3IHUA

Crystal structure of dna binding protein (yp_298823.1) from ralstonia eutropha jmp134 at 1.92 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
205
structure length
205
Chain Sequence
SASDTVFFGIMSGLELGTFVPGQRLVETDLVAHFGVGRNSVREALQRLAAEGIVDLQRHRGAVIRRLSLQETLDVLDVAERMTGLLARAATRGSGNQPQVQALRASVQALVAAEKAQDGETFSNARRHFYRTLLEMGDNRELRRLFPTIHMPIVHAQHRLASLRQMRLDDYRRIATAVLAGEPDAAEAAGAAHVKNVRGAILDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, GntR family
publication title Crystal structure of DNA binding protein (YP_298823.1) from Ralstonia eutropha JMP134 at 1.92 A resolution
rcsb
source organism Ralstonia eutropha
molecule tags Transcription regulator
total genus 80
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ihuA01
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3ihuA02
5CVVA 1UFMA 4MQ9F 2V1XA 4WWCA 4BHPA 3HUGA 4HX4A 5D6FA 4IHSA 4L9TA 4L9VA 1KGSA 2ISYA 3VODA 2CWEA 5JFRA 4HF0A 2EFOA 5FGMA 1KQ9A 1QZZA 1O3QA 2VE9A 2ISZA 1DUXC 1XN7A 1E17A 2Q8KA 2XUBA 2ADUA 2UXXA 3FHZA 4MTDA 2E1CA 4LFUA 1LQ1A 3KP3A 4BQAA 2K4BA 4IPAA 3V7SA 2NYXA 3ABUA 3L00A 1JE8A 1G4DA 1XGMA 2YSRA 2L02A 1FYKA 3IL2A 3M8FA 4BHBA 4P9FA 1GHCA 1IUYA 3QOPA 3U1DA 1YW9A 1DDNA 1W4MA 2GA2A 2MC3A 3ELKA 1WWXA 3LAPA 2JSCA 3GO5A 2Z99A 2V79A 2EWNA 1PP8F 1YS7A 4D0PA 1FC3A 2FF4A 3S2WA 2RNJA 1I5ZA 1UCRA 5CJ9A 5D6EA 4IRGA 5DV5A 3FMRA 3KE2A 4ON0A 3CUQC 4UVBA 3J80Z 4CO8A 3AAFA 2XVCA 3C18A 2EFPA 2A68F 2KIMA 2F5CA 5H6QA 1DPRA 1Y0UA 2NRAC 4HX7A 5AIQA 1O7LA 1K78A 2HQRA 1SD6A 2A5YB 1ON2A 3EDPA 3GEZA 4RGRA 2BEOA 4A5NA 2VOOA 4WXHA 3WTUC 2XAGA 2O61A 2Y75A 1QO0D 3M9AA 4HV6A 3GFIA 1TLHB 4OIRF 2IA0A 2Q0OA 5LGNA 5AIPA 1MD0A 5ICCA 2LNBA 1Z6RA 4S05A 5TJJA 3WU0A 1LB2A 2WC2A 2HR3A 5BQTA 1YQAA 3F23A 4ZH4F 4I0AA 3KZYA 1SFXA 3T1BA 1G3WA 2VE8A 2Z5UA 4UXNA 2KIFA 2W25A 5FFZA 1RZ4A 4M9SA 1ZGAA 2PI0A 1FOKA 1KU3A 4P96A 2D1HA 5DCFA 5DUIA 1LDJA 4HYEA 4P5OA 5L3BA 3OV8A 2XROA 3GFJA 3IKVA 4K2EA 4EGZA 4ZYEA 2CFXA 1W5TA 1FP2A 4ESFA 3KETA 3GWZA 2STWA 4CHUA 1HSJA 2O0YA 2OQRA 1J0RA 2EFQA 2DQLA 3RPUA 3V4GA 3HTUA 3K0LA 3KEQA 1O3TA 4MEYF 5FD5A 3EYIA 4N9IA 1LDKB 3HOTA 1TNSA 5ILUA 3KP6A 4LGWA 1YYVA 1JHFA 5ED4A 4LJZF 1FYLA 1B9MA 4CICA 4JBAA 3ZN0A 3JSOA 4AD9A 1Z7UA 2DLLA 1TW2A 2OU2A 1UB9A 4G6QA 3DP7A 3EQLF 3D0SA 1RIOH 1FT9A 2FNPA 5HDKA 3MCZA 3HTSB 3GX4X 4Q5SF 1F9NA 1MKMA 2DAOA 4KDPA 3TO9A 2V1UA 2JPCA 4BH9A 2EV0A 2VONA 2RKHA 2X4HA 3B02A 1WKMA 3BY6A 4NB5A 1P6RA 2EJRA 2RC4A 5H20A 5LHIA 5BPDA 2EB7A 1R22A 4HDVA 3R4KA 1SD5A 3QAHA 5HS7A 3E6BA 1BOAA 5JI6A 1STZA 5CVIA 1OR7A 3GZ5A 4EQQA 3GUDA 4Q47A 1JHHA 3DPLC 4OMYA 2MA3A 1SFEA 2P4WA 2Y0MA 1FX7A 4I01A 1Z05A 4HOBA 2A69F 2GXGA 3K9TA 4XBFA 1XGOA 2MLKA 1WSUA 1TTYA 2FBIA 1BI3A 3CO7C 3VEPA 4QLCU 4KT5C 1TQIA 3CUQA 1TQMA 1S3JA 1S8NA 2OZUA 2L3DA 2QBYA 1F4KA 3D5LA 2YPRA 4GGGA 3WTXC 2RDPA 4A6DA 3E3VA 5LEKA 4MHGA 1FNNA 5LRSA 3LQRA 5DD4A 1REPC 5DUKA 2IRFG 2RV8A 4HLXA 4HF1A 2DTRA 3LAJA 2XAQA 3R61A 4G7HF 1R1VA 2GIVA 1A04A 1KYZA 1R23A 2W24A 4IF4A 3F6VA 2GA1A 2PN6A 4I0BA 4AIJA 5CYVA 1KYWA 3CUQB 3R0JA 4GO1A 1I27A 3I59A 2HDCA 2IA2A 3SHFA 4IHTA 5DYMA 2BGCA 2ZKZA 2QBYB 3KCCA 1T98A 3JTGA 2FNAA 2CO5A 1ZG5A 4L0ZB 3L2CA 2RQPA 2EV6A 3LA7A 3K2ZA 1SAXA 1J9IA 3KLNA 1WI9A 4RGXA 2M8EA 5D5UB 2PMUA 2BE5F 4M9ZA 3COAC 5DEQA 4UNOA 1S7AA 4KUMA 2D2WA 3Q5FA 4WXDA 1B6AA 4IRIA 4BAYA 1W7PA 2OA4A 2COMA 5BPIA 2FBKA 5CLSA 4CGZA 5FB2A 2FSWA 2HYGD 1I6XA 3TQNA 2K86A 3R0AA 4KNYA 1V3FA 3HIFA 2A07F 2M87A 1HW5A 1LDDA 3H3ZA 3I59B 2VC0A 3R6SA 1R5HA 3GFLA 2IT0A 1LEAA 3F8MA 3HRUA 2CQKA 1XD7A 2IVMA 1Z9CA 1JXSA 4FHTA 3DV8A 3BDDA 3IC7A 5D4RA 1YIOA 2ESHA 4KFCA 2HZTA 4KN4X 3TDZC 1VTNC 1FYMA 1KQ0A 4JQFA 3MWMA 2G7UA 3ERED 4G9YA 1W7PB 3VFZA 5HDGA 1U3EM 2XAFA 2HKXA 3BZ6A 5ICFA 4KICA 3DFGA 1J5YA 3LFKA 1TNTA 1AWCA 3KFWX 3I5UA 4QWQA 1FLIA 5HVQC 3WODF 1YO5C 5KK1A 2W85A 3V8LA 2DT5A 1F5TA 4DQ2A 5L3GA 5LGUA 1ZLJA 3MFKA 4EVIA 2DPDA 1ZLKA 4P55A 4FX0A 3KZZA 2STTA 3DPTA 1IN8A 1BBYA 2QLZA 3PFIA 2VODA 3L9FA 3KLOA 5BMZA 1Q1HA 3TGNA 3BPVA 1AOYA 4M6YA 1IAWA 3BJ6A 2XAHA 5LHGA 4CYDA 5D4SA 5LGTA 2DU9A 1O7FA 3HSEA 1YW7A 3QPTA 1ZHFA 4GCVA 2L01A 2IP2A 5AONA 1T2KA 2LSOA 3DXJF 3K1MA 2A6HF 3M8EA 2M1BA 1B59A 1HQCA 3ZN1A 1T6SA 3N4MA 1BI0A 2X0LA 4Z2YA 4ESBA 1I1GA 3Q9VA 2EV5A 2L4MA 3KP4A 4A2UA 1F1ZA 4ZZLA 4PZJA 4IRHA 6PAXA 3MEXA 2FQ3A 1GXQA 2ELHA 5EEGA 5JVTA 4Y15A 2VBXA 5K5RA 4CXFA 3HYIA 2P6TA 4L5IA 5E1WA 3W6JB 5ILVA 1EH6A 3BROA 4RAZA 5F64A 1J7KA 3DQVC 1BI2A 5FD6A 3C1DA 5A2QZ 3I54A 5JR3A 4EJWA 4ZZDA 4HW0A 4EJTA 3GXOA 2H6CA 3OOPA 4M9XA 5LBQA 4OU0A 3C7JA 5E1ZB 2XKPA 3FX3A 3SFZA 3V7RA 1MJAA 3HRMA 1RNLA 2Z3YA 2AXLA 3JSPA 1Z91A 1XMAA 1J75A 1ON1A 2A3SA 2FMYA 1V4RA 3Q9SA 3E97A 2PBIA 2JPBA 1ZRCA 5L3EA 3H92A 1IRFA 1IZ1A 1R1UA 2OQGA 3ABTA 2CSOA 1BIAA 3GYHX 4OIQF 1D5VA 4Q48A 3B73A 4PDKA 3SXMA 3T5XA 3FF5A 1OYYA 2EA4A 4HQMA 2W57A 3L7WA 2K02A 2PFBA 3F22A 3LQQA 4EJUA 1E2XA 1K78B 2DK8A 3CTAA 2ZNZA 1EV7A 1HBXG 3DEUA 2M5WA 2ZNYA 1SFUA 4LK0F 3DKWA 2H09A 1RUNA 2ZCWA 4ASNA 1ZGJA 2HFHA 2P6SA 4ZYHA 4U0YA 4P9UA 4L18B 3HSFA 5E17F 4O5VA 1FBSA 1D8JA 4ETSA 4AIKA 1LEBA 4G94A 1ZG1A 1YG2A 4LK1F 3ZQ7A 1T38A 4XRFA 1ODDA 3ZMUA 2D1VA 3J7AO 1D3YA 3JAMZ 2FE3A 4ENJA 1S7OA 2C6YA 3SQNA 5L3CA 2IPQX 3F6OA 2DI3A 4HF2A 4GYIA 1MJ9A 3TKYA 2QWWA 2HEOA 1P4WA 5LHHA 1IW7F 3BJAA 2QM3A 2MLGA 2P8TA 1R1TA 1PP7U 2P5VA 1XSVA 3EUHA 4O3MA 3TDUC 2Z9OA 3FM3A 4LB5A 3K1NA 4CZZA 2E1NA 4KMUX 3HSRA 2HGCA 2DQRA 4R1HA 4KIGA 4Q4ZF 3TOBA 4OOIA 4HA8A 1QBJA 1R7JA 4UVCA 4YFXF 1D8KA 4EJVA 4HQEA 2G9WA 5FO5A 5DCMA 4G7OF 5HLIA 2P5LC 2JT1A 3ECHA 1FBQA 5K1YA 2FA5A 3E6DA 1ZG3A 1LNWA 1ZRDA 3K69A 1WQ2A 3V7CA 4LLLA 2KRFA 3T0YA 2IJLA 4S04A 4MNUA 3N97A 2DBBA 3U9GA 4KIBA 4WF2A 4OIPF 1USSA 1R5GA 1SMYF 3KP5A 5CVUA 3WTTC 5A2QK 2KIUA 1IF1A 2QUFA 2P7CB 2WV0A 2NNYA 1MJBA 5J8FA 5DDGA 3J80K 2H94A 5HDNA 3BP8A 5DCMB 1ZARA 4HBLA 2XV4S 3KEOA 4GXOA 1U8RA 4L9NA 2CGPA 5K5QA 4XSZF 2LKPA 4JK1X 1U78A 4PGGA 4R8HA 4A6EA 1FWZA 1IRGA 2HKOA 1FPQA 3ZMVA 1BI1A 3I58A 3WGGA 3O2PE 4U0VA 3WE3A 1Z6TA 3VOEA 1GXPA 3U2RA 4I98B 5D5VB 3WTWC 4HLYA 1YLFA 1U6GA 3HHHA 2Y48A 2VT3A 2PLYA 3P7NA 4A0ZA 2XASA 3RKYA 1H9GA 2RN7A 4EM0B 3RKXA 3CDHA 1OPCA 5IT9Z 1FY7A 1ZRFA 5J8CA 1KU7A 5H6RA 2KJCA 1B1BA 3GFMA 3RPQA 2GXBA 3LWFA 2EFNA 4RGSA 3CO6C 4HV5A 2KJBA 3I53A 5J6XA 1XDUA 2OAZA 4RGUA 4LG0A 1PUEE 1P92A 4KN7X 2QZ8A 4PCQA 3G73A 2E7WA 2DO7A 2PEXA 2DFIA 3JAMK 4G8XA 3SXZA 3P9IA 1IN5A 1HW1A 5D5WB 5LLQA 3IHUA 3FXQA 1XSDA 2F2EA 4I02A 3ISPA 1XCVA 5HLHA 3KP7A 4KIFA 2RVCA 4M72A 4LG0B 2LF8A 3SXYA 3PQKA 4MQVA 2CW0F 2FBHA 3NEUA 1B9NA 2XHKA 3HRTA 2P5KA 4HAMA 2FEZA 3HHGA 2R3SA 2ZBKA 1T39A 1NHAA 2RGVA 3BPXA 3E5UA 1FSHA 5IT3A 2YX4A 1XGNA 4OMZA 1Z1DA 3MAJA 4AIHA 2BYVE 3O6BB 1MZBA 4ENKA 4H0EA 2NNNA 4G6DA 2QQ9A 1ONVA 3P9KA 2JTVA 3F3XA 5E8GA 2H6BA 4I7HA 1LJ9A 4BHCA 3I0TA 1HKTA 4N0BA 1QQIA 4HX8A 2HYFA 1YFHA 1ZN2A 4B8XA 1DPUA 4BXUA 1GVJA 1H0MA 2QQBA 3ROUA 2TDXA 3R60A 1P4XA 1R36A 5LRRA 3RI4A 3E6CC 4EV0A 5BOXA 2K7LA 4I2OA 1P4AA 3WTYC 2VOPA 1HKQA 1MDMA 3QU6A 2IW5A 3FZVA 2PG4A 3CUOA 4YIFA 4ZYGA 1IXSB 4L5JA 3WG9A 1ZAOA 1ULYA 1SMTA 1R58A 1ZYRF 2JZYA 5L3DA 5ICGA 1K6OA 5D8LB 1OYWA 1BC8C 1O3RA 4RB2C 4A5MA 4U7DA 1UHWA 1G3TA 3L09A 3TO7A 2V9VA 2H27A 1O3SA 3V8JA 2ZXJA 1KU2A 3RTRA 1YW8A 1RUOA 3VB2A 2NS0A 3LSTA 2XRNA 4WK8F 3F8CA 3FMSA 3V8KA 3WTSC 1MDMB 5JHUA 5IT9K 4M73A 3IRQA 2XKOA 1EH7A 5DD8A 2K4JA 2MH2A 1MGTA 1BJAA 2L54A 4WXCA 2QYOA 2XAJA 2F5FA 2ACJA 3QP6A 4Y17A 2UWMA 2YU3A 2R7FA 2E7XA 3IWFA 5ILSA 1QNTA 4HZFA 2A6EF 2FXAA 2O3FA 3REOA 4GYGA 2QENA 3TO6A 2MH9A 3BJOA 4UV9A 3MQ0A 2K27A 3G3ZA 5TRDA 2J5OA 3FXRA 1SD4A 4EJOA 2QVOA 4ESJA 1XGSA 4NQWA 3JTHA 1FSEA 2VC1A 2VBWA 3F8NA 2O8XA 4TV7A 3H3UA 4MGRA 3ECOA 1CF7A 2UXNA 1FZPB 2ZFWA 4EMSA 3T8RA 3FXUA 3M7GA 1SD7A 1HW2A 4L0YB 2HOEA 3KP2A 3M1EA 1K79A 2G7HA 4O6JA 3ZPLA 1OMIA 2VXZA 2NAZA 1W5SA 4L9JA 3EETA 3P9CA 4LLNA 5E8IA 2AS5F 1L0OC 2UZKA 1IN4A 2FMLA 2FU4A 5F6FA 2DW4A 1OYIA 5BS6A 4EGYA 3BWGA 3F72A 2O03A 2R7DA 3RDIA 3GLXA 4F7ZA 4WCGA 1BIBA 4RS8A 1CF7B 1USTA 3CLOA 3LA3A 1B4AA 2OD5A 1U5TC 2HQNA 3NQOA 3WGHA 3ULQB 1S29A 2D45A 4CDGA 4B09A 2ESNA 1TW3A 1QGPA 3EYYA 5LEJA 3PQJA 4ZYDA 2HS5A 2M45A 2WTEA 3E6MA 3F8BA 4I09A 5K5OA 1J59A 2YX7A 1T0FA 4HDUA 4XSXF 2B0LA 2HTJA 1XDSA 3QP5A 2M30A 3WU1B 3IRRA 4U88A 1G3YA 2J5PA 4M71A 5FLXZ 2VN2A 5D5XB 1J2XA 4U0WA 3FWEA 1RI7A 1KA8A 2GZWA 2Z33A 4WX9A 1IN6A 3O3KA 5HS8A 4UUVA 3RKWA 4EM2A 2CG4A 3IWZA 2ZMEA 4KA4A 4OIOF 1UHMA 2PQ8A 3J81Z 1PDNC 4A0XA 4DNCA 4YFKF 1X3UA 3WTVC 4G7ZF 3I71A 3GZ6A 1P2FA 2WWYA 2OZ6A 2BBYA 3GVAA 4YG2F 1XCBA 3F8FA 5HLGA 4E70A 2OBPA 1XB4A 3RJPA 4RB1A 1XMKA 2EA2A 1YS6A 3ML6A 4XLPF 2PJPA 4LD5A 4Y13A 3RIRA 4IXAA 5E18F 2CYYA 1HSTA 3I4PA 3RYRA 3FMQA 2XIGA 4FX4A 4MTEA 2ZMEB 3K1PA 4A12A 2VT2A 4OINF 4RAYA 4KYWA 3WGIA 1S6LA 1IXCA 5ERIA 1IN7A 3ZMSA 1OKRA 1EH8A 2Q2EA 3FM5A 3MZHA 3WE2A 4ENMA 2EK5A 1I1SA 2HWVA 3QRFF 1TQPA 2F5DA 1CGPA 4YIIA 3SXKA 2V1DA 1QZYA 4XLNF 5E20A 3GW2A 2ETHA 1G6NA 4A0YA 1K7AA 2FRHA 1R00A 2ZJ2A 4M6XA 2O6GE 4LB6B 3BOQA 4N9HA 1H9TA 4R79A 1ZREA 2W84A 1DP7P 3SZTA 1LVAA 1U2WA 4MEXF 1WRJA 2LDUA 4BYYA 2FOKA 2DK5A 2GAUA 1XSXA 4LLGF 2VBZA 1BC7C 4AVPA 4BNCA 1KU9A 5E1XA 4PGHA 3T8TA 2BV6A 2QQAA 2L4AA 3HRSA 3E5XA 3C3WA 2A61A 2V6CA 4YFNF 2GWRA 2MD5A 3E5QA 5FFXA 5F1RA 4NHJA 1FP1D 5ICEA 5L3FA 3TOAA 4KMFA 3GF2A 3F21A 4UHTA 3RYPA 4IJAA 1O57A 1JGSA 2VBYA 4U7BA 4AWXB 3JW4A 2DPUA 5HS9A 4RB0A 4LMYA 2YR2A 1IXRC 3ZMTA 3LA2A 4UV8A 1U5TA 4M74A 5D8KB 4ENNA 1G3SA 3QU3A 4UVAA 2F5EA 1YTYA 1HKSA 3MZYA 1L3LA 2ZO4A 1C0WA 4EM1A 1QPMA 3IKTA 2LF7A 1KQ8A 3QPHA 2EFWA 3WTZA 5FLXK 3HOSA 3DF8A 4RB3C 5CVJA 3I64A 1W7PD 4IVNA 3ZMDA 2MBFA 2GQQA 2PMHA 1FBUA 1BM9A 5CVRA 3W6KB 1U5TB 5KVRA 3NRVA 2HTSA 5EEHA 1TBXA 3J81K 3ZP5A 3ZMZA 3CJNA 4FT8A 1ZH5A 1BN5A 3SZPA 2IA1A 5HOOA 1HXDA 2P7VB 2KKOA 2JRTA 2XGXA
chains in the Genus database with same CATH superfamily
5CVVA 4U5FE 4MVZA 1UFMA 4MQ9F 2V1XA 4IHXA 2CDQA 5C4JJ 4WWCA 3JREA 5L0DA 2CUEA 4BHPA 2VPLA 5D92A 3HUGA 4HX4A 5D6FA 1TC3C 2Q3TA 3RSNA 4IHSA 4CS9A 1G4US 4L9TA 4L9VA 1Y39A 1KGSA 2ISYA 4RM2A 3LMMA 3H36A 1N25A 3TP3A 3VODA 2CWEA 4YN0B 2V1NA 3PUFA 2LR8A 4ULWA 1XTAA 4IKFA 2WVQA 2H8RA 5JFRA 2R7SA 1PD1A 4BQOA 4X0RA 4HF0A 1QVTA 4CCOA 1G4WR 4XOTA 2EFOA 3B6AA 5FGMA 3ITFA 1KQ9A 1QZZA 1O3QA 2VE9A 1EJ9A 2JA6J 3ATPA 2ISZA 4PACA 1DUXC 1XN7A 1E17A 2Q8KA 3CCJI 5F28E 2MD0A 3LJBA 1W2WA 2XUBA 2ADUA 4JP0A 4A3DJ 2E2HJ 2ZMEC 1JJ6C 4XONA 4BU2A 2A0BA 2UXXA 3FHZA 4DRIB 3ZIBA 3C2HA 2L7KA 4FX5A 2E36A 4MTDA 2E1CA 4XTKA 4LFUA 1LQ1A 1Q0KA 3KP3A 2X85A 4BQAA 2D5RB 2K4BA 4IPAA 1D1CA 4NQFA 1NZEA 2L6FA 2DCEA 4LDRA 2GDCA 3V7SA 2NYXA 2HOAA 3ABUA 3L00A 3Q3SA 1JE8A 3PCVA 1G4DA 3W2AA 1R4NB 1XGMA 5F0FA 2YSRA 4R32A 2L02A 1FYKA 2BC5A 3L8JA 4F4BA 3IL2A 3I4NJ 3HPGA 3M8FA 4BHBA 3HUGB 1OR7C 3DMDA 2Y3HA 4P9FA 4BJ6C 5M3MJ 1JKOC 4N4NB 1GHCA 1IUYA 2YS9A 2YLGA 3LNQA 4J19A 3QOPA 3U1DA 4CDYA 3OYBA 1YW9A 1DDNA 1W4MA 1XX5A 5GPAA 2K9SA 4B48A 2GA2A 2MC3A 3ELKA 2QA4I 1WWXA 3LAPA 3U8VA 1IDYA 4QSHA 2JSCA 1YI2I 5J47A 5KCMA 1QHGA 3GO5A 4DW6A 1JTYA 3ZR8X 3EGXA 1VZ0A 1BZ4A 2Z99A 5E3CA 1R4MB 1GV5A 2V79A 2EWNA 1PP8F 1O3UA 3RQFA 1YS7A 3C2BA 4D0PA 2ZJQF 1FC3A 4FASD 3K1IC 4F52A 1V5EA 3M1CA 2FF4A 2Q4FA 2LY1A 1OQYA 3S2WA 3JRAA 2RNJA 1I5ZA 1UCRA 2VQHA 5CJ9A 3MYIA 5D6EA 1XMXA 4IRGA 4LIVA 2R9RB 2R05A 2M7AA 2FD5A 3L2RA 1YAUO 4LERA 3DKXA 5DV5A 2XLWA 4YT2A 3FMRA 3KE2A 1IZMA 1JR8A 4ON0A 3G50A 2KRCA 3CUQC 4UVBA 1GDTA 3J80Z 2HSQA 2EPNA 4XNFA 4CO8A 3OYDA 2XVCA 3JRDA 3AAFA 1OCZC 2EIMC 4QI2A 3C18A 2P61A 3G4ZA 4II2A 3KYJA 1QA6A 2EFPA 2GIZA 3FXLA 2A68F 2KIMA 2F5CA 5H6QA 1DPRA 1Y0UA 2NRAC 1T6IA 4HX7A 2UV1A 2GA0A 1YYXA 5AIQA 1O7LA 1K78A 2XL8A 1TT0A 1CGME 3C8ZA 2ZXRA 3FBNB 4BJ5C 3AGTA 3UMIA 5JRAA 2HQRA 1SD6A 1OCZH 2EIMH 2A5YB 1NBBA 1ETKA 3HOWJ 1ON2A 3MYFA 2WA0A 5HODA 3EDPA 3GEZA 4NTAA 4RGRA 3ABMC 2BEOA 3N0TA 2YL3A 2AWYA 3US6A 4A5NA 2VOOA 4CCNA 1I39A 2A0UA 3NMJA 4WXHA 2OJED 3LESA 3WTUC 2XAGA 1FFHA 3EGXB 1WWPA 3JZ0A 2BY3A 2QQ8A 2O61A 1RKWA 2XSDC 3LS0A 2Y75A 1QO0D 3M9AA 4BY1J 4HV6A 4K7BA 3GFIA 3U0CA 2W4SA 3M1CB 3PNYA 1TLHB 2XLDA 3EFOA 2KDOA 1BR1A 4OIRF 3J7AY 4XRSG 3QYBA 1Y56A 2XL4A 2IA0A 3FOOA 1Z3XA 4BE0A 5EDNA 2Q0OA 4PJLA 5LGNA 2M0CA 2JVHA 1UZCA 3GEEA 2WAEA 4BL0B 2ID3A 5AIPA 3S3MA 1ETVA 3ZQLA 1MD0A 5ICCA 3ZQYA 5KYNA 2LNBA 1Z6RA 1F1MA 2XF7A 4CCMA 1VQMI 4S05A 3DKAA 4CDAA 2H7VC 5TJJA 1GGQA 3WU0A 3HOYJ 1ZGWA 4EHPA 1LB2A 2YQYA 1D5YA 3AG3H 2WC2A 2JUGA 4C3DA 4IAOA 1S7EA 3T6GB 2BY2A 3EZIA 2HR3A 3CDLA 2UUIA 5BQTA 1YQAA 1MIJA 2X6XA 3W8HA 2V9PA 3F23A 4ZH4F 2R7WA 2V4JC 4I0AA 2LRDA 1SFXA 3KZYA 1G3WA 3T1BA 2VE8A 1RCPA 2Z5UA 4EIYA 2VQLA 4UXNA 2NVQJ 2KIFA 2W25A 4HNVA 1W0UA 1Q0FA 3I9V2 3KEYA 2GM4A 3GANA 3QVYA 5FFZA 1TZLA 1RZ4A 1TWFJ 4M9SA 4B1RA 4BBSJ 1HE9A 1WGWA 1V74B 2QSFX 2MYSA 3DEEA 2XM0A 3EFOB 1VQ8I 2K40A 4CSWA 4ER9A 1ZGAA 2PI0A 4DYCA 1FOKA 1KU3A 3UKGA 4P96A 3KH2A 2D1HA 2BY0A 2EINC 1RXQA 1ST6A 4JEAA 1CGOA 1YRNA 4LLCA 2NOGA 5DCFA 5DUIA 1LDJA 4HYEA 4P5OA 5L3BA 2LKXA 2L7AA 3ABLC 3OV8A 2X48A 2XROA 3ESWB 3GFJA 3LUTB 3IKVA 4K2EA 2OTJI 2MSYA 4EGZA 4CCKA 4ZYEA 2CFXA 3ASOC 1W5TA 1FP2A 4ESFA 1NK2P 2HSBA 4RBOA 3KETA 2CUFA 3GWZA 2HVQA 2EINH 2STWA 4CHUA 2Z16A 1HSJA 3A2KA 2VCCA 4J7TA 3Q0UA 2O0YA 2OQRA 5E33A 2NSFA 4A3BJ 1J0RA 2EFQA 2K9MA 4A3CJ 3FBIB 3OWTA 2DQLA 1ETXA 3RPUA 1JAFA 3ASOH 3V4GA 1PV3A 3HTUA 5CI9A 3MKLA 3TULA 3H0DA 2DMPA 3LFUA 3BEHA 3K0LA 3KEQA 3M4CA 1O3TA 2JUCA 4MEYF 1ZHYA 5FD5A 3EYIA 4N9IA 1TFOB 1LDKB 3BZKA 1T8IA 1LI7A 1WATA 2VJJA 2MW8A 1Y0NA 3IH3A 2O7OA 4HSTA 1TNSA 3LSGA 5ILUA 3HOTA 3KP6A 5L0FA 3BT9A 4LGWA 1YYVA 1JHFA 5ED4A 2B0JA 4LJZF 1FYLA 1B9MA 2W48A 4CICA 3B0VC 4JBAA 3IPMO 1IG7A 2ETSA 1H7IA 1VOMA 1KZHA 4OAZA 2F48A 2JJ7A 3ZN0A 3JSOA 4XN3A 1YRNB 2WVNA 4HEAJ 4AD9A 2L6HA 1VQKI 1EI7A 1Z7UA 2L7ZA 2DLLA 5H2FC 1TW2A 4PFPA 3HJEA 4MVMA 2OU2A 3C8GD 4J01A 1UB9A 4G6QA 3L0IA 3DP7A 3EQLF 3D0SA 4QDLA 1M2VA 1RIOH 5IYBJ 1DP3A 5IYDJ 3RQEA 4Y3OA 1FT9A 4XKWA 3K4KA 3LSRA 3E7LA 5B3SC 2AQEA 2FNPA 5HDKA 3MCZA 3HTSB 1WJDA 3GX4X 4Q5SF 1F9NA 1Y8QB 2LG4A 4BQNA 1MKMA 4XM3A 3KYLA 1I5NA 4O6YA 3S3NA 3HOUJ 4OWRB 4BXFA 3RKQA 2DAOA 1QPIA 3OYHA 2KISA 2HQ5A 5AGFA 4KDPA 2KC3A 4ZJZA 3NMIA 4FQGA 3TO9A 2ZXPA 3K7AJ 1UMQA 2V1UA 1UFBA 2R7TA 2JPCA 4BH9A 2Y3DA 2Y31A 5B3SH 4XLAA 2TCTA 1I3QJ 2EV0A 2VONA 1JUSA 3ZQIA 4U9EA 2RKHA 2X4HA 1V55H 2AHQA 3OSGA 5A6BA 3B02A 1WKMA 1MMDA 3BY6A 2CV0A 4NB5A 2NSGA 3Q7GA 1Y6IA 1P6RA 2EJRA 3A4CA 2RC4A 5H20A 4XQ1A 5LHIA 5COMA 3RPUD 3CCSI 2IYLD 5BPDA 2EB7A 3BLYA 4AM3A 4IARA 4PJNA 5JS5A 2IM8A 3TL4X 1R22A 4HDVA 3R4KA 1SD5A 3H5RA 2DODA 3S1MJ 4B47A 3QAHA 1VQ6I 1X2NA 1Y8RB 2DYRH 1K6YA 5HS7A 1Y4CA 1O5HA 3E6BA 1BOAA 4NUBA 5JI6A 1M2VB 1STZA 3MBGA 1FAPB 5CVIA 1OR7A 4LLEA 5GTHC 2L6GA 3GZ5A 4EQQA 4BJ6A 2M7BA 1F43A 3IQCA 2EZIA 3GUDA 3TMOA 4Q47A 2BZTA 2K9LA 1ZVZA 1RESA 2FFHA 2CU7A 1JHHA 2HXIA 3DPLC 5A6JA 3CC2I 2PNOA 5FCLA 4OMYA 1OCPA 2MA3A 1SFEA 1EKEA 2K3FA 2P4WA 3AG2C 1TWAJ 2VKDA 3TQOA 1ETWA 2Y0MA 1FX7A 3H3VK 1K04A 3OA1A 1GS9A 2MHRA 1TWGJ 4I01A 1Z05A 4HOBA 1PVEA 1WH5A 2A69F 5B1BC 2GXGA 5EZHA 3HBLA 3MD2A 3K9TA 4XBFA 5CQEA 1XGOA 2MLKA 4XPWA 3FHNA 3X1OA 1WSUA 1ZHWA 2JWTA 2DJNA 5DQTA 1TTYA 3AQBA 1XZQA 2FBIA 1BI3A 3CO7C 2M34A 4BEMJ 2JA7J 4BJTA 3NYJA 3VEPA 5IP9J 4QLCU 4KT5C 1RR7A 2BL2A 4K0DA 1TQIA 3CUQA 5B1BH 4UB8C 2YHSA 3I5PA 1TQMA 5L3QA 1S3JA 2VL8A 5GAHJ 1S8NA 3L2UA 4NC6A 1Y1WJ 3BR0A 5F08A 2OZUA 1IV6A 4BJ1A 5A6BD 2L3DA 5EJCA 2QBYA 1F4KA 1OJLA 4A3LJ 1VNDA 3D5LA 2YPRA 5JHFA 1LE8A 4GGGA 3M07A 2YU9J 3WTXC 2RDPA 4A6DA 1YZAA 1X4PA 3E3VA 1S7ZA 5LEKA 3R7CA 4MHGA 1FNNA 5LRSA 3LQRA 5L0CA 5JUAA 2WZLA 4XK4A 1S9HA 5DD4A 1REPC 4E6KG 5DUKA 5IYCJ 4XRMA 1B8IA 2XLEA 1W5CC 2IRFG 1BL0A 2RV8A 4HLXA 4HF1A 1Q0MA 2OKUA 2DTRA 2L9NA 2QE9A 1VQ7I 2CW7A 3JRGA 3LAJA 2LY2A 2XAQA 1MSEC 3PIPF 2G62A 2M2EA 5F1JA 3H2VA 3R61A 1N75A 4G7HF 1R1VA 2PF4E 1TFKB 2GIVA 2I10A 3BR1A 2YLIA 4E4HA 1A36A 4H54A 1A04A 1XS9A 3U9JA 1KYZA 1R23A 5IOZA 5EG0A 5HNHA 2W24A 4IF4A 4U5CE 5KYWA 3F6VA 2GA1A 2PN6A 4I0BA 1UG0A 1ACIA 4AIJA 2J9BA 5CYVA 1KYWA 3CUQB 3R0JA 4KISA 3AG4C 3FDQA 1QSPA 4GO1A 3OR2C 1I27A 3I59A 2HDCA 3G4XA 2IA2A 1G8XA 3LSHA 1Z77A 3SHFA 5F0HA 2JK3A 4PJJA 5DYMA 4IHTA 2XM4A 3DI5A 2VKVA 2BGCA 2CQXA 2ZKZA 1HDDC 1J8MF 5DLJA 2QBYB 2ZXHA 2CO5A 1T98A 2KHMA 2FNAA 3KCCA 3JTGA 4C3BA 2BXZA 1ZG5A 4O6MA 3ZGKA 2J45A 4L0ZB 1LE8B 3L2CA 2RQPA 4M3FA 2EV6A 3LA7A 3K2ZA 3AG4H 2F22A 3B0PA 3EH1A 3FAJA 5IY5C 1SAXA 1QZEA 1J9IA 3KLNA 2E87A 3MZ8A 1WI9A 1YITI 4RGXA 1ORKA 3BQZA 3EPZA 2M8EA 1E3HA 5J4VA 1B8IB 5D5UB 2PMUA 2BE5F 2BHYA 4M9ZA 1NU9C 3COAC 5DEQA 1N77A 4UNOA 1ETQA 1OCOH 1OISA 1S7AA 2FQ4A 4KUMA 3K7DA 2D2WA 1XC5A 1P9QC 3CMMA 1GM5A 3Q5FA 2J0WA 1ZW2A 1AU7A 4QTRA 3DWWA 4WXDA 1B6AA 4IRIA 3JSZA 3MX3A 1V5FA 3DBRB 4BAYA 4GRIA 1YIJI 1W7PA 2KLOA 3K6GA 5JLWA 2OA4A 3TEDA 2COMA 5BPIA 9ANTA 1FOYA 2ZD9A 2FBKA 4BDYA 2LYCA 2OC6A 1R9TJ 5CLSA 4CGZA 1LFPA 2Q7RA 5FB2A 3S17J 2FSWA 2HYGD 1SFOJ 1I6XA 5EG0B 5GPCA 1Z5ZA 3TQNA 3N24A 2K86A 3HOVJ 3UMHA 5KYWB 3R0AA 4KNYA 1A6QA 3AGUA 4CUGA 5M5YJ 1V3FA 3HIFA 2A07F 2LC2A 1JTXA 2M87A 1HW5A 1SVLA 3DBLB 5DM6F 3IH4A 3GTLJ 1LDDA 3H3ZA 3I59B 2YEVA 1JKPC 2P81A 2VC0A 5JVGF 3R6SA 4IOAF 1EA8A 1ORYA 3GWLA 3U8PA 1R5HA 3L1MA 3GFLA 2IT0A 1LEAA 2D5VA 4HRIA 4IQJA 3F8MA 2P0WA 3HRUA 3CAXA 4E0IA 2CQKA 2QKLB 1XD7A 4LACB 3O39A 2IVMA 1Z9CA 2H1KA 2Y3BA 1JXSA 2R7RA 1X19A 4FHTA 1LFUP 3DV8A 1PJRA 3FAPB 3BDDA 3IC7A 2QTVA 5D4RA 2G0EA 1H88C 1YIOA 3FHDA 1SVMA 2ESHA 2LH9A 2ZJRF 1VQLI 5JVEA 4KFCA 2HZTA 4KN4X 2RQQA 3TDZC 1VTNC 1FYMA 3AFHA 2NS7A 1KQ0A 3JT1A 4JQFA 2G3VA 3MWMA 4Y4RA 1JI8A 2X1EA 2O9LA 2G7UA 2IS1A 2ZPAA 3ERED 4G9YA 1W7PB 1YE9A 3VFZA 5HDGA 3JRMO 2BW3A 1MNEA 1GT0C 1AEPA 1U3EM 3FK7A 2XAFA 4AU7A 3B6CA 4XRSA 1RJ9A 2HKXA 1TQGA 3BZ6A 4II3A 4KICA 5ICFA 1IO2A 3O6XA 5E3LA 3MKYB 3DFGA 5L0GA 1J5YA 3LFKA 3CQZJ 1UELB 1X58A 1TNTA 2HNHA 2X6WA 2DTZA 1AWCA 3KFWX 1NG6A 3JRCA 2QUPA 3VM6A 3LSPA 3I5UA 2LK2A 1T08B 4PJMA 2COBA 4QWQA 1FLIA 2M9HA 5HVQC 3EHNA 2KPMA 1D1AA 3WODF 1AVOB 4M63A 3HG9A 2L0KA 2X0CA 1IDZA 2JX0A 1YO5C 1OCRC 2YUSA 5KK1A 2W85A 3S2DJ 3V8LA 1W36C 3FXHA 2DT5A 1VB5A 1F5TA 5EK0A 2IXPA 4DQ2A 5L3GA 1FR0A 5LGUA 2EBIA 1ZLJA 3MFKA 4EVIA 2DPDA 5F5HA 1ZLKA 3V5ZA 2WB1A 4CCJA 3EG9B 4V2GA 1D0YA 4P55A 4FX0A 4IEJA 4E7LA 2W45A 3KZZA 1OCRH 2ELKA 4HPQA 3HNJA 2STTA 3DPTA 1IN8A 1TR2A 2XPUA 1DU6A 1BBYA 2LFBA 2QLZA 3PFIA 2GXAA 1E84A 2VODA 1MBGA 3EUHC 3L9FA 4CDVA 3KLOA 3QPSA 2DXIA 1Z3IX 5BMZA 1Q1HA 3TGNA 3U2LA 3BPVA 3AG1H 4B3XA 3O55A 1AOYA 4M6YA 1IAWA 3BJ6A 2XAHA 2BW3B 2ZFUA 4NBQA 5LHGA 2QY9A 2CFOA 3IV5A 4DBQA 3PSFA 4CYDA 4Y52J 4GYTA 3L2WA 1T95A 1CQTA 2KP6A 5D4SA 1RJ9B 1NG1A 3GCMA 5LGTA 2DU9A 1O7FA 5F27A 3HSEA 1YW7A 2H8AA 3K4NA 3QPTA 3FDYA 3LNMB 1ZHFA 1DU0A 4GCVA 2L01A 3BR5A 1LPQA 1NU7D 2IP2A 5AONA 1T2KA 1LE4A 3Q7LA 5EEAA 4HFFB 1OKKA 2LSOA 3DXJF 3RQIA 2W00A 2HV6A 4C3HJ 4JCZA 3U21A 4BQQA 4NC3A 1RKCA 1UG7A 2XS1A 2MGQA 3K1MA 2A6HF 2DA2A 2IGOA 3M8EA 4AUXA 4IHVA 3A9CA 2KNHA 4XEKA 1Z7LA 4D9JA 4JJGA 4MNDA 1J8YF 2M1BA 1B59A 2JRMA 1MNDA 1HQCA 3VYRB 1ZR2A 1G5ZA 4DJ9A 3DU5A 1I4YA 3HKZA 3JRBA 1A41A 3ZN1A 3CCLI 1WVRA 1T6SA 4RDUA 3K4CA 3SP1A 3S9OA 3CZ6A 3N4MA 3J7YJ 1BI0A 3CCRI 2Q1ZB 2IGKA 2X0LA 2QSGX 3N2ZB 4Z2YA 2DOEA 3QOEA 4ESBA 3OYEA 1I1GA 2R92J 1YA7O 3Q9VA 2EV5A 2EQRA 2L4MA 3KP4A 2J9UA 4G6TB 4IQ4A 2JPUA 4A2UA 1F1ZA 2YLDA 4ZZLA 3CSKA 4PZJA 4N6HA 4YL0A 1WI3A 3BG6A 4IRHA 2A5WA 6PAXA 3IQTA 3MEXA 3S28A 3JR9A 1GVDA 2FQ3A 1GXQA 3OL4A 2L9JA 2ELHA 1PUFA 5EEGA 1T33A 5JVTA 4Y15A 2VBXA 1FTSA 2M64A 5K5RA 5JT4A 4CXFA 3HYIA 4H4KC 2EZHA 2F4IA 2KK1A 3V5XA 3EZHA 2HPMA 2P6TA 3NDBB 4J00A 1O87A 4L5IA 5E1WA 1D0ZA 1QKRA 3FOPA 5E79C 1K4SA 3DE9A 3W6JB 5ILVA 1VI0A 3A03A 2WY7Q 2GBYA 1EH6A 3BROA 3SEQA 3PJRA 1FEXA 1HC8A 4RAZA 5F64A 1Z67A 1MSFC 1Q0GA 3T6JA 1J7KA 3DQVC 1BI2A 1DQUA 5FD6A 2NVXJ 2TRTA 3C1DA 3LEOA 1WASA 3FXJA 5A2QZ 2ELJA 3I54A 3CMEI 3F9KA 4BDZA 4XLHA 4RAGA 4IHWA 3GTKJ 5JR3A 1Z6AA 3GM1A 5KNLA 4EJWA 3OS1A 4U5BE 5KYUA 1OKKD 1QLEC 5A6AA 3F46A 4ZZDA 4HW0A 4EJTA 3OS0A 1A7DA 2R02A 3GXOA 4JW1A 1FMVA 2PX9A 4MW8A 2V6EA 2H6CA 3K4BA 1K4TA 2RNGA 5B5EC 3OOPA 4M9XA 5LBQA 1ORJA 3RCOA 4OU0A 5F04A 3C7JA 2Z2SB 5E1ZB 4D7NA 2ASRA 4YT5A 2XKPA 3FX3A 3S8PA 3SFZA 3V7RA 4XQFA 1MMSA 1MJAA 3HRMA 4I1OB 3A0HC 4BE1A 1RNLA 1OXKA 2Z3YA 4X1EA 1LIHA 1PUFB 5EYRA 5K0IA 3NAUA 2AXLA 3DD7A 2GWWA 2X51A 1Z91A 3JSPA 3U2MA 1VQ4I 1C03A 1XMAA 2OTLI 2EPKX 2P0NA 1J75A 4MO7A 1ON1A 2A3SA 4ZYAA 4KBLA 2W1OA 1OQCA 2FMYA 1V4RA 3Q9SA 1MMGA 3E97A 3GODA 2PBIA 1BW5A 2JPBA 3ZXSA 1ZRCA 1ZR4A 1N1CA 2DB4A 5L3EA 3H92A 1IRFA 2JQ7A 1IZ1A 1R1UA 4CCLA 2OQGA 3ABTA 4MFEA 1RRJA 2R7VA 3CD6I 1X1DA 4G0HA 2E35A 4J7YA 2CSOA 2AXTC 3NYLA 3IEEA 2Z15A 1BIAA 3GYHX 1X3ZB 4OIQF 1D5VA 2MG4A 3OYGA 5KYUB 4F92B 3WHCA 4Q48A 2HUJA 3B73A 4U5EE 2K9QA 4PDKA 3SXMA 3T5XA 3FF5A 3SEZA 4JX4A 1OYYA 1WJ5A 3AG3C 1ZKGA 2EA4A 3SFIA 4HQMA 4DBRA 2W57A 4RLQA 2R7ZJ 4RLFA 3L7WA 3HJCA 3K1HA 4D5CA 2W7NA 2K02A 1LVKA 2PFBA 3F22A 1OLTA 1DOVA 2LCHA 3LQQA 3ZQQA 4EJUA 3BZCA 5AC4A 1E2XA 1K78B 2DK8A 1TP4A 5FJ8J 2X1CA 3Q0VA 3CTAA 3FKIJ 3MVPA 1OCCH 2ZNZA 1EV7A 1HBXG 3DEUA 1AHDP 4KC9A 3T6BA 3S0XA 4YRVA 3OIQA 2M5WA 5J4YA 1TWHA 4ULVA 2ZNYA 5HV9A 1SFUA 4LK0F 4JYKA 1HE1A 2LBFA 2QCOA 3DKWA 2H09A 4IGGA 1RUNA 2VLAA 3GTPJ 1GQAA 2ZCWA 1C17M 2I15A 3HEFA 4ASNA 1BDJB 4C3JJ 3W3CA 1HLVA 1ZGJA 1M56C 1WJEA 2HFHA 2P6SA 4BGDA 4ZYHA 1FOWA 4U0YA 4L5EA 4C2TA 4P9UA 2Q9AA 2DMUA 2FJ1A 2XGDA 5L0IA 4L18B 3HSFA 1F36A 3C8GA 2EIKH 5E17F 1RPWA 2RREA 3UGPA 3HM5A 2WAQA 3EHMA 4O5VA 1FBSA 3BTIA 2Y0SN 1D8JA 4ETSA 2OOCA 3PO3J 3C2GA 3S93A 4AIKA 3DWLE 1LEBA 5E3AA 4G94A 1X2MA 4JOMA 3GM2A 4IRUA 3S29A 1ZG1A 1YG2A 4LK1F 4FTHA 3ZQ7A 2KRHA 1T38A 2HKVA 3E70C 3NKDA 3HC7A 3CCEI 1X1AA 1Z7Qc 3EH2A 5DS6A 3CMAI 4W8PA 4XRFA 1ODDA 3ZMUA 4F93B 4JEBA 2WBMA 2D1VA 3UR3C 4FCYA 1QPUA 1MBFA 4LDQA 3J7AO 1D3YA 5DM7F 4LIUA 3G71I 3CDIA 3JAMZ 2KQ9A 3LAYA 4O7GA 1A7EA 2FE3A 2HPIA 4ENJA 3E0JB 1S7OA 3K70D 2DA7A 2C6YA 5K7FA 2LBFB 3SQNA 5L3CA 2IPQX 5JLIA 1RETA 2DOFA 3F6OA 4XEFA 3ZWIA 2HDWA 1NK3P 2DI3A 4XN0A 4HF2A 4GYIA 2C03A 1Z0XA 1LI5A 4CZCA 2OCEA 4I6ZA 4ZTJA 4UB6C 1MJ9A 1APCA 3W4YA 1HF0A 3TKYA 1T6UA 3C8GB 2CS3A 2QWWA 2BVLA 3ABKH 3AOUA 2HEOA 4XLEA 1U0BB 3RVZA 2XB0X 3RZDJ 2IS6A 3S32A 3QTHA 5GPGB 1P4WA 5LHHA 1V4AA 2XLVA 1IW7F 1X3WB 2E19A 4C3EA 3F0CA 3BJAA 2QM3A 2JD3A 4A3MJ 4FESA 1SC7A 4U87A 2XPWA 3FVYA 1VTMP 1XZPA 2MLGA 2P8TA 1R1TA 1H89C 1SYQA 2HZ8A 2HU9A 3VWBA 2H1LA 1PP7U 2OQMA 2P5VA 3H5NA 1XSVA 3EUHA 4O3MA 2XF6A 1MNMC 2E1OA 2VXDA 3TDUC 2Z9OA 2R7QA 3O8GA 3BG3A 3FM3A 1K83J 4C30A 2LFFA 3OIOA 2KZGA 4LB5A 3C63A 2NXNB 3K1NA 3HOXJ 3GEHA 4DJAA 3JTLO 5EGYA 4CZZA 4YL3A 2V9KA 3OYAA 2E1NA 2FOWA 2KDZA 4KMUX 3HSRA 2HGCA 2MC4A 4LOCA 1KONA 2DQRA 1U8BA 5B66C 4R1HA 2I8BA 3OMYA 3GEIA 1V55C 4BEJA 4KIGA 3SZGA 4Q4ZF 2LQGA 3Q6MA 3TOBA 4BS9A 1A7VA 4OOIA 4HEA2 4ZDPA 4HA8A 3DLLF 1QBJA 1R7JA 1SANA 3GTOJ 3FXMA 4UVCA 3PSIA 4AE4A 1TWAA 2ZSHB 1YOVB 4YFXF 2NUPA 1D8KA 1S5LC 2AQFA 2HMQA 4NCQA 4EJVA 2IGMA 4HQEA 2QLAA 2ZXIA 2G9WA 2ZSIB 5FO5A 1WJFA 5DCMA 1TWGA 1SEUA 4BE2A 4G7OF 5HLIA 2P5LC 2JT1A 4CBEA 3ECHA 4ZC3A 1FBQA 3TP0A 5K1YA 4AX2A 2FA5A 2DYRC 1FIAA 3E6DA 4U5DE 2C04A 5J1RA 3LSMA 4NY3A 2E5ZA 2AU5A 2KFDA 3DE8A 4F91B 4BPMA 1ZG3A 2ECBA 3JSEO 2N8GA 4N06A 1LNWA 3H1CA 4JURI 1ZRDA 3FISA 2DFHA 3K69A 1P7JA 1WQ2A 4MFDA 4LLLA 2KRFA 3T0YA 2IJLA 3V7CA 1OR2A 1VQ5I 3EGDA 4S04A 1T01A 3HNLA 4MNUA 5A69A 3S16J 2NOJB 3N97A 2DBBA 3U9GA 1I4ZA 1Z21A 3H0GJ 2P1AA 2XXAA 2RSEB 3SNHA 3H9GA 5FKNA 1K61A 5JSLA 1YJWI 1W36D 1MW7A 2DMTA 4KIBA 4F3QA 1RKEA 3LSIA 3ONQA 2ME0A 4WF2A 2HMZA 4OIPF 1MBKA 2B63J 4ZDLA 1USSA 4E7KA 3L8IA 1NSGB 1R5GA 2DMQA 1SMYF 3IP4B 3KP5A 1A31A 2DA5A 3QMKA 1DGRM 5CVUA 3WTTC 3JRHA 5A6KA 5TISC 5HLTA 2MABA 5A2QK 2KIUA 1IF1A 2QUFA 4YELA 5B1AH 2P7CB 2WV0A 1YLMA 2YWAA 4BKXA 2NNYA 1Y6DA 4AE4B 1MJBA 4IB4A 5J8FA 2NUPB 4JE9A 5DDGA 3J80K 3BRJA 2UUHA 2H94A 4RAFA 3H2UA 5HDNA 3BP8A 3QODA 5DCMB 1WGXA 1ZARA 2DYSC 2LK4A 4E17A 3M4BA 3U1KA 2L2OA 1UAAA 4CS8A 4QPQA 4HBLA 1TL8A 2J7PA 4DVYP 1QHHD 2XV4S 5FZTA 1YYJA 3ZG1A 3KEOA 3ZQCA 3VDXA 3WHNA 4GXOA 3M4OJ 2R25A 2RD9A 3H9JA 1U8RA 1I6HJ 4Z9HA 1WJBA 1HDPA 4L9NA 4FETA 2CGPA 2OF7A 5K5QA 4XSZF 5GAEJ 5FRMA 2DYSH 2LKPA 1Q0DA 1YDIA 4Y7NJ 1Y1VJ 5J1YA 1EA3A 4JK1X 5COFA 1U78A 4PGGA 2EILC 3EGDB 1JPJA 1E3PA 2TMVP 5FKKA 2YL1A 2XRLA 2OV7A 4R8HA 2XXAB 3T9OA 2YKZA 4A6EA 2BVMA 2R5ZA 1POGA 3U3BA 1JUMA 1RKEB 1FWZA 1VFCA 2HKOA 1IRGA 2CUZA 4KI2A 3GZNB 1FPQA 4L6RA 3ZMVA 1BI1A 3I58A 3BG5A 3WGGA 1R6RA 2EILH 3O2PE 3SYNA 4EWCA 3U5SA 5C3EJ 4U0VA 2R7OA 3WE3A 1JMWA 1Z6TA 5EZGA 3VOEA 5HSWA 1FFTC 1O4XA 2FX0A 2E2JJ 1OFCX 3SYTA 1GXPA 1WFXA 1ITYA 1M6TA 2NVYJ 3HDDA 3KYIA 3U2RA 4I98B 5D5VB 3WTWC 4HLYA 1YLFA 3W2VA 2LP4A 1U6GA 2IXOA 2L9RA 3HHHA 3TOLA 4B3AA 2LVSA 2Y48A 3IQ6A 2VT3A 2PLYA 2MFZA 2QEXI 4UUTA 3X2QC 5KAFC 2NUTA 2X9DA 4P6IC 3GLLA 1PCXA 2CCYA 4CS7A 3IAS2 1KTMA 3P7NA 4A0ZA 3SEOA 3H35A 3N05A 1CPRA 2XGCA 3DTEA 1S72I 3ASNC 2XASA 5KYYA 3PFYA 3RKYA 1H9GA 2LP0A 2RN7A 4EM0B 3RKXA 4UY8I 1TKNA 1SF8A 3S84A 3CDHA 1OPCA 4FWVA 3OL3A 5IT9Z 1LS4A 3X2QH 2J7PD 2X6OA 1FY7A 1ZRFA 5J8CA 1KU7A 5H6RA 2R7UA 2KJCA 2PMZN 1YX3A 3AQCA 1B1BA 4XLCA 1OCOC 3GFMA 3RPQA 2Y39A 2GXBA 2R7XA 3ASNH 3LWFA 2EZLA 4MVSA 4NTFA 2EFNA 3OEOA 2IEKA 4RGSA 5T3WA 1V54H 5D91A 4CIPA 4N6CA 3CO6C 4HV5A 2KJBA 3I53A 4JX6A 5J6XA 1XDUA 2OAZA 1X4OA 4FISA 4ZDOA 4RGUA 4LG0A 1PUEE 4OD4A 1P92A 3K70C 2DMNA 3DU6A 4KN7X 2QZ8A 3JYHA 5T3TA 1GV2A 4A69C 3B9QA 3MKWB 4PCQA 1BW6A 2GOXB 3CCMI 1ENHA 3G73A 4D7MA 1VMAA 3RVYA 2IBFA 1D0XA 2E7WA 3DAFA 2J9WA 1BBHA 2IXSA 1YJNI 1XWJA 2Y69C 1L7CA 2NUTB 3T4RA 2A6TA 2DO7A 1FTTA 2PEXA 2YVKA 2DFIA 3JAMK 4G8XA 1Q1VA 2DOAA 3SXZA 2F4OB 3P9IA 1IN5A 1VF9A 2YZSA 4JJFA 4EBJA 1HW1A 5KYYB 2WB7A 5D5WB 4HFKB 1LE2A 5LLQA 2J0XA 2CW8A 1EKYA 2O5RA 3IHUA 2XRHA 4JZAA 3K10A 3A0BC 4GFBA 4QPOA 1AA7A 1LPEA 2CQNA 3KL4A 2Y69H 5HNFA 1FTZA 1ZHTA 2LD6A 3FXQA 4B6IA 1UG2A 1XSDA 2A05A 3HXLA 2F2EA 4E7HA 1FJLA 3KYDB 2JA8J 2J46A 4I1MA 2VJIA 2W82A 4I02A 3ISPA 3HOZJ 1XCVA 5FKLA 5HLHA 3KP7A 4KIFA 1A0BA 2LIGA 2OEXA 2RVCA 1U89A 4S0HB 4CH7A 3S2HJ 1LUJB 3K6BA 2R4GA 2DGJA 3K2AA 3K66A 4M72A 1FIPA 4LITA 4LG0B 2I5UA 2PJRA 4CX9A 2LF8A 3SXYA 3PQKA 4MQVA 4NNJA 4MVOA 2CW0F 1V5GA 4XR6A 3PUBA 4IJJA 2DN0A 2FBHA 3NEUA 1B9NA 3HLZA 1U6HA 3FKJA 3L2QA 2R5YA 3LL7A 2XGEA 2XHKA 2FUG2 2VCBA 4CSAC 3HRTA 4KNWA 2P5KA 2IXNA 2VQCA 4FAPB 2DA6A 1HCRA 1Z3YA 4HAMA 2FAPB 4MS2A 1MMNA 2FEZA 3HHGA 2DA4A 2R3SA 4V19K 1SFKA 1XPXA 2ZBKA 3CMYA 1T39A 2Q00A 3EPVA 3U3FA 1NHAA 3BTJA 3KKBA 2RGVA 1JUPA 3CJTB 5EGOA 5M5WJ 3J7ZI 2CJJA 1UHSA 3DM5A 3BPXA 1WTYA 3G2BA 3E5UA 1GUUA 3EUKL 4A3GJ 1FSHA 1BR2A 3KIOA 5IT3A 2YX4A 3RQGA 4MTFA 1XGNA 4OMZA 5FRNA 1Z1DA 3MAJA 4AIHA 4I99C 2BYVE 3O6BB 5KAIC 1MZBA 1TWCJ 2I8DA 2VKEA 4ENKA 2W9YA 4JRZA 3I55I 3MMYB 4H0EA 2RAEA 3JCUC 1E86A 2NNNA 4G6DA 2QQ9A 3GTMJ 3AG1C 3KMIA 4RD9A 3ZSUA 1ONVA 3P9KA 1YVIA 1I3AA 2PJRB 4XKBA 4XPYA 5F5FA 1H6GA 3PO2J 4A3KJ 1MMAA 2JTVA 4NDLA 2R93J 2R5YB 2CYDA 5L3VA 4PFOA 2F6CA 3F3XA 1QZXA 1MQVA 3NKEA 5E8GA 4BXXJ 2X6YA 2IAIA 2H6BA 4I7HA 3L1PA 1LJ9A 2GLOA 2D4UA 2J8WA 1SR2A 4BBRJ 4E7IA 5F0CA 4BHCA 4M3EA 3I0TA 1HKTA 1I50J 5EGOB 1T0FC 4N0BA 1ZQ3P 1QQIA 1MBEA 2QNLA 4NC7A 1N78A 3EUAA 2E60A 4HX8A 2HYFA 3QYFA 3CCUI 1YFHA 3OR1C 2FGYA 1ZN2A 2CV1A 2WL8A 4B8XA 2XC7A 1DPUA 5CIVA 4BXUA 1VYKA 1GVJA 2EIJC 3GWNA 4M3GA 1CPQA 1MBHA 3G4SI 1H0MA 2VPRA 4M3BA 4I3MA 3ECSA 2QQBA 1OCTC 3ROUA 4P1WA 4YT4A 2H7OA 4MLOA 4D1QA 3CJRB 1ETOA 2TDXA 5DVWA 4C7OA 2DT7B 3R60A 1K40A 1P4XA 2HFIA 3BR2A 4N4OB 2CUJA 4NTBA 1BR4A 1R36A 3I4UA 5LRRA 3RI4A 3E6CC 2AO9A 2XB5A 2EIJH 4EV0A 5BOXA 2K7LA 4I2OA 2EPMX 1P4AA 3WTYC 2VOPA 1HKQA 3QZCA 1LFBA 1SVOA 1U9NA 3FXKA 1MDMA 3V42A 1QQ3A 3S14J 3QU6A 3QYEA 1ORSC 4M6VA 1J09A 1PYVA 2IW5A 2L9VA 3FZVA 1W0TA 2F5VA 2PG4A 5GTIC 3GTJJ 4Y33A 3E9VA 3CUOA 4YIFA 4ZYGA 3Q0WA 1IXSB 4BY7J 4L5JA 2R0QC 2XPVA 1YX5A 3WG9A 1ZAOA 3OS2A 1ULYA 4AYBN 1SMTA 1R58A 4DYRA 2P6VA 1ZYRF 2JZYA 5L3DA 5ICGA 1WZ2A 3RYLA 1E85A 3RZOJ 1K6OA 5D8LB 1NFNA 1OYWA 4A3JJ 1BC8C 2PFDA 4DVZA 4XLFA 1O3RA 4WJ0A 3OYCA 1YJ9I 2L9SA 1JPNA 1IUFA 1APLC 4RB2C 3DAGA 4E18A 2DDAA 1JKQC 4A5MA 4YL1A 4XEVA 4U7DA 5IPAA 4AK9A 4PSXA 4AL1A 4CS8C 5BQIA 4UDVA 1UHWA 1G3TA 3I5QA 1X1CA 5FLVA 3AL0C 2V7FA 3DLAA 3HL2A 2KGOA 2XSEA 4I76A 4C7OB 3L09A 3TO7A 3I3LA 2V9VA 2H27A 2KSFA 1O3SA 2HV7A 2CMPA 3V8JA 2ZXJA 1KU2A 3RTRA 1MH3A 1YW8A 3WHBA 3QQAA 1RUOA 3VB2A 2NS0A 3LSTA 2XRNA 4WK8F 3F8CA 3I4MJ 4MVRA 3FMSA 3V8KA 3WTSC 1MDMB 5JHUA 5IT9K 4M73A 2ICWG 1LM3B 4W97A 3IRQA 2XKOA 1EH7A 2Y3GA 3LSKA 2K4JA 2MH2A 1MGTA 5DD8A 5FKMA 1BJAA 3DTKA 2L54A 4WXCA 2QYOA 3S27A 2DT6A 2E71A 3JRFA 2KJGA 1ZU4A 2XAJA 3G6EI 4MW3A 3ZRGA 2F5FA 2YL7A 2ACJA 3QP6A 4MIMA 4Y17A 3BCBA 4JVSA 2UWMA 4KNVA 2LFDA 2V26A 2K9NA 4DRHB 2YU3A 1XG1A 2WV1A 2R7FA 3JCUQ 2E7XA 2QSHX 2LSEA 4UUSA 3IWFA 2OG2A 5ILSA 1QNTA 3DTIA 4HZFA 2A6EF 1R49A 2XS8A 5J40A 2PBEA 2LMDA 3H65A 2FXAA 3ZQFA 2O3FA 3REOA 2V3CC 4YWQA 1WH7A 1VLTA 4GYGA 3A11A 2O8KA 2BY1A 1AUEA 3ERMA 2E1MC 4P9TA 3ZQVA 2QENA 3TO6A 2MH9A 3BJOA 4XICA 4UV9A 3MQ0A 2WADA 2K27A 2IBDA 3NMKA 4J30B 3G3ZA 3OYFA 3JRIA 2OEVA 4XORA 3UGOA 5TRDA 2J5OA 4A2NB 5GAGJ 3FXRA 2VB6A 5T1DB 2HI3A 1OCCC 1P7IA 1SD4A 4G12A 1IC8A 2VIXA 1RC9A 4EJOA 3TBIA 2JA2A 2QVOA 1XGSA 4ESJA 3TW7A 2XAUA 3HGYA 4E0HA 3ABMH 4E7ZA 1E3OC 3QPLA 4NQWA 2L7FP 3JTHA 2OU6A 1FSEA 2VC1A 4ONSA 1JRAA 2DFFA 5CI8A 2VBWA 2AP3A 1VQ9I 3P5JA 3LNRA 3POVA 2MWQA 3HZJA 3F8NA 2O8XA 2KQRA 4UUSB 1NH3A 2CGEA 2EIKC 4TV7A 1WOLA 4ABZA 2E2IJ 1SZIA 5LFAA 3H3UA 1ZELA 3ECOA 4MGRA 1CF7A 2BXYA 1B72A 2WVOA 2UXNA 4DGWB 1FZPB 3EJNA 2ZFWA 2GOMA 3DBHB 2KYHA 3ZDLA 4EMSA 1VQPI 1R5ID 2E34A 4MVQA 3T8RA 3FXUA 1EQ1A 3DCFA 3M7GA 1SD7A 1HW2A 4L0YB 1QVXA 2HOEA 3KP2A 3M1EA 1BJZA 1K79A 2VJ5A 4F55A 1S05A 2IS4A 4U5HA 2G7HA 4O6JA 4XMYA 2NVUB 4C3IJ 4HNUA 4XOPA 4DZPA 3ZPLA 2L81A 1OMIA 1M57C 3VYSB 4U5GA 3GTQJ 2AWCA 4JTDB 4Z6YA 1RMVA 2Y9ZA 3BC8A 2VXZA 2NAZA 4YJWA 1W5SA 3BG7A 4L9JA 1YZCA 3EETA 2K5CA 3RF3A 5EF6A 4KITB 1RKTA 2WB1N 2ZB9A 3P9CA 3HB9A 1VYIA 2GFHA 2H7BA 3PNTA 4LLNA 3WG7C 5E8IA 5JLXA 4DOZA 3D5RC 2AS5F 1L0OC 4CSAA 2UZKA 3NRHA 1IN4A 2FMLA 2YL0A 2DJIA 1FMWA 2FU4A 4ZLCA 4NQWB 5F6FA 2OCCC 2DW4A 4FE7A 4DIQA 4XWJA 1OYIA 2HVRA 4FE4A 5BS6A 3PIOF 4EGYA 3GORA 4YIRX 4W8KA 3BWGA 3KPHA 3F72A 2O03A 2R7DA 3RDIA 3GLXA 4AC0A 4A4AA 5DS4A 4F7ZA 4WCGA 1BIBA 3WG7H 1DGWY 3OYMA 3ABKC 4AL0A 3V5YA 2WY8Q 3CP8A 4RS8A 1CF7B 4OD5A 3MN2A 1B72B 2PMZA 3GMEA 1TT5B 1USTA 2Q9BA 3ZTMA 1K05A 2OCCH 3ZC4A 3CLOA 4BG0A 3ZQGA 2KW3C 1NTCA 3CLQA 4KT6A 3LA3A 4RM3A 5L0HA 1B4AA 2XLMA 1HOMA 3NWSA 3UNGC 2OD5A 1TWHJ 1U5TC 1CGNA 2HQNA 3ABLH 2WZGA 3F47A 1OXBA 3IH2A 1NG7A 2VKHA 3PMRA 3NQOA 4HSRA 3WGHA 3ULQB 1FOXA 1S29A 1BA5A 2CRGA 5C44J 2R03A 2W4MA 3DEWA 4ITVA 1ETYA 3HNIA 4KJZA 3FIWA 5C4XJ 3HKZN 3OYJA 4HG2A 4CDGA 2D45A 4B09A 2XLOA 4O6NA 2ESNA 3RIPA 1DOWA 1QGPA 1TW3A 2KL4A 4D4XA 1VQOI 3TK0A 5EHHA 3EYYA 2G3KA 5LEJA 1BOBA 3PQJA 5M5XJ 1H8AC 3IUOA 4CIHA 1JT6A 4ZYDA 4PK4A 3H9QA 2HS5A 5K7ZA 2ZC2A 1M2OA 3G1OA 2M45A 4ANJA 2WTEA 3E6MA 3K4LA 3F8BA 4I09A 5K5OA 1J59A 4OAYA 2LTPA 4IL6C 2YX7A 1T0FA 2VQGA 1A5JA 3QWLA 3G1LA 3SZRA 4HDUA 3S3OA 3E1SA 4X6AJ 3LSJA 3LLIA 4GEHA 3KX2A 4XSXF 2PP4A 2B0LA 2EZKA 3Q6NA 1VQNI 3RW0A 3V7OA 2HTJA 1XDSA 3CEXA 2AVKA 3QP5A 2M30A 3CJQB 4M3DA 3OSFA 5L0JA 3BG9A 1MH4A 1A35A 4DZJA 4EBBA 3WU1B 3BCAA 5DS9A 4D4NA 3VYTB 5FLMJ 2HOSA 3DPUA 3CF2A 1HA8A 4RDAA 3MKZA 1YHQI 3IRRA 4U88A 2KMUA 1WN0A 4MTOA 1G3YA 3JRTA 1A6IA 2J5PA 3FK6A 1ZHZA 4M71A 5DTDA 5FLXZ 2VN2A 1C02A 5E3OA 2L5QA 3K4JA 3RFYA 3K33A 5D5XB 2VC9A 1J2XA 4U0WA 3FWEA 1RI7A 1KA8A 4IO9F 3CF5F 2H8WA 2GZWA 2Z33A 4JCHA 4WX9A 1IN6A 3OOUA 2VCAA 1ZZPA 3O3KA 3PNVA 3IQ5A 5HS8A 4UUVA 5B1AC 3RKWA 3W2WA 2CG4A 3IWZA 4EM2A 4EUKB 2ZMEA 4G78A 4Q7CA 4W1UA 1X1PA 2E5NA 4KA4A 4OIOF 1UHMA 2PQ8A 2JVGA 2UUZA 4PSWA 1IRZA 4O79A 3J81Z 1PDNC 4CS9C 4A0XA 4DNCA 4YFKF 1X3UA 3WTVC 1R71A 5GADJ 1SAUA 3L2VA 3I71A 4G7ZF 2PX3A 2EPOA 4I44A 3PHF2 1IV8A 3GZ6A 1U9OA 2ID6A 1P2FA 1JJ8C 2KZVA 3S90A 2CNWA 4EBKA 5JP7A 2WWYA 2OZ6A 2Z1DA 4BACA 2QGUA 3CESA 2BBYA 4X0GA 4N4WA 4RBNA 3M79A 4IZZA 3GVAA 2DFEA 1QU3A 2NPUA 4YG2F 3JYYA 3WU2C 1XCBA 3SDGA 3F8FA 5CKTA 5HLGA 4E70A 1IJWC 2OBPA 5CQGA 3VF0A 2VASA 1G2HA 3O8HA 1LKXA 1XB4A 1ZU5A 2KIQA 3RJPA 4RB1A 1XMKA 2EA2A 1YS6A 5DQZA 4RA2A 3ML6A 5BUOA 3MLGA 4XLPF 2PJPA 1OW8A 4LD5A 1R4TA 2JSPA 2IS2A 4Y13A 5J1UA 3GBGA 4IAQA 1ZHXA 2CQQA 5E3NA 3RIRA 1KNYA 4IX7A 4IXAA 4RMNA 3KYCB 1M1EB 5E18F 2CYYA 5E3MA 1FNTc 1HSTA 2XDVA 3I4PA 3FXOA 4PJ0C 3RYRA 2HJMA 3FMQA 3PM1A 2M0MA 2BHZA 2XIGA 4FX4A 1NLXA 4YT8A 4K1OA 4MTEA 4V2FA 2ZMEB 2K85A 3K1PA 3A01A 1OW7A 3K1IA 4A12A 2VT2A 1UJ8A 2ME6A 4OINF 4ZLDA 3KZIC 4RAYA 5FROA 4B43A 2HZDA 3AG2H 3NARA 2LKSA 2OUMA 4KYWA 4A93J 1YA9A 3WGIA 3OIPA 1S6LA 1IXCA 1QVUA 2X1DA 3TD7A 2L7MP 3QVZA 5ERIA 4JTAB 1IN7A 3ZMSA 3B29A 1OKRA 1ZTRA 2WAFA 1EH8A 3HPHA 1Z23A 4Z9IA 2Q2EA 4E7SA 3VSKA 3FM5A 3MZHA 3WE2A 4JKVA 4PR9A 3DM9B 4GDFA 4JTCB 4MTGA 3DJNB 4PUSA 2Y30A 3CP2A 5J3LA 5BQGA 4ENMA 2EK5A 1I1SA 4Z9JA 4ZTFA 2CH0A 1GLNA 4BJ5A 2HWVA 3QRFF 4AIDA 3AL0B 1TQPA 2BOLA 1D1BA 2F5DA 1CGPA 4YIIA 2CNWD 3O10A 3D5SC 3SXKA 2V1DA 1QZYA 3VAYA 2JA5J 2DA1A 3GTGJ 1WJAA 4A3EJ 2M8GX 3LOCA 4XLNF 5E20A 2XF5A 2WAQN 1X1BA 3GW2A 2ETHA 3I56I 2A1DD 3SDBA 1G6NA 3G1MA 4A0YA 2EPLX 5COGA 1ZW3A 4C9YA 1K7AA 1V54C 1E83A 4CYCA 4IHYA 2FRHA 3C62A 1R00A 3TJ6A 2ECCA 2ZJ2A 3A1YA 4A3IJ 2IXMA 3QW0A 4WGYA 1E0EA 3RH3A 3VRCA 2DA3A 4M6XA 2R5ZB 2O6GE 4LB6B 4XIDA 3VYUB 4EATA 3A01B 4AYBA 3HNKA 3BOQA 3W8IA 3S15J 3B71A 3ZOBA 4N9HA 2IOQA 1EF4A 1VLSA 4CJGA 1H9TA 3HKKA 4R79A 2VH3A 2W4BA 1ZREA 2W84A 3M3YJ 1JOGA 4JX5A 1DP7P 4IOCF 3SZTA 1LVAA 1QRYA 2CV2A 1U2WA 2K3PA 1WRJA 4MEXF 2HDDA 2Q2EB 4LDKA 4HE8D 1L3PA 2Y2ZA 2LDUA 5M3FJ 3S1RJ 4BYYA 2FOKA 3BR6A 2XL6A 2XLHA 1U0JA 4J32B 4DXWA 5KYXA 1ZK8A 2DK5A 2GAUA 2E1MB 1XSXA 2EH3A 2JMWA 2VBZA 3DKYA 1W1WE 4LLGF 5CPRB 2J9VA 2WZFA 1BC7C 2B7EA 4AVPA 4BNCA 2NVTJ 1KU9A 2HXOA 3BTLA 3M8JA 3SJMA 5E1XA 1YJGA 3S1NJ 3OYNA 1JT0A 3BTCA 4PGHA 3HTKC 4AVZA 2NG1A 5FKOA 3T8TA 2BV6A 2M4GA 3OYLA 2QKMB 2QQAA 3ZTZA 2L4AA 1WCMJ 2B9SA 3HRSA 2JN6A 3E5XA 3NYMA 3CQZA 4CYCB 3C3WA 3OY9A 3TJ5A 3L34A 2V6CA 2A61A 3A02A 4YFNF 2Q9CA 5IY5H 2GWRA 2MD5A 3CCQI 3E5QA 5FFXA 2LOOA 2LREA 5F1RA 3TOMA 3WAQA 2Y9YA 4DYQA 1FP1D 5ICEA 4NHJA 4C2MJ 2YRFA 5L3FA 4A3FJ 1WPKA 2HQAA 1TWCA 3TOAA 4KMFA 4QI0A 3GF2A 3F21A 4UHTA 3RYPA 2XSJC 4IJAA 1O57A 1JGSA 2VBYA 1MBJA 5LD2C 2EPFA 1PD0A 1HMOA 4U7BA 4AWXB 3M15A 4YK5A 5K7HA 3JW4A 2DPUA 2ZXOA 5HS9A 4RB0A 2IGNA 1AKHA 2HVSA 4BUPA 3OYKA 2ZXWC 3PL8A 4LMYA 4BEHA 3NG1A 2QF7A 2VUMJ 2GAQA 2YR2A 1Z63A 3NWTA 5TJ5E 4XKVA 5B3IA 1IXRC 5KYXB 3VPRA 3LEVA 3ZMTA 3UMKA 3LA2A 2OPTA 4UV8A 4DRJB 1WJCA 3R2PA 1U5TA 4HNTA 2ZXWH 3VYWA 2DDBA 1YARO 1NFOA 2M4KA 3PDMP 4M74A 3B0UX 4B44A 2F4MB 5D8KB 3EG9A 4ENNA 1G59A 256BA 5IOYA 4IWBA 5E2QA 3CC4I 4WABA 3OYIA 1T9KA 5AC5A 1G3SA 3QU3A 3ZCOA 3BR3A 2P7VA 2B0HA 3AKZA 5GP9A 3TW6A 4UVAA 2F5EA 4YEJA 1IRXA 4B4CA 3CCVI 1JKRC 4CA0A 1YTYA 1HKSA 3MZYA 1L3LA 2ZO4A 1C0WA 2PX0A 2LD5A 4EM1A 4JC7A 1QPMA 3IKTA 1VK5A 2LF7A 3K4MA 2O9XA 2VI6A 3CC7I 1KQ8A 3BQYA 2HJ3A 2KT0A 3QPHA 5IP6A 1LS1A 5KHDA 3WTZA 4QIWN 2EFWA 5FLXK 1HMDA 3HOSA 1OR3A 3ZVRA 3IAM2 4LG3A 3HGGA 1AKHB 4U9DA 4NC8A 4XPXA 5IP7J 3GM3A 1WHUA 4BEHB 2LY9A 5DS5A 3DF8A 4RB3C 5CVJA 2HOTA 1OW6A 4EKWA 2LLKA 3I64A 4EEFG 1W7PD 1ERDA 3LLKA 5TGTA 3D1NI 4IVNA 3ZMDA 3S1QJ 2MBFA 1B68A 1T5OA 3RKOF 2GQQA 2PMHA 1IGNA 2M4EA 2ZJPF 4WGZA 1FBUA 1BM9A 2Y0SA 4C2UA 5CVRA 3W6KB 1JGGA 1U5TB 4CJOA 4E7JA 1T56A 2VJ4A 3NRVA 5KVRA 2HTSA 1RR8C 3QW1A 4MVUA 2NS8A 5EEHA 3W6VA 1TBXA 3J81K 3ZP5A 3H5AA 3ZMZA 5BQHA 3LS1A 3RQ4A 3CJNA 4FT8A 4XKCA 4D5FA 1T6QA 1ZH5A 3DZAA 1HY5A 1BN5A 3SZPA 3ZQHA 3AJMA 2IA1A 3DJUB 5HOOA 3J06A 1HXDA 3MFNA 2P7VB 2KKOA 2CQ7A 2HYJA 4XL9A 5BNGA 3CCYA 2JRTA 3VSLA 2OJQA 3U9MA 4JIOA 2XGXA 4GQHA 2M3AA
chains in the Genus database with same CATH topology
5CVVA 1UFMA 4MQ9F 2V1XA 4WWCA 4BHPA 3HUGA 4HX4A 5D6FA 4IHSA 4L9TA 4L9VA 1KGSA 2ISYA 3VODA 2CWEA 5JFRA 4HF0A 2EFOA 5FGMA 1KQ9A 1QZZA 1O3QA 2VE9A 2ISZA 1DUXC 1XN7A 1E17A 2Q8KA 2XUBA 2ADUA 2UXXA 3FHZA 4MTDA 2E1CA 4LFUA 1LQ1A 3KP3A 4BQAA 2K4BA 4IPAA 3V7SA 2NYXA 3ABUA 3L00A 1JE8A 1G4DA 1XGMA 2YSRA 2L02A 1FYKA 3IL2A 3M8FA 4BHBA 4P9FA 1GHCA 1IUYA 3QOPA 3U1DA 1YW9A 1DDNA 1W4MA 2GA2A 2MC3A 3ELKA 1WWXA 3LAPA 2JSCA 3GO5A 2Z99A 2V79A 2EWNA 1PP8F 1YS7A 4D0PA 1FC3A 2FF4A 3S2WA 2RNJA 1I5ZA 1UCRA 5CJ9A 5D6EA 4IRGA 5DV5A 3FMRA 3KE2A 4ON0A 3CUQC 4UVBA 3J80Z 4CO8A 3AAFA 2XVCA 3C18A 2EFPA 2A68F 2KIMA 2F5CA 5H6QA 1DPRA 1Y0UA 2NRAC 4HX7A 5AIQA 1O7LA 1K78A 2HQRA 1SD6A 2A5YB 1ON2A 3EDPA 3GEZA 4RGRA 2BEOA 4A5NA 2VOOA 4WXHA 3WTUC 2XAGA 2O61A 2Y75A 1QO0D 3M9AA 4HV6A 3GFIA 1TLHB 4OIRF 2IA0A 2Q0OA 5LGNA 5AIPA 1MD0A 5ICCA 2LNBA 1Z6RA 4S05A 5TJJA 3WU0A 1LB2A 2WC2A 2HR3A 5BQTA 1YQAA 3F23A 4ZH4F 4I0AA 3KZYA 1SFXA 3T1BA 1G3WA 2VE8A 2Z5UA 4UXNA 2KIFA 2W25A 5FFZA 1RZ4A 4M9SA 1ZGAA 2PI0A 1FOKA 1KU3A 4P96A 2D1HA 5DCFA 5DUIA 1LDJA 4HYEA 4P5OA 5L3BA 3OV8A 2XROA 3GFJA 3IKVA 4K2EA 4EGZA 4ZYEA 2CFXA 1W5TA 1FP2A 4ESFA 3KETA 3GWZA 2STWA 4CHUA 1HSJA 2O0YA 2OQRA 1J0RA 2EFQA 2DQLA 3RPUA 3V4GA 3HTUA 3K0LA 3KEQA 1O3TA 4MEYF 5FD5A 3EYIA 4N9IA 1LDKB 3HOTA 1TNSA 5ILUA 3KP6A 4LGWA 1YYVA 1JHFA 5ED4A 4LJZF 1FYLA 1B9MA 4CICA 4JBAA 3ZN0A 3JSOA 4AD9A 1Z7UA 2DLLA 1TW2A 2OU2A 1UB9A 4G6QA 3DP7A 3EQLF 3D0SA 1RIOH 1FT9A 2FNPA 5HDKA 3MCZA 3HTSB 3GX4X 4Q5SF 1F9NA 1MKMA 2DAOA 4KDPA 3TO9A 2V1UA 2JPCA 4BH9A 2EV0A 2VONA 2RKHA 2X4HA 3B02A 1WKMA 3BY6A 4NB5A 1P6RA 2EJRA 2RC4A 5H20A 5LHIA 5BPDA 2EB7A 1R22A 4HDVA 3R4KA 1SD5A 3QAHA 5HS7A 3E6BA 1BOAA 5JI6A 1STZA 5CVIA 1OR7A 3GZ5A 4EQQA 3GUDA 4Q47A 1JHHA 3DPLC 4OMYA 2MA3A 1SFEA 2P4WA 2Y0MA 1FX7A 4I01A 1Z05A 4HOBA 2A69F 2GXGA 3K9TA 4XBFA 1XGOA 2MLKA 1WSUA 1TTYA 2FBIA 1BI3A 3CO7C 3VEPA 4QLCU 4KT5C 1TQIA 3CUQA 1TQMA 1S3JA 1S8NA 2OZUA 2L3DA 2QBYA 1F4KA 3D5LA 2YPRA 4GGGA 3WTXC 2RDPA 4A6DA 3E3VA 5LEKA 4MHGA 1FNNA 5LRSA 3LQRA 5DD4A 1REPC 5DUKA 2IRFG 2RV8A 4HLXA 4HF1A 2DTRA 3LAJA 2XAQA 3R61A 4G7HF 1R1VA 2GIVA 1A04A 1KYZA 1R23A 2W24A 4IF4A 3F6VA 2GA1A 2PN6A 4I0BA 4AIJA 5CYVA 1KYWA 3CUQB 3R0JA 4GO1A 1I27A 3I59A 2HDCA 2IA2A 3SHFA 4IHTA 5DYMA 2BGCA 2ZKZA 2QBYB 3KCCA 1T98A 3JTGA 2FNAA 2CO5A 1ZG5A 4L0ZB 3L2CA 2RQPA 2EV6A 3LA7A 3K2ZA 1SAXA 1J9IA 3KLNA 1WI9A 4RGXA 2M8EA 5D5UB 2PMUA 2BE5F 4M9ZA 3COAC 5DEQA 4UNOA 1S7AA 4KUMA 2D2WA 3Q5FA 4WXDA 1B6AA 4IRIA 4BAYA 1W7PA 2OA4A 2COMA 5BPIA 2FBKA 5CLSA 4CGZA 5FB2A 2FSWA 2HYGD 1I6XA 3TQNA 2K86A 3R0AA 4KNYA 1V3FA 3HIFA 2A07F 2M87A 1HW5A 1LDDA 3H3ZA 3I59B 2VC0A 3R6SA 1R5HA 3GFLA 2IT0A 1LEAA 3F8MA 3HRUA 2CQKA 1XD7A 2IVMA 1Z9CA 1JXSA 4FHTA 3DV8A 3BDDA 3IC7A 5D4RA 1YIOA 2ESHA 4KFCA 2HZTA 4KN4X 3TDZC 1VTNC 1FYMA 1KQ0A 4JQFA 3MWMA 2G7UA 3ERED 4G9YA 1W7PB 3VFZA 5HDGA 1U3EM 2XAFA 2HKXA 3BZ6A 5ICFA 4KICA 3DFGA 1J5YA 3LFKA 1TNTA 1AWCA 3KFWX 3I5UA 4QWQA 1FLIA 5HVQC 3WODF 1YO5C 5KK1A 2W85A 3V8LA 2DT5A 1F5TA 4DQ2A 5L3GA 5LGUA 1ZLJA 3MFKA 4EVIA 2DPDA 1ZLKA 4P55A 4FX0A 3KZZA 2STTA 3DPTA 1IN8A 1BBYA 2QLZA 3PFIA 2VODA 3L9FA 3KLOA 5BMZA 1Q1HA 3TGNA 3BPVA 1AOYA 4M6YA 1IAWA 3BJ6A 2XAHA 5LHGA 4CYDA 5D4SA 5LGTA 2DU9A 1O7FA 3HSEA 1YW7A 3QPTA 1ZHFA 4GCVA 2L01A 2IP2A 5AONA 1T2KA 2LSOA 3DXJF 3K1MA 2A6HF 3M8EA 2M1BA 1B59A 1HQCA 3ZN1A 1T6SA 3N4MA 1BI0A 2X0LA 4Z2YA 4ESBA 1I1GA 3Q9VA 2EV5A 2L4MA 3KP4A 4A2UA 1F1ZA 4ZZLA 4PZJA 4IRHA 6PAXA 3MEXA 2FQ3A 1GXQA 2ELHA 5EEGA 5JVTA 4Y15A 2VBXA 5K5RA 4CXFA 3HYIA 2P6TA 4L5IA 5E1WA 3W6JB 5ILVA 1EH6A 3BROA 4RAZA 5F64A 1J7KA 3DQVC 1BI2A 5FD6A 3C1DA 5A2QZ 3I54A 5JR3A 4EJWA 4ZZDA 4HW0A 4EJTA 3GXOA 2H6CA 3OOPA 4M9XA 5LBQA 4OU0A 3C7JA 5E1ZB 2XKPA 3FX3A 3SFZA 3V7RA 1MJAA 3HRMA 1RNLA 2Z3YA 2AXLA 3JSPA 1Z91A 1XMAA 1J75A 1ON1A 2A3SA 2FMYA 1V4RA 3Q9SA 3E97A 2PBIA 2JPBA 1ZRCA 5L3EA 3H92A 1IRFA 1IZ1A 1R1UA 2OQGA 3ABTA 2CSOA 1BIAA 3GYHX 4OIQF 1D5VA 4Q48A 3B73A 4PDKA 3SXMA 3T5XA 3FF5A 1OYYA 2EA4A 4HQMA 2W57A 3L7WA 2K02A 2PFBA 3F22A 3LQQA 4EJUA 1E2XA 1K78B 2DK8A 3CTAA 2ZNZA 1EV7A 1HBXG 3DEUA 2M5WA 2ZNYA 1SFUA 4LK0F 3DKWA 2H09A 1RUNA 2ZCWA 4ASNA 1ZGJA 2HFHA 2P6SA 4ZYHA 4U0YA 4P9UA 4L18B 3HSFA 5E17F 4O5VA 1FBSA 1D8JA 4ETSA 4AIKA 1LEBA 4G94A 1ZG1A 1YG2A 4LK1F 3ZQ7A 1T38A 4XRFA 1ODDA 3ZMUA 2D1VA 3J7AO 1D3YA 3JAMZ 2FE3A 4ENJA 1S7OA 2C6YA 3SQNA 5L3CA 2IPQX 3F6OA 2DI3A 4HF2A 4GYIA 1MJ9A 3TKYA 2QWWA 2HEOA 1P4WA 5LHHA 1IW7F 3BJAA 2QM3A 2MLGA 2P8TA 1R1TA 1PP7U 2P5VA 1XSVA 3EUHA 4O3MA 3TDUC 2Z9OA 3FM3A 4LB5A 3K1NA 4CZZA 2E1NA 4KMUX 3HSRA 2HGCA 2DQRA 4R1HA 4KIGA 4Q4ZF 3TOBA 4OOIA 4HA8A 1QBJA 1R7JA 4UVCA 4YFXF 1D8KA 4EJVA 4HQEA 2G9WA 5FO5A 5DCMA 4G7OF 5HLIA 2P5LC 2JT1A 3ECHA 1FBQA 5K1YA 2FA5A 3E6DA 1ZG3A 1LNWA 1ZRDA 3K69A 1WQ2A 3V7CA 4LLLA 2KRFA 3T0YA 2IJLA 4S04A 4MNUA 3N97A 2DBBA 3U9GA 4KIBA 4WF2A 4OIPF 1USSA 1R5GA 1SMYF 3KP5A 5CVUA 3WTTC 5A2QK 2KIUA 1IF1A 2QUFA 2P7CB 2WV0A 2NNYA 1MJBA 5J8FA 5DDGA 3J80K 2H94A 5HDNA 3BP8A 5DCMB 1ZARA 4HBLA 2XV4S 3KEOA 4GXOA 1U8RA 4L9NA 2CGPA 5K5QA 4XSZF 2LKPA 4JK1X 1U78A 4PGGA 4R8HA 4A6EA 1FWZA 1IRGA 2HKOA 1FPQA 3ZMVA 1BI1A 3I58A 3WGGA 3O2PE 4U0VA 3WE3A 1Z6TA 3VOEA 1GXPA 3U2RA 4I98B 5D5VB 3WTWC 4HLYA 1YLFA 1U6GA 3HHHA 2Y48A 2VT3A 2PLYA 3P7NA 4A0ZA 2XASA 3RKYA 1H9GA 2RN7A 4EM0B 3RKXA 3CDHA 1OPCA 5IT9Z 1FY7A 1ZRFA 5J8CA 1KU7A 5H6RA 2KJCA 1B1BA 3GFMA 3RPQA 2GXBA 3LWFA 2EFNA 4RGSA 3CO6C 4HV5A 2KJBA 3I53A 5J6XA 1XDUA 2OAZA 4RGUA 4LG0A 1PUEE 1P92A 4KN7X 2QZ8A 4PCQA 3G73A 2E7WA 2DO7A <