A 2MH9A 3ULQB 3K1MA 1PP8F 1R5GA 2J5OA 4I02A 4FHTA 1G4DA 3V8LA 2ZJ2A 3WE2A 1K78A 4XSZF 2XHKA 4OIPF 4P55A 3ROUA 2EJRA 2OQRA 2F5CA 1QQIA 2JPBA 3HYIA 3WTXC 3CUQB 4YIFA 1T38A 4WXDA 4G94A 3ABTA 4FX0A 5KVRA 2IP2A 1I1SA 4L0ZB 2O8XA 3JAMK 3I4PA 3GEZA 3MQ0A 5J8CA 2NRAC 1XGSA 4JK1X 4KA4A 4M6YA 5IT9K 2VE8A 2MA3A 1O3QA 3CUOA 2PFBA 1W5SA 2P6TA 3I71A 3ZQ7A 1KQ8A 2DU9A 4HV6A 3I59B 3OV8A 2HYGD 5CVRA 4LD5A 3FZVA 1ODDA 3R4KA 1RI7A 3QP5A 2F5EA 2RN7A 4IF4A 4AWXB 2VOPA 1WKMA 2CFXA 3KE2A 1USSA 6PAXA 2Q0OA 1U5TB 4RGXA 4D0PA 4ESFA 2PMHA 3EYIA 4R1HA 3ZN1A 3JAMZ 3HSEA 3ERED 2XGXA 3HTUA 5JHUA 1DP7P 2EA4A 2HKOA 2IVMA 1LQ1A 1KU9A 2HEOA 2EB7A 3RJPA 4P96A 1B1BA 2YU3A 1XSVA 2Y75A 4YFXF 5LGUA 3L9FA 3R6SA 3V8KA 3D0SA 2NS0A 2FMYA 3IHUA 3RIRA 1R1VA 1UCRA 1HW5A 2GZWA 4ASNA 3IWFA 2Y0MA 3ZMTA 2WC2A 1RUNA 1W4MA 3DFGA 4A5MA 1BI2A 2O0YA 4L9VA 3RKWA 2HYFA 1R23A 2HR3A 5IT3A 4M6XA 5FGMA 1LJ9A 5AONA 3G3ZA 5DD8A 4UV9A 3C7JA 5HLGA 4MGRA 2H6BA 3F8MA 3ISPA 1R7JA 4GYIA 1B9MA 4N0BA 5BOXA 3T5XA 2HOEA 1YO5C 1FYMA 1HKSA 2YPRA 1O3TA 1Z7UA 2L3DA 4PCQA 5HDKA 3RKYA 2GIVA 2RVCA 2DW4A 3SXKA 1UHMA 2XROA 1PUEE 2V79A 2BYVE 2NNNA 1ZLKA 4L9JA 2FBKA 5JR3A 3FXUA 4CHUA 5LRSA 3F3XA 5DV5A 3E5XA 1B9NA 3W6JB 1EH8A 1XCVA 2W24A 5CVJA 3TOAA 1D8KA 3HHGA 2EFNA 4I01A 4I0AA 5E1WA 1SD6A 4KT5C 5L3EA 2KIMA 5LRRA 4UUVA 4KUMA 2FF4A 1OMIA 2CGPA 2FSWA 5ICCA 2O6GE 1S29A 2YX4A 3LA2A 3MZYA 3HRMA 1BI1A 3SFZA 1BOAA 3V7CA 3IRQA 3F22A 2F2EA 1YW7A 1SMYF 4ZYDA 5BS6A 3F8BA 3ZMVA 2ZXJA 2KKOA 3BJ6A 3REOA 1R36A 1K79A 1MJBA 4MQ9F 3L2CA 4XLPF 2GXBA 2M8EA 4FT8A 4L0YB 4GGGA 2MC3A 4MNUA 4LLGF 1J7KA 2Z3YA 4ENKA 4Y13A 3FXRA 3BDDA 1IN5A 3DQVC 3TO6A 2STTA 1R22A 2VBZA 1CF7A 2VONA 2DI3A 4K2EA 1T6SA 2A07F 1SAXA 1H0MA 3I5UA 3WG9A 4HQEA 1ON2A 3QP6A 3KCCA 3PQJA 3KEOA 3PFIA 1U5TA 4U0VA 3GZ6A 2LNBA 4WWCA 4GXOA 4FX4A 1T0FA 1IAWA 2L54A 5D5XB 1ZREA 2F5DA 2Y48A 1HW1A 1UFMA 1FNNA 4EM1A 4UV8A 2OZ6A 5JFRA 2QZ8A 3D5LA 1G3TA 5H6RA 3KLOA 4XBFA 3ZMSA 3J7AO 5FD5A 2HTJA 4KMUX 4WXCA 4RB3C 4G8XA 2RGVA 2XAGA 1R00A 4LLLA 5HDNA 3HIFA 2AXLA 1KYZA 1EH7A 1HSTA 2XKOA 2COMA 1OYYA 1YS6A 4HV5A 4IXAA 2HWVA 4NQWA 1O3SA 2PI0A 4WF2A 2XAJA 3CO7C 2VT2A 2BV6A 5E20A 2EFQA 3RYPA 3BY6A 4M74A 4RB2C 2GXGA 5AIQA 1K78B 1GVJA 4XRFA 3F21A 2QBYB 4XLNF 1STZA 3ZMDA 5D8KB 5L3BA 4KICA 3M8FA 1P2FA 2Z5UA 2DQRA 3ECOA 1S3JA 3TDUC 3BZ6A 3U9GA 3BP8A 3O2PE 2DK8A 5K5QA 1E17A 3SQNA 5LHHA 4UVCA 2CG4A 2RKHA 1LVAA 3LA7A 3LSTA 2EFWA 2FRHA 4HQMA 3WE3A 3T8TA 2MD5A 4BNCA 2J5PA 2CO5A 2GWRA 3E5UA 1P4WA 3HOSA 1ZGAA 5DEQA 1IF1A 3NQOA 1LDKB 2K7LA 3P9CA 4O6JA 4OOIA 2YR2A 3FWEA 1WSUA 4MTDA 3GUDA 3K1NA 1FZPB 4L18B 3LQQA 3KP4A 2KIFA 1T98A 4EJVA 3Q9VA 2HS5A 5L3DA 4EM0B 5L3GA 1HKTA 2EV5A 2Q8KA 1YW9A 5H6QA 4DQ2A 3RKXA 4UHTA 1GHCA 1ONVA 1R58A 4PGHA 2E7XA 3ZMZA 4BHBA 2LF7A 2YX7A 1WQ2A 4RAZA 2PLYA 2VBYA 1TQMA 1IW7F 4EVIA 2H6CA 2QYOA 4UVBA 2P5LC 3K1PA 3L7WA 1BIBA 3H3UA 5D4SA 2W57A 2H27A 2D45A 4G7ZF 1G3WA 4P5OA 4IJAA 3DXJF 1GXQA 1IUYA 2JPCA 4KIBA 4AVPA 3IKVA 4HZFA 1MZBA 4A5NA 2FXAA 2ZMEA 4A6EA 4AIJA 5CYVA 3K0LA 1BN5A 2VN2A 1LB2A 2WV0A 4HAMA 2QLZA 1XB4A 1Z9CA 1G3YA 2OQGA 3QU3A 5K1YA 5DD4A 1JHHA 4LGWA 4RGSA 1AOYA 4R79A 2V6CA 2M87A 3U2RA 3MAJA 3E3VA 3JSOA 4ZZDA 3NRVA 1BC7C 5E1ZB 2JSCA 1J2XA 3SZPA 2ESHA 2QVOA 5HDGA 4P9UA 1UHWA 2VBWA 2VC1A 1QPMA 1K6OA 2HQNA 1K7AA 2OZUA 1MDMA 2K4JA 4P9FA 2M30A 2CYYA 2QQ9A 5H20A 1U2WA 2DLLA 1BBYA 2M5WA 4UNOA 3ABUA 4G6QA 1WWXA 4B8XA 4KNYA 4EJTA 1KGSA 3E97A 3J81K 2IT0A 4CZZA 3COAC 2JT1A 2D1VA 2P4WA 5HLHA 3WODF 4M9SA 4A0XA 5E17F 3BOQA 4LB5A 2HFHA 2XIGA 4MEXF 4BXUA 2V1XA 4RS8A 1IZ1A 4I98B 1L0OC 3W6KB 4HX8A 2FA5A 2FU4A 1SD5A 1RIOH 2A5YB 5E8IA 3CJNA 4OIOF 1BI3A 1J59A 3SXYA 4KYWA 4PDKA 1LEAA 2RQPA 3G73A 3NEUA 1DUXC 3GZ5A 1U5TC 3R60A 4I7HA 1F4KA 2ZNZA 3EDPA 1IXSB 5E8GA 5L3CA 1YLFA 4XSXF 4EJWA 5BPIA 3N4MA 4HX4A 4KIGA 5JI6A 3ML6A 2ISZA 1IN4A 3RI4A 4OINF 3E5QA 1LDJA 1XMKA 2RC4A 2LF8A 2PEXA 3HOTA 5EEGA 3ZMUA 4CGZA 4MHGA 2YSRA 4AD9A 2PG4A 3HRUA 1QGPA 4G6DA 1JGSA 3EQLF 1U6GA 2GQQA 3DV8A 2VODA 4CO8A 3IRRA 3K9TA 3V8JA 3Q5FA 1AWCA 5D5VB 3JTGA 1VTNC 5FO5A 3ZPLA 2OA4A 5F6FA 1P6RA 4RGUA 1RUOA 3DPLC 4CDGA 4KFCA 1QZZA 4U88A 3WTTC 3HUGA 1UB9A 4CYDA 1HXDA 1OYWA 4BHPA 1W7PB 4O5VA 2B0LA 4G7OF 3I54A 1OPCA 3LWFA 2ZKZA 1IN6A 4EQQA 3EYYA 4GCVA 3I64A 1BJAA 2DPUA 2ZMEB 2OBPA 2UXXA 4G9YA 1T2KA 4Q5SF 2QQAA 4IRGA 3CO6C 3M9AA 2VC0A 5F64A 2M45A 3TQNA 2XKPA 5LEJA 3J80Z 2QM3A 3GXOA 4O3MA 1TW3A 4N9IA 2CQKA 4EV0A 5D5WB 1V4RA 4A0YA 4MEYF 5BMZA 5D5UB 2ELHA 4Y15A 3TO9A 4BYYA 5K5OA 2G7UA 4AIHA 3JSPA 1BIAA 1B4AA 1R5HA 2TDXA 2P6SA 2Z33A 4I0BA 3SXMA 3KLNA 1R1UA 3T0YA 4BHCA 3F8FA 1D5VA 4IHSA 2X4HA 3WTZA 2HGCA 1O3RA 2OAZA 2V1UA 3HRTA 1SD7A 1Z6TA 5FFXA 1YW8A 3WU1B 5HLIA 1TQPA 3VFZA 1A04A 1IN7A 2W85A 1P4AA 4IRHA 4YIIA 4Z2YA 4IVNA 4RGRA 4U0YA 4A12A 1NHAA 5FD6A 3B02A 2A68F 2O03A 4IPAA 3M7GA 3DF8A 1XN7A 5BQTA 1G3SA 2E1CA 4GYGA 5CVVA 1JXSA 4KN7X 3LQRA 1ZARA 3GLXA 4DNCA 4YFNF 4ON0A 5DYMA 1ZLJA 1KQ9A 1LEBA 1LNWA 2D1HA 4L5IA 3TGNA 1YFHA 4NB5A 4CICA 2V1DA 1FT9A 1V3FA 2EV0A 3KP7A 3E6MA 2EK5A 3K69A 4HOBA 1FLIA 2UZKA 1FPQA 3BWGA 4Q48A 1MKMA 4A2UA 3HHHA 2A3SA 2L02A 2IRFG 4ETSA 1H9TA 3HSFA 2CWEA 1QBJA 1I27A 2QUFA 2O61A 2W25A 1XD7A 2K4BA 1P92A 4WK8F 4F7ZA 1HQCA 2PN6A 4HBLA 1JHFA 2E1NA 5HS7A 3K2ZA 4U7BA 5ILUA 2DBBA 4ZYHA 3LFKA 1Y0UA 2KJBA 2DFIA 3CLOA 5LGNA 3WGHA 3C18A 1XGOA 5A2QK 2NAZA 4EJUA 3CDHA 2HKXA 5EEHA 2A6EF 1HBXG 3CUQC 5CVIA 1ZAOA 2QWWA 5J8FA 1I1GA 3E6DA 2FEZA 2DT5A 4LFUA 5AIPA 2Z9OA 3P9IA 3J80K 1YG2A 4KMFA 4KIFA 4PZJA 2FNPA 1S6LA 1WRJA 3ELKA 1B6AA 3KZZA 2VBXA 3F23A 4BQAA 3MWMA 3GFMA 2QQBA 2GA2A 4WX9A 5TJJA 3RPQA 3SHFA 4MQVA 3CTAA 4RB1A 3IKTA 3HTSB 4LK1F 3WTYC 4JBAA 1YIOA 1TLHB 5FB2A 3RDIA 4A0ZA 3BJOA 5ICGA 5ILVA 2HQRA 2VXZA 1H9GA 1ZHFA 3U1DA 2FNAA 2KIUA 4HX7A 4RAYA 3OOPA 1I5ZA 1XGMA 3GW2A 4LK0F 3GYHX 2ISYA 3BPVA 2Z99A 3E6CC 1XCBA 5HS9A 1MD0A 3O6BB 3KP5A 1CGPA 5BPDA 2P8TA 4L9TA 5DCFA 3RYRA 3S2WA 4ENMA 3P7NA 4EMSA 2OU2A 1W7PA 3IWZA 3KP6A 2MBFA 3EUHA 3QPHA 3GWZA 1J75A 3KETA 4ZH4F 1GXPA 5HOOA 2ACJA 5LHGA 1RNLA 1KU3A 4Q4ZF 3E6BA 2G9WA 1ZG5A 4N9HA 2XV4S 3MFKA 2UWMA 4ESBA 3SZTA 3R61A 1J5YA 5A2QZ 4AIKA 3KZYA 2H94A 2BEOA 1TNSA 4JQFA 2K27A 1W5TA 1U8RA 5DUIA 2W84A 3B73A 3FX3A 2XAFA 4OMYA 1IRGA 3FMRA 1ZYRF 5JVTA 2ZBKA 4LJZF 4YG2F 1XSDA 5LEKA 3H3ZA 1MJAA 1F1ZA 1FC3A 3WTSC 4BAYA 4HDUA 2O3FA 1G6NA 1FP2A 1TNTA 1CF7B 5LLQA 1IN8A 1FP1D 1FSHA 1D8JA 2WTEA 2D2WA 2IPQX 1Z05A 1SD4A 2H09A 1KQ0A 3KEQA 1R1TA 4M71A 3QOPA 3T1BA 1ZRFA 2HDCA 4M73A 3R0JA 4ESJA 1Z91A 4HF0A 3KP2A 4EM2A 2XUBA 1QZYA 1DPUA 2BGCA 3TDZC 2LSOA 4QWQA 4UVAA 2ZFWA 3ZP5A 1TW2A 1KU2A 2DPDA 1FY7A 2Q2EA 1BM9A 1SFXA 3ECHA 1ULYA 2L4MA 5ERIA 1Q1HA 1S7AA 3JTHA 5D8LB 3R0AA 4RB0A 2JRTA 2DO7A 4OU0A 1QO0D 3TKYA 2XVCA 5DDGA 4WXHA 3F6VA 4HF1A 1MDMB 3DPTA 2NNYA 3I58A 2L4AA 3DP7A 1O57A 3WU0A 1RZ4A 3QRFF 3GFIA 2WWYA 5FFZA 3WTWC 3GX4X 5CLSA 2A61A 2LDUA 4A6DA 1YTYA 2IA0A 3FF5A 5ICEA 3LAJA 2XASA 5D4RA 1XGNA 4OMZA 5ICFA 4TV7A 3F6OA 5DCMA 4IHTA 2VOOA 4ENJA 4M9ZA 2E7WA 1HSJA 2QBYA 2PMUA 3GFLA 3C1DA 2VE9A 2EA2A 3MZHA 4NHJA 3CUQA 3FMQA 4KDPA 1ZRDA 2MLGA 2EFOA 2PJPA 5J6XA 3V7RA 2HZTA 2R3SA 4IRIA 1HKQA 5IT9Z 4WCGA 5HVQC 5ILSA 1XMAA 1XSXA 1IRFA 3T8RA 2GA1A 3L09A 3KP3A 4HA8A 4HF2A 2P7CB 2IJLA 2PBIA 2FMLA 1ZG3A 5DCMB 5ED4A 2OD5A 3O3KA 3ZN0A 3HSRA 2G7HA 5DUKA 3GVAA 5LBQA 5L3FA 1O7LA 1FBQA 4S05A 1W7PD 1DDNA 3BJAA 3DKWA 5D6FA 2HTSA 4HYEA 2X0LA 3L00A 4GO1A 4S04A 4EJOA 2FQ3A 4KN4X 3GF2A 3RPUA 4LMYA 3VB2A 1OKRA 1REPC 1ZN2A 2BE5F 4U0WA 2R7DA 3RTRA 3AAFA 3FXQA 4ZYEA 4LB6B 5HS8A 2XAHA 4R8HA 3F8NA 5FLXK 3EETA 3FMSA 2A69F 3VEPA 3BROA 2L01A 1QNTA 3GFJA 2EWNA 1FOKA 4M9XA 2IA1A 3QAHA 2XAQA 2JTVA 3I59A 3QPTA 5E18F 3QU6A 1TBXA 1J9IA 4YFKF 1X3UA 1KA8A 2CW0F 3TO7A 4QLCU 4ZZLA 4LLNA 3WGIA 3MCZA 3DEUA 1FYKA 2UXNA 4I2OA 5F1RA 2FOKA 1S8NA 1C0WA 1SFEA 1BI0A 2P5VA 1MGTA 5TRDA 3HRSA 4HLYA 3GO5A 1FSEA 2P5KA 2FBIA 1DPRA 2IA2A 2PQ8A 3V7SA 4ZYGA 4HDVA 2DTRA 3PQKA 5FLXZ 3FM5A 1EH6A 1S7OA 1Z6RA 2RNJA 2ESNA 2EV6A 5K5RA 5LHIA 1YYVA 2CSOA 3VOEA 2JZYA 2ZNYA 1YQAA 1FX7A 1TTYA 3FHZA 3VODA 1P4XA 3LAPA 3WGGA 2LKPA 5E1XA 1FBUA 4L9NA 3P9KA
chains in the Genus database with same CATH superfamily
2R7XA 1IXCA 1A35A 1NFNA 2DA4A 4CSAA 1LFUP 3FM3A 3CCYA 1IG7A 1WJ5A 1QKRA 2DAOA 5EDNA 1IUFA 2ADUA 1I6XA 4PFPA 5D92A 3V4GA 3Q6MA 2A6HF 2VT3A 1M2OA 3H92A 4HSTA 4BH9A 3J81Z 5AC5A 4HW0A 3F46A 4MTEA 4Y4RA 1ACIA 5DS4A 2K86A 2XRNA 4BU2A 2X1EA 3TOBA 2IW5A 3JW4A 1WATA 2F5FA 3ITFA 3IC7A 1ON1A 1LS1A 3DTKA 3WTUC 2V9VA 2CGEA 2WB1N 3MD2A 2ZO4A 1OCPA 4YK5A 1VLSA 5LD2C 3C63A 1HCRA 5GTIC 2HZDA 1U3EM 1RR8C 1ITYA 3E7LA 2ZCWA 4MS2A 2K40A 1UFBA 3F72A 5J4VA 4IARA 4E7LA 4HLXA 2YS9A 3ZRGA 3M1EA 1RJ9B 4XRSA 5EGOA 4NTAA 3GTKJ 4LG0B 2CCYA 2PMZN 2HU9A 1U78A 1F5TA 3CSKA 1OW7A 3RSNA 3M8EA 2ZC2A 2Z2SB 4ULWA 3Q9SA 1R4NB 5L0HA 3GWNA 3GTJJ 3M8JA 1YS7A 4C7OA 3HXLA 1G8XA 2EFPA 2KIQA 4RDAA 3BZKA 2NYXA 3W4YA 3NDBB 3SDGA 3F8CA 1USTA 2KRFA 2OV7A 3BPXA 1QQ3A 1ZR4A 1MJ9A 3HNLA 3FBIB 1T39A 2YLDA 1FTSA 5CVUA 4ZTJA 4I09A 5TGTA 3DMDA 4E70A 4FX5A 4JJGA 4ZJZA 1R9TJ 4MFDA 1BC8C 1KYWA 4M72A 1V5FA 2GLOA 4U9DA 5E3LA 4G7HF 3FHDA 1FAPB 1N77A 3FOOA 3Q6NA 2IXMA 2R7FA 2FE3A 4RBNA 1Y56A 1ZW2A 2Y69C 4GDFA 5C44J 2M1BA 1FBSA 4BJ5A 4A3DJ 1WHUA 4FESA 3I53A 2XLVA 4XMYA 1PV3A 1NU7D 1WJEA 2I5UA 4ENNA 3N0TA 2LYCA 3AG2H 1X1BA 4Y17A 4MVZA 2O9LA 1M1EB 2AO9A 2ETHA 5E79C 2JQ7A 2JA2A 1B59A 3CESA 1OR7A 1Z3IX 1XDUA 3HOYJ 4YJWA 4UXNA 2F6CA 5LGTA 1S7EA 1QVXA 2DYRH 1J0RA 1KU7A 3RVZA 3PNVA 2R03A 2HQ5A 2D5RB 5L0DA 1RCPA 2RV8A 2V9KA 3IL2A 1X2NA 4PSXA 2ICWG 1PD1A 3JCUQ 1V55C 1IXRC 2BY0A 4DZJA 3GTQJ 2ZSHB 3I0TA 2ASRA 4OIRF 2STWA 3ECSA 4AK9A 3JR9A 5B3SC 1ENHA 1TWGA 4FAPB 4RLQA 3H35A 1GV2A 3ZTZA 2LKSA 1ZGJA 1PP7U 1M6TA 2RDPA 1MBKA 3DEWA 2EPNA 5FRMA 3OR2C 1EV7A 4EGZA 4PGGA 2GFHA 3L8JA 3RQFA 4EBKA 2LR8A 5CJ9A 4JVSA 2BBYA 1FWZA 4BJ6C 4A3LJ 1ZG1A 4BBSJ 2P7VB 1ZH5A 3WAQA 4OIQF 1WI9A 2QENA 4EGYA 3EG9B 1Z1DA 1FMVA 2KJCA 2HJ3A 3SXZA 4AIDA 4KBLA 2DCEA 2K02A 2RAEA 2M3AA 3LSGA 1OCZH 3GCMA 2CUFA 1OYIA 2LD5A 5D6EA 1XDSA 4L5JA 1SMTA 2DK5A 2E5NA 2MH2A 3KFWX 4LG0A 5IPAA 3GTLJ 1JAFA 1L3PA 1HMDA 3DLAA 5T1DB 1Q0GA 4D4XA 1ZRCA 2L7FP 5J3LA 3OWTA 5JVGF 2LH9A 3U21A 3T6JA 4D1QA 1O7FA 2EIKH 2LMDA 4U7DA 4B09A 2VI6A 1X19A 2JUCA 3CZ6A 1L3LA 1PDNC 3GLLA 4H0EA 2FBHA 1QRYA 1DU6A 2C6YA 1D3YA 3CCEI 3N97A 5A6KA 5D91A 1TWAJ 3G1MA 1OCOH 3K6GA 3RPUD 4I1OB 2E1MC 1FYLA 5KK1A 3C3WA 2X1CA 3MKLA 4DBQA 3QODA 1HMOA 4Q47A 3L2QA 2LSEA 1TQIA 2F5VA 2GAQA 1Z0XA 1LKXA 2AS5F 3MEXA 1XPXA 2NPUA 1X58A 3NMKA 1I4ZA 1F9NA 2DQLA 4J19A 1LDDA 2MLKA 1E2XA 4JOMA 3G71I 4X1EA 3K33A 1NG6A 2GAUA 3M3YJ 5E3AA 3LA3A 1U6HA 2NXNB 5BQIA 2XXAB 2Y39A 3OR1C 1S72I 1JE8A 1A7EA 1RKEB 4QPOA 3HZJA 1YDIA 4I1MA 3WTVC 4DXWA 4C9YA 1AVOB 2VQLA 2YHSA 4CXFA 3L2RA 5J1UA 2R05A 3BRJA 2EBIA 3CQZJ 1SFUA 1HW2A 3DBLB 1Z3XA 3JRFA 3TQOA 2WZFA 2MH9A 3ULQB 1K4TA 3K1MA 1PP8F 3DTEA 1W0TA 4EBBA 1R5GA 2J5OA 2DMTA 4I02A 3L1PA 3IV5A 4JCZA 4FHTA 5KYXA 2CS3A 1G4DA 2MYSA 3V8LA 4F52A 2ZJ2A 1EKEA 2E60A 2LTPA 3WE2A 1K78A 4XSZF 2XHKA 5K7HA 4OIPF 3LNQA 4P55A 1YJNI 2KPMA 2WAQA 3ROUA 4QI0A 2EJRA 3QZCA 2OQRA 2W7NA 1SYQA 2XSEA 2F5CA 2F22A 3SP1A 1A7VA 1QQIA 4BPMA 2JPBA 3HYIA 3QTHA 2WAQN 3WTXC 2CNWD 3CUQB 4YIFA 4NQWB 1T38A 4IRUA 1Z67A 3Q7LA 2XDVA 4WXDA 4ABZA 3B6CA 1MMAA 3GTOJ 3DTIA 4G94A 1TR2A 1S5LC 3ABTA 3I5PA 3HEFA 2R5ZB 5IYBJ 4FX0A 2ZXRA 3FHNA 5GTHC 5KVRA 2KSFA 3E1SA 4ANJA 3RQEA 2IP2A 1I1SA 2Y3HA 4KISA 3CQZA 4L0ZB 1ZHXA 5HLTA 1WCMJ 3S1QJ 2O8XA 3JAMK 3S14J 1XTAA 3I4PA 3K4MA 4DJ9A 2HVQA 1WGXA 1R4MB 2P1AA 3QVYA 2Y3DA 3GEZA 3MQ0A 4Z9HA 1VLTA 3M4CA 3HKZN 5J8CA 3PCVA 4CS8A 2K3FA 3KYCB 4V19K 3I55I 2NRAC 1XGSA 4JK1X 2VKEA 4Y33A 4XOPA 4C2MJ 5EZGA 4KA4A 4M6YA 1YA7O 5IT9K 3IH2A 2VE8A 2MA3A 2VH3A 1O3QA 3CUOA 2PFBA 3RQGA 1W5SA 1HE9A 2P6TA 3I71A 3ZQ7A 3NRHA 1KQ8A 3K2AA 2DU9A 5GAHJ 4HV6A 3QWLA 4JCHA 2IGNA 3I59B 4W1UA 3OV8A 2HYGD 1PD0A 5CVRA 4LD5A 3FZVA 3GBGA 3EGXB 5IOYA 1ODDA 3BG7A 3SYTA 1Y6IA 5KYUA 3S3OA 3WHNA 3EZIA 3R4KA 2MHRA 3HM5A 4XPXA 1RI7A 2CH0A 1APLC 3QP5A 2W82A 2ZXIA 4LIVA 3HG9A 1W36D 4IOAF 2YEVA 2F5EA 2RN7A 1DQUA 4IF4A 4AWXB 1WJBA 3PFYA 2VOPA 1WKMA 3ABLC 4FE7A 2J0WA 3GM1A 2BW3B 4BBRJ 2CFXA 4EHPA 3KE2A 1USSA 2ME0A 2E87A 2M7AA 2Q0OA 2LLKA 6PAXA 4XL9A 1U5TB 5BQGA 3S0XA 4RGXA 2Q2EB 4N4OB 4D0PA 4ESFA 2PMHA 4U5CE 3EYIA 1E3HA 1NLXA 4R1HA 2P0NA 2CQ7A 3ZN1A 3JAMZ 3ASOH 3CMEI 1YJGA 4JIOA 3HSEA 3NARA 3K66A 3ERED 2XGXA 5HNFA 4JEBA 3HTUA 1V5EA 4H4KC 5JHUA 1DP7P 2EA4A 2VUMJ 1ORJA 2HKOA 2VKDA 1OQCA 3FDYA 4NQFA 1MBJA 1RR7A 2IS2A 2IVMA 1LQ1A 3QOEA 1KU9A 4BQNA 2HEOA 2EB7A 3RJPA 4JZAA 3H9JA 3I3LA 4P96A 256BA 1B1BA 4NCQA 3B71A 2QEXI 2QCOA 2YU3A 3JRCA 1EI7A 3G50A 1XSVA 3FK7A 2Y75A 2DB4A 4YFXF 5LGUA 3L9FA 3R6SA 1U9NA 1GDTA 1AU7A 3V8KA 2R7RA 4IZZA 4XK4A 4ZLCA 2K9SA 3D0SA 1GQAA 3C8GA 4MVUA 2NS0A 2VJ5A 2FMYA 1V54C 3IHUA 4Q7CA 3RIRA 4WGYA 3QPSA 1R1VA 1AKHB 3K6BA 3HDDA 4CYCA 3JYHA 1UCRA 2VC9A 1HW5A 2GZWA 4ASNA 2HJMA 5HNHA 2EH3A 1PCXA 3IWFA 2EPLX 3CDLA 3I4UA 1VQMI 2Y0MA 2DODA 3ZMTA 3NKEA 1YAUO 2WC2A 1RUNA 3LMMA 1W4MA 4NC8A 3DFGA 5J4YA 2QTVA 4A3CJ 4A5MA 1B8IA 2FAPB 2JVGA 2AVKA 2V9PA 1BI2A 2O0YA 4L9VA 4Y52J 3RKWA 3W2VA 2HYFA 1R23A 2HR3A 3AGTA 2XC7A 2DMPA 5IT3A 4M6XA 5FGMA 2XLMA 1LJ9A 5AONA 1FTZA 3HNKA 3S27A 1FIPA 2ZMEC 1C17M 3G3ZA 1UG0A 4QI2A 5DD8A 2FJ1A 3BQYA 3EUKL 1JGGA 1HF0A 4UV9A 3C7JA 1BDJB 2LK4A 2IGOA 4IB4A 5HLGA 4BG0A 3EGDB 4MGRA 2IM8A 3O55A 2H6BA 3F8MA 4QIWN 4CS7A 2L7AA 3ISPA 1K4SA 1V54H 2XB0X 1R7JA 2L7ZA 3ESWB 1I4YA 3NG1A 4J32B 2M0MA 3K10A 4GYIA 5TJ5E 1B9MA 3JRDA 4N0BA 4NC3A 2JVHA 4D4NA 5BOXA 2DYRC 2W4MA 2MC4A 5EG0A 3T5XA 1Z3YA 2HOEA 1YO5C 1FYMA 4U5EE 5M5WJ 1HKSA 2YPRA 3I9V2 3JRHA 4RBOA 4AL0A 3S90A 2LP0A 2LY1A 4JRZA 1OR3A 1O3TA 1Z7UA 1ZELA 2L3DA 2QKLB 2W00A 3JRIA 3ZR8X 1RMVA 4DRJB 4PCQA 4LOCA 2NG1A 5HDKA 2V1NA 4BKXA 3HUGB 1XX5A 3RKYA 5COFA 2X1DA 4BY7J 2P6VA 2GIVA 3X2QH 1I39A 2RVCA 2DW4A 3S15J 1XWJA 3SXKA 1UHMA 2XROA 3OYDA 1MNMC 2V79A 1PUEE 4O7GA 3A4CA 2XGCA 2E1MB 3OMYA 2BYVE 2NNNA 2OTLI 1ZLKA 4L9JA 2R9RB 2FBKA 4PFOA 5JR3A 3OEOA 1JRAA 1VQNI 1MMDA 3FXUA 5B1BC 4CHUA 2R93J 4KITB 5LRSA 1BZ4A 3F3XA 1SZIA 2VJIA 3CF2A 5DV5A 4IJJA 2BVLA 3OIOA 4WJ0A 1X1PA 1RXQA 3NYMA 3E5XA 1B9NA 3VSLA 1W36C 1BA5A 2Q9CA 3DJNB 3W6JB 4LDQA 4AE4A 4A3JJ 5JRAA 3CMMA 4JKVA 1TQGA 2UUHA 1T01A 1EH8A 4M3FA 1XCVA 2W24A 1BR2A 5CVJA 4E7HA 2NVTJ 1KNYA 1V74B 1I3AA 3TOAA 1D8KA 1PJRA 3HHGA 2EFNA 4EEFG 4AVZA 4CCOA 2FQ4A 4I01A 4IQJA 4I0AA 1XC5A 1NG7A 5E1WA 1SD6A 1GUUA 3HLZA 1QHGA 3BR1A 4KT5C 3CP2A 5EG0B 2UV1A 2DFEA 5L3EA 1Y4CA 3RYLA 2KIMA 5LRRA 4UUVA 3GODA 1YZAA 4IGGA 1IDYA 4KUMA 2FF4A 2JA5J 5J47A 1Z7Qc 3BG3A 1OMIA 1V5GA 3Q0UA 2CGPA 2QUPA 3FAJA 1KTMA 1T6QA 2FSWA 3PIOF 1L7CA 4IAOA 3R7CA 5ICCA 2O6GE 3T6BA 1NU9C 1S29A 1U8BA 1D0ZA 1YVIA 3EG9A 2DMUA 2YX4A 3LA2A 3MZYA 1D5YA 3UGOA 1YX3A 3HRMA 1BI1A 3SFZA 1BOAA 1SAUA 4LG3A 3V7CA 1LFBA 1QU3A 1F36A 3R2PA 3IQ5A 2M7BA 2CV2A 3G4SI 3IRQA 1G4WR 3F22A 3A9CA 3CDIA 3DE9A 4MW3A 2F2EA 1YW7A 3CEXA 2VCCA 1SMYF 3RCOA 4ZYDA 2XLOA 2R7TA 3L34A 4FISA 4Y3OA 5BS6A 3V5ZA 2VQHA 3S2DJ 3S3NA 1VZ0A 3F8BA 2HVSA 2IAIA 3ZMVA 2ZXJA 2R7ZJ 2R02A 2KKOA 3BJ6A 3REOA 1MW7A 1R71A 4IHVA 4MTFA 1R36A 4CCMA 3G1LA 1K79A 4N6CA 3U0CA 1MJBA 1WN0A 4MQ9F 2LKXA 1UHSA 3L2CA 1TWCA 3K7AJ 4XLPF 2IGMA 2M8EA 2GXBA 3CP8A 4FT8A 4L0YB 2XSDC 1FOXA 3IAS2 3G4XA 4AM3A 3OYKA 4G12A 4GGGA 2MC3A 4MNUA 2L2OA 4LLGF 3LNRA 4UUSA 1J7KA 2Z3YA 4ENKA 3FAPB 4Y13A 3FXRA 3LS1A 3M79A 3BDDA 5FLVA 3CJTB 1IN5A 3DQVC 4DJAA 2WL8A 4CDYA 2WAEA 3TO6A 3JZ0A 2STTA 1R22A 2VBZA 1CF7A 5FKMA 2ECCA 1Z21A 2VONA 3HNIA 2DI3A 4K2EA 4WGZA 1T6SA 4YL0A 2A07F 1SAXA 1H0MA 3W2AA 4AL1A 4YT5A 1EQ1A 3TK0A 2OCCH 3I5UA 3WG9A 1M2VA 4HQEA 4AX2A 4ZDLA 3D5SC 4LERA 1ON2A 3QP6A 4BUPA 5CIVA 2JJ7A 1ETXA 1MSEC 1WZ2A 3KCCA 3PQJA 3KEOA 3PFIA 1U5TA 1JKRC 1C03A 4U0VA 2WA0A 3GZ6A 4NDLA 2LNBA 1E85A 1R6RA 4WWCA 3FXMA 2OJQA 2KDOA 4GXOA 1MBFA 3CCLI 4I99C 4FX4A 1JKOC 1T0FA 1IAWA 5KNLA 4QDLA 5COGA 1JUPA 3K4NA 4B43A 1YX5A 1RJ9A 1Y6DA 2L54A 1W5CC 3MZ8A 5D5XB 1ZREA 2F5DA 2EZIA 1E3OC 5FKNA 2VCAA 2Y48A 3H2UA 1FR0A 1HW1A 3O6XA 1UFMA 4XLEA 1IV6A 1FNNA 3AG3C 4E0IA 4IOCF 4YWQA 1I3QJ 1Y1VJ 4EM1A 3IQCA 3UR3C 2EPFA 1UG7A 3TL4X 4E18A 4JC7A 4UV8A 2OZ6A 4XLHA 2PX9A 5JFRA 2QZ8A 3BT9A 1G3TA 3D5LA 3KYIA 2W45A 5H6RA 3VYTB 1HE1A 5HSWA 1FEXA 2EQRA 3ABMH 3KLOA 2W48A 1GVDA 4M3GA 2JN6A 4XBFA 3ZMSA 5E33A 3J7AO 1TFKB 3K7DA 1T56A 2YKZA 1HC8A 5FD5A 2HTJA 2DA2A 4KMUX 2L9VA 4WXCA 3EJNA 5JLWA 4RB3C 4G8XA 2AXTC 2Q3TA 1E84A 2XS1A 2ZB9A 5JLXA 1CGME 2RGVA 2OEVA 1OFCX 3EH1A 1XZPA 2KT0A 1R00A 1MMGA 2XAGA 4LLLA 5IP9J 3C8GD 2KMUA 3VSKA 5HDNA 3HIFA 2B9SA 2AXLA 1OCZC 3S29A 1Y0NA 1KYZA 1EH7A 3GORA 3JT1A 1VQ7I 1HSTA 2XKOA 4BEMJ 3IEEA 2COMA 3UKGA 1B72A 3MLGA 1A31A 4X6AJ 1OYYA 2KZGA 3K4LA 3AQBA 3BR6A 1YS6A 2LVSA 5K7ZA 2CFOA 2VIXA 4HV5A 3HOVJ 4IXAA 3S28A 4CSWA 4RDUA 3US6A 2JMWA 1WJDA 2HWVA 1TL8A 3DPUA 5BQHA 1NTCA 1OLTA 3B0UX 1OCOC 4NQWA 1O3SA 3EUHC 2PI0A 1YRNB 3T4RA 4WF2A 2XAJA 3D1NI 1OCCC 3CO7C 2VT2A 2BV6A 3I56I 5E20A 4A3GJ 4O6NA 2EFQA 2KISA 2HKVA 3RYPA 4MTGA 3BY6A 1TWCJ 5M5XJ 1NH3A 2H7BA 4M74A 4M3BA 4RB2C 3DEEA 1Z5ZA 5CI8A 2PJRA 1YYJA 2G3KA 3ZDLA 2I8BA 2GXGA 2Z16A 2XLHA 5AIQA 3DCFA 3G2BA 1GVJA 3IH4A 3MVPA 1RKTA 3NAUA 4NC7A 4XRFA 3F21A 1K78B 2QBYB 3S16J 3RFYA 3ZQYA 1WH7A 4XLNF 1STZA 3ZMDA 5D8KB 5L3BA 4GEHA 2LIGA 2WZLA 4KICA 4OAYA 3IP4B 1TT0A 3TW6A 2K3PA 4KC9A 3M8FA 1P2FA 3H9GA 2Z5UA 2DQRA 3ECOA 1S3JA 4Y7NJ 3TDUC 4BQOA 3LLIA 3BZ6A 1RKCA 3JRBA 3U9GA 1VQPI 4KJZA 3OYGA 2K5CA 1SFKA 3BP8A 3O2PE 2C04A 1Q0FA 1VQ5I 3BG5A 4HEAJ 2DK8A 1MH3A 3I4MJ 5K5QA 2JRMA 1E17A 4M63A 3TD7A 2J9UA 3SQNA 3EHNA 2AP3A 2DYSC 5B3IA 1U9OA 2XXAA 5LHHA 4UVCA 2CG4A 1ZVZA 2RKHA 2R5YB 5KYWA 1LVAA 3EFOA 3LA7A 3LSTA 1AKHA 2EFWA 2XLWA 2FRHA 3MFNA 4HQMA 5B1AH 1VQ9I 3CCSI 3WE3A 3T8TA 1Z63A 2MD5A 3P5JA 3L2WA 4BNCA 1MMNA 2CO5A 2GWRA 2J5PA 2K9MA 4BGDA 2J9BA 2E34A 3G6EI 3E5UA 5F0CA 1VQLI 1HLVA 2M64A 1P4WA 2C03A 1QVTA 5FJ8J 3HOSA 4K1OA 1ZGAA 2QKMB 2WY8Q 5DEQA 1IF1A 3ABKC 2KRCA 1XG1A 3GEHA 4IEJA 3NQOA 1JJ6C 3V7OA 1LDKB 2K7LA 3P9CA 4XM3A 3POVA 1C02A 1YIJI 4M3DA 4LIUA 2YRFA 4B44A 4O6JA 3HPHA 1FIAA 1FOWA 4OOIA 4N6HA 4BL0B 1D1CA 2LK2A 1QLEC 3RQIA 2WY7Q 2R7QA 2YR2A 3FWEA 2X51A 1WSUA 3JRTA 2XRHA 4MTDA 5JP7A 2HV7A 3GUDA 3Q3SA 4XLCA 1T33A 3K1NA 5L3VA 1FZPB 3KX2A 4L18B 3LSKA 3DE8A 2JWTA 3LQQA 1VQ6I 2NUTA 3KP4A 2KIFA 1T98A 2KZVA 2J45A 3QPLA 4EJVA 3Q9VA 2AWCA 3C2GA 2HS5A 5L3DA 1JOGA 4IQ4A 1GS9A 4EM0B 1DGRM 1LS4A 5L3GA 3CD6I 3RZDJ 5DM6F 3L2VA 1HKTA 2DA1A 4KNWA 3EGXA 2EV5A 2AQEA 3UMKA 2Q8KA 1YW9A 2RSEB 3LNMB 5A6BD 5H6QA 4DQ2A 3B0PA 4FWVA 4PJ0C 5GPAA 3TEDA 2WV1A 4Z6YA 4I6ZA 5FCLA 3QVZA 1TP4A 1J8YF 1K04A 1IZMA 3DAGA 4LLCA 3RKXA 5T3TA 4UHTA 2IS4A 2QSGX 2KW3C 1GHCA 4MFEA 1ONVA 2R5YA 5KYWB 1R58A 4PGHA 2E7XA 3ZMZA 3CC4I 1G5ZA 1AEPA 3VYUB 4BHBA 4E6KG 2MABA 5M5YJ 1A0BA 4PK4A 2LF7A 1YOVB 4EIYA 1JUSA 2YX7A 1WQ2A 1GV5A 4M3EA 4RAZA 3ASNH 3FIWA 2VBYA 1TQMA 1IW7F 2NVUB 1LE8A 2PLYA 2LCHA 2RD9A 4EVIA 2H6CA 2QYOA 4UVBA 3KIOA 9ANTA 1QPUA 2P5LC 3K1PA 3OIPA 3L7WA 1QA6A 1TC3C 1E0EA 3AJMA 3U9MA 3VM6A 3TP0A 1BIBA 3OYJA 3H3UA 5D4SA 4XEVA 1O87A 1HA8A 4A3KJ 5L0IA 2XPVA 4MIMA 4PJJA 2W57A 2H27A 2D45A 3WU2C 4XEKA 2E2HJ 4G7ZF 2DA6A 1G3WA 1CGNA 4YEJA 2DOFA 2W1OA 4FTHA 4P5OA 5JS5A 4XNFA 4IJAA 4C7OB 1W1WE 1GXQA 3DXJF 2VXDA 3O8HA 2F4IA 2DYSH 4ZTFA 3GANA 2NOJB 4DYCA 1IUYA 3FBNB 2JPCA 4PACA 4KIBA 3HKKA 1O4XA 4JJFA 4AVPA 3IKVA 4HZFA 2KGOA 4CSAC 1MZBA 5CQEA 4A5NA 4BEHA 2FXAA 4RM3A 2L6GA 3E70C 2ZMEA 4BEHB 4BQQA 2HMZA 4A6EA 4AIJA 5CYVA 3SFIA 3K0LA 2Z1DA 1T5OA 1BN5A 2OQMA 5HV9A 2EIMC 1JTXA 2Y31A 2L9SA 4B4CA 2VN2A 4BACA 2G62A 2KJGA 1LB2A 2WV0A 4HAMA 2QLZA 1NG1A 1JT6A 1K6YA 2XPWA 1XB4A 3BLYA 1R49A 4CCKA 1Z9CA 1G3YA 5L0JA 2X6YA 3OS2A 2XF6A 4Z9JA 2ZSIB 5B3SH 3EPZA 2OQGA 4A69C 3QU3A 4XLFA 3VDXA 5K1YA 5L3QA 3ERMA 2B7EA 3CAXA 5DD4A 1JHHA 4LGWA 4RGSA 1LE8B 1LI5A 1IO2A 1ETWA 4G78A 3V5XA 1ETKA 1HDDC 4RA2A 1AOYA 1WOLA 4R79A 2V6CA 4HE8D 1LFPA 3HGYA 3DJUB 4ONSA 5EHHA 2M87A 3A0BC 3U2RA 2OKUA 5KYYB 3MAJA 1WI3A 4XOTA 3E3VA 1YJWI 2EIJH 1XS9A 3GEEA 1P7IA 2R92J 4XRMA 3S1NJ 3HOUJ 2XM0A 2CDQA 3G1OA 1IRXA 3JSOA 4F3QA 4XRSG 4ZZDA 2ME6A 4JTCB 3PDMP 3H9QA 3NRVA 2XF5A 4FCYA 1BC7C 2A6TA 2HI3A 3CCUI 5E1ZB 1ZGWA 2JSCA 1VMAA 4D5CA 4LDRA 2EIKC 3W6VA 1J2XA 3SZPA 1O3UA 5COMA 2ESHA 2K9QA 2QVOA 5HDGA 4P9UA 1VYIA 1UHWA 1ETQA 3ZXSA 2GBYA 2VBWA 2VC1A 2LC2A 1QPMA 1K6OA 3BTJA 2IEKA 2HQNA 1K7AA 2OZUA 2DN0A 1WH5A 1MDMA 3SJMA 3FXHA 1MBEA 1ETOA 2K4JA 3L1MA 4P9FA 4GRIA 4R32A 1U0JA 2GXAA 2M30A 5DS9A 2CYYA 2QQ9A 3HKZA 5H20A 2J9WA 1U2WA 5E3CA 2DLLA 1BBYA 4HPQA 4YRVA 4U5GA 2M5WA 3ABUA 3CMAI 4UNOA 4G6QA 1OKKA 2TMVP 3LAYA 1WWXA 4B8XA 4KNYA 3B29A 3X2QC 4II2A 2HVRA 1KGSA 4EJTA 3E97A 3J81K 2IT0A 5JSLA 4CZZA 3COAC 4BJTA 4U5DE 2JT1A 2XF7A 2D1VA 2P4WA 3HB9A 5EEAA 3DKAA 2DMNA 5HLHA 3HOWJ 1N1CA 4GFBA 2V26A 4DYQA 3WODF 5EGYA 5DVWA 3QYBA 2XL8A 3LEOA 3BTIA 4M9SA 2X6XA 4A0XA 4CBEA 4KNVA 5E17F 3BOQA 2K9NA 2DA5A 4NNJA 4LB5A 2HFHA 2VJ4A 2XIGA 3HNJA 4QSHA 5FKLA 3IH3A 4MEXF 3JRMO 1OW6A 4BXUA 4AU7A 2V1XA 5FRNA 3O39A 4RS8A 3AQCA 3GM3A 5GAEJ 1IZ1A 4I98B 1L0OC 1OCRC 3F47A 2MG4A 3W6KB 3QMKA 4P9TA 4EKWA 1FNTc 4XN0A 4HX8A 1BW6A 2FA5A 2FU4A 1SD5A 1RIOH 1T95A 2VB6A 2A5YB 5E8IA 4XN3A 3CJNA 2YU9J 4OIOF 2X48A 1LPEA 3X1OA 3ZG1A 1BI3A 1J59A 3SXYA 2DJNA 4PDKA 4KYWA 3N2ZB 1FFTC 1OCCH 1LEAA 4PSWA 2AWYA 1E86A 2RQPA 3G73A 4DRHB 1X4OA 3NEUA 2ZXWH 1DUXC 2HXOA 3AFHA 3GZ5A 3M15A 2VJJA 1U5TC 3ONQA 4A3FJ 4EWCA 4D9JA 3EFOB 3R60A 4I7HA 1APCA 1TKNA 4NBQA 4PJMA 1F4KA 2ZNZA 3EDPA 1Z7LA 1IXSB 4HG2A 2AU5A 5E8GA 1K40A 3NKDA 5L3CA 4YT8A 1YLFA 4XSXF 4EJWA 3AKZA 3RQ4A 3BQZA 1CGOA 5BPIA 4J7TA 3TMOA 3N4MA 2P61A 4HX4A 4KIGA 4JW1A 4CJOA 1RRJA 4BY1J 2HSQA 5JI6A 2JA8J 4J00A 2JD3A 3ML6A 2ISZA 1IN4A 2KQ9A 3RI4A 2E2JJ 4MVQA 3KKBA 5C4JJ 1JPNA 4OINF 4EBJA 1UG2A 3ZQGA 3E5QA 1LDJA 1XMKA 4NY3A 1VK5A 2E71A 4B6IA 4BJ6A 3EPVA 3BTLA 3PNYA 2RC4A 3W2WA 2LF8A 2PEXA 2FFHA 1Q0MA 2CUEA 3LSIA 3HOTA 4IHWA 3K4KA 3K70C 5EEGA 2CQQA 3ZMUA 4CGZA 1NZEA 5M3FJ 2X85A 1GGQA 2HQAA 4ZYAA 1W2WA 3AG2C 3FISA 3OYAA 1RKWA 5AGFA 4MHGA 2PX0A 2YSRA 3JSZA 2ELJA 3O10A 4AD9A 2ZXWC 3ZTMA 5K0IA 4NUBA 2PG4A 1OQYA 1WWPA 4OWRB 5HODA 2XS8A 3PO2J 3HRUA 3JSEO 4F4BA 1QGPA 4CIPA 1MNDA 4G6DA 1JGSA 5GP9A 1VF9A 2L9RA 3WG7C 3EQLF 3H5AA 3ZQHA 4E7ZA 1U6GA 1IV8A 2GQQA 1Y39A 4E0HA 3DV8A 3BEHA 4PR9A 2VODA 1NK2P 1K05A 5BUOA 2GOMA 2LBFA 4KT6A 2BXZA 4CO8A 3IRRA 3K9TA 2J8WA 1XMXA 3V8JA 3Q5FA 2QA4I 1AWCA 2ZFUA 1NK3P 5D5VB 2OCCC 4IAQA 1UELB 3JTGA 3BZCA 4DW6A 2QNLA 1VTNC 1OXBA 5FO5A 3ZPLA 2OA4A 5F6FA 2AHQA 3LEVA 4G0HA 1P6RA 4RGUA 3JRGA 4HRIA 2XLDA 2CUZA 1RUOA 5IYCJ 2VKHA 3DPLC 2PNOA 1H89C 4CDGA 4KFCA 1QZZA 4U88A 4JE9A 3WTTC 5L0GA 2BY1A 3HUGA 4B3XA 1AHDP 1FJLA 2WB1A 2MFZA 1UB9A 2EINH 2QSFX 3DBHB 4CYDA 4IHYA 1HXDA 5C4XJ 1OYWA 3H36A 1W7PB 3ZGKA 4O5VA 2B0LA 4BHPA 3I54A 3ZOBA 3OYNA 1OPCA 4BDYA 4G7OF 1ZK8A 3LWFA 3CC2I 2M4GA 4YIRX 2ZKZA 3ZQIA 1IN6A 4JEAA 4EQQA 5LFAA 4OD4A 2IGKA 3EYYA 4GCVA 1XZQA 1IJWC 2IS6A 3I64A 1BJAA 3W8IA 4DZPA 2DPUA 2ZMEB 5DQZA 2OBPA 3KYJA 2VLAA 3B6AA 2UXXA 4G9YA 3RKQA 1WJAA 1T2KA 1H6GA 2KHMA 4Q5SF 3EGDA 2QQAA 4O6YA 4XTKA 2KQRA 4IRGA 1X4PA 4XWJA 3EUAA 3CO6C 3M9AA 3RIPA 2VC0A 3KZIC 1G59A 2JPUA 2M9HA 2KNHA 2Y3GA 4MLOA 1A41A 1RESA 2FD5A 5F64A 3ASNC 1I50J 2M45A 3TQNA 2XKPA 2UUIA 4GQHA 2X6WA 2R0QC 3H5RA 4RMNA 5LEJA 2H7OA 1WJCA 2E5ZA 3J80Z 2WBMA 2QM3A 3SEQA 1B8IB 3CCMI 2B0JA 3B9QA 2V3CC 2RNGA 4ER9A 3GXOA 4O3MA 3LL7A 3LSJA 1FTTA 1JI8A 1TW3A 2IBDA 2CQKA 4N9IA 2YL1A 4EV0A 3S3MA 3HTKC 5D5WB 1V4RA 2QY9A 1K83J 4A0YA 3NMJA 2JSPA 4MEYF 5D5UB 5BMZA 1PUFA 1I5NA 2ELHA 3U8PA 1Q1VA 4Y15A 3RF3A 3TO9A 3MN2A 4JX6A 4BYYA 5K5OA 3FXLA 2VKVA 2G7UA 2Y9YA 4AIHA 3JSPA 2ZJRF 2R7VA 1OR7C 2CW7A 1BIAA 1R5HA 1B4AA 1S9HA 2OC6A 4DOZA 5IOZA 2KYHA 2TDXA 3K1IA 4J7YA 2NS8A 4LACB 4KI2A 2VPRA 2P6SA 3OOUA 2ELKA 1H88C 2Z33A 2R7UA 4I0BA 4XQ1A 3HPGA 2WVQA 3SXMA 3U3BA 3KLNA 1R1UA 3MYFA 3T0YA 4BHCA 3F8FA 1D5VA 1EA8A 2ZD9A 2J46A 1ZHYA 2LOOA 4CJGA 3FK6A 4IHSA 2X4HA 3WTZA 2M34A 2HGCA 2EZKA 3DM5A 3T9OA 4HFFB 1O3RA 1LUJB 2OAZA 3HRTA 1SD7A 1VI0A 1Z6TA 5FFXA 1UZCA 3J7YJ 2V1UA 1YW8A 1Q0DA 3WU1B 3HJCA 3WHBA 3PIPF 1TFOB 2VQCA 5HLIA 1TQPA 4XONA 3VFZA 5E2QA 1A04A 1LE2A 3Q0VA 1IN7A 2W85A 3DU6A 1P4AA 2HMQA 5F5HA 4IRHA 3PSFA 3ATPA 5E3MA 1YITI 3BG9A 5B1AC 4YIIA 4Z2YA 4IVNA 4RGRA 2DTZA 4U0YA 4A12A 1NHAA 5FD6A 4NC6A 4JX4A 3B02A 2A68F 4IL6C 1TWAA 1X3ZB 2FX0A 1D0YA 3TW7A 2WVOA 4V2FA 2O9XA 2O03A 3M4OJ 2DJIA 4E7SA 2W9YA 4IPAA 3M7GA 1F43A 3DF8A 1DOVA 2NVQJ 3IUOA 1N25A 3A1YA 5A6BA 5JHFA 2PBEA 1XN7A 5BQTA 1G3SA 3DKXA 4B48A 4MVSA 2E1CA 2CUJA 1PUFB 5CPRB 3BG6A 3EHMA 4GYGA 1X2MA 2DT6A 5CVVA 1MMSA 1JXSA 5F27A 5B66C 1BR4A 3VPRA 5IY5C 4KN7X 1S05A 1SVLA 2H8AA 3AG1H 3U3FA 5KYNA 3LQRA 4JURI 3ZQQA 2J0XA 1G2HA 4UUTA 2Z15A 1TWHJ 1ZARA 3ZCOA 3TJ5A 3GLXA 1RC9A 5IP7J 1SVOA 2A05A 4G6TB 4DNCA 2CNWA 3W3CA 4C3BA 4YFNF 2CV0A 1Z77A 1ORYA 4YL3A 5H2FC 3ASOC 3W8HA 4ON0A 3M4BA 3HOXJ 5DYMA 1E83A 1ZLJA 4C3JJ 2M4KA 1KQ9A 1LEBA 1LNWA 2FGYA 4S0HB 2D1HA 4L5IA 2X6OA 3SDBA 3TGNA 2OF7A 3LLKA 1OCTC 1YFHA 1QSPA 3TULA 1LPQA 2JA7J 4E7JA 4NB5A 2GA0A 4CICA 3RH3A 2V1DA 1FT9A 1V3FA 2EV0A 2I15A 3KP7A 3E6MA 2EK5A 3A01A 3H2VA 3K69A 4HOBA 4UB6C 2DA7A 5FROA 2HYJA 1ZKGA 3ZC4A 1MBGA 3LJBA 1H7IA 3DU5A 1FLIA 1IDZA 5EJCA 3HL2A 5EK0A 3PM1A 1ETYA 4JP0A 4FE4A 3U5SA 4XKWA 5J1RA 2HOAA 2LG4A 3C2HA 1MIJA 2UZKA 4IKFA 3PO3J 4JX5A 1FPQA 4YT2A 3OL4A 3BWGA 4Q48A 3A01B 1MKMA 4A2UA 3S1MJ 3HHHA 2QGUA 2A3SA 1SANA 2L02A 4ETSA 1DGWY 2IRFG 3HSFA 1H9TA 5F28E 2CWEA 4U5FE 2AQFA 1QBJA 2Q7RA 1I27A 3OYCA 2QUFA 3CCVI 1NSGB 4CH7A 5EYRA 2N8GA 2O61A 4RAFA 2W25A 3S8PA 3QW1A 4C30A 1XD7A 2K4BA 5B5EC 2OOCA 1P92A 4WK8F 3CCRI 2KL4A 2HSBA 4F7ZA 1ZHWA 3JCUC 4U5BE 2W4SA 1HQCA 2PN6A 4HBLA 1JHFA 2CQNA 1YHQI 2E1NA 3CF5F 2E35A 5L0CA 3LS0A 5HS7A 3RW0A 3K2ZA 4GYTA 2PF4E 4U7BA 2YL0A 5IYDJ 3U8VA 5ILUA 3F9KA 4E7IA 2YUSA 2DBBA 2IS1A 1T6IA 4BJ5C 2K9LA 3FKIJ 4ZYHA 5FLMJ 4CYCB 3E9VA 1U89A 3KEYA 1AUEA 3S1RJ 2BOLA 3LFKA 4XORA 1Y0UA 3C8GB 4HFKB 2KJBA 4M6VA 2HPMA 3S2HJ 2DFIA 3CLOA 4J01A 5LGNA 1CQTA 3GM2A 2OCEA 3WGHA 3C18A 5F08A 3HOZJ 1XGOA 2KFDA 3MX3A 3MMYB 5A2QK 2NAZA 4EJUA 1FMWA 2BVMA 1SF8A 1GM5A 3KYDB 3CDHA 3ABMC 2HKXA 5EEHA 2A6EF 1HBXG 2OG2A 4XKVA 3CUQC 2GOXB 5CVIA 4MW8A 1ZAOA 2QWWA 3SEZA 4D5FA 3OYMA 2HFIA 3ZQVA 5EF6A 5J8FA 3IQTA 1WASA 2JA6J 2L9JA 3CCJI 3I5QA 1T8IA 2HOSA 1WJFA 1I1GA 2D4UA 2B0HA 2XB5A 3E6DA 3FXOA 2MWQA 2Q1ZB 2FEZA 5F0FA 3WHCA 1LI7A 2DT5A 2A0UA 4LFUA 2QQ8A 5AIPA 1F1MA 2YWAA 3UNGC 2R4GA 3MKZA 2Z9OA 1KZHA 3P9IA 3GTGJ 4YT4A 2O5RA 3J80K 1YG2A 4KMFA 2ETSA 4CS9C 2Q4FA 4KIFA 2DOAA 4CA0A 1A5JA 1VOMA 2R7OA 4PZJA 2FNPA 2L9NA 2EPMX 1S6LA 1WRJA 3ELKA 5T3WA 3I4NJ 1B6AA 1ORKA 2V7FA 4ITVA 3KZZA 2VBXA 2WVNA 1J09A 1P9QC 3F23A 4BQAA 3MWMA 2DMQA 3GFMA 4A3BJ 3U9JA 3ZSUA 5AC4A 2QQBA 2IXPA 5JLIA 3LSRA 2WZGA 2GA2A 3K1HA 5KYUB 2JUGA 2XM4A 4WX9A 5TJJA 3DI5A 4C3EA 3RPQA 1ORSC 1TWHA 4UUSB 1QVUA 2VL8A 3SHFA 4MQVA 1BL0A 3C8ZA 3CTAA 4LDKA 4RB1A 3K4JA 5DS6A 1EKYA 2OUMA 3IKTA 2NS7A 4DVYP 3HTSB 3H1CA 5A69A 4LK1F 1VQKI 3WTYC 2LFDA 2ID3A 1DU0A 3DKYA 4JBAA 3EZHA 2NSFA 3M1CB 1YIOA 1TWFJ 1TLHB 2OJED 2PMZA 2M0CA 5FB2A 3ZQFA 2CW8A 5IP6A 3QQAA 3CMYA 1BW5A 1GLNA 3AOUA 1CPQA 3JTLO 2IOQA 3RDIA 4A0ZA 4D7NA 4F93B 3MBGA 3FXJA 4I3MA 2Y0SN 3BJOA 3LSHA 2XSJC 2XRLA 2E2IJ 4O6MA 4RD9A 4BEJA 1W0UA 2RREA 5ICGA 5ILVA 2QSHX 1Y8RB 2HQRA 1H9GA 2VXZA 1ZHFA 3S84A 3U1DA 1NBBA 2LD6A 2FNAA 5JUAA 2KIUA 4HX7A 4FETA 4AYBN 4RAYA 2R5ZA 1FFHA 2KLOA 3OOPA 1I5ZA 2V4JC 2BL2A 2L6HA 1T9KA 2LQGA 5B1BH 2H1LA 3H0DA 1VQOI 1XGMA 4E7KA 1VQ8I 2TRTA 1JKPC 1QPIA 3GW2A 3N24A 4LK0F 4ZLDA 1MH4A 1OISA 2ISYA 3BPVA 3GYHX 2PJRB 2HUJA 2IBFA 2Z99A 3E6CC 5EGOB 4XR6A 3PUBA 1XCBA 3DZAA 1VTMP 2BY2A 2Q9AA 5HS9A 3QYFA 1T08B 1MD0A 3O6BB 3KP5A 5J40A 5BPDA 2P8TA 1CGPA 3JYYA 4L9TA 5DCFA 3RYRA 3S2WA 4QTRA 1JUMA 4ENMA 4E4HA 3P7NA 1V55H 4FASD 4CX9A 4EMSA 4YL1A 2OU2A 1W7PA 4N06A 4ULVA 3IWZA 5KYXB 4BDZA 3KP6A 4DGWB 3HC7A 1B68A 2MBFA 1QHHD 3EUHA 3QPHA 2EPKX 2BZTA 3GWZA 1J75A 1B72B 3OY9A 2XGDA 3KETA 5KHDA 4ZH4F 2L7MP 1GXPA 4AE4B 1A36A 2ECBA 5TISC 2NSGA 1JJ8C 2UUZA 1Z23A 1SR2A 5HOOA 4OD5A 3BR0A 2ACJA 1ZW3A 2HPIA 4CCJA 2YL3A 3NYLA 4U5HA 2XLEA 4PUSA 4RLFA 5LHGA 3K1IC 1RNLA 4XICA 2DA3A 1KU3A 3GTMJ 3BR3A 4L5EA 3E6BA 4Q4ZF 2G9WA 3SZRA 4LLEA 4B47A 1DP3A 2R7SA 5GPGB 1ZG5A 2OEXA 2G0EA 1E3PA 4N9HA 2XV4S 3MFKA 2Q00A 2UWMA 2KDZA 2EPOA 4ESBA 2GDCA 4DRIB 3SZTA 4UDVA 3R61A 4YELA 1T6UA 1J5YA 5A2QZ 1ERDA 4AIKA 3KZYA 2ZPAA 2H94A 2BEOA 1JKQC 5F04A 1S7ZA 2OU6A 3CJQB 3BR5A 1TNSA 1SC7A 4BS9A 3S9OA 3TOLA 3B0VC 3ZWIA 4E17A 3LOCA 2K27A 1W5TA 4JQFA 5J1YA 3JRAA 1QZEA 5DUIA 1U8RA 3UMIA 2TCTA 2A1DD 5FKKA 4CDVA 3HBLA 4F55A 4RM2A 2CJJA 2W84A 1CPRA 2QE9A 2YL7A 2RQQA 3B73A 3FX3A 2XAFA 4OMYA 5JVEA 1IRGA 4PJNA 1X1DA 5IY5H 1OR2A 3FMRA 4A93J 3NMIA 1ZYRF 2DGJA 2P7VA 5JVTA 3OYFA 2ZBKA 4LJZF 3S32A 4YG2F 4CCNA 1ETVA 2CQXA 1OXKA 1XSDA 5LEKA 3H3ZA 1MBHA 1MJAA 1F1ZA 2L7KA 1FC3A 3WTSC 4BAYA 4HDUA 3NYJA 3TJ6A 2LP4A 3DD7A 2O3FA 3S93A 3S17J 1G6NA 1SVMA 2BHZA 2ID6A 1R4TA 3GWLA 4W8PA 3FVYA 2R25A 1FP2A 1LM3B 1UJ8A 3N05A 1TNTA 2EINC 4Z9IA 1IC8A 1CF7B 5LLQA 1IN8A 2WAFA 1Y1WJ 3U2LA 1FP1D 2ZXHA 3VYWA 2YLIA 3ZIBA 1FSHA 3DAFA 3OSGA 2WTEA 3BTCA 1D8JA 1JPJA 1EF4A 1X1AA 2LY2A 2D2WA 3U1KA 4N4NB 1LVKA 3RVYA 3TP3A 2IPQX 3KMIA 1Z05A 2XL4A 1SD4A 2H09A 2P0WA 2O8KA 1KQ0A 1A6IA 3C2BA 3OIQA 3KEQA 4EATA 3M1CA 1R1TA 2EILH 4B3AA 4M71A 1IGNA 3QOPA 3T1BA 1ZRFA 3H5NA 1V4AA 4U9EA 5A6JA 2L81A 3OYHA 4DYRA 1WGWA 4XIDA 2HDCA 3BC8A 2YZSA 1ZQ3P 3OL3A 4AYBA 3AG3H 2EIMH 4IWBA 4EUKB 2WB7A 4M73A 3R0JA 3E0JB 3WG7H 2DFHA 5M3MJ 2E1OA 4ESJA 1LE4A 2K85A 1Z91A 4HF0A 3VYRB 3KP2A 2I10A 4EM2A 2XUBA 4IO9F 4HSRA 4A2NB 3Q0WA 2KRHA 4MVOA 1FOYA 1QZYA 2F4MB 2M8GX 1DPUA 4UY8I 2BGCA 3PNTA 3TDZC 5DTDA 3PJRA 4XKCA 1I6HJ 1NFOA 1ZU4A 1SEUA 3VF0A 2HXIA 3FOPA 1JT0A 2VQGA 2LSOA 4QWQA 3KYLA 1K61A 4UVAA 2ZFWA 3AGUA 3ZP5A 1TW2A 2OTJI 4PJLA 1KU2A 3K4CA 2DPDA 3A0HC 3J7AY 4W97A 4BXXJ 1FY7A 2Q2EA 1BM9A 1SFXA 3ECHA 1Q0KA 2FUG2 2DXIA 1ULYA 2JK3A 4BE2A 2L4MA 2DT7B 5ERIA 1Q1HA 1S7AA 3JTHA 3SNHA 2BW3A 2L0KA 5A6AA 5D8LB 2MD0A 3QW0A 3R0AA 5E3NA 3G4ZA 4RB0A 4O79A 1JTYA 2EILC 2JRTA 1D0XA 1D1BA 2DO7A 1BOBA 5F0HA 4OU0A 1QO0D 3TKYA 1TWGJ 2XVCA 4HEA2 5DDGA 3K70D 1EJ9A 2JX0A 2ZXPA 4WXHA 1H8AC 2LREA 3F6VA 4X0GA 4HF1A 3FDQA 1DOWA 1HOMA 1MDMB 3UMHA 1ZTRA 2MW8A 3EH2A 3DPTA 3HJEA 3OS0A 2L6FA 1G4US 3A03A 2NNYA 3I58A 2L4AA 3DBRB 3DP7A 3KL4A 3L0IA 1O57A 3ABKH 1RZ4A 3WU0A 3QRFF 1VQ4I 3K4BA 3SYNA 3GFIA 2J7PD 2WWYA 4DIQA 3NWSA 5FFZA 2NVYJ 3WTWC 3MKWB 3GX4X 5CLSA 2A61A 2IXNA 4U87A 2XGEA 2PFDA 2LDUA 3DWLE 3VYSB 4A6DA 3J06A 1YTYA 4XLAA 3AL0B 3Q7GA 2ZJQF 2IA0A 2LRDA 3V42A 2A5WA 3FF5A 5ICEA 3LAJA 5KYYA 2XASA 5D4RA 2CMPA 5JT4A 1XGNA 4RAGA 3OS1A 4OMZA 1OKKD 2GM4A 1QZXA 3DWWA 5ICFA 4F92B 4TV7A 3F6OA 4P1WA 4C3IJ 2YLGA 4BXFA 5KAFC 3DM9B 2I8DA 2H1KA 1JR8A 1AA7A 3GZNB 5DCMA 4IHTA 1YE9A 1VYKA 2VOOA 1PVEA 4ENJA 4M9ZA 4C2UA 4MTOA 3CJRB 2E7WA 1HSJA 1ZHZA 2QBYA 2PMUA 3GFLA 4V2GA 5CKTA 3C1DA 2VE9A 2EA2A 3OYIA 2HOTA 2GIZA 3MZHA 1EA3A 2NUPA 4NHJA 3CUQA 3FMQA 4XQFA 3FXKA 1ZRDA 4KDPA 3PMRA 4XPWA 1POGA 3H0GJ 1X3WB 2MLGA 2EFOA 4II3A 2PJPA 5J6XA 5CQGA 3V7RA 2HZTA 2R3SA 4UB8C 4CUGA 4IRIA 1HKQA 5IT9Z 4CS9A 4AUXA 3VWBA 3AG1C 4X0RA 4WCGA 5HVQC 5ILSA 4XPYA 1XMAA 1XSXA 4K7BA 2A0BA 2VPLA 1IRFA 2FOWA 3T8RA 2GA1A 5FKOA 3L09A 1VNDA 3KP3A 1P7JA 4HA8A 3H3VK 4N4WA 4D7MA 2NVXJ 4HF2A 1ST6A 2Y9ZA 2P7CB 5DM7F 2IJLA 3NWTA 3SEOA 2PBIA 1YA9A 3KPHA 3TBIA 4WABA 2FMLA 2IYLD 1ZG3A 5DCMB 2BXYA 2IXSA 5ED4A 2OD5A 2LY9A 3O3KA 3ZN0A 3L8IA 4MNDA 4P6IC 3HSRA 1VB5A 2G7HA 1KONA 4JTAB 3LSMA 3ABLH 5DUKA 3GVAA 1X1CA 5LBQA 5L3FA 1O7LA 1FBQA 3PSIA 4S05A 1RKEA 1W7PD 1DDNA 3BJAA 1MNEA 3CLQA 3O8GA 3CCQI 4A4AA 3DKWA 1GT0C 3RZOJ 5D6FA 2DDBA 1HY5A 4AC0A 3HGGA 2W4BA 2HTSA 4HYEA 2X0LA 4A3EJ 3L00A 5F1JA 2F4OB 2WADA 4GO1A 4C3HJ 1PYVA 3SZGA 3AG4H 3MKYB 3T6GB 3V5YA 4S04A 2Y2ZA 2G3VA 1WVRA 2LBFB 3VRCA 4FQGA 1M57C 4XKBA 3BCAA 4EJOA 3VAYA 1UMQA 2XL6A 1RETA 2D5VA 2FQ3A 3A11A 1O5HA 1R5ID 4KN4X 5F5FA 1UAAA 3GF2A 3RPUA 1WPKA 2P81A 4YN0B 4LMYA 1YJ9I 3LUTB 1Y8QB 4NTFA 2CV1A 1T0FC 2OPTA 3VB2A 2KP6A 1OKRA 5C3EJ 3QYEA 3C62A 5BNGA 3A2KA 3KH2A 2H8WA 1A7DA 3L2UA 1REPC 4H54A 1ZN2A 2BE5F 4U0WA 1ZR2A 2L5QA 2R7DA 3RTRA 3AAFA 1MQVA 4BJ1A 3FXQA 4LB6B 4ZYEA 2HNHA 4ZDPA 2VASA 2XAHA 3F8NA 4R8HA 5HS8A 5EZHA 2EZLA 2HV6A 2NUTB 2Y3BA 4HNVA 5FLXK 2BC5A 3EETA 4BE1A 3U2MA 3A02A 3F0CA 4LITA 4MO7A 1YZCA 3TOMA 3FMSA 3GEIA 2KK1A 1TT5B 2XPUA 1D1AA 1ZU5A 2V6EA 5L0FA 1N78A 1ZZPA 1YI2I 2A69F 4QPQA 3VEPA 3ZQLA 1N75A 2EIJC 4HNUA 1M2VB 2HDWA 1U0BB 3IQ6A 2E36A 3BROA 2E19A 2M2EA 2KC3A 2L01A 3MYIA 1QNTA 4W8KA 1BJZA 1BBHA 3GTPJ 4CIHA 4A3IJ 3AL0C 1WTYA 2GWWA 4CZCA 3GFJA 2EWNA 3IAM2 2EZHA 1FOKA 2J7PA 4C3DA 4M9XA 3GMEA 2BY3A 2IA1A 3QAHA 2XAQA 2JTVA 3M07A 2R7WA 4HNTA 2ZJPF 4IHXA 2J9VA 1ZHTA 3I59A 1VFCA 3ZQCA 4CS8C 3D5RC 2B63J 2Q9BA 3QPTA 4MVRA 5E18F 3QU6A 1TBXA 1J9IA 2PP4A 2X0CA 5GPCA 4YFKF 5DS5A 3UGPA 5K7FA 1BR1A 2LFBA 3OYLA 1YLMA 1Z6AA 4JTDB 1X3UA 1KA8A 2CW0F 2CYDA 4L6RA 2HZ8A 1TZLA 3TO7A 4QLCU 4ZZLA 5E3OA 3WGIA 4LLNA 4K0DA 2QF7A 4DVZA 3MCZA 1J8MF 1M56C 4J30B 3DEUA 1FYKA 4ZC3A 2UXNA 4I2OA 2O7OA 1YARO 3BR2A 5F1RA 2FOKA 1S8NA 3OYEA 1LIHA 1C0WA 1SFEA 1YYXA 1BI0A 3OA1A 4JYKA 2IXOA 4DBRA 3RKOF 2P5VA 1MGTA 2H7VC 5KAIC 2VCBA 3HRSA 4HLYA 5TRDA 1MSFC 3OYBA 5DLJA 3GO5A 3PUFA 4XEFA 3LESA 1FSEA 2P5KA 2FBIA 1DPRA 2IA2A 1OJLA 2PQ8A 2NOGA 2MSYA 4OAZA 2XAUA 4I76A 3V7SA 4ZYGA 3ZVRA 3J7ZI 1OCRH 2Y69H 5KCMA 4F91B 4IX7A 4HDVA 1SFOJ 2YVKA 5CI9A 2DTRA 3PQKA 5FLXZ 3JREA 2DOEA 3FM5A 1JMWA 3PHF2 2CU7A 1EH6A 3BCBA 2Y30A 2X9DA 3FKJA 1S7OA 2MGQA 4BE0A 4B1RA 3LSPA 1HDPA 2COBA 1Z6RA 2RNJA 2LFFA 2PX3A 2ESNA 2HDDA 2EV6A 5K5RA 2Y0SA 3AG4C 5LHIA 1YYVA 2CSOA 5FZTA 5GAGJ 3VOEA 5GADJ 1RPWA 1WFXA 2JZYA 1YRNA 1IRZA 2NUPB 2ZNYA 4C2TA 1YQAA 1FX7A 1A6QA 2BHYA 3PL8A 2YQYA 4ZDOA 3IPMO 1TTYA 2CRGA 4NTBA 4CCLA 3FHZA 5DQTA 2DDAA 1OW8A 2H8RA 4A3MJ 2F48A 3VODA 2M4EA 4MVMA 2QLAA 1P4XA 3WGGA 3LAPA 2LKPA 3DLLF 5E1XA 3OSFA 1FBUA 3H65A 2DFFA 4L9NA 3LFUA 4CDAA 3CC7I 2ZXOA 3P9KA 4I44A
chains in the Genus database with same CATH topology
1IXCA 3FM3A 2DAOA 2ADUA 1I6XA 3V4GA 2A6HF 2VT3A 3H92A 4BH9A 3J81Z 4HW0A 4MTEA 2K86A 2XRNA 3TOBA 2IW5A 3JW4A 2F5FA 3IC7A 1ON1A 3WTUC 2V9VA 2ZO4A 1U3EM 2ZCWA 3F72A 4HLXA 3M1EA 4LG0B 1U78A 1F5TA 3M8EA 3Q9SA 1YS7A 2EFPA 2NYXA 3F8CA 1USTA 2KRFA 3BPXA 1MJ9A 1T39A 5CVUA 4I09A 4E70A 1BC8C 1KYWA 4M72A 4G7HF 2R7FA 2FE3A 2M1BA 1FBSA 3I53A 4ENNA 4Y17A 2ETHA 1B59A 1OR7A 1XDUA 4UXNA 5LGTA 1J0RA 1KU7A 2RV8A 3IL2A 1IXRC 3I0TA 4OIRF 2STWA 1ZGJA 1PP7U 2RDPA 1EV7A 4EGZA 4PGGA 5CJ9A 2BBYA 1FWZA 1ZG1A 2P7VB 1ZH5A 4OIQF 1WI9A 2QENA 4EGYA 1Z1DA 2KJCA 3SXZA 2K02A 1OYIA 5D6EA 1XDSA 4L5JA 1SMTA 2DK5A 2MH2A 4LG0A 3KFWX 1ZRCA 1O7FA 1L3LA 4U7DA 4B09A 1PDNC 4H0EA 2FBHA 2C6YA 1D3YA 3N97A 1FYLA 5KK1A 3C3WA 4Q47A 1TQIA 2AS5F 3MEXA 1F9NA 2DQLA 1LDDA 2MLKA 1E2XA 2GAUA 3LA3A 1JE8A 3WTVC 4CXFA 1SFUA 1HW2A 2MH9A 3ULQB 3K1MA 1PP8F 1R5GA 2J5OA 4I02A 4FHTA 1G4DA 3V8LA 2ZJ2A 3WE2A 1K78A 4XSZF 2XHKA 4OIPF 4P55A 3ROUA 2EJRA 2OQRA 2F5CA 1QQIA 2JPBA 3HYIA 3WTXC 3CUQB 4YIFA 1T38A 4WXDA 4G94A 3ABTA 4FX0A 5KVRA 2IP2A 1I1SA 4L0ZB 2O8XA 3JAMK 3I4PA 3GEZA 3MQ0A 5J8CA 2NRAC 1XGSA 4JK1X 4KA4A 4M6YA 5IT9K 2VE8A 2MA3A 1O3QA 3CUOA 2PFBA 1W5SA 2P6TA 3I71A 3ZQ7A 1KQ8A 2DU9A 4HV6A 3I59B 3OV8A 2HYGD 5CVRA 4LD5A 3FZVA 1ODDA 3R4KA 1RI7A 3QP5A 2F5EA 2RN7A 4IF4A 4AWXB 2VOPA 1WKMA 2CFXA 3KE2A 1USSA 6PAXA 2Q0OA 1U5TB 4RGXA 4D0PA 4ESFA 2PMHA 3EYIA 4R1HA 3ZN1A 3JAMZ 3HSEA 3ERED 2XGXA 3HTUA 5JHUA 1DP7P 2EA4A 2HKOA 2IVMA 1LQ1A 1KU9A 2HEOA 2EB7A 3RJPA 4P96A 1B1BA 2YU3A 1XSVA 2Y75A 4YFXF 5LGUA 3L9FA 3R6SA 3V8KA 3D0SA 2NS0A 2FMYA 3IHUA 3RIRA 1R1VA 1UCRA 1HW5A 2GZWA 4ASNA 3IWFA 2Y0MA 3ZMTA 2WC2A 1RUNA 1W4MA 3DFGA 4A5MA 1BI2A 2O0YA 4L9VA 3RKWA 2HYFA 1R23A 2HR3A 5IT3A 4M6XA 5FGMA 1LJ9A 5AONA 3G3ZA 5DD8A 4UV9A 3C7JA 5HLGA 4MGRA 2H6BA 3F8MA 3ISPA 1R7JA 4GYIA 1B9MA 4N0BA 5BOXA 3T5XA 2HOEA 1YO5C 1FYMA 1HKSA 2YPRA 1O3TA 1Z7UA 2L3DA 4PCQA 5HDKA 3RKYA 2GIVA 2RVCA 2DW4A 3SXKA 1UHMA 2XROA 1PUEE 2V79A 2BYVE 2NNNA 1ZLKA 4L9JA 2FBKA 5JR3A 3FXUA 4CHUA 5LRSA 3F3XA 5DV5A 3E5XA 1B9NA 3W6JB 1EH8A 1XCVA 2W24A 5CVJA 3TOAA 1D8KA 3HHGA 2EFNA 4I01A 4I0AA 5E1WA 1SD6A 4KT5C 5L3EA 2KIMA 5LRRA 4UUVA 4KUMA 2FF4A 1OMIA 2CGPA 2FSWA 5ICCA 2O6GE 1S29A 2YX4A 3LA2A 3MZYA 3HRMA 1BI1A 3SFZA 1BOAA 3V7CA 3IRQA 3F22A 2F2EA 1YW7A 1SMYF 4ZYDA 5BS6A 3F8BA 3ZMVA 2ZXJA 2KKOA 3BJ6A 3REOA 1R36A 1K79A 1MJBA 4MQ9F 3L2CA 4XLPF 2GXBA 2M8EA 4FT8A 4L0YB 4GGGA 2MC3A 4MNUA 4LLGF 1J7KA 2Z3YA 4ENKA 4Y13A 3FXRA 3BDDA 1IN5A 3DQVC 3TO6A 2STTA 1R22A 2VBZA 1CF7A 2VONA 2DI3A 4K2EA 1T6SA 2A07F 1SAXA 1H0MA 3I5UA 3WG9A 4HQEA 1ON2A 3QP6A 3KCCA 3PQJA 3KEOA 3PFIA 1U5TA 4U0VA 3GZ6A 2LNBA 4WWCA 4GXOA 4FX4A 1T0FA 1IAWA 2L54A 5D5XB 1ZREA 2F5DA 2Y48A 1HW1A 1UFMA 1FNNA 4EM1A 4UV8A 2OZ6A 5JFRA 2QZ8A 3D5LA 1G3TA 5H6RA 3KLOA 4XBFA 3ZMSA 3J7AO 5FD5A 2HTJA 4KMUX 4WXCA 4RB3C 4G8XA 2RGVA 2XAGA 1R00A 4LLLA 5HDNA 3HIFA 2AXLA 1KYZA 1EH7A 1HSTA 2XKOA 2COMA 1OYYA 1YS6A 4HV5A 4IXAA 2HWVA 4NQWA 1O3SA 2PI0A 4WF2A 2XAJA 3CO7C 2VT2A 2BV6A 5E20A 2EFQA 3RYPA 3BY6A 4M74A 4RB2C 2GXGA 5AIQA 1K78B 1GVJA 4XRFA 3F21A 2QBYB 4XLNF 1STZA 3ZMDA 5D8KB 5L3BA 4KICA 3M8FA 1P2FA 2Z5UA 2DQRA 3ECOA 1S3JA 3TDUC 3BZ6A 3U9GA 3BP8A 3O2PE 2DK8A 5K5QA 1E17A 3SQNA 5LHHA 4UVCA 2CG4A 2RKHA 1LVAA 3LA7A 3LSTA 2EFWA 2FRHA 4HQMA 3WE3A 3T8TA 2MD5A 4BNCA 2J5PA 2CO5A 2GWRA 3E5UA 1P4WA 3HOSA 1ZGAA 5DEQA 1IF1A 3NQOA 1LDKB 2K7LA 3P9CA 4O6JA 4OOIA 2YR2A 3FWEA 1WSUA 4MTDA 3GUDA 3K1NA 1FZPB 4L18B 3LQQA 3KP4A 2KIFA 1T98A 4EJVA 3Q9VA 2HS5A 5L3DA 4EM0B 5L3GA 1HKTA 2EV5A 2Q8KA 1YW9A 5H6QA 4DQ2A 3RKXA 4UHTA 1GHCA 1ONVA 1R58A 4PGHA 2E7XA 3ZMZA 4BHBA 2LF7A 2YX7A 1WQ2A 4RAZA 2PLYA 2VBYA 1TQMA 1IW7F 4EVIA 2H6CA 2QYOA 4UVBA 2P5LC 3K1PA 3L7WA 1BIBA 3H3UA 5D4SA 2W57A 2H27A 2D45A 4G7ZF 1G3WA 4P5OA 4IJAA 3DXJF 1GXQA 1IUYA 2JPCA 4KIBA 4AVPA 3IKVA 4HZFA 1MZBA 4A5NA 2FXAA 2ZMEA 4A6EA 4AIJA 5CYVA 3K0LA 1BN5A 2VN2A 1LB2A 2WV0A 4HAMA 2QLZA 1XB4A 1Z9CA 1G3YA 2OQGA 3QU3A 5K1YA 5DD4A 1JHHA 4LGWA 4RGSA 1AOYA 4R79A 2V6CA 2M87A 3U2RA 3MAJA 3E3VA 3JSOA 4ZZDA 3NRVA 1BC7C 5E1ZB 2JSCA 1J2XA 3SZPA 2ESHA 2QVOA 5HDGA 4P9UA 1UHWA 2VBWA 2VC1A 1QPMA 1K6OA 2HQNA 1K7AA 2OZUA 1MDMA 2K4JA 4P9FA 2M30A 2CYYA 2QQ9A 5H20A 1U2WA 2DLLA 1BBYA 2M5WA 4UNOA 3ABUA 4G6QA 1WWXA 4B8XA 4KNYA 4EJTA 1KGSA 3E97A 3J81K 2IT0A 4CZZA 3COAC 2JT1A 2D1VA 2P4WA 5HLHA 3WODF 4M9SA 4A0XA 5E17F 3BOQA 4LB5A 2HFHA 2XIGA 4MEXF 4BXUA 2V1XA 4RS8A 1IZ1A 4I98B 1L0OC 3W6KB 4HX8A 2FA5A 2FU4A 1SD5A 1RIOH 2A5YB 5E8IA 3CJNA 4OIOF 1BI3A 1J59A 3SXYA 4KYWA 4PDKA 1LEAA 2RQPA 3G73A 3NEUA 1DUXC 3GZ5A 1U5TC 3R60A 4I7HA 1F4KA 2ZNZA 3EDPA 1IXSB 5E8GA 5L3CA 1YLFA 4XSXF 4EJWA 5BPIA 3N4MA 4HX4A 4KIGA 5JI6A 3ML6A 2ISZA 1IN4A 3RI4A 4OINF 3E5QA 1LDJA 1XMKA 2RC4A 2LF8A 2PEXA 3HOTA 5EEGA 3ZMUA 4CGZA 4MHGA 2YSRA 4AD9A 2PG4A 3HRUA 1QGPA 4G6DA 1JGSA 3EQLF 1U6GA 2GQQA 3DV8A 2VODA 4CO8A 3IRRA 3K9TA 3V8JA 3Q5FA 1AWCA 5D5VB 3JTGA 1VTNC 5FO5A 3ZPLA 2OA4A 5F6FA 1P6RA 4RGUA 1RUOA 3DPLC 4CDGA 4KFCA 1QZZA 4U88A 3WTTC 3HUGA 1UB9A 4CYDA 1HXDA 1OYWA 4BHPA 1W7PB 4O5VA 2B0LA 4G7OF 3I54A 1OPCA 3LWFA 2ZKZA 1IN6A 4EQQA 3EYYA 4GCVA 3I64A 1BJAA 2DPUA 2ZMEB 2OBPA 2UXXA 4G9YA 1T2KA 4Q5SF 2QQAA 4IRGA 3CO6C 3M9AA 2VC0A 5F64A 2M45A 3TQNA 2XKPA 5LEJA 3J80Z 2QM3A 3GXOA 4O3MA 1TW3A 4N9IA 2CQKA 4EV0A 5D5WB 1V4RA 4A0YA 4MEYF 5BMZA 5D5UB 2ELHA 4Y15A 3TO9A 4BYYA 5K5OA 2G7UA 4AIHA 3JSPA 1BIAA 1B4AA 1R5HA 2TDXA 2P6SA 2Z33A 4I0BA 3SXMA 3KLNA 1R1UA 3T0YA 4BHCA 3F8FA 1D5VA 4IHSA 2X4HA 3WTZA 2HGCA 1O3RA 2OAZA 2V1UA 3HRTA 1SD7A