3IHUA

Crystal structure of dna binding protein (yp_298823.1) from ralstonia eutropha jmp134 at 1.92 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
205
structure length
205
Chain Sequence
b'SASDTVFFGIMSGLELGTFVPGQRLVETDLVAHFGVGRNSVREALQRLAAEGIVDLQRHRGAVIRRLSLQETLDVLDVAERMTGLLARAATRGSGNQPQVQALRASVQALVAAEKAQDGETFSNARRHFYRTLLEMGDNRELRRLFPTIHMPIVHAQHRLASLRQMRLDDYRRIATAVLAGEPDAAEAAGAAHVKNVRGAILDRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, GntR family
publication title Crystal structure of DNA binding protein (YP_298823.1) from Ralstonia eutropha JMP134 at 1.92 A resolution
rcsb
source organism Ralstonia eutropha
molecule tags Transcription regulator
total genus 80
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ihuA01
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3ihuA02
4MNUA 4S04A 4A0XA 1FY7A 1OPCA 2DLLA 2CGPA 1BIBA 4AWXB 5CVIA 2A3SA 2DW4A 2OAZA 1IXRC 3L09A 3FHZA 1B9NA 3IKVA 1O3QA 4Y15A 1ZARA 1OYYA 5F1RA 5DCFA 2NYXA 2IT0A 3ZMDA 2YX7A 4UV8A 5F6FA 4WF2A 4A0YA 3KP6A 5DCMA 1PP7U 4ZH4F 4PCQA 3WGIA 2O8XA 4L9JA 3WTYC 4IRIA 5L3GA 4HA8A 3MFKA 2A6HF 3BY6A 3DKWA 3E5XA 1WQ2A 1XMKA 5BS6A 1USSA 4FX0A 4OIRF 2IRFG 1J2XA 1PDNC 5HLHA 4Z2YA 4HV6A 4LLGF 3E3VA 4ASNA 2VONA 1IUYA 1XCBA 1IXSB 2EK5A 2AXLA 1YTYA 1B6AA 1H9TA 2KKOA 4I02A 3I59B 3LWFA 4IPAA 2X4HA 3GLXA 2XASA 4RGRA 5HS7A 2F2EA 1FBUA 3SXYA 2EFQA 1FSHA 2JTVA 1RIOH 5DD8A 2CFXA 3LSTA 1EV7A 1IXCA 3RYPA 5D6FA 3JSPA 1ZLJA 3HRUA 3K2ZA 3E6DA 2QWWA 2XIGA 4BQAA 2CO5A 4MTDA 2ISZA 3CDHA 2K86A 4OIQF 5FLXZ 1T0FA 3MCZA 2L4MA 1RI7A 4RB1A 4G8XA 3V7SA 3JTGA 4XLPF 1PUEE 3I64A 4G94A 1T38A 3Q9SA 2ISYA 1YW8A 1OYWA 3MWMA 5LHIA 5D8LB 5E1ZB 2M45A 4TV7A 1O57A 2PMHA 3GZ6A 5JVTA 1GXQA 2GXBA 2EFNA 2J5PA 2W84A 1W5TA 2VC1A 2VBYA 3WGGA 3ISPA 2F5CA 2RKHA 2BV6A 1QZZA 3O6BB 3RI4A 1JE8A 3FMQA 3VOEA 3RYRA 1ZGJA 1R58A 2G9WA 2XRNA 4IVNA 1HKQA 2GWRA 3F6VA 1BN5A 2H6CA 3QU3A 3RJPA 4GO1A 1NHAA 5F64A 3BZ6A 4IXAA 3VFZA 4MEYF 2BYVE 3IWZA 1DDNA 2DO7A 4IHSA 3KE2A 5J6XA 3IRRA 4I01A 4LLLA 2XAFA 2H94A 4ZZDA 1R1VA 1EH8A 2Z3YA 2VBWA 2G7UA 4EJUA 4RAYA 4IRHA 2ZCWA 2CYYA 3ERED 3F21A 1L0OC 5DUIA 3JSOA 1UCRA 3VB2A 1U8RA 3QP6A 1G4DA 2HTJA 2HOEA 2VT2A 3F8FA 2IPQX 2XUBA 3WTSC 2VE9A 2MA3A 5ICGA 2NS0A 2GA2A 4BHBA 3KCCA 3GO5A 4UUVA 5L3CA 2L01A 4HDUA 4I0AA 3DPLC 4RAZA 3HTSB 4L0YB 5EEGA 1R5HA 1YS6A 2P5VA 1RUNA 1TQMA 3KFWX 2Z33A 2FEZA 2EV5A 1ZRCA 1V3FA 4LG0B 4ENMA 5CVJA 2H09A 3I59A 1W4MA 3M1EA 1UFMA 2OU2A 4LK1F 2VBXA 2LNBA 4OIPF 3WTUC 4ZYGA 4UNOA 3IKTA 3HRTA 1D8JA 4EGZA 1MDMB 5E1XA 1SMYF 1I1GA 1O3TA 3EYYA 1LDDA 2XVCA 1KU9A 2GXGA 1KYWA 2FBIA 4EMSA 1G3SA 4L18B 5IT3A 2ZKZA 1HW2A 1IRGA 2JPCA 2PQ8A 1HW5A 3K1MA 2M30A 1XD7A 3CUQB 3JAMZ 2V1UA 1U3EM 3T0YA 4Q47A 4DNCA 1IW7F 2RN7A 5FGMA 2RNJA 2CW0F 5LHHA 3SZTA 5FD6A 4YFKF 3ML6A 2G7HA 3J80Z 5LEKA 1TNTA 1KGSA 4ZZLA 3TQNA 5IT9K 4LJZF 1XB4A 3WODF 2WTEA 2OBPA 3B73A 1GVJA 3EYIA 2WC2A 4M9XA 5E1WA 4U0WA 1I6XA 4BH9A 4NHJA 2H27A 4KMUX 2LKPA 5HDNA 5HDKA 1SFEA 4JK1X 5J8FA 3TDUC 5TJJA 4HQMA 2HYFA 1SD4A 5E20A 5AIPA 4HX8A 3J81Z 1RUOA 1DPUA 3I53A 2L3DA 2W57A 1FP2A 4G6DA 4M71A 2F5FA 4IHTA 1UHWA 2MLKA 3ZMZA 4U0YA 5K5QA 5L3BA 2XAHA 4LB6B 1HKSA 1Q1HA 2DFIA 3C1DA 2DPUA 3FMSA 3IC7A 4CYDA 1ZN2A 3V4GA 2CWEA 1ZRDA 2LSOA 3BPXA 4UVBA 5E17F 1BM9A 4A12A 4RGSA 5D6EA 2MBFA 2R7FA 5KK1A 3JTHA 4HOBA 4S05A 4ETSA 3U1DA 1RZ4A 2D2WA 3GVAA 1H9GA 2DK8A 1EH6A 1ZG3A 5A2QK 4HYEA 1ZHFA 4ZYHA 4YIIA 2NAZA 3DPTA 2P6TA 2FOKA 4LG0A 3G73A 3COAC 4M74A 1LJ9A 3DXJF 2D1VA 2A69F 4LLNA 4KFCA 1Z91A 2YPRA 5E8IA 2QM3A 1GHCA 1P2FA 2RGVA 3L9FA 3TOBA 1P4WA 3ELKA 5L3EA 2FA5A 3I5UA 4KYWA 4OINF 4MTEA 5FO5A 4JBAA 3GWZA 1QBJA 5H20A 3F22A 2EFOA 1YW7A 4HF0A 1MDMA 2XKPA 2W25A 3BOQA 1FBSA 1SD7A 3GW2A 3P9IA 4D0PA 2P5LC 1JXSA 3KLOA 2JPBA 1XDUA 4KIBA 3MZHA 4YG2F 3IRQA 3KP5A 5E8GA 1XSDA 4KNYA 2E1CA 3ABUA 3VEPA 3GFMA 1LQ1A 4M6XA 1Z05A 3CUQA 2ZNZA 3QPTA 2E7WA 2QVOA 2K02A 4U7BA 1L3LA 1G3WA 1BC8C 3RDIA 1RNLA 2XAQA 1HSTA 1OKRA 1ZAOA 3P7NA 4A6DA 4YIFA 5E18F 2KRFA 2HR3A 3TDZC 2ZXJA 1K79A 2A5YB 1P92A 4HV5A 1Z7UA 4M9ZA 5D5WB 3HSRA 3R0AA 3TO7A 4MQ9F 2O6GE 1F4KA 2IA0A 5FFZA 2FF4A 3NRVA 3OV8A 1Z1DA 1X3UA 1YLFA 2ZBKA 5J8CA 3GFIA 2EV6A 2ELHA 2E7XA 1ON2A 1FLIA 3QPHA 2LDUA 1F5TA 5LRSA 3V8JA 3F23A 2AS5F 2BEOA 4KIFA 3TOAA 1J7KA 3ROUA 2JT1A 1HQCA 3HRMA 3HUGA 2YX4A 1QGPA 3LFKA 3TO6A 4R79A 4ZYEA 1J5YA 5BMZA 3LA3A 3ZMTA 1IN7A 5D4SA 3NQOA 3WTVC 3T5XA 2PEXA 1BIAA 4LGWA 1WRJA 1FBQA 4EJTA 2GQQA 4EM0B 2XAJA 2Q0OA 2DAOA 4M6YA 4PGHA 3E5QA 2Q8KA 4BAYA 5FB2A 2BE5F 3LA7A 4UV9A 4L9NA 3SZPA 3SHFA 4G7HF 1YYVA 3C7JA 1B1BA 3DFGA 2KIUA 3TKYA 4EV0A 4AD9A 3JW4A 2WV0A 4WXCA 1I27A 1T6SA 2HYGD 2DQRA 4N9HA 5FFXA 3O3KA 2GA1A 4OMZA 4I09A 2M87A 2OD5A 5JHUA 4K2EA 4EJWA 1SMTA 5K5OA 2Z9OA 4WXDA 2DT5A 2M1BA 1CF7B 2QQAA 2ESHA 4M73A 3FF5A 2MH9A 3VODA 1DP7P 1BOAA 3GXOA 4I2OA 5HLGA 1XMAA 4G7OF 2QBYB 2Z99A 3LQQA 3ECOA 3M9AA 3W6KB 4EQQA 5CLSA 5JI6A 2QQBA 1FX7A 4WCGA 1HSJA 5BOXA 5CVVA 3CTAA 1MJBA 2V9VA 1YIOA 3F6OA 4XSZF 1BJAA 2MD5A 2VODA 5TRDA 3RTRA 1USTA 1KU7A 2Y0MA 2ZO4A 4KUMA 2O3FA 4HX4A 2V6CA 2RQPA 3K0LA 4YFXF 2P5KA 3H92A 2DU9A 4MGRA 4GGGA 2R3SA 4UHTA 3T8RA 4P96A 4KIGA 1P4AA 2FMYA 4PZJA 4XBFA 1K6OA 1XSXA 5DD4A 4RB3C 2HKXA 1W7PD 4I0BA 4IRGA 5D5XB 4EM1A 1TQIA 3L00A 3I58A 4GCVA 3B02A 1S8NA 3KP3A 1Z6TA 2EA4A 4I98B 5LEJA 2EJRA 3RKYA 4OIOF 2PFBA 4CICA 2HS5A 4UXNA 2K4JA 2ZJ2A 5IT9Z 5D5UB 4HLYA 2KJCA 3BJOA 4BHPA 1T98A 5AIQA 1R5GA 5BPDA 1R23A 3RPQA 1LB2A 1KQ8A 1QZYA 2P7VB 2QYOA 3GFJA 1R1TA 1D3YA 1B4AA 2PJPA 2BBYA 2J5OA 2Z5UA 2EFWA 5CYVA 2K27A 1KU2A 2HWVA 1V4RA 3HOTA 2Y75A 4B8XA 4I7HA 3R60A 4A0ZA 1FC3A 1DUXC 4PDKA 3HIFA 4GYIA 3T8TA 2XHKA 1FOKA 4OU0A 4N0BA 5JR3A 4R8HA 1FP1D 1YO5C 1XGMA 4HF2A 2D45A 1FSEA 1JHFA 2L54A 4ON0A 1ZGAA 3TGNA 1AOYA 4P9FA 3F3XA 5KVRA 1YS7A 3FXQA 2E1NA 4CXFA 2ESNA 4HF1A 4NB5A 1J0RA 1BC7C 3QOPA 2DK5A 1BI0A 1LEBA 3BPVA 4EJVA 2ZNYA 1ODDA 1TW3A 5BPIA 3F8CA 1XGNA 1U5TB 1CF7A 1I5ZA 5A2QZ 3KP7A 5AONA 4WX9A 3HYIA 3SXMA 3F8BA 1O7LA 3LQRA 1OYIA 4HDVA 1ONVA 2OQGA 2QBYA 2QQ9A 5HVQC 1TLHB 2OZUA 3M8EA 4L5IA 1IN4A 2DQLA 3ZN1A 1S7OA 4P9UA 1TTYA 4ENKA 4G9YA 2MC3A 4M72A 3ZN0A 3IL2A 2DBBA 4G7ZF 2QUFA 4RGUA 5ILSA 4ESFA 2LF8A 1J59A 1S6LA 1B59A 3JAMK 1CGPA 1XSVA 1TW2A 1OMIA 3EUHA 4BYYA 2O03A 3IHUA 1WKMA 3SFZA 4IF4A 2UXNA 1MJAA 3I71A 2O61A 2JRTA 4QWQA 4U88A 3F8MA 1BI3A 3FXUA 4L9TA 3J80K 2FBHA 4CDGA 1YFHA 3F8NA 3E6MA 1FT9A 3DP7A 3KP2A 5LHGA 2A61A 4LB5A 2CSOA 4P5OA 3WU0A 2GIVA 3H3ZA 2HFHA 4ZYDA 5LRRA 3V7RA 1FYMA 3C18A 2Y48A 2NRAC 2X0LA 3WTZA 1WI9A 4N9IA 4MEXF 2ETHA 1IZ1A 1LDKB 2VOOA 3WE2A 2VBZA 2RC4A 2V1XA 2OA4A 4UVAA 3HSFA 2B0LA 1HBXG 4RS8A 3U2RA 3GFLA 2D1HA 1MZBA 4UVCA 3N4MA 5H6QA 1HW1A 2IJLA 1J75A 2VXZA 2BGCA 3M7GA 5ILVA 4HBLA 1G3YA 4F7ZA 3BP8A 4FT8A 3FZVA 3HSEA 4E70A 2K7LA 1QNTA 4XRFA 3PQKA 3Q5FA 2V79A 1FZPB 2NNNA 3KZYA 4ESJA 1LDJA 3KEOA 2H6BA 4LFUA 4Q4ZF 2GZWA 1LNWA 4L5JA 4BXUA 3GEZA 3LAJA 1G3TA 2ZMEB 4Q5SF 2M8EA 1S3JA 4B09A 2KIMA 4BNCA 5CVUA 4O3MA 5DEQA 2XROA 1R36A 5H6RA 4XLNF 2HQRA 1GXPA 2CG4A 1W7PB 2WWYA 2MLGA 3N97A 1ON1A 3DV8A 3K9TA 3ZQ7A 1XDSA 4LD5A 1U5TA 3I0TA 1VTNC 5HDGA 1R1UA 2XV4S 2L02A 1MD0A 1LEAA 3D0SA 3WE3A 6PAXA 1STZA 1D5VA 3U9GA 2HDCA 3R0JA 3C3WA 3L7WA 4FX4A 1J9IA 1UB9A 2HZTA 3K69A 3BROA 3PQJA 4A5MA 2A68F 3HOSA 2IA2A 4WK8F 3SXZA 2CQKA 1IF1A 1XGSA 2GAUA 4MHGA 1O3RA 4O6JA 2A6EF 2ACJA 1E17A 3R6SA 1C0WA 1ZH5A 2IVMA 3QP5A 1XGOA 1KA8A 3KEQA 2DPDA 2OZ6A 1SD6A 4OMYA 1Y0UA 1HXDA 1ZG1A 3FM5A 2XKOA 2IW5A 2O0YA 4PGGA 3HRSA 4EGYA 3I4PA 1F1ZA 4RB0A 1W5SA 3GX4X 3LAPA 3GUDA 1FPQA 3GYHX 3DQVC 4BHCA 2W85A 1EH7A 3FM3A 1XCVA 2VE8A 3ZP5A 2M5WA 4L0ZB 1OR7A 3DF8A 1QO0D 4LMYA 2IA1A 3WTTC 1H0MA 3D5LA 4GYGA 4M9SA 3V8KA 3CUQC 5LBQA 3ULQB 3RIRA 5ICFA 2XGXA 2EWNA 2PN6A 2NNYA 1D8KA 2YSRA 4YFNF 2F5EA 4CGZA 1O3SA 3ECHA 3P9CA 2FE3A 1FWZA 3GZ5A 2XAGA 1ZG5A 1K78B 2UZKA 1IN8A 5FD5A 1KU3A 4WWCA 3P9KA 1BI2A 4R1HA 1I1SA 5HS9A 1FYKA 2DI3A 5HLIA 2PBIA 1R00A 1S29A 4A5NA 3E5UA 3WG9A 4ENJA 5HS8A 1ULYA 5LGNA 1U5TC 2EFPA 5L3DA 2ADUA 3KLNA 1IN5A 2OQRA 2VOPA 3SQNA 4XSXF 5LLQA 1ZLKA 1YW9A 1PP8F 3M8FA 5FLXK 1UHMA 1YG2A 1FYLA 5D8KB 2HKOA 3FMRA 1FNNA 3HTUA 4KN4X 2UXXA 5LGUA 1SAXA 2HQNA 2ZMEA 2COMA 1E2XA 2FRHA 1T2KA 3QAHA 2C6YA 3SXKA 2R7DA 2FU4A 3EETA 3WTWC 1KYZA 3OOPA 5LGTA 3QRFF 1ZREA 2PMUA 1AWCA 1R7JA 1W7PA 2HGCA 1QPMA 3I54A 1SFUA 1MGTA 5D5VB 4CO8A 2DTRA 4U0VA 3ZMVA 2P8TA 2FBKA 1K7AA 4OOIA 2STTA 2L4AA 4DQ2A 1BI1A 1B9MA 1T39A 3K1PA 4EJOA 3RKWA 4KDPA 4P55A 3GF2A 2RVCA 5HOOA 4KMFA 1WWXA 1SFXA 4A6EA 1QQIA 2P6SA 1F9NA 3F72A 1U78A 2ZFWA 1P4XA 5ICCA 1ZYRF 1ZRFA 3RPUA 4EM2A 4KICA 3WGHA 4AIKA 4LK0F 5D4RA 2FXAA 3T1BA 1DPRA 4IJAA 2HEOA 2UWMA 3S2WA 3REOA 3BDDA 2PG4A 1JHHA 2QZ8A 2TDXA 3V7CA 2VT3A 4ESBA 4Y17A 2EB7A 2P7CB 2RDPA 3MAJA 1U6GA 5L3FA 3Q9VA 2Q2EA 4G6QA 3HHGA 2EV0A 2A07F 2JZYA 2MH2A 1WSUA 5DUKA 4KT5C 3MZYA 4RGXA 1HKTA 3WU1B 4GXOA 5K5RA 4ENNA 4Y13A 2W24A 2QENA 4Q48A 4H0EA 1XN7A 3ZPLA 5DCMB 4U7DA 1TNSA 1KQ0A 1Z6RA 2QLZA 3NEUA 1JGSA 4WXHA 3QU6A 4KA4A 4KN7X 2VN2A 3BJAA 3L2CA 3R61A 2JSCA 2K4BA 3KP4A 3O2PE 3MQ0A 3FWEA 1K78A 3ZMUA 4A2UA 3E6CC 2VC0A 3E97A 2FSWA 5CVRA 4AIHA 3K1NA 3CLOA 5ED4A 3KZZA 2HTSA 4MQVA 4CHUA 1IN6A 2EA2A 3BJ6A 2KIFA 4EVIA 5BQTA 3HHHA 3ABTA 3CUOA 2FQ3A 4HX7A 3RKXA 3V8LA 3DEUA 1KQ9A 2F5DA 5JFRA 4RB2C 1U2WA 1O7FA 5ERIA 4JQFA 5DV5A 2YR2A 2PLYA 3J7AO 4HAMA 1G6NA 1A04A 1REPC 3BWGA 3CO6C 3CJNA 3AAFA 3EQLF 1BBYA 4O5VA 4HW0A 4AVPA 1IAWA 1MJ9A 4NQWA 5ICEA 1SD5A 5ILUA 2PI0A 3EDPA 2P4WA 3WTXC 3R4KA 3LA2A 1S7AA 2RV8A 1YQAA 1Z9CA 3KETA 3E6BA 4HQEA 2FMLA 2STWA 4HZFA 3ZMSA 2LF7A 3W6JB 3G3ZA 2FNPA 5CJ9A 4QLCU 4FHTA 3CO7C 3H3UA 3FXRA 5DDGA 2YU3A 1IRFA 2KJBA 3PFIA 3FX3A 3J81K 3IWFA 4CZZA 1TBXA 4HLXA 5K1YA 4AIJA 1R22A 4L9VA 1MKMA 2IP2A 5DYMA 1TQPA 1LVAA 1P6RA 5EEHA 2V1DA 2FNAA 3MEXA 3TO9A
chains in the Genus database with same CATH superfamily
5A6AA 4MNUA 3W2WA 4S04A 2AXTC 4A0XA 1HLVA 3QOEA 3A0BC 4DXWA 4ITVA 1ACIA 3AG2H 2XLMA 4CSWA 3BZCA 5KYUB 2G0EA 1FY7A 1OPCA 4FETA 2DLLA 2CGPA 1BIBA 4AWXB 1WN0A 5CVIA 3ZGKA 1RC9A 2A3SA 2DW4A 1IXRC 2OAZA 1YARO 4F52A 2XGDA 1TWCA 1EA3A 3L09A 4LG3A 1F1MA 3FHZA 3CCUI 4JJFA 3H0GJ 1LE2A 3CCMI 1B9NA 3IKVA 1O3QA 4JW1A 4Y15A 4PFPA 1ZARA 2LH9A 1X1DA 4C2UA 1OYYA 5F1RA 4DJAA 2V6EA 1U89A 5DCFA 2NYXA 1ZK8A 2IT0A 3K10A 3ZMDA 3EGXA 5JT4A 2YX7A 4UV8A 3DI5A 5F6FA 5HODA 3HNJA 1TFKB 3E0JB 4BGDA 4WF2A 4A0YA 3KP6A 3ONQA 1NU7D 5DCMA 1YRNA 4AYBN 1YYJA 3PDMP 4U5BE 4U5DE 3JRHA 4ZH4F 1PP7U 2JA7J 1ZKGA 1Y6IA 4PCQA 4FESA 3CJRB 3WGIA 4PSWA 2DGJA 5GPGB 3SZRA 2O8XA 4F91B 5GPCA 4L9JA 3WTYC 2R05A 4IRIA 2HQAA 3ZC4A 2DFFA 2A05A 2QSFX 5L3GA 4HA8A 2L6FA 3MFKA 2XGEA 3GTJJ 2A6HF 2LCHA 2Y3BA 3BY6A 3HOUJ 3FXHA 3O10A 3DKWA 3E5XA 3S3NA 1WQ2A 2JA2A 4XOPA 1XMKA 1ETYA 2OV7A 5COMA 2WAFA 3GLLA 5BS6A 2LMDA 1VQKI 5L0HA 1USSA 2WBMA 2E2JJ 1MNDA 1A0BA 4FX0A 4OIRF 2E34A 2IRFG 5CPRB 1UFBA 3S16J 1U0BB 3TP3A 1FNTc 3EUHC 1J2XA 4W8PA 2I5UA 2VPRA 1PDNC 1R6RA 4XKBA 4II3A 1U9NA 5HLHA 4UUSB 4BE0A 1QA6A 1LM3B 3EZIA 5T1DB 5IP6A 4Z2YA 4HV6A 3DBRB 3MVPA 2R7WA 4LLGF 1BW5A 3E3VA 4ASNA 2FX0A 2VONA 2GOXB 1IUYA 4BPMA 1XCBA 3FBNB 1TT5B 1IXSB 2EK5A 4W1UA 2AXLA 1YTYA 5B3SC 5GTHC 3N2ZB 4I1MA 4AE4B 4XRSG 3K4KA 4N4WA 2R25A 1B6AA 3GMEA 2HVRA 5HSWA 4B4CA 1U9OA 2KKOA 4I02A 3I59B 3LWFA 1H9TA 2CQXA 3HNKA 3LS0A 4A3EJ 2BW3A 4IPAA 4BJ6C 4IJJA 3GTOJ 1HMOA 3TL4X 3BG9A 2JPUA 3S0XA 4ONSA 1LS4A 4II2A 4JCZA 3VSLA 1XX5A 2X4HA 2XASA 3GLXA 4FQGA 2OQMA 3IQCA 4RGRA 3LAYA 5HS7A 4IB4A 2F2EA 1R71A 1Y56A 1CGNA 4IHXA 1FBUA 3SXYA 2EFQA 4PK4A 2JTVA 5K7HA 1RIOH 2O8KA 1FSHA 2D5RB 4AE4A 4XTKA 2WZLA 2E87A 2JUCA 5DD8A 2CFXA 1V4AA 4I6ZA 3LSTA 1EV7A 1IXCA 5CI9A 3RYPA 4YL0A 5D6FA 2E2IJ 1Z21A 2HOAA 3JSPA 4C7OA 1VQ8I 3RQEA 1FEXA 2M4KA 4RDUA 3LSKA 3TW7A 4AK9A 3FK6A 1ZLJA 3HRUA 3K2ZA 3E6DA 4KBLA 2QWWA 4NUBA 3FAJA 1V54H 2XIGA 4ABZA 1Q0GA 2H7BA 4BQAA 2R7VA 3I4UA 4B44A 4R32A 2CO5A 1R4NB 2YU9J 3B0PA 1VTMP 3IAS2 4MTDA 2ISZA 3CDHA 2K86A 4OIQF 4RBNA 3AG3C 3CJTB 1S9HA 1T9KA 4D5FA 5TGTA 1JPJA 3ZVRA 5FLXZ 1T0FA 4EEFG 3QW1A 2NUPA 3MCZA 1GV5A 1OKKA 2L4MA 2CS3A 1TKNA 3KX2A 1RI7A 4FTHA 4RB1A 1ORKA 1LPQA 2YQYA 1TZLA 3HPHA 3SEZA 2J9VA 4G8XA 2QF7A 4EHPA 3LS1A 2NS8A 3V7SA 4IOAF 2LIGA 2MWQA 3JTGA 4XLPF 2VKHA 1PUEE 3I64A 1FFHA 5FKOA 4G94A 1T38A 3Q9SA 1K04A 2ISYA 1S72I 1YW8A 1W2WA 2MW8A 1OYWA 2HMZA 3MWMA 3S1QJ 4KT6A 2OKUA 3DPUA 5LHIA 1AKHA 2NVXJ 5D8LB 1FTSA 5E1ZB 1IRZA 4J00A 5M3FJ 2M45A 3IQTA 4TV7A 2R5YB 4AL1A 4J7YA 1VFCA 1O57A 2BY0A 3MKZA 2G3KA 2YLIA 2LQGA 2ZFUA 2PMHA 3OYJA 2M0MA 3G4XA 3GZ6A 2OCCH 5JVTA 4IHVA 3AOUA 1GXQA 4RAFA 2GXBA 4FAPB 2EFNA 1TFOB 2J5PA 2WY8Q 3JRDA 1SVOA 1A6IA 1G2HA 2W84A 1SF8A 1QHHD 5J3LA 3NDBB 1W5TA 4FASD 5IP9J 3MN2A 3MMYB 2KPMA 1E3OC 2PJRB 1RJ9B 4LLCA 4RM3A 256BA 3OYIA 1HC8A 5IY5H 2X1EA 1YIJI 3CQZA 2VC1A 2VBYA 2DYRC 3WGGA 2MG4A 3ISPA 3LSGA 1XZPA 2F5CA 2NOGA 1T01A 2RKHA 2BV6A 2DMPA 1VK5A 1JRAA 2H8WA 1QZZA 4FX5A 2HV6A 3OIPA 3O6BB 3RI4A 1JE8A 2QUPA 3KYLA 3U1KA 5B5EC 3HPGA 3FMQA 3VOEA 3VF0A 3RYRA 1ZGJA 3OYBA 1TR2A 3ZTMA 1R58A 3M07A 3LFUA 5J1RA 2G9WA 2XRNA 4IVNA 2ECBA 1B8IA 3G1OA 1HKQA 4M3GA 4HRIA 3DU5A 5KYWA 2GWRA 3SEOA 3F6VA 1BN5A 5F04A 3S32A 2H6CA 3PSFA 2CW7A 3QU3A 3B6AA 2KHMA 5KAIC 3JYHA 3RJPA 2Y30A 3U9JA 1FAPB 2NXNB 1NG6A 1NHAA 2VJ4A 4GO1A 4PR9A 5L0JA 2ID6A 3PUFA 5F64A 3BZ6A 4IXAA 3IQ6A 3VFZA 5KYUA 1W0UA 5K7ZA 2BY2A 3JSEO 4DRIB 4MEYF 3CZ6A 2BYVE 2W4SA 3IWZA 2DO7A 1DDNA 2XRHA 3NYJA 5EEAA 4Y33A 4IHSA 3KE2A 2KMUA 2VJJA 1OCTC 3VWBA 2O9XA 5J6XA 3IRRA 4I01A 2XXAB 4LLLA 1SZIA 1O5HA 3LEVA 2XAFA 3GZNB 4D4XA 2H94A 3DKXA 3BCBA 4ZZDA 4KC9A 1R1VA 1EH8A 2Z3YA 3PIPF 2VBWA 3LMMA 3CMEI 3V5YA 2G7UA 5LFAA 4NQWB 2DTZA 2DFHA 4XEFA 4EJUA 4XIDA 1OCRC 4RAYA 4OWRB 2CV0A 1UAAA 4IRHA 2ZCWA 3UKGA 2CYYA 2JSPA 2ZC2A 3F21A 3ERED 2J0WA 4CS9A 1L0OC 4AUXA 5DUIA 5JVGF 4PJ0C 3JSOA 1UCRA 3VB2A 2J45A 2FAPB 3QPSA 3BLYA 1H88C 5TJ5E 1U8RA 1YX3A 2L9JA 3QP6A 4J01A 2MFZA 2M2EA 2KISA 1G4DA 4HE8D 5JP7A 5L0IA 2EPKX 4XLAA 2HTJA 2HOEA 2VT2A 4E7ZA 3DM5A 2JD3A 4O79A 5KYYB 5E3AA 1WJEA 3F8FA 2IPQX 2VL8A 4K0DA 2XUBA 1YOVB 5EHHA 2E19A 3TEDA 4UUSA 1Y39A 3WTSC 2VE9A 2MA3A 3TBIA 2NS0A 2GA2A 4F3QA 4BHBA 1TWAJ 5ICGA 3KCCA 4NTBA 1OLTA 3BR0A 3GO5A 3PFYA 3BR6A 1E3HA 4UUVA 5L3CA 2VCAA 3TULA 2L01A 4HDUA 4I0AA 4B48A 3AG4H 1K61A 2DA4A 3DPLC 4RAZA 2O9LA 3HTSB 4L0YB 1JR8A 2M34A 5EEGA 3CAXA 2DDAA 1R5HA 1YS6A 3A0HC 3KIOA 3FXLA 4A3DJ 2L7AA 2P5VA 1RUNA 1NU9C 1TQMA 3KFWX 2Z33A 2FEZA 2K9NA 2EV5A 2VASA 1ZRCA 2QLAA 1AHDP 4JZAA 1T08B 1T0FC 1V3FA 4LG0B 4BJ5C 3ZQFA 4ENMA 5CVJA 3IP4B 2H09A 2L9SA 3I59A 1W4MA 3M1EA 1UFMA 4D4NA 5A6BA 2QNLA 3C63A 1DQUA 2OU2A 3W6VA 3HG9A 3G1LA 4LK1F 4EBBA 2AP3A 2NUPB 4LDKA 4I44A 1LKXA 1W5CC 2VBXA 1LE4A 3JCUC 1JJ8C 1VQ7I 2LNBA 2HVQA 4OIPF 4Y4RA 1XC5A 3WTUC 2LG4A 4ZYGA 4UNOA 2AQEA 2YRFA 3IKTA 3HRTA 1D8JA 1V55H 3O8HA 1SANA 1K40A 1U0JA 3GTGJ 4EGZA 1OFCX 1MDMB 3OYCA 3O8GA 2CUEA 3SZGA 5E1XA 1ETWA 2CFOA 1SMYF 2KNHA 2EZHA 1I1GA 1O3TA 5EJCA 1ORJA 1IC8A 4DOZA 3PM1A 3EYYA 1J8YF 1LDDA 2XVCA 4DVZA 1W36D 2GDCA 1KU9A 2GXGA 1KYWA 2ZJQF 2YZSA 3SNHA 2FBIA 4EMSA 1G3SA 1N78A 2ZXPA 1LFUP 3JRCA 3PL8A 1RMVA 1PUFA 4XRSA 1PYVA 4L18B 1RPWA 5IT3A 2ZKZA 1Q0KA 1YZCA 1HW2A 1ORYA 3E9VA 2J7PA 2HXOA 2Y39A 1U6HA 4HG2A 4IHWA 1RKEB 1IRGA 1ZELA 2JPCA 3U2LA 1QZEA 5DQZA 2VC9A 2PQ8A 1HW5A 3DTIA 2J7PD 3K1MA 2A1DD 5JHFA 2M30A 1XD7A 4DJ9A 3CUQB 3BTIA 3JAMZ 2YEVA 4DYQA 4MVOA 3TD7A 2QY9A 4O6NA 3TOMA 1AA7A 1U3EM 2V1UA 4CS7A 3T0YA 4E7LA 4Q47A 4LERA 4DNCA 2Y9ZA 1ETKA 1YJWI 3EGXB 3PCVA 4YL1A 3RZOJ 2L6GA 1IW7F 2XLOA 2V9PA 2RN7A 4C3JJ 4JCHA 1BJZA 2F4OB 2V7FA 3FVYA 2X48A 2R5YA 5FGMA 2RNJA 2CW0F 5LHHA 3SZTA 4P9TA 3WHBA 2Q9CA 4U9EA 2O7OA 5FD6A 2B63J 4YFKF 4A3MJ 3ML6A 1Y8QB 2G7HA 4PJLA 4B1RA 3WAQA 3J80Z 5LEKA 2F6CA 3T6GB 5L3QA 2JVHA 2X51A 1TNTA 4LOCA 3S27A 1KGSA 4QIWN 1CPQA 2RQQA 2ZXWC 3OYMA 2WVNA 4ZZLA 4NY3A 1D0XA 2MC4A 1H89C 2LP4A 3TQNA 3NWTA 2PJRA 1FMWA 1RJ9A 3VM6A 2XF6A 5IT9K 4LJZF 4YRVA 4YT8A 3RYLA 1MH3A 1XB4A 3WODF 2ZMEC 2WTEA 1YA7O 2OBPA 1UG0A 2F22A 1MSFC 2H8AA 3B73A 3RQ4A 2R02A 5E3CA 3OS1A 1GVJA 1MMSA 3AG2C 3EYIA 2PX9A 4MO7A 2WC2A 2OCEA 5GADJ 4M9XA 1YAUO 2WVOA 2B9SA 4U5CE 2OJED 3B6CA 5E1WA 2AU5A 3GODA 4U0WA 2L0KA 1I6XA 3DEEA 3G1MA 4BH9A 4NHJA 4BEHB 2IEKA 4XOTA 2H27A 1AU7A 4JEAA 1LE8B 1P7IA 2BHYA 1QPIA 4KMUX 2BY1A 2LKPA 5HDNA 4BBSJ 1MQVA 1OISA 1QVXA 5HDKA 2K9SA 1NG7A 4C3DA 1SFEA 4JK1X 5H2FC 3B0VC 5J8FA 3TDUC 1SEUA 2ELKA 3EGDB 1ETOA 5TJJA 4HQMA 2HYFA 1MBKA 2F4IA 3L8IA 2BXYA 2NVUB 2XL8A 5FKLA 2OEVA 2RAEA 1GT0C 1SD4A 5E20A 1LS1A 2DMUA 5AIPA 3VAYA 4DW6A 3EUAA 4HX8A 3J81Z 1RUOA 1DPUA 3NAUA 1V74B 1BOBA 3I53A 5F28E 2F48A 2L3DA 3TW6A 2W57A 1FP2A 4G6DA 4M71A 2NUTB 5FZTA 2F5FA 3BTJA 5FKMA 2OPTA 4IHTA 1ORSC 1UHWA 2HPMA 2FQ4A 4CDAA 2JK3A 2MLKA 3ZMZA 4U0YA 4CCJA 5L3BA 3VYUB 5K5QA 2XAHA 3CLQA 3HOXJ 3OL3A 4XK4A 3BR5A 1M1EB 3DWLE 4DYRA 4LB6B 1WASA 5GTIC 4Y52J 1HKSA 1Q1HA 2DFIA 4B47A 3C1DA 2DPUA 5A6KA 3FMSA 3PNTA 3A1YA 1RXQA 1S7ZA 3FIWA 3ZQVA 1RR7A 4ZLDA 3IC7A 4CYDA 2Z2SB 1A35A 1IO2A 1IG7A 1ZN2A 4IARA 2KSFA 5IOZA 3V4GA 1JT0A 1ZHYA 2IBDA 3LL7A 2CWEA 1ZRDA 3CF5F 2PP4A 4X1EA 1AUEA 2BC5A 2LSOA 3BPXA 4UVBA 2Q3TA 5KYYA 3HXLA 3U21A 3RF3A 3G2BA 5E17F 2Y3HA 1BM9A 4YELA 4A12A 3E1SA 4RGSA 5D6EA 2KJGA 3K7AJ 2MBFA 2R7FA 4RA2A 5KK1A 1JTXA 1RKTA 3JTHA 3M1CA 4EWCA 3MFNA 4BY1J 1OQYA 4HOBA 5M5XJ 4S05A 1SC7A 4ETSA 2CCYA 3LNQA 1U8BA 3U1DA 1RZ4A 2D2WA 5JLWA 3GVAA 1H9GA 1C17M 1TWHA 2HUJA 2DK8A 1EH6A 1I3QJ 2XAUA 3HBLA 3ZCOA 2E1OA 4AYBA 2HSBA 2EILH 1ZG3A 5A2QK 4HYEA 4GEHA 2HXIA 1ZHFA 4ZYAA 4ZYHA 2X1CA 4YIIA 1XWJA 2CH0A 2GIZA 2NSGA 4A3BJ 3T6JA 2K3FA 2NAZA 3DPTA 2P6TA 2FOKA 1EKEA 4LG0A 3G73A 3COAC 4M74A 2J8WA 3EFOB 1LJ9A 4JURI 3DXJF 4G6TB 4E17A 2D1VA 4CUGA 4EATA 3QQAA 4C9YA 2A69F 4LLNA 1R9TJ 4QPOA 3PMRA 1V54C 3CMYA 2Y2ZA 4KFCA 1YE9A 5KYNA 4JX5A 4CDYA 1YVIA 1W1WE 1Z91A 2YPRA 5E8IA 2HZDA 2QM3A 1BR4A 1P2FA 2RGVA 3L9FA 3TOBA 1GHCA 3AQBA 3S9OA 5M5WJ 1HE1A 1Z5ZA 1P4WA 3ELKA 1KTMA 2WB7A 2R7UA 5L3EA 1YJGA 4FCYA 2FA5A 3I5UA 4A3CJ 3GM3A 4KYWA 4OINF 4MTEA 5FO5A 4JBAA 3GWZA 1QBJA 5H20A 3BR1A 1CPRA 3F0CA 2EFOA 4XONA 3F22A 1YW7A 4ZTFA 3OA1A 3Q0UA 1ZHXA 4HF0A 1MDMA 3R2PA 4IAOA 3CD6I 2Y3DA 2XKPA 2W25A 3BOQA 3OYGA 4XPWA 3G6EI 2ZD9A 1FBSA 1SAUA 5E79C 1M57C 1F43A 1SD7A 2ZXIA 3GW2A 3K70D 4NC6A 4NC7A 2OG2A 3P9IA 5T3TA 5FLVA 4JIOA 2NPUA 1GUUA 4D0PA 3K4JA 2HMQA 4GYTA 2P5LC 1JXSA 3KLOA 2VPLA 3L34A 5DVWA 2JPBA 3M4OJ 4PFOA 3W8HA 2VJ5A 4CSAC 2L9NA 1WOLA 4PACA 1XDUA 3L0IA 3E7LA 5HNFA 1ZW3A 1ST6A 2OCCC 3L1MA 4KIBA 3MZHA 4YG2F 3IRQA 1RKEA 2GA0A 3KP5A 5L0GA 5E8GA 3OSGA 1XSDA 4KNYA 2E1CA 2LFBA 3ABUA 3VEPA 3GFMA 1LQ1A 4M6XA 1Z05A 3CUQA 2ZNZA 3QPTA 2GFHA 1XPXA 2E7WA 1YYXA 3UGPA 4YJWA 1DP3A 2WA0A 2IGOA 2XB0X 5IY5C 1NTCA 4X0GA 2M9HA 2QVOA 2K02A 4U7BA 3DKAA 1L3LA 1G3WA 3C2BA 1BC8C 1Y4CA 2EIMH 3RDIA 1RNLA 2A5WA 2XAQA 4JRZA 1HSTA 2LTPA 3U2MA 1OKRA 1TWCJ 2W45A 2XLVA 4DBRA 1RETA 1RR8C 1HF0A 1ZAOA 3P7NA 4A6DA 4YIFA 3NKDA 5F0HA 1QKRA 5F27A 4Z6YA 5E18F 1ZHWA 1VNDA 2KRFA 1HOMA 3TJ5A 3X1OA 4D7NA 2HR3A 3TDZC 2ZXJA 2MYSA 3Q3SA 4M3DA 5CQEA 1K79A 1SYQA 2A5YB 3CP8A 4IHYA 4PJJA 4C3HJ 1P92A 4HV5A 4QSHA 1VLTA 3EH2A 3OYHA 4JEBA 3CC2I 1Z7UA 3AGUA 3OEOA 4M9ZA 5D5WB 2JQ7A 5KYXA 2KIQA 4MLOA 1Z7Qc 3HSRA 1X3ZB 3ABLC 3FHDA 5AC4A 3R0AA 3TO7A 4MTOA 3GANA 4MQ9F 2WADA 2O6GE 1OW6A 1I4YA 2VH3A 1F4KA 2IA0A 5FFZA 3JR9A 2FF4A 5AGFA 2XPVA 3NRVA 3OV8A 1Z1DA 2O5RA 1X3UA 2VQCA 3AQCA 2PX0A 5BQIA 4IQJA 3BG5A 2CMPA 4BEHA 4XRMA 1YLFA 2ZBKA 1LE8A 1E86A 2G3VA 3RCOA 2JA5J 3TJ6A 5GAGJ 1X58A 5J8CA 3U9MA 3GFIA 2EV6A 2ELHA 2HJMA 3L8JA 2GM4A 2RNGA 2E7XA 4CYCB 4RMNA 3N0TA 1ON2A 4M3EA 3ZRGA 2LK2A 1FLIA 1ZR2A 5COGA 3EGDA 2P81A 3QPHA 2W4MA 2LDUA 2YL1A 3PIOF 1Z7LA 1F5TA 5LRSA 2YL7A 2WAQA 5DS5A 1MMNA 1WH5A 3V8JA 4CCNA 2DA6A 5F08A 1IDYA 3F23A 4FE4A 4ZLCA 3DJUB 2AS5F 2BEOA 1MMGA 2NUTA 1JKOC 4E18A 1OW8A 2HJ3A 4DZJA 4RLQA 3DE8A 4KIFA 3TOAA 3V7OA 2J9BA 2QKMB 3BTCA 4E0HA 4KITB 5LD2C 2EIKH 2BY3A 1J7KA 2R0QC 3ROUA 2B7EA 1HQCA 2JT1A 3HRMA 3HUGA 1A36A 3LEOA 4H54A 2BHZA 4GDFA 1UG7A 3BQZA 2OTJI 1E0EA 2YX4A 1ZU4A 1QGPA 5EGYA 3LFKA 3TO6A 1A6QA 2L7FP 4R79A 2OC6A 4NC3A 4ZYEA 4RD9A 2YUSA 4XEKA 1J5YA 1MNEA 5BMZA 2HOSA 4U5GA 3LA3A 3AL0C 3ZMTA 5J47A 3AG4C 2HNHA 5B1BH 1TWGA 1IN7A 3V5ZA 2MABA 2X6XA 3K4NA 3M4BA 5D4SA 1PUFB 1FTZA 3K33A 4AC0A 3NQOA 5IYCJ 3PSIA 3CCVI 3NMJA 3WTVC 3T5XA 1LFPA 2PEXA 3NYMA 2BL2A 1BIAA 3OYLA 4LGWA 3BRJA 1WRJA 1FBQA 4EJTA 1VQ4I 4ULVA 3GCMA 3HJEA 2GQQA 4EM0B 2XAJA 4JP0A 4JX4A 3NMKA 2Q0OA 5DS9A 2XGCA 3BR3A 2KT0A 3LSMA 2M4EA 3N24A 2XF5A 2BXZA 3UR3C 1XS9A 2CUZA 2DAOA 4W97A 2JA6J 3S28A 3K4BA 3GTQJ 2E5NA 3W2AA 1LUJB 1S5LC 4M6YA 4PGHA 4C3IJ 3E5QA 3HOVJ 5JVEA 2Q8KA 4BAYA 3G4ZA 1SFOJ 4F93B 5FB2A 2BE5F 3ECSA 3VYRB 2ZSHB 1VQLI 2IS4A 1V55C 1RKWA 4V2GA 5F0FA 3LA7A 4B3XA 3EFOA 4UV9A 3OYAA 5E2QA 4L9NA 3SZPA 3SHFA 4G7HF 2HSQA 2IXNA 1MBGA 1G8XA 3DFGA 1YYVA 3C7JA 1B1BA 5E3NA 2KIUA 3TKYA 4EV0A 2FFHA 5IYBJ 2IAIA 3EHMA 4AD9A 2MGQA 3JW4A 1JJ6C 4B3AA 2WV0A 2VUMJ 4WXCA 1YZAA 3HM5A 4W8KA 1J09A 1I27A 1T6SA 2HYGD 2R7OA 5A6JA 2CU7A 2DQRA 4N9HA 2X6YA 5FFXA 1POGA 1PJRA 3O3KA 2GA1A 4OMZA 2XL4A 4I09A 1HDDC 2M87A 2QGUA 5K0IA 2OD5A 2Q7RA 5JHUA 4K2EA 4XKCA 1SMTA 4EJWA 5K5OA 2Z9OA 2R7RA 1Z3IX 5GP9A 1E83A 4WXDA 1T6QA 1X4PA 2DT5A 2M1BA 1CF7B 2QQAA 5DS4A 4HSTA 1OW7A 2ESHA 4M73A 3FF5A 5E33A 3MX3A 2MH9A 3VODA 3CCJI 5JS5A 4YT2A 1DP7P 1BOAA 3GXOA 4I2OA 4IGGA 1RCPA 5HLGA 1XMAA 4CJGA 3SP1A 4G7OF 2HKVA 2QBYB 2Z99A 3FISA 2H8RA 3EHNA 2ZJRF 3ABLH 3LQQA 2E1MC 1MNMC 3ECOA 1JUPA 2XRLA 3M9AA 3L2QA 2OJQA 5L0DA 2DB4A 3W6KB 4EQQA 5CLSA 2IS6A 3NARA 1JKQC 2EZIA 2PBEA 4B43A 5JI6A 2QQBA 1TP4A 1FX7A 1CQTA 1IUFA 2XB5A 4WCGA 1WJDA 2Z15A 2W00A 1HSJA 5BOXA 2GLOA 2L7ZA 2WB1N 5CVVA 3QW0A 3H9QA 3CTAA 3H5RA 1MJBA 2V9VA 1YIOA 3F6OA 4XSZF 3ZOBA 1BJAA 2MD5A 3CCRI 1L3PA 4O6MA 3ERMA 2VODA 5TRDA 3RTRA 4E7HA 2A0BA 4DVYP 1USTA 1KU7A 2IS1A 2KW3C 2I8BA 3DAFA 2QQ8A 2Q1ZB 2Y0MA 5IOYA 2CDQA 2ZO4A 2BOLA 4KUMA 2O3FA 2DDBA 1B72B 3MD2A 2V4JC 2VQLA 2CNWD 4HFFB 4HX4A 2V6CA 1B68A 2IS2A 2RQPA 2JA8J 2MHRA 2GBYA 3QODA 2KK1A 3AJMA 2L9VA 4ZJZA 3K0LA 2XL6A 3K6BA 4YFXF 5C44J 2P5KA 3H92A 3S93A 3HZJA 1QPUA 4MTFA 1EA8A 4A2NB 2DU9A 4N06A 4A4AA 4ZDOA 2NG1A 3SEQA 4MGRA 5F5FA 1T5OA 2EH3A 3CSKA 2AWCA 2A0UA 2VXDA 2R3SA 4GGGA 4NBQA 2WV1A 4UHTA 2JX0A 3HNIA 3T8RA 3K4MA 4CH7A 4P96A 3ZQIA 2N8GA 2KLOA 4KIGA 4JC7A 5FRNA 1P4AA 2FMYA 2ASRA 4PZJA 4XBFA 2XM4A 4CIHA 1K6OA 2ID3A 1G4US 4JTAB 1TWAA 1XSXA 2KP6A 5DD4A 4GFBA 4RB3C 2HKXA 1W7PD 5IYDJ 5D92A 4I0BA 4FWVA 1P9QC 4IRGA 5D5XB 2KQRA 1ZTRA 3C2HA 3JRGA 4EM1A 1TQIA 3L00A 2KGOA 2M7AA 3I58A 2Y69C 5DQTA 3GWLA 2DA2A 1H8AC 4GCVA 2LKSA 3B02A 3I55I 2J46A 2XF7A 3CMMA 1S8NA 3KP3A 1SVMA 3IH3A 5FROA 1Z6TA 2COBA 2EA4A 2YLDA 3UMHA 1TQGA 5BUOA 5KAFC 2CUJA 2KZVA 4I98B 4CYCA 2CYDA 3Q6NA 2CGEA 2E2HJ 5LEJA 2YVKA 2K40A 1OCPA 2EJRA 4IQ4A 5BNGA 1Y1VJ 3RKYA 2HVSA 4OIOF 2HV7A 2PFBA 4CICA 4N6CA 3L2RA 2IGNA 2GAQA 3WG7C 2HS5A 4UXNA 4KNWA 4IEJA 3GTPJ 2K4JA 3OWTA 2DJNA 2ZJ2A 1VLSA 2QKLB 5D5UB 4HLYA 1TL8A 5IT9Z 1A7VA 1K4TA 2KJCA 3BJOA 2DODA 5FJ8J 4BHPA 1T98A 5AIQA 2M7BA 1WJ5A 3IH2A 1R5GA 2M64A 2CQNA 3W4YA 3O55A 3OYDA 1YI2I 2EIJH 1R23A 3RPQA 5BPDA 4NQFA 1R5ID 1LB2A 1T8IA 1KQ8A 1QZYA 2P7VB 2QYOA 3GFJA 4C2MJ 3S1MJ 4PJNA 1R1TA 1D3YA 2LR8A 4GRIA 1Z6AA 1B4AA 2PJPA 3LLIA 3FXKA 2BBYA 3OS0A 2J5OA 3GEHA 2Z5UA 3S14J 2CQQA 2EFWA 3OL4A 5CYVA 2FOWA 3FAPB 3D5SC 3O6XA 2ZXRA 1KZHA 2K27A 3H5AA 2EILC 4JTDB 1Y0NA 1KU2A 3HKKA 2LK4A 2Q4FA 2HWVA 1V4RA 3HOTA 1M2VB 2IYLD 2Y75A 4B8XA 3ZTZA 4I7HA 3R60A 1L7CA 4A0ZA 1LIHA 2Q9AA 1FC3A 1ZZPA 3H3VK 1DUXC 2H7OA 3CCYA 4PDKA 2JWTA 4AIDA 4E7KA 2FJ1A 2ZSIB 1QZXA 4GQHA 3U5SA 2AQFA 3EPZA 2ETSA 3HIFA 4LDQA 4CIPA 4DBQA 2VKEA 4BQNA 4GYIA 3T8TA 1LVKA 2XHKA 1FOKA 4XLHA 4OU0A 4N0BA 5JR3A 2EZKA 3I4MJ 3GEEA 4F92B 1E85A 3FXOA 4R8HA 3LSPA 1WGWA 1FR0A 4HNTA 1FP1D 3EPVA 5B66C 2IGMA 1YO5C 1XGMA 3S3MA 4HF2A 2D45A 2XM0A 1K6YA 3CCEI 5JLIA 1VZ0A 1FSEA 3GEIA 1WZ2A 2L6HA 1JHFA 4MVUA 1QHGA 2L54A 2X6WA 4ON0A 1ZGAA 3TGNA 1AOYA 4P9FA 2PF4E 1Z77A 3F3XA 5KVRA 1YS7A 1UMQA 2K9QA 3FXQA 1VQ9I 2E1NA 2R93J 3S1NJ 1JPNA 3OS2A 2LFFA 4J7TA 4CXFA 2ESNA 5JSLA 4HF1A 4NB5A 1J0RA 1QLEC 1BC7C 3QOPA 1YLMA 4EBJA 3POVA 2DK5A 1BI0A 2R7XA 2LBFB 4ZDLA 3JREA 1HCRA 1LEBA 5KYXB 2E71A 3Q7GA 2Z16A 4IRUA 2R92J 1MMAA 3BPVA 4EJVA 4U87A 1NBBA 5BQHA 2K85A 2ZNYA 4J32B 1N25A 2AWYA 3JRAA 1T56A 1ODDA 4XLFA 1WHUA 1TW3A 1BL0A 1T95A 2LREA 2I10A 3QYBA 5L0FA 5BPIA 3US6A 4HNUA 4CS9C 3F8CA 2H7VC 1XGNA 5GPAA 3TQOA 1ZU5A 3SJMA 1AVOB 1U5TB 4XR6A 1CF7A 1GV2A 1I5ZA 2EBIA 5A2QZ 2XS1A 3KP7A 4O7GA 2AO9A 5AONA 2X6OA 3VYTB 4WX9A 2DYSC 3HYIA 3CESA 3SXMA 3F8BA 1UELB 1O7LA 3LQRA 2XLDA 4A3LJ 4QDLA 1OYIA 4DGWB 2WL8A 4JE9A 3ZWIA 4HDVA 3BCAA 1ONVA 2KFDA 2OQGA 2QBYA 2QQ9A 2EIMC 1FOYA 3X2QH 3CEXA 5HVQC 1TLHB 1WH7A 2OZUA 5T3WA 4XQ1A 4RDAA 5FKKA 1M6TA 3GM1A 1OCOH 3M8EA 3OSFA 3V5XA 1BBHA 4L5IA 1IN4A 2DQLA 3FBIB 4Y3OA 3ZN1A 3DD7A 3HGYA 4A3KJ 2JJ7A 2W7NA 2GWWA 2LKXA 1S7OA 3F46A 4BXFA 2Y69H 1OJLA 4JTCB 4XPXA 2LYCA 4D1QA 2K3PA 4P9UA 3NG1A 4XQFA 5L3VA 1VB5A 3S2HJ 4CDVA 2W48A 2KDOA 3ASNH 1TTYA 4ENKA 4G9YA 1RRJA 2MC3A 4M72A 3HUGB 1XTAA 3ZN0A 3IL2A 4BS9A 2DBBA 4G7ZF 2QUFA 4RGUA 2X1DA 4P6IC 1LFBA 5AC5A 5ILSA 1I3AA 1ZHZA 4WJ0A 3GORA 3WG7H 1KNYA 4ESFA 1WFXA 2LF8A 1J59A 1B72A 4ULWA 2IXMA 2LP0A 1SR2A 2M3AA 4OAZA 4CS8A 1X2MA 1S6LA 1B59A 3JAMK 4RM2A 5DLJA 1CGPA 1OR3A 1V5EA 3L2UA 2LLKA 1XSVA 4YIRX 1K05A 1TW2A 1OMIA 2VCCA 3EUHA 2LC2A 3EUKL 4BYYA 2O03A 1APCA 3IHUA 2PFDA 5JLXA 4XICA 1GLNA 1WKMA 4IF4A 3SFZA 2UXNA 1MJAA 1ITYA 3I71A 1DOVA 1I5NA 4D7MA 2O61A 2EPLX 2PMZN 2M0CA 3SFIA 2JRTA 2DMQA 4JKVA 3FDQA 4QWQA 4CA0A 4U88A 2V1NA 3QWLA 3RVZA 3F8MA 3C8GA 1BI3A 4BL0B 2IBFA 3A2KA 3FXUA 4L9TA 3LNMB 3J80K 2FBHA 4CDGA 2VCBA 1YFHA 3F8NA 1W36C 4HPQA 3E6MA 5FKNA 1FT9A 2ELJA 2VKVA 1Y1WJ 4AX2A 3DP7A 2WZFA 3C8GD 3KP2A 5LHGA 5TISC 2QEXI 1JAFA 3S29A 2A61A 4LB5A 2CSOA 4P5OA 3WU0A 2C04A 2GIVA 2KL4A 2P1AA 2ZPAA 3H3ZA 4NC8A 1WATA 5J4YA 5E3MA 3DCFA 4BJ6A 3IAM2 4MNDA 2EIKC 2LY1A 4DIQA 3F9KA 2HFHA 3ZQCA 3K66A 1QVUA 4ZYDA 2B0HA 4N4NB 5LRRA 3V7RA 1FYMA 1PVEA 2LVSA 2V26A 2Y48A 3C18A 2Q00A 1VQ6I 3CCLI 3PO2J 2NRAC 1SVLA 2X0LA 3ESWB 1TWHJ 1WI9A 3WTZA 2L81A 4IWBA 3RVYA 3MYIA 4N9IA 3F47A 4MEXF 2ETHA 1IZ1A 2M8GX 1LDKB 2Y0SN 2VOOA 1RKCA 3KYDB 3NMIA 3TP0A 1OXBA 3LSIA 3WE2A 2VBZA 2RC4A 2V1XA 2W82A 4NNJA 2LFDA 1IGNA 4Z9IA 5B1BC 2OA4A 3G71I 4UVAA 3HSFA 2R7SA 2B0LA 1YDIA 2EPOA 2YKZA 3AG1H 2ECCA 3CCSI 1HBXG 4RS8A 2E5ZA 3QYEA 4YL3A 2EPFA 3GFLA 3U2RA 2D1HA 3EG9B 4UDVA 2I15A 3JZ0A 1MZBA 2EINC 4UVCA 3N4MA 1VF9A 1HW1A 5H6QA 2P6VA 3UGOA 2IJLA 3U8PA 1J75A 2P7VA 4Y7NJ 2VXZA 5A69A 1QVTA 1JGGA 2BGCA 3P5JA 3M7GA 5ILVA 5FCLA 3ATPA 3ASOH 4HBLA 1G3YA 3VYSB 1BR1A 4F7ZA 4D9JA 4I1OB 4JJGA 1UZCA 3BP8A 4FT8A 1FIAA 3FZVA 2QSHX 3DKYA 1DGRM 4YWQA 3S84A 1MBEA 3HSEA 4E70A 4BE2A 2BZTA 3I4NJ 2K7LA 1GS9A 3QTHA 1QNTA 4XRFA 1M2VA 5HLTA 3PQKA 4E0IA 1MMDA 1UHSA 3TMOA 3CDLA 4V2FA 3Q5FA 2V79A 1FZPB 3PHF2 1C02A 3CP2A 1FFTC 4M3BA 4A3GJ 3PJRA 2Y9YA 5EK0A 2MSYA 4RBOA 2L9RA 3M1CB 2NNNA 2KZGA 3KZYA 4ESJA 2XPWA 1LDJA 3KEOA 2DYSH 3Q0WA 3W2VA 2H6BA 3HTKC 2WY7Q 3DAGA 3HGGA 4LFUA 5GAEJ 4K7BA 4MVMA 1CGME 3RQGA 4Q4ZF 3HOYJ 2VQHA 2GZWA 3LOCA 3K6GA 4XNFA 3SDBA 1Z23A 4JVSA 4MW3A 2DA5A 3ITFA 1LNWA 4MFEA 3E70C 4WGYA 5D91A 1F36A 4L5JA 2KQ9A 2CQ7A 3SDGA 4BXUA 3H9JA 3GEZA 3LAJA 2M4GA 2W4BA 2X85A 4M3FA 5J1UA 1BA5A 2LD5A 1G5ZA 1G3TA 3FXJA 2ZMEB 4Q5SF 3OR2C 2M8EA 1S3JA 4B09A 1K83J 2KIMA 3PUBA 3S1RJ 4BNCA 2X0CA 4XN0A 3ZQHA 3G50A 5CQGA 2L7KA 3KYJA 2LBFA 5CVUA 1DGWY 1D0ZA 4O3MA 5DEQA 2XROA 1YJNI 1R36A 2UV1A 5H6RA 1FJLA 2Q9BA 4YT4A 3OMYA 4X6AJ 3IH4A 4D5CA 4XLNF 2HQRA 1GXPA 2CG4A 2W1OA 1W7PB 1R49A 2VQGA 5M5YJ 5C3EJ 3HKZN 5DM6F 2WWYA 1VQOI 2XSJC 4J30B 2BVMA 2MLGA 4XWJA 3K1HA 2K5CA 3ZR8X 3N97A 5CIVA 1ON1A 4F4BA 3DV8A 3K9TA 3ZQ7A 1XDSA 3N05A 4LD5A 1U5TA 3I0TA 4YEJA 1VTNC 4CS8C 4BDYA 4EUKB 2HOTA 5HDGA 1R1UA 2XV4S 2L02A 2IM8A 1MD0A 2DOEA 3VDXA 5B1AH 3DZAA 1LEAA 3D0SA 3WE3A 6PAXA 1STZA 1D5VA 2DT7B 1C03A 1H6GA 4EBKA 2J9WA 2NSFA 3U9GA 2HDCA 5F1JA 3R0JA 3KPHA 3C3WA 1MW7A 3BTLA 3L7WA 4XN3A 3H2UA 1XMXA 4FX4A 1FOWA 4B6IA 1J9IA 3HC7A 2HU9A 1UB9A 2HZTA 1NLXA 4U5FE 4BE1A 4E6KG 1VQNI 3K69A 3BROA 3PQJA 4A5MA 1VOMA 4PSXA 3RKOF 2A68F 3HOSA 3ZSUA 2IA2A 2HDWA 1WI3A 3M3YJ 2CUFA 1N75A 4WK8F 3L2VA 2ZJPF 1WTYA 2CQKA 3SXZA 2L5QA 1IF1A 4XPYA 1XGSA 2JMWA 2GAUA 3BG6A 1K4SA 2H1KA 4MHGA 1O3RA 4O6JA 4CZCA 5EG0B 2A6EF 2V3CC 2ACJA 3LJBA 1E17A 1D1BA 3R6SA 1D1AA 1JMWA 1C0WA 4HEAJ 4UB8C 4HSRA 2R7TA 1ZH5A 4BUPA 2IVMA 1XG1A 5COFA 4BQQA 5CI8A 4QTRA 3A9CA 4NTAA 4XORA 3ZQGA 3QP5A 2AVKA 1XGOA 4LIUA 1ZVZA 4E7JA 2TMVP 1X1PA 1KA8A 2YS9A 1JOGA 3KEQA 3K1IA 4IO9F 1TWFJ 2ZXHA 2DPDA 2OZ6A 1WCMJ 1SD6A 4OMYA 1Y0UA 1I4ZA 1HXDA 1ZG1A 4LLEA 4O6YA 2IGKA 3FM5A 2EINH 4ZTJA 3NYLA 2XKOA 2PX3A 4QI0A 5HV9A 2E60A 1Y8RB 3EZHA 2IW5A 3QYFA 3K70C 2O0YA 2R4GA 4PGGA 3HRSA 1TWGJ 2WB1A 4EGYA 3I4PA 3LSHA 3OIQA 4UUTA 4NCQA 1F1ZA 4RB0A 1W5SA 3GX4X 1VMAA 2CRGA 3DBLB 3GUDA 4ZC3A 1FPQA 3LAPA 3CCQI 1NK2P 4MS2A 4U5HA 3GYHX 2YLGA 3RZDJ 2W85A 1EH7A 3DQVC 4BHCA 5EDNA 4BJ5A 2CV2A 2Q2EB 4E7SA 2EIJC 4BKXA 3FM3A 1XCVA 2LY9A 3OY9A 4CCKA 2NVYJ 2VE8A 4CCOA 3ZP5A 1VYIA 2M5WA 4L0ZB 1OKKD 1OR7A 2RREA 3DF8A 1QO0D 4LMYA 2IA1A 2EPNA 1HA8A 4HEA2 1JUMA 3WTTC 1H0MA 3D5LA 1HDPA 1JT6A 4GYGA 4M9SA 4NDLA 3RH3A 3T9OA 1OCCH 3V8KA 2ME6A 4BU2A 1Q0DA 3KMIA 2CJJA 4JX6A 3L2WA 1WJCA 3H0DA 4BEMJ 3CUQC 3DLAA 4BDZA 5KHDA 3JYYA 1J8MF 3ZIBA 5LBQA 4XLEA 3H2VA 3ULQB 2DMTA 4KJZA 3D1NI 2XLWA 1GVDA 3RIRA 2OU6A 1ZHTA 3B29A 3VYWA 1Z3XA 3IEEA 5ICFA 2XGXA 2EWNA 3EG9A 2PN6A 2NNYA 3CMAI 3VRCA 1D8KA 2YSRA 3DTKA 5J4VA 1A5JA 4YFNF 2F5EA 4CGZA 3KL4A 3S8PA 1O3SA 3ECHA 1Z3YA 3P9CA 1HMDA 3M79A 2FE3A 1FWZA 3GZ5A 4XLCA 1GM5A 2XAGA 2WAQN 1ZG5A 1K78B 3A03A 4XKWA 3CQZJ 2XSEA 2FGYA 3HL2A 1EF4A 1YX5A 1X4OA 2UZKA 3DJNB 4PJMA 3U8VA 3ZQYA 4C2TA 4YN0B 1VQPI 1YITI 2LOOA 1IN8A 1AEPA 3IQ5A 2MD0A 3FDYA 1PV3A 1NG1A 2RSEB 5FD5A 2XPUA 3W3CA 3LLKA 1KU3A 4WWCA 5FLMJ 3A01B 3M4CA 3P9KA 1Y6DA 1BI2A 4R1HA 1I1SA 5HS9A 1FYKA 2DI3A 5HLIA 2PBIA 5EZGA 5C4XJ 1ERDA 2IXOA 9ANTA 2XS8A 4MVSA 2DXIA 4F55A 1GDTA 2WAEA 1R00A 1S29A 4A5NA 3E5UA 4MW8A 2EZLA 1LI5A 3OYKA 3WG9A 1G4WR 2E36A 4G12A 2R7ZJ 2V9KA 2NS7A 4ENJA 4CJOA 3O39A 4A3IJ 5HS8A 1ULYA 5JUAA 5LGNA 3K4CA 5J1YA 3H35A 4FE7A 1Z63A 5EF6A 1U5TC 1IV6A 2EFPA 2DA1A 5L3DA 2ADUA 3KLNA 1IN5A 4DZPA 2OQRA 1FTTA 3BZKA 3WHCA 1NH3A 2VOPA 3SQNA 4XSXF 3AKZA 2KRCA 5LLQA 1M2OA 1ZLKA 3HOZJ 3Q6MA 3JRTA 1T6UA 1YW9A 1PP8F 3M8FA 5FLXK 3OOUA 4U9DA 1UHMA 1NZEA 2VB6A 3JSZA 1YG2A 5IPAA 2HDDA 2CNWA 4IAQA 1FYLA 5D8KB 2HKOA 1O87A 3FMRA 3CC7I 3FK7A 3M8JA 3SYTA 3EH1A 5F5HA 1FNNA 3HJCA 3C62A 4C3EA 1X3WB 3HTUA 2DCEA 2TRTA 4KN4X 2UXXA 5LGUA 3U3BA 3S90A 1SAXA 1GQAA 1HE9A 1Q0MA 2HQNA 2YL3A 5B3SH 1O3UA 4CCMA 2AHQA 2ZMEA 3S17J 2COMA 4MVQA 1E2XA 2FRHA 1T2KA 3QAHA 2C6YA 1T6IA 3SXKA 3H9GA 3S2DJ 3KEYA 2R7DA 2VLAA 2FU4A 3OYFA 3BC8A 3EETA 4M6VA 3WTWC 1KYZA 3OOPA 1OCZC 3RIPA 3X2QC 5KNLA 5LGTA 3QRFF 1ZREA 2Y3GA 3ZXSA 2PMUA 3J06A 4I3MA 4MVRA 3K7DA 3FKIJ 1AWCA 1Z67A 1WPKA 3A4CA 1R7JA 4BJ1A 2XC7A 3JRIA 3L1PA 3IUOA 3C8GB 4MFDA 1W7PA 2UUIA 1OCOC 1VI0A 2HGCA 1D1CA 4P1WA 4KNVA 1KONA 1QPMA 3I54A 4IZZA 1P7JA 3LUTB 1ETVA 2R5ZB 3BG3A 1MGTA 5D5VB 1SFUA 3H1CA 4BXXJ 4CO8A 2DTRA 2VKDA 1M56C 4AM3A 3OIOA 4U0VA 3K1IC 4IKFA 3ZMVA 1VQMI 2P8TA 4LACB 3KH2A 3ASNC 1S7EA 1A7EA 3TK0A 3UNGC 2FBKA 1K7AA 2D4UA 3FOPA 4OOIA 2STTA 2L4AA 3RKQA 2LSEA 4DQ2A 1BI1A 1B9MA 1X19A 2DJIA 5KCMA 4KISA 4HNVA 1T39A 1V5FA 5EGOB 3K1PA 5J40A 5DS6A 1VYKA 4EJOA 3GM2A 2VIXA 3QVZA 3RKWA 2C03A 1MSEC 4KDPA 2ICWG 2UUHA 4P55A 1WVRA 3AG3H 3GF2A 4BBRJ 2RVCA 2KDZA 1ZQ3P 2G62A 2R03A 4U5EE 2YL0A 1E84A 4IX7A 3A11A 5HOOA 1YHQI 4KMFA 5EZHA 3I56I 1MIJA 1A41A 3KYCB 5K7FA 3JRBA 5EG0A 1WWXA 1SFXA 4A6EA 1QQIA 2P6SA 4JYKA 1F9NA 3F72A 3FKJA 3I3LA 1U78A 3JCUQ 3GBGA 3MYFA 2ZFWA 4CBEA 3RFYA 1P4XA 5ICCA 1ZYRF 1OR2A 3AL0B 5A6BD 1ETXA 1OR7C 4OD4A 3A02A 1D5YA 1ZRFA 3RPUA 3ABKC 2WVQA 5JRAA 4EM2A 5FRMA 1JTYA 3K2AA 5E3OA 2RD9A 2YHSA 4KICA 1T33A 2LRDA 4FISA 3MKWB 3ABMC 3KKBA 4G0HA 3NWSA 3WGHA 4J19A 4AIKA 3RPUD 4LK0F 5D4RA 1N77A 2NVQJ 1O4XA 2FXAA 3T1BA 1DPRA 1MBHA 4LIVA 1GGQA 3C8ZA 3G4SI 1RESA 2JN6A 1WJAA 4IJAA 5E3LA 3LSRA 2HEOA 2UWMA 3S2WA 2P0WA 4I99C 4CCLA 3J7YJ 2OUMA 3PO3J 2LD6A 3S3OA 3REOA 3BDDA 2PG4A 3V42A 4A3JJ 2HQ5A 3HLZA 1WJBA 3I5QA 1JHHA 3BR2A 2QZ8A 2TDXA 3V7CA 3PNVA 3LESA 2VT3A 1XZQA 3WHNA 4ESBA 2XSDC 2NVTJ 1R4TA 3DE9A 2NOJB 1OQCA 1WWPA 3FOOA 3S15J 4Y17A 4AU7A 1LPEA 3WU2C 2EB7A 2P7CB 1JI8A 1BW6A 3QPLA 3KYIA 2RDPA 3BQYA 1NSGB 2DYRH 3B9QA 4EIYA 3MAJA 1EKYA 5IP7J 1U6GA 3AG1C 5L3FA 2OTLI 3Q9VA 2Q2EA 2YWAA 1QSPA 4G6QA 3LNRA 3HHGA 3ZG1A 2EV0A 2VJIA 4A69C 2DOFA 2A07F 2JZYA 1LI7A 2MH2A 1WSUA 5DUKA 3OR1C 4KT5C 4XEVA 2HI3A 3MZYA 4RGXA 3RQIA 1HKTA 1Q1VA 2DN0A 3T6BA 2J9UA 1X1CA 2TCTA 1SFKA 3WU1B 1BZ4A 4GXOA 5K5RA 1Q0FA 3ASOC 3RQFA 4DYCA 3GTKJ 4ENNA 1ZGWA 5L0CA 2QA4I 4Y13A 4QPQA 3PNYA 2FD5A 2W24A 4LITA 2QENA 4Q48A 4DRJB 1QQ3A 2KRHA 4H0EA 3JTLO 1XN7A 3ZPLA 2OOCA 5DCMB 4U7DA 1YRNB 1Z0XA 3NKEA 2A6TA 1TNSA 1KQ0A 2HYJA 2PMZA 4I76A 4BG0A 2OEXA 2HPIA 1Z6RA 4MIMA 4XL9A 2IOQA 3K4LA 1HY5A 1N1CA 2QLZA 1EI7A 3NEUA 1UJ8A 1DU6A 1JGSA 4WXHA 4LDRA 4AL0A 4QI2A 3QU6A 4KA4A 4KN7X 2KC3A 2DA7A 3Q7LA 2VN2A 3BJAA 3H36A 3L2CA 3R61A 2JSCA 2K4BA 4HFKB 3MBGA 2E35A 3KP4A 3O2PE 2B0JA 4AVZA 2DA3A 3MQ0A 3FWEA 4XKVA 3ZMUA 2JUGA 4A2UA 1K78A 3E6CC 1FMVA 2XLHA 3TOLA 2VC0A 5B3IA 3E97A 1A7DA 4CSAA 2FSWA 1EQ1A 2E1MB 3QMKA 5CVRA 4AIHA 3K1NA 3CLOA 1IZMA 3J7ZI 2IXPA 3MLGA 3VSKA 1WGXA 1IJWC 5ED4A 3KZZA 3JRFA 2HTSA 3VPRA 1PCXA 4MQVA 4CHUA 1OCZH 3HOWJ 1IN6A 1OCRH 2EA2A 3A01A 3EJNA 4C3BA 3R7CA 3BJ6A 3B0UX 2UUZA 2KIFA 4EVIA 3CDIA 5BQTA 3HHHA 3ABTA 2DFEA 3DU6A 3CUOA 2FQ3A 4JOMA 2Y0SA 2WZGA 5F0CA 4HX7A 3RKXA 2J0XA 2ME0A 4UY8I 1G59A 3V8LA 3DEUA 1KQ9A 2LY2A 3DTEA 2XDVA 2F5DA 5JFRA 4A3FJ 2DOAA 2XLEA 3M15A 2CW8A 1X1BA 1X1AA 3HEFA 4RB2C 3ZQLA 1TC3C 1UG2A 3FHNA 1JUSA 1NFOA 1U2WA 4Z9JA 1O7FA 5ERIA 3B71A 4JQFA 5DV5A 2BW3B 2YR2A 2PLYA 4YK5A 4DRHB 3J7AO 3MKLA 1PD1A 4YT5A 4BJTA 1IV8A 4HAMA 5EYRA 1G6NA 1A04A 1MH4A 1REPC 4XMYA 3BWGA 3CO6C 3HNLA 1ETQA 1QRYA 3CJNA 3OYNA 3IPMO 2W9YA 2DT6A 1S05A 3DWWA 1OXKA 1NK3P 5M3MJ 1EJ9A 2QTVA 4E4HA 3DEWA 2XXAA 3JT1A 1I50J 2L7MP 3AAFA 3EQLF 3D5RC 3I9V2 4CX9A 1BBYA 5B1AC 1PD0A 2D5VA 4Z9HA 1MBFA 2BVLA 4O5VA 4HW0A 4AVPA 1IAWA 4C7OB 1MJ9A 3W8IA 5CKTA 5BQGA 2F5VA 1YJ9I 4KI2A 1A31A 4NQWA 5ICEA 1SD5A 5ILUA 1YA9A 2PI0A 3EDPA 4RAGA 4UB6C 4IOCF 2P4WA 3WTXC 2JVGA 4RLFA 3R4KA 4N6HA 3HB9A 3LA2A 1S7AA 3ABKH 4XM3A 3MZ8A 2EPMX 2RV8A 2X9DA 1YQAA 1Z9CA 4IL6C 1CGOA 1TT0A 1NFNA 3ABMH 2Z1DA 3KETA 2ZXOA 3SYNA 3E6BA 2R5ZA 2I8DA 4HQEA 4NTFA 3Q0VA 4M63A 1I6HJ 3T4RA 2EQRA 2FMLA 1H7IA 3FXMA 4HZFA 4E7IA 2STWA 3ZMSA 4MTGA 2LF7A 2CV1A 2QSGX 4S0HB 5C4JJ 3NRHA 3W6JB 2R7QA 2Y31A 3LSJA 3GTMJ 2OF7A 4K1OA 3CJQB 4Q7CA 3G3ZA 3QVYA 2FNPA 1ZR4A 4BEJA 1FOXA 5CJ9A 3GTLJ 2R9RB 1DOWA 2K9MA 3ZDLA 5EGOA 1AKHB 4QLCU 1R4MB 4H4KC 3I5PA 1APLC 4MVZA 2K9LA 3GWNA 4FHTA 4WABA 4BACA 2HFIA 2HZ8A 1MBJA 4ZDPA 1X2NA 3UMKA 2QCOA 3CC4I 2JRMA 3ZQQA 3DM9B 3AFHA 3H5NA 3HKZA 3CO7C 2F4MB 3H3UA 2L2OA 3FXRA 2KYHA 3H65A 3U3FA 5DDGA 2YU3A 4X0RA 1IDZA 1I39A 3U0CA 1W0TA 3BEHA 2GXAA 1BR2A 4C30A 3BG7A 1IRFA 1IRXA 4V19K 2KJBA 1VQ5I 3PFIA 3FX3A 2DMNA 4G78A 5GAHJ 4ANJA 3J81K 3IWFA 4L5EA 3OYEA 4CZZA 3RSNA 5DM7F 3MKYB 3IV5A 1TBXA 4HLXA 4BY7J 4N4OB 5DTDA 1ENHA 5K1YA 1E3PA 3J7AY 1BDJB 4L6RA 4AIJA 1R22A 1DU0A 2PNOA 3CF2A 4BQOA 1QU3A 2H1LA 4ER9A 4PUSA 4L9VA 1MKMA 2IP2A 5DYMA 1JKRC 1TQPA 2VI6A 2GOMA 4WGZA 1LVAA 1ZW2A 3AGTA 4EKWA 2ZB9A 3BT9A 3DLLF 3RW0A 1P6RA 3UMIA 3KZIC 5EEHA 1B8IB 2P0NA 3JRMO 3DBHB 1JKPC 2P61A 2V1DA 1V5GA 3C2GA 3DMDA 4OD5A 5KYWB 1D0YA 5HNHA 2FNAA 2IXSA 2ZXWH 4OAYA 1WJFA 1FIPA 4A93J 1OCCC 3MEXA 2QE9A 2FUG2 3QZCA 3HDDA 3TO9A
chains in the Genus database with same CATH topology
4MNUA 4S04A 4A0XA 1FY7A 1OPCA 2DLLA 2CGPA 1BIBA 4AWXB 5CVIA 2A3SA 2DW4A 2OAZA 1IXRC 3L09A 3FHZA 1B9NA 3IKVA 1O3QA 4Y15A 1ZARA 1OYYA 5F1RA 5DCFA 2NYXA 2IT0A 3ZMDA 2YX7A 4UV8A 5F6FA 4WF2A 4A0YA 3KP6A 5DCMA 1PP7U 4ZH4F 4PCQA 3WGIA 2O8XA 4L9JA 3WTYC 4IRIA 5L3GA 4HA8A 3MFKA 2A6HF 3BY6A 3DKWA 3E5XA 1WQ2A 1XMKA 5BS6A 1USSA 4FX0A 4OIRF 2IRFG 1J2XA 1PDNC 5HLHA 4Z2YA 4HV6A 4LLGF 3E3VA 4ASNA 2VONA 1IUYA 1XCBA 1IXSB 2EK5A 2AXLA 1YTYA 1B6AA 1H9TA 2KKOA 4I02A 3I59B 3LWFA 4IPAA 2X4HA 3GLXA 2XASA 4RGRA 5HS7A 2F2EA 1FBUA 3SXYA 2EFQA 1FSHA 2JTVA 1RIOH 5DD8A 2CFXA 3LSTA 1EV7A 1IXCA 3RYPA 5D6FA 3JSPA 1ZLJA 3HRUA 3K2ZA 3E6DA 2QWWA 2XIGA 4BQAA 2CO5A 4MTDA 2ISZA 3CDHA 2K86A 4OIQF 5FLXZ 1T0FA 3MCZA 2L4MA 1RI7A 4RB1A 4G8XA 3V7SA 3JTGA 4XLPF 1PUEE 3I64A 4G94A 1T38A 3Q9SA 2ISYA 1YW8A 1OYWA 3MWMA 5LHIA 5D8LB 5E1ZB 2M45A 4TV7A 1O57A 2PMHA 3GZ6A 5JVTA 1GXQA 2GXBA 2EFNA 2J5PA 2W84A 1W5TA 2VC1A 2VBYA 3WGGA 3ISPA 2F5CA 2RKHA 2BV6A 1QZZA 3O6BB 3RI4A 1JE8A 3FMQA 3VOEA 3RYRA 1ZGJA 1R58A 2G9WA 2XRNA 4IVNA 1HKQA 2GWRA 3F6VA 1BN5A 2H6CA 3QU3A 3RJPA 4GO1A 1NHAA 5F64A 3BZ6A 4IXAA 3VFZA 4MEYF 2BYVE 3IWZA 1DDNA 2DO7A 4IHSA 3KE2A 5J6XA 3IRRA 4I01A 4LLLA 2XAFA 2H94A 4ZZDA 1R1VA 1EH8A 2Z3YA 2VBWA 2G7UA 4EJUA 4RAYA 4IRHA 2ZCWA 2CYYA 3ERED 3F21A 1L0OC 5DUIA 3JSOA 1UCRA 3VB2A 1U8RA 3QP6A 1G4DA 2HTJA 2HOEA 2VT2A 3F8FA 2IPQX 2XUBA 3WTSC 2VE9A 2MA3A 5ICGA 2NS0A 2GA2A 4BHBA 3KCCA 3GO5A 4UUVA 5L3CA 2L01A 4HDUA 4I0AA 3DPLC 4RAZA 3HTSB 4L0YB 5EEGA 1R5HA 1YS6A 2P5VA 1RUNA 1TQMA 3KFWX 2Z33A 2FEZA 2EV5A 1ZRCA 1V3FA 4LG0B 4ENMA 5CVJA 2H09A 3I59A 1W4MA 3M1EA 1UFMA 2OU2A 4LK1F 2VBXA 2LNBA 4OIPF 3WTUC 4ZYGA 4UNOA 3IKTA 3HRTA 1D8JA 4EGZA 1MDMB 5E1XA 1SMYF 1I1GA 1O3TA 3EYYA 1LDDA 2XVCA 1KU9A 2GXGA 1KYWA 2FBIA 4EMSA 1G3SA 4L18B 5IT3A 2ZKZA 1HW2A 1IRGA 2JPCA 2PQ8A 1HW5A 3K1MA 2M30A 1XD7A 3CUQB 3JAMZ 2V1UA 1U3EM 3T0YA 4Q47A 4DNCA 1IW7F 2RN7A 5FGMA 2RNJA 2CW0F 5LHHA 3SZTA 5FD6A 4YFKF 3ML6A 2G7HA 3J80Z 5LEKA 1TNTA 1KGSA 4ZZLA 3TQNA 5IT9K 4LJZF 1XB4A 3WODF 2WTEA 2OBPA 3B73A 1GVJA 3EYIA 2WC2A 4M9XA 5E1WA 4U0WA 1I6XA 4BH9A 4NHJA 2H27A 4KMUX 2LKPA 5HDNA 5HDKA 1SFEA 4JK1X 5J8FA 3TDUC 5TJJA 4HQMA 2HYFA 1SD4A 5E20A 5AIPA 4HX8A 3J81Z 1RUOA 1DPUA 3I53A 2L3DA 2W57A 1FP2A 4G6DA 4M71A 2F5FA 4IHTA 1UHWA 2MLKA 3ZMZA 4U0YA 5K5QA 5L3BA 2XAHA 4LB6B 1HKSA 1Q1HA 2DFIA 3C1DA 2DPUA 3FMSA 3IC7A 4CYDA 1ZN2A 3V4GA 2CWEA 1ZRDA 2LSOA 3BPXA 4UVBA 5E17F 1BM9A 4A12A 4RGSA 5D6EA 2MBFA 2R7FA 5KK1A 3JTHA 4HOBA 4S05A 4ETSA 3U1DA 1RZ4A 2D2WA 3GVAA 1H9GA 2DK8A 1EH6A 1ZG3A 5A2QK 4HYEA 1ZHFA 4ZYHA 4YIIA 2NAZA 3DPTA 2P6TA 2FOKA 4LG0A 3G73A 3COAC 4M74A 1LJ9A 3DXJF 2D1VA 2A69F 4LLNA 4KFCA 1Z91A 2YPRA 5E8IA 2QM3A 1GHCA 1P2FA 2RGVA 3L9FA 3TOBA 1P4WA 3ELKA 5L3EA 2FA5A 3I5UA 4KYWA 4OINF 4MTEA 5FO5A 4JBAA 3GWZA 1QBJA 5H20A 3F22A 2EFOA 1YW7A 4HF0A 1MDMA 2XKPA 2W25A 3BOQA 1FBSA 1SD7A 3GW2A 3P9IA 4D0PA 2P5LC 1JXSA 3KLOA 2JPBA 1XDUA 4KIBA 3MZHA 4YG2F 3IRQA 3KP5A 5E8GA 1XSDA 4KNYA 2E1CA 3ABUA 3VEPA 3GFMA 1LQ1A 4M6XA 1Z05A 3CUQA 2ZNZA 3QPTA 2E7WA 2QVOA 2K02A 4U7BA 1L3LA 1G3WA 1BC8C 3RDIA 1RNLA 2XAQA 1HSTA 1OKRA 1ZAOA 3P7NA 4A6DA 4YIFA 5E18F 2KRFA 2HR3A 3TDZC 2ZXJA 1K79A 2A5YB 1P92A 4HV5A 1Z7UA 4M9ZA 5D5WB 3HSRA 3R0AA 3TO7A 4MQ9F 2O6GE 1F4KA 2IA0A 5FFZA 2FF4A 3NRVA 3OV8A 1Z1DA 1X3UA 1YLFA 2ZBKA 5J8CA 3GFIA 2EV6A 2ELHA 2E7XA 1ON2A 1FLIA 3QPHA 2LDUA 1F5TA 5LRSA 3V8JA 3F23A 2AS5F 2BEOA 4KIFA 3TOAA 1J7KA 3ROUA 2JT1A 1HQCA 3HRMA 3HUGA 2YX4A 1QGPA 3LFKA 3TO6A 4R79A 4ZYEA 1J5YA 5BMZA 3LA3A 3ZMTA 1IN7A 5D4SA 3NQOA 3WTVC 3T5XA 2PEXA 1BIAA 4LGWA 1WRJA 1FBQA 4EJTA 2GQQA 4EM0B 2XAJA 2Q0OA 2DAOA 4M6YA 4PGHA 3E5QA 2Q8KA 4BAYA 5FB2A 2BE5F 3LA7A 4UV9A 4L9NA 3SZPA 3SHFA 4G7HF 1YYVA 3C7JA 1B1BA 3DFGA 2KIUA 3TKYA 4EV0A 4AD9A 3JW4A 2WV0A 4WXCA 1I27A 1T6SA 2HYGD 2DQRA 4N9HA 5FFXA 3O3KA 2GA1A 4OMZA 4I09A 2M87A 2OD5A 5JHUA 4K2EA 4EJWA 1SMTA 5K5OA 2Z9OA 4WXDA 2DT5A 2M1BA 1CF7B 2QQAA 2ESHA 4M73A 3FF5A 2MH9A 3VODA 1DP7P 1BOAA 3GXOA 4I2OA 5HLGA 1XMAA 4G7OF 2QBYB 2Z99A 3LQQA 3ECOA 3M9AA 3W6KB 4EQQA 5CLSA 5JI6A 2QQBA 1FX7A 4WCGA 1HSJA 5BOXA 5CVVA 3CTAA 1MJBA 2V9VA 1YIOA 3F6OA 4XSZF 1BJAA 2MD5A 2VODA 5TRDA 3RTRA 1USTA 1KU7A 2Y0MA 2ZO4A 4KUMA 2O3FA 4HX4A 2V6CA 2RQPA 3K0LA 4YFXF 2P5KA 3H92A 2DU9A 4MGRA 4GGGA 2R3SA 4UHTA 3T8RA 4P96A 4KIGA 1P4AA 2FMYA 4PZJA 4XBFA 1K6OA 1XSXA 5DD4A 4RB3C 2HKXA 1W7PD 4I0BA 4IRGA 5D5XB 4EM1A 1TQIA 3L00A 3I58A 4GCVA 3B02A 1S8NA 3KP3A 1Z6TA 2EA4A 4I98B 5LEJA 2EJRA 3RKYA 4OIOF 2PFBA 4CICA 2HS5A 4UXNA 2K4JA 2ZJ2A 5IT9Z 5D5UB 4HLYA 2KJCA 3BJOA 4BHPA 1T98A 5AIQA 1R5GA 5BPDA 1R23A 3RPQA 1LB2A 1KQ8A 1QZYA 2P7VB 2QYOA 3GFJA 1R1TA 1D3YA 1B4AA 2PJPA 2BBYA 2J5OA 2Z5UA 2EFWA 5CYVA 2K27A 1KU2A 2HWVA 1V4RA 3HOTA 2Y75A 4B8XA 4I7HA 3R60A 4A0ZA 1FC3A 1DUXC 4PDKA 3HIFA 4GYIA 3T8TA 2XHKA 1FOKA 4OU0A 4N0BA 5JR3A 4R8HA 1FP1D 1YO5C 1XGMA 4HF2A 2D45A 1FSEA 1JHFA 2L54A 4ON0A 1ZGAA 3TGNA 1AOYA 4P9FA 3F3XA 5KVRA 1YS7A 3FXQA 2E1NA 4CXFA 2ESNA 4HF1A 4NB5A 1J0RA 1BC7C 3QOPA 2DK5A 1BI0A 1LEBA 3BPVA 4EJVA 2ZNYA 1ODDA 1TW3A 5BPIA 3F8CA 1XGNA 1U5TB 1CF7A 1I5ZA 5A2QZ 3KP7A 5AONA 4WX9A 3HYIA 3SXMA 3F8BA 1O7LA 3LQRA 1OYIA 4HDVA 1ONVA 2OQGA 2QBYA 2QQ9A 5HVQC 1TLHB 2OZUA 3M8EA 4L5IA 1IN4A 2DQLA 3ZN1A 1S7OA 4P9UA 1TTYA 4ENKA 4G9YA 2MC3A 4M72A 3ZN0A 3IL2A 2DBBA 4G7ZF 2QUFA 4RGUA 5ILSA 4ESFA 2LF8A 1J59A 1S6LA 1B59A 3JAMK 1CGPA 1XSVA 1TW2A 1OMIA 3EUHA 4BYYA 2O03A 3IHUA 1WKMA 3SFZA 4IF4A 2UXNA 1MJAA 3I71A 2O61A 2JRTA 4QWQA 4U88A 3F8MA 1BI3A 3FXUA 4L9TA