3IHUA

Crystal structure of dna binding protein (yp_298823.1) from ralstonia eutropha jmp134 at 1.92 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
205
structure length
205
Chain Sequence
SASDTVFFGIMSGLELGTFVPGQRLVETDLVAHFGVGRNSVREALQRLAAEGIVDLQRHRGAVIRRLSLQETLDVLDVAERMTGLLARAATRGSGNQPQVQALRASVQALVAAEKAQDGETFSNARRHFYRTLLEMGDNRELRRLFPTIHMPIVHAQHRLASLRQMRLDDYRRIATAVLAGEPDAAEAAGAAHVKNVRGAILDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of DNA binding protein (YP_298823.1) from Ralstonia eutropha JMP134 at 1.92 A resolution
rcsb
source organism Ralstonia eutropha
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, GntR family
total genus 80
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ihuA01
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3ihuA02
4HW0A 3FMRA 1KU2A 4RS8A 3ZPLA 4LLLA 4L9TA 2P5KA 2D1HA 3ECOA 3GFIA 1RZ4A 2FOKA 4TV7A 1S29A 4L9VA 1G4DA 5D8KB 1U6GA 3J81Z 2HDCA 1F9NA 2EK5A 5DCMB 2FNPA 4ESBA 3R6SA 1XB4A 4LD5A 1O57A 3D0SA 4I2OA 1ZHFA 2V1DA 3V7SA 5H6RA 2DI3A 3KLOA 4A12A 3JAMZ 2NNNA 4XRFA 3DP7A 1EH6A 2MH9A 1R1TA 2CG4A 1CF7B 5F64A 3GUDA 2STWA 2CO5A 2M5WA 2D1VA 3ZN1A 1OYIA 1ONVA 3JW4A 4WF2A 2JT1A 1H0MA 3CO7C 1U5TC 2EWNA 3DV8A 2OD5A 4G9YA 4KN7X 2GA2A 4UHTA 4RB1A 3F72A 1T2KA 4L5JA 1GVJA 2XAGA 3BP8A 2GAUA 4IJAA 3GW2A 5D5WB 1BN5A 1RUNA 1P4WA 4RAYA 2F5FA 2EFPA 1YS7A 3WTUC 3H3UA 2IJLA 4G7HF 4RB3C 3IWFA 1R00A 1O3TA 2DW4A 4IXAA 3EYIA 1XGNA 1WRJA 2FF4A 4Q4ZF 3TO9A 2RV8A 3MEXA 2RN7A 3I54A 3HHHA 3WODF 4P55A 1ZRFA 4KA4A 4EJVA 1JE8A 3AAFA 2BYVE 3DFGA 4PGHA 1U8RA 3G3ZA 4Q5SF 3E97A 1QQIA 3WTYC 3VB2A 4Q47A 3WG9A 2HFHA 3FM3A 2NAZA 1TNSA 1ZREA 3QRFF 3ERED 2NRAC 2QLZA 3TDZC 4ZYGA 2LSOA 4U0VA 1IXSB 4D0PA 1O3QA 3O6BB 3JSOA 1KU7A 3R61A 2Y0MA 4HLXA 1O7LA 2DU9A 4KICA 5FLXZ 3GFJA 5L3DA 2G9WA 1KQ0A 2E1NA 2LF8A 3RIRA 5HDGA 2XAQA 1QO0D 1FLIA 3HTUA 5A2QZ 2KIMA 1GXPA 3CLOA 1EV7A 3BPXA 4RGRA 5E8IA 3SXYA 5K5QA 3IKTA 1AOYA 4G6DA 5HDKA 2P8TA 1T0FA 2BE5F 3T5XA 4KMFA 1REPC 2XV4S 5EEGA 3CUQB 1XD7A 3SXZA 3TDUC 1YLFA 4L18B 3KLNA 5L3GA 4GGGA 5ILSA 2QBYB 4XSZF 2EB7A 3M9AA 4F7ZA 1QPMA 3BJ6A 3SXMA 2YPRA 4G6QA 4EJUA 3TOAA 4G94A 3U9GA 2A61A 3GFLA 2IA2A 1J75A 1PDNC 4KN4X 2FBHA 3BJOA 1MDMB 1J7KA 1SD6A 2IA1A 1SD5A 1DPRA 2MD5A 2ELHA 2BV6A 3P9CA 2CQKA 1QNTA 2P4WA 1WSUA 1W7PB 3WTXC 3E6MA 3B73A 5K1YA 2VE8A 4MTDA 2STTA 2HQRA 3BOQA 1DP7P 3WTVC 1IN8A 2JRTA 4M6XA 3KE2A 2ESNA 1QZZA 3LAJA 4P5OA 1UB9A 5HLHA 5LGUA 1L3LA 1IXRC 4P9UA 3ZQ7A 3BDDA 3O2PE 3K1NA 4MNUA 3BPVA 1OKRA 2Y75A 4U7BA 1LB2A 2VONA 1QZYA 1GXQA 2KIUA 5F1RA 3RKXA 1G3SA 1I1GA 3SHFA 3DPLC 3GFMA 1J5YA 4ZYHA 2GIVA 1ON1A 1O3RA 2KJCA 1KU3A 2KKOA 5LGNA 3V8JA 1HSTA 4ON0A 5JVTA 1F4KA 2ZJ2A 4I98B 4EQQA 3LAPA 5AIQA 4LB6B 3KP7A 5BPDA 3ZMSA 1SD7A 5D5XB 2V1XA 3QU6A 2HTJA 3GEZA 5CVRA 1ZGAA 4EM2A 4DQ2A 3LA3A 3KFWX 1MJBA 4JK1X 2MLGA 1FZPB 5JI6A 1BJAA 4WCGA 1IRFA 1W7PD 2CW0F 1TQIA 1HW5A 1B6AA 2P6SA 4HYEA 4P9FA 1B9NA 2FSWA 1YW8A 2OBPA 2EV6A 2GZWA 2W84A 1B9MA 2XAJA 3T0YA 3ROUA 3ZN0A 4BYYA 1KA8A 2CSOA 2A6HF 2B0LA 4LK1F 1SFUA 1LDDA 5FO5A 2WV0A 4RGSA 3E5XA 5FB2A 3EUHA 5JFRA 2JZYA 1DDNA 2G7HA 5D5UB 3LFKA 4LK0F 1HSJA 4I0AA 4PCQA 3FXRA 4HX7A 1BIAA 1FYMA 4LG0A 1MD0A 2L4AA 1XGOA 3HOTA 5J6XA 4LG0B 2ZBKA 4L9NA 2FBIA 1R36A 3F6VA 2OZUA 3SZTA 3E3VA 3IKVA 3PQJA 1FNNA 4L0YB 1VTNC 1HBXG 3NQOA 4U0YA 1MKMA 2UZKA 3P9IA 5HLGA 3BZ6A 2QZ8A 3IC7A 3ABTA 3CDHA 1U5TB 3OOPA 4IRIA 1S6LA 2W24A 5DCMA 1KYWA 4Y17A 4Z2YA 5BMZA 2EFQA 3GZ6A 4R8HA 3QPTA 4LLNA 3WE2A 4BAYA 4ZZDA 3L00A 2GQQA 2HYFA 3CUQC 3HTSB 2Z5UA 2R3SA 1R5GA 4EJWA 3KZYA 3RPQA 1RUOA 2RGVA 4CZZA 3K9TA 2O61A 3B02A 1ZYRF 2K7LA 1Z9CA 2HYGD 5AIPA 2XIGA 4UVCA 2JSCA 2VBZA 2A5YB 2NNYA 2XASA 5LEKA 4O3MA 1OYWA 1CF7A 1USTA 2VC0A 4FX0A 3WTTC 5L3FA 3K2ZA 4NB5A 3M8EA 2LKPA 3QP5A 2W25A 3KEOA 1T98A 3WGGA 3GLXA 3C7JA 4S05A 4AIHA 5D6EA 1W5SA 5LGTA 4Q48A 2HZTA 1TNTA 4HBLA 1R1UA 1ZRDA 4KMUX 3Q9VA 3C3WA 1LDKB 1ULYA 2OQRA 3JSPA 5KVRA 5LRSA 3CO6C 4BHBA 4BNCA 3RPUA 3BWGA 5E20A 4QLCU 4RB2C 3K1PA 5DYMA 2GA1A 4M74A 2K86A 3CTAA 1P6RA 2XHKA 4CYDA 2P5LC 2J5PA 3V7CA 3F6OA 3OV8A 1P4XA 3E6DA 4GO1A 1KQ9A 2JTVA 4MEXF 4EGYA 2LDUA 1LDJA 2QVOA 1GHCA 1G3TA 2ZCWA 4ASNA 1KQ8A 4ESFA 4OIQF 4M9ZA 1LEBA 2GXBA 2FNAA 1RNLA 4XBFA 1YW7A 4JQFA 4MTEA 4G7OF 1T38A 1R23A 3MZYA 4EV0A 1X3UA 3MZHA 2EJRA 1Z05A 1FC3A 4LGWA 5CJ9A 4GXOA 4BH9A 4Y13A 4AIKA 1BI0A 3FXUA 3SZPA 1KYZA 5ICCA 3KP5A 3I4PA 4CXFA 1OR7A 2OU2A 1FBUA 2P5VA 5HS8A 4H0EA 3ZMVA 2QUFA 5DDGA 4M73A 1XCVA 2O8XA 4QWQA 2YSRA 2QM3A 4DNCA 4I09A 3L7WA 2Q2EA 4ZZLA 1FBSA 3M8FA 3F21A 3VFZA 2H09A 1C0WA 2KJBA 4KYWA 3J81K 2H6CA 3FXQA 3F8NA 2QQ9A 2VXZA 2VOPA 2L01A 4N9HA 1ZAOA 3SFZA 4KT5C 2V6CA 1SMTA 2ZO4A 4OIPF 2XAHA 1Z91A 1FT9A 3KP2A 4HX8A 1TTYA 4UXNA 3LA7A 4WX9A 4MQ9F 1Z6RA 2UXNA 2V9VA 1WQ2A 1ZN2A 3Q5FA 1D8KA 3KZZA 2P7CB 4IRGA 3MCZA 1BOAA 5LRRA 4UUVA 1FP2A 3R0JA 4O6JA 3E5UA 3J80K 1K78A 2D45A 1WWXA 3I5UA 2IT0A 1D5VA 1BI3A 2M45A 3IRRA 4OMZA 2F2EA 1FWZA 3IHUA 5HLIA 3W6KB 2XRNA 3LQQA 3ML6A 4KUMA 3T8RA 3V7RA 2ZXJA 4ZH4F 1JHHA 2PMUA 1XDUA 4LFUA 3T1BA 1XSVA 1Y0UA 3P9KA 2RKHA 1DPUA 2EA4A 3GXOA 3F23A 2HR3A 1XMKA 1XGMA 3J7AO 3KP4A 3V4GA 5ICGA 1J0RA 2FXAA 3H3ZA 4M9SA 4A0ZA 2ZMEB 5LHHA 2WWYA 1R58A 3CUQA 3WU0A 3V8LA 5ILUA 1J9IA 4O5VA 3F8CA 1XMAA 2G7UA 4OOIA 3FZVA 3MWMA 1KU9A 1LEAA 1JGSA 5E17F 1U3EM 3IL2A 4CICA 4HDUA 3E6CC 2V79A 4M9XA 3GWZA 4XSXF 4U0WA 3DQVC 2DQRA 1TQMA 1MGTA 1PP7U 1XSXA 4HQEA 5J8CA 4IHTA 4EVIA 5IT9K 3DXJF 4YG2F 1W4MA 3HRSA 1R5HA 4CDGA 1RI7A 1FBQA 5E1XA 3KP3A 5A2QK 1K79A 3DEUA 2PMHA 2Y48A 1ON2A 2A69F 5DUIA 1SMYF 4IRHA 4LJZF 2YX4A 2XKPA 3RYPA 5HOOA 2RNJA 1U78A 4HQMA 1T39A 1IN4A 4KFCA 3TOBA 5D8LB 1ZGJA 2VOOA 3HOSA 3TO7A 4RAZA 4UNOA 2HS5A 2FMLA 4G7ZF 4WWCA 3HRTA 2XVCA 4FHTA 1HQCA 3F22A 2M8EA 3ZMUA 5DCFA 1YO5C 3HSFA 5F6FA 5HDNA 2GXGA 3NRVA 5LLQA 1IN7A 2RC4A 4B8XA 5TJJA 2XKOA 1AWCA 3WTZA 2A3SA 4LLGF 2VC1A 4JBAA 3WU1B 3SQNA 5K5RA 4I02A 2F5DA 3LA2A 3WGIA 2HWVA 3O3KA 1J59A 3JAMK 2ZNYA 4AWXB 3C1DA 2H6BA 4A0YA 4U88A 3K0LA 4NHJA 2O03A 5E1WA 3RTRA 2DLLA 3L2CA 1FSHA 1BI1A 3WTWC 4M71A 2HEOA 4EGZA 3VEPA 3I71A 1UFMA 5L3BA 2ACJA 1OYYA 3R0AA 4RGUA 1IF1A 4R1HA 2XAFA 1ZARA 2RQPA 4GYGA 1FOKA 2PJPA 2F5CA 5ICEA 4HA8A 2OAZA 3LWFA 2MBFA 4RGXA 1IZ1A 2PBIA 4A5MA 5LEJA 1BI2A 1O7FA 5H20A 1DUXC 3I59B 3HSEA 1Q1HA 4P96A 2J5OA 2M30A 2W85A 3ECHA 2VBWA 3QP6A 4ENJA 2XROA 1KGSA 2CFXA 3G73A 1J2XA 4EM1A 2HGCA 2HTSA 1D8JA 4G8XA 3N97A 3HRUA 4NQWA 4HLYA 4FT8A 6PAXA 3SXKA 1IAWA 4OINF 1W7PA 1MJ9A 1PP8F 5EEHA 3T8TA 2DPUA 2OQGA 3LSTA 5LHIA 2ESHA 3PFIA 4HV6A 3F3XA 3LQRA 2HQNA 1QBJA 1MJAA 1I5ZA 1LJ9A 1ZLJA 3MFKA 5E1ZB 2MC3A 1YYVA 3HUGA 1L0OC 4MQVA 4K2EA 4KIBA 1XGSA 1BM9A 2BEOA 5ED4A 2HKOA 4B09A 1K6OA 3HSRA 3Q9SA 3TKYA 5D4SA 3ZMTA 3F8FA 3K1MA 1LQ1A 4HF1A 3RYRA 5LHGA 3WTSC 1G6NA 3IRQA 3TO6A 3S2WA 3I64A 3WGHA 3HYIA 1OMIA 4ZYDA 2PN6A 4AVPA 2YU3A 2AS5F 3L09A 4HZFA 4HDVA 1JXSA 1YW9A 4E70A 5BOXA 5HVQC 1WKMA 2ISYA 4A0XA 2R7DA 1RIOH 2DPDA 4WXHA 1R7JA 2R7FA 2O6GE 3EQLF 3I0TA 1B59A 2E7WA 1TLHB 2A6EF 2BBYA 2QYOA 3FHZA 1G3WA 1HKTA 2DBBA 2Z9OA 5H6QA 1SFEA 1BC8C 4I7HA 3PQKA 5CVVA 1TW2A 1STZA 3U2RA 2UXXA 1CGPA 2QENA 3V8KA 1HW2A 2NS0A 3ZMDA 1W5TA 2LF7A 3EDPA 5TRDA 2ADUA 4HF0A 4XLPF 4WXCA 1S7AA 1FYLA 4OU0A 4HAMA 2X0LA 2PFBA 2L54A 5JHUA 2Q8KA 3BROA 1HXDA 3RKWA 3W6JB 5FFXA 3I53A 4KDPA 4I0BA 5IT9Z 2FA5A 4UV8A 2CYYA 1TW3A 5DD4A 2QQAA 1HKQA 2EFNA 1XCBA 1B4AA 2VBXA 1P92A 1SD4A 4EJTA 4ETSA 4KIGA 4PZJA 3QPHA 1T6SA 5FD6A 2GWRA 2E1CA 1YS6A 1FP1D 3GVAA 3KEQA 1FX7A 1U5TA 4R79A 1R1VA 4YFXF 2MA3A 3RJPA 3R60A 4BHCA 2MH2A 3I59A 4IF4A 2K27A 2FEZA 3VODA 4ENNA 5L3CA 3RI4A 3GZ5A 2RVCA 4RB0A 2X4HA 5D4RA 3WE3A 2DTRA 1MZBA 1ZRCA 3GX4X 1LVAA 1YIOA 1D3YA 5CVUA 3BY6A 4M6YA 3FMSA 4M72A 5FD5A 2FE3A 1TBXA 5BS6A 1SFXA 1ODDA 3F8BA 2JPBA 1UHWA 2XGXA 2DFIA 3DKWA 1ZG5A 1E17A 2FRHA 1IUYA 5D5VB 1FYKA 1BC7C 1Z1DA 2IVMA 2QWWA 1XSDA 1FSEA 4CGZA 3HHGA 4EJOA 5ERIA 2BGCA 2O3FA 3DPTA 4UVAA 4YIIA 1IW7F 1EH8A 2K4BA 2WTEA 4HX4A 4L5IA 3N4MA 2ZFWA 5HS7A 3QU3A 2EFWA 4N0BA 2Z3YA 3FMQA 3I58A 3H92A 3GYHX 1B1BA 3U1DA 1I1SA 2ZNZA 3C18A 3MQ0A 1V3FA 4OIRF 2D2WA 2WC2A 1XDSA 2IPQX 5CLSA 1YQAA 1HKSA 2PQ8A 1MDMA 2M87A 2EV0A 4EM0B 4BXUA 4YFNF 4HF2A 4ESJA 4PGGA 3M7GA 1G3YA 5ILVA 2IP2A 2DK5A 1O3SA 4UVBA 2FBKA 2K4JA 2PI0A 1PUEE 5CVJA 4L9JA 5DUKA 2L3DA 3KCCA 5FLXK 2PEXA 2EV5A 2L4MA 1F1ZA 2O0YA 3EYYA 2KIFA 3HRMA 3MAJA 1IN6A 1P4AA 3L9FA 1QGPA 2PLYA 5DD8A 4IPAA 4GCVA 2F5EA 5AONA 1HW1A 4MEYF 2EFOA 4Y15A 3F8MA 3CJNA 3ZMZA 2OZ6A 2QQBA 2P6TA 3FF5A 1USSA 2W57A 3BJAA 2AXLA 5IT3A 3JTGA 5HS9A 2VE9A 2A07F 5DV5A 4OIOF 1F5TA 1A04A 1S8NA 1ZLKA 2IRFG 3R4KA 2ZMEA 4AIJA 4L0ZB 2PG4A 3QAHA 2VN2A 1I27A 3VOEA 2KRFA 2FMYA 3HIFA 1YTYA 2YX7A 2IA0A 3FM5A 3NEUA 3EETA 4BQAA 3E5QA 5E18F 3ISPA 2COMA 4OMYA 3REOA 2C6YA 5E8GA 2FQ3A 3JTHA 4HV5A 4CO8A 5FFZA 4A6DA 2E7XA 4U7DA 1S7OA 2LNBA 3ABUA 4A2UA 4S04A 2QBYA 4GYIA 4EMSA 2H94A 1YFHA 2JPCA 1S3JA 5JR3A 3M1EA 4ENMA 4ENKA 5BPIA 4I01A 2Q0OA 3D5LA 2V1UA 4AD9A 5ICFA 2ISZA 5CYVA 4LMYA 3FWEA 2NYXA 1SAXA 4PDKA 4N9IA 4HOBA 1H9TA 3E6BA 1UHMA 1E2XA 1ZH5A 4IHSA 2DAOA 4FX4A 1FPQA 4KNYA 1H9GA 2K02A 1I6XA 3FX3A 4IVNA 4WXDA 1LNWA 5BQTA 4UV9A 4CHUA 2DT5A 2YR2A 4WK8F 4A6EA 2CGPA 2M1BA 2RDPA 4A5NA 3P7NA 1NHAA 1FY7A 5LBQA 5J8FA 3RDIA 5KK1A 3GO5A 2H27A 5L3EA 3KETA 4KIFA 1Z7UA 3KP6A 1JHFA 1ZG3A 3J80Z 4XLNF 1IRGA 1YG2A 2XUBA 2HKXA 2VODA 1BBYA 2CWEA 3TGNA 2ETHA 2UWMA 4LB5A 5FGMA 4YFKF 1XN7A 3ZP5A 2HOEA 1R22A 1ZG1A 1IXCA 5K5OA 3TQNA 3QOPA 2L02A 1K78B 4MHGA 1BIBA 4BHPA 3ELKA 4YIFA 2EA2A 1OPCA 1Z6TA 1U2WA 1TQPA 2FU4A 3RKYA 2OA4A 3CUOA 2P7VB 5DEQA 3COAC 2VT2A 1EH7A 1IN5A 1UCRA 3GF2A 2ZKZA 3ULQB 1WI9A 2IW5A 2DQLA 4MGRA 4ZYEA 2MLKA 2Z99A 5CVIA 1K7AA 2Z33A 2DO7A 2VT3A 5D6FA 2A68F 3K69A 3DF8A 2DK8A 3IWZA 2TDXA 2VBYA 1P2FA 1V4RA
chains in the Genus database with same CATH superfamily
4HW0A 3FMRA 1KU2A 4C9YA 4RS8A 5IOYA 3ZPLA 4LLLA 2W00A 5FRMA 1OQCA 3Q0UA 2YLIA 4L9TA 2P5KA 4I76A 2QSHX 2EIMC 4PR9A 2NUTA 2D1HA 3ECOA 4E0IA 3O8GA 3GFIA 1RZ4A 2FOKA 4TV7A 1S29A 4L9VA 2OEVA 2L6HA 1G4DA 1FIPA 1YX3A 5C4XJ 3ZQGA 4CX9A 5D8KB 3BQYA 1U6GA 2O5RA 5J1UA 2JK3A 3M8JA 4AU7A 1GGQA 3J81Z 2KZVA 5J1YA 2XF7A 1OCRH 2HDCA 2GXAA 2TCTA 4JIOA 1X2MA 3C2GA 1ZHZA 1F9NA 3EJNA 1VTMP 3S32A 3H9JA 2B9SA 1HMDA 2EK5A 2C04A 5DCMB 5E79C 1V5GA 2FNPA 1OCPA 2VJJA 3C2BA 3OYEA 3A9CA 3ABLH 3OA1A 4AYBN 3IPMO 4ESBA 3HGGA 3R6SA 4BS9A 1XB4A 3GLLA 1YRNA 2CH0A 4DBQA 4LD5A 1YRNB 1YJWI 1TWHA 1O57A 3D0SA 5GAGJ 1ZHFA 2V1DA 3MD2A 4I2OA 3V7SA 2HKVA 3LEOA 3TQOA 5H6RA 4M3DA 2DI3A 3KLOA 2GFHA 2COBA 3AG3H 4A12A 2EIJC 1W5CC 3JAMZ 2NNNA 2X9DA 3OY9A 3OYJA 4XRFA 3DP7A 1EH6A 3FK7A 2BOLA 2MH9A 1R1TA 3RPUD 5EEAA 2CG4A 2QE9A 4YT4A 1CF7B 4IJJA 1UG2A 5F64A 3VYUB 3GUDA 4CA0A 3DKYA 5C44J 2STWA 2CO5A 1LKXA 2D1VA 2M5WA 1PUFB 1JRAA 3BG5A 2H7VC 3FXJA 3ZN1A 3CMYA 5LD2C 2A6TA 1OYIA 4XLEA 3FK6A 2R9RB 2JRMA 2HJ3A 1ONVA 3JW4A 3LSJA 4WF2A 2DFEA 2JT1A 4KI2A 1H0MA 1MBGA 1U5TC 2EWNA 2L9RA 1MMDA 3DV8A 3CO7C 4BDYA 2JA7J 1ORKA 2OD5A 3OYNA 2YVKA 3RQGA 4G9YA 1A36A 5B5EC 2PP4A 4KN7X 3Q0WA 1TP4A 2W48A 4A3LJ 4EUKB 3BQZA 2GA2A 3H2UA 4UHTA 4RB1A 4DJ9A 2YQYA 3F72A 1T2KA 4NQWB 1V5EA 4L5JA 4D7NA 1GVJA 2XAGA 2OKUA 2XSEA 3BP8A 3ZQQA 3JRMO 2GAUA 4IJAA 4E4HA 3GW2A 4FISA 1BN5A 5D5WB 2J9VA 3R7CA 5E3NA 3RFYA 1R4TA 1UFBA 1RUNA 3RCOA 1K04A 1P4WA 4RAYA 3N24A 2M2EA 4XN0A 1IG7A 3C8GA 3DWWA 4IQJA 2F5FA 2LYCA 3FKIJ 2DB4A 2EFPA 1OCZH 3HJEA 4JX5A 3SDBA 1RRJA 1YS7A 1Q0MA 1H89C 2PJRB 1A7DA 1VLSA 3WTUC 3ZVRA 3DKAA 1SANA 3FISA 1V4AA 1AUEA 2I5UA 1D1BA 3H3UA 4W8PA 1ST6A 1VLTA 4XPYA 2GLOA 4ZTJA 2LP4A 2R7WA 3CDLA 1YJGA 4MVZA 2IJLA 2L5QA 3POVA 4CIPA 3QWLA 2G62A 4B43A 1IC8A 2VIXA 4G7HF 3I55I 1YZCA 4RB3C 4PJMA 4U5EE 3AG4H 3IWFA 1VQ9I 1R00A 3G1MA 5M3MJ 1O3TA 4N6CA 4E17A 2V7FA 3KX2A 2YL7A 2E1MB 4IKFA 2DW4A 4IXAA 3EYIA 4CCLA 4C3DA 3FXOA 2Y69C 4Y33A 3DMDA 5L0IA 1MW7A 1XGNA 1NFNA 5FKOA 5A6BA 1WRJA 2FF4A 3EG9B 3PFYA 4Q4ZF 3TO9A 1ZQ3P 4E7LA 1Y8QB 2RV8A 2Y9YA 3MEXA 2ZXPA 5F0FA 2RN7A 3I54A 3HHHA 3SZGA 3WODF 5F5HA 4P55A 4BE0A 4KA4A 1ZRFA 4EJVA 1JE8A 2N8GA 4BJ5C 3AAFA 2BYVE 2W45A 3DU5A 3DFGA 5JVGF 1N75A 4PGHA 2P0WA 2KDOA 1U8RA 2ZXIA 3G3ZA 2Q9CA 1SFKA 1TWHJ 3ABKC 4Q5SF 5KAIC 2R5YB 2LG4A 3E97A 4C2UA 1YHQI 1QQIA 3WTYC 5FKLA 3VB2A 4LIUA 3RF3A 3PL8A 4Q47A 3PNYA 2R7RA 3WG9A 2ECBA 2HFHA 3FM3A 1NK3P 3JSZA 2NAZA 1KZHA 1TNSA 1FOYA 1ZREA 3EFOB 1VYKA 4S0HB 3BG6A 4Z9HA 4CS8C 2EIMH 1ETKA 2EIKH 3ERED 3QRFF 3CMEI 3U9JA 4F3QA 2DA4A 2NRAC 2QLZA 1Z7LA 3TDZC 1KNYA 4ZYGA 3SZRA 2B0HA 2LSOA 4XIDA 3U21A 1BZ4A 2HOSA 2Y39A 2LH9A 4JOMA 3QVYA 4DOZA 4U0VA 5T1DB 2TMVP 1SF8A 1MH3A 3ZQCA 4LDRA 1IXSB 2QSFX 4D0PA 4DW6A 1IGNA 1O3QA 1NTCA 3O6BB 1IUFA 3JSOA 1OW6A 2ZXWH 1KU7A 3HOZJ 3UMKA 3LMMA 5EGOA 3R2PA 3R61A 3H9GA 3P5JA 5IPAA 4YL0A 2Y0MA 4HLXA 3EZHA 1O7LA 4QI0A 1QVTA 2DU9A 4KICA 3J7AY 5JLIA 2L9JA 1Q0GA 5FLXZ 3AL0B 3GFJA 5L3DA 1SYQA 3RQ4A 4J32B 2G9WA 1KQ0A 2E1NA 4XKWA 3L2RA 2LF8A 4O6MA 3RIRA 2IGMA 1FIAA 3DTEA 3NG1A 5HDGA 3GTQJ 2YUSA 2XAQA 5B66C 2NSFA 1QO0D 1FLIA 3HTUA 1SC7A 1CPRA 5E3LA 5A2QZ 3RIPA 2KIMA 3AG1H 2HZDA 1GXPA 3CLOA 3ABKH 1EV7A 4C30A 4GYTA 3BPXA 4RGRA 5E8IA 2J9UA 5T3WA 4LERA 4XRMA 4XICA 2W4BA 3SXYA 5K5QA 3IKTA 1AOYA 4G6DA 2VPLA 2V9KA 5CQEA 5HDKA 4BEHB 4EEFG 2JA2A 5FKKA 2P8TA 2E34A 4A4AA 1T0FA 2BE5F 3JRAA 3IAM2 3BR2A 3T5XA 2WY8Q 3VYSB 2R5ZB 5GPCA 3QW1A 4KMFA 1CPQA 1RJ9A 5E3MA 2P7VA 2W4SA 3TMOA 1REPC 3BC8A 5T3TA 2XV4S 2KQ9A 5EEGA 1C17M 1VMAA 1GLNA 1RKEB 4GEHA 3CUQB 1XD7A 2MG4A 3SXZA 3TDUC 5JVEA 2EPNA 2VQHA 1YLFA 3L2VA 4L18B 3IH2A 2Q9BA 3H2VA 3KYDB 3V5YA 1BW6A 3KEYA 3KLNA 3LESA 5L3GA 3L1MA 3NMJA 5GTIC 1FMVA 4GGGA 2EPKX 5ILSA 3B71A 2LY9A 2QBYB 1Z3XA 4XSZF 1MSFC 3WG7C 2KP6A 4PSXA 3JSEO 2EB7A 3M9AA 4F7ZA 1QPMA 3H0DA 4YT8A 2E1MC 3BJ6A 3SXMA 2IXSA 4IX7A 4FWVA 2YPRA 4G6QA 4EJUA 2J9BA 3TOAA 4BJ6A 3ZXSA 3X1OA 1TT5B 2ZJPF 1QRYA 4G94A 2HNHA 1XX5A 4M3GA 3U9GA 1K4TA 3Q7LA 2A61A 2L7AA 3GFLA 1KONA 2H1LA 4PUSA 3M3YJ 4X6AJ 2IA2A 4QPOA 1J75A 1PDNC 1XWJA 4KN4X 2JX0A 2FBHA 3BJOA 1MDMB 3DKXA 1J7KA 2OCCH 1Q1VA 1SD6A 2IA1A 4U5FE 3FAJA 4JEAA 4XK4A 1SD5A 1GS9A 2KLOA 1DPRA 3K70C 3S84A 2MD5A 2Q3TA 2ELHA 2DMQA 2JJ7A 2WA0A 3LOCA 3QODA 1Z23A 4K1OA 4X1EA 4HG2A 2UUIA 2BV6A 3P9CA 2CQKA 2DXIA 1QNTA 1BR1A 3CDIA 2P4WA 1VB5A 3S90A 3SYTA 3DBRB 3C2HA 5CIVA 3X2QC 2HDDA 2QKMB 3BCBA 3HM5A 3EH2A 3K4NA 3HPGA 1E0EA 1WSUA 2DOAA 1W7PB 3B0VC 4IGGA 3V5XA 2WAQN 2HJMA 3BR0A 2QUPA 3WTXC 2JD3A 1TQGA 4KJZA 1LE8B 3RYLA 3E6MA 4BU2A 4JKVA 1AEPA 3AG2H 1QA6A 2OF7A 2X48A 2X6WA 3B73A 5K1YA 2VE8A 2OJED 4MTDA 3OR2C 5GP9A 2STTA 1POGA 1YOVB 1YDIA 2P61A 2HQRA 3BOQA 1VQ7I 2F22A 1DP7P 1JAFA 3WTVC 3ZQLA 1IN8A 4WGYA 5TGTA 2NUPB 2JRTA 4M6XA 1W36C 3KE2A 2LD5A 2R03A 1O87A 3DJUB 2WZLA 5IY5H 4IQ4A 4QPQA 1OCCC 2ESNA 3CP2A 1DOVA 2XM0A 3O39A 1QZZA 3IQTA 5DS4A 1GVDA 4GFBA 1RESA 1TWCA 4MTOA 2LKXA 3G2BA 2L7KA 3MBGA 1IZMA 3LAJA 4P5OA 3KL4A 3KMIA 5F27A 1UB9A 2EILH 4Z6YA 5HLHA 2M7BA 5LGUA 5EZGA 2KSFA 3M15A 3OIPA 1L3LA 3H1CA 2P6VA 1IXRC 3JTLO 2CW7A 4P9UA 3BEHA 1NG6A 2CUJA 2ICWG 2NOGA 3GTMJ 4M3BA 1ZW3A 4I1OB 3ZQ7A 3A0BC 3BDDA 1HDDC 2RREA 3D1NI 2QSGX 2OCCC 4M3EA 2VC9A 1XC5A 2BY2A 2NS7A 3O2PE 2R7UA 5A6AA 3MFNA 5BQHA 1NH3A 3K1NA 4MNUA 2PX9A 3TULA 3BPVA 3H35A 1OKRA 2Y75A 4U7BA 1LB2A 1JKPC 3W2WA 2VONA 3DE9A 1QZYA 3RSNA 1GXQA 5DLJA 2KIUA 1ETQA 5F1RA 3RKXA 4IWBA 3QPLA 1G3SA 1G2HA 1JJ8C 3GM3A 1ZU4A 3PIPF 1G4US 1I1GA 3K66A 1Z77A 3FXLA 2ETSA 1O5HA 3WHNA 4RDAA 1TWAJ 3SHFA 2DYRH 1E86A 3DPLC 2R7VA 4HE8D 1ZELA 3FHNA 2Z15A 5DQZA 1U9OA 3GFMA 4F92B 1J5YA 1NK2P 5E3AA 4BEMJ 2XGCA 3A2KA 3BRJA 4ZYHA 2GIVA 1ON1A 4J30B 4CBEA 1O3RA 2KJCA 2IS1A 1KU3A 4HPQA 2KKOA 5LGNA 3V8JA 2MHRA 1WJBA 1OLTA 1UZCA 2ECCA 3OIQA 1HSTA 4AL1A 3HOVJ 2VASA 4ON0A 2EH3A 5JVTA 2QA4I 1F4KA 1PCXA 2D5RB 2FGYA 1D1AA 2ZJ2A 4I98B 1Q0DA 2WZFA 1UJ8A 2LOOA 4EQQA 2LY2A 1OJLA 1QZXA 3LAPA 3EHNA 1Z63A 5AIQA 4LB6B 1WJFA 3JRHA 5JUAA 3KP7A 5BPDA 1FTTA 1FTSA 3ZMSA 2Q4FA 1TC3C 4EWCA 4XOPA 3J7YJ 1I3QJ 1YARO 1SD7A 1OCRC 5B1AC 3OYAA 5D5XB 2V1XA 2XPVA 3QU6A 1XS9A 1F1MA 2HTJA 3GEZA 5CVRA 1ZGAA 4EM2A 4DQ2A 3LA3A 3S1NJ 3K7AJ 3KFWX 4MIMA 3S3NA 3AG4C 3S28A 3OYLA 2MYSA 4NC8A 4IARA 4Z9JA 1MJBA 4JK1X 2MLGA 3BR5A 3QPSA 1FZPB 1VQ6I 3H5AA 3EPVA 5JI6A 1V54C 1GQAA 4G6TB 1Z6AA 1BJAA 4WCGA 1IRFA 1W7PD 2CW0F 3EGDA 1TQIA 1HW5A 1APLC 1B6AA 4L5EA 2P6SA 3OYBA 2HZ8A 4G12A 1QPUA 4HYEA 3GM2A 4P9FA 3W2VA 1B9NA 1TZLA 2F5VA 2FSWA 1YW8A 2OBPA 1NBBA 4CZCA 1YJ9I 2EV6A 2WB1N 2GZWA 4EHPA 2WVNA 4AUXA 3HDDA 2KFDA 2W84A 3JRCA 5K0IA 1B9MA 2XAJA 1QLEC 3DWLE 3BG7A 3T0YA 5FCLA 3PO2J 3ROUA 4L6RA 3ZN0A 2NVTJ 2C03A 2RNGA 4BYYA 3F0CA 2XPWA 4NC6A 1KA8A 1RR7A 2CSOA 2A6HF 2HPMA 3AJMA 3L34A 4BJ6C 4DJAA 2B0LA 4LK1F 3WAQA 1TFKB 1DU6A 5J4VA 2I8DA 1SFUA 1LDDA 1WASA 4MVRA 2DYSH 1MBKA 5FO5A 2WV0A 2R7ZJ 4AX2A 3G4XA 2LIGA 4RGSA 3GEEA 2DA2A 3DM5A 3E5XA 5FB2A 3EUHA 4HSRA 5JFRA 2JZYA 1DDNA 3CD6I 2G7HA 4E7JA 3I4MJ 3Q7GA 4RBOA 5KHDA 5D5UB 3LFKA 4LK0F 2JVGA 1HSJA 2ZSHB 2XS8A 4I0AA 3ASOH 1JPJA 4PCQA 3FXRA 4HNUA 4YT2A 3IH3A 2GBYA 1O3UA 2XXAA 3ZC4A 1DOWA 4HX7A 2HU9A 1BIAA 1FYMA 4BY1J 1EI7A 4FASD 4LG0A 1MD0A 2L4AA 2BW3A 4UB8C 1XGOA 1VI0A 3HOTA 5J6XA 4ZDLA 4LG0B 2ZBKA 4R32A 4L9NA 2FBIA 1R36A 3F6VA 2OZUA 3W3CA 3JREA 3SZTA 3E3VA 3L1PA 3IKVA 4DYCA 3PQJA 2XLHA 1FNNA 4L0YB 2HMQA 3K6GA 3I5QA 3BR6A 1VTNC 1OXKA 4LACB 1Y8RB 1HBXG 1ZHWA 2QNLA 1WZ2A 1HE1A 3L8JA 3S27A 3NQOA 4RM3A 4YWQA 4U0YA 5M3FJ 1MKMA 4AVZA 4ULWA 1MIJA 1G5ZA 1HDPA 2UZKA 2XPUA 4JW1A 2FUG2 4AIDA 3EG9A 1X4OA 2MGQA 1X3ZB 3P9IA 2KRHA 3D5RC 5HLGA 1JUSA 3BZ6A 2QZ8A 3IC7A 3NYJA 4CYCA 3O10A 1SFOJ 1Q0FA 1W36D 3ABTA 3CDHA 4D5FA 1T9KA 2PNOA 1U5TB 4JC7A 1AA7A 3OOPA 2EZKA 4B48A 4IRIA 1S6LA 2BL2A 4G0HA 4AE4B 2W24A 2YLDA 5DCMA 2CUFA 3LLIA 1KYWA 4Y17A 4Z2YA 2KC3A 5BMZA 4CIHA 3K70D 2EFQA 5F08A 2LKSA 4BXFA 3GZ6A 4R8HA 2DJNA 3QPTA 2VUMJ 1V55C 4LLNA 2M8GX 4CDYA 3FXKA 5HODA 3WE2A 2E2IJ 3K4BA 4BAYA 4ZZDA 1K61A 2UV1A 1T08B 3L00A 4A3KJ 5J3LA 2GQQA 2HYFA 3CUQC 1AHDP 3F47A 2WBMA 4JYKA 4YELA 2DOFA 4LLCA 4DYQA 5B1BC 3HTSB 2Z5UA 2R3SA 2K9SA 2XLOA 3C62A 1R5GA 3AGTA 3ATPA 4EJWA 4BUPA 2ZMEC 3KZYA 3RPQA 3TEDA 2A1DD 2LK4A 1TR2A 1RUOA 3HOUJ 2RGVA 4Y3OA 3A01A 2M4GA 3MYIA 2CU7A 1MQVA 4XPXA 1RMVA 4JP0A 4CZZA 1SAUA 2EPLX 2HMZA 3K9TA 2O61A 2W4MA 3NWSA 3B02A 5A6KA 1ZYRF 3SEQA 2AXTC 3HOYJ 2K7LA 1Z9CA 2HYGD 5AIPA 3V5ZA 2RD9A 3K1HA 2XIGA 4ZLDA 1WJDA 4UVCA 5DTDA 2JSCA 2VBZA 4A3MJ 4P1WA 2NG1A 1NFOA 4JJGA 2A5YB 3AOUA 2HI3A 2KISA 3LSRA 2NNYA 5EG0A 4ZTFA 2GOXB 2XASA 2L6GA 4U87A 3TK0A 4CDVA 2R25A 4JX4A 5LEKA 1W0TA 1OYWA 4O3MA 3X2QH 1V54H 2YL0A 1CF7A 2DMUA 2VI6A 3J7ZI 1WGXA 1USTA 2VC0A 1AU7A 3OMYA 3W6VA 1XZPA 1WHUA 4FX0A 1VK5A 5BQIA 3WTTC 2P1AA 5L3FA 3K2ZA 3CF5F 3KYIA 3QMKA 3DTIA 5JP7A 3M79A 2YL1A 5J47A 1QVUA 2DOEA 4NB5A 3M8EA 5DS9A 4F93B 2LKPA 1CGNA 3AG1C 4NC3A 3QP5A 2W25A 3KEOA 3S15J 3K7DA 2OV7A 1T98A 4BE2A 2DMPA 3WGGA 1WI3A 3GLXA 3C7JA 1D0YA 4S05A 4JTAB 4AIHA 5IP9J 3E7LA 3M1CA 5B1BH 2Y3GA 2E87A 2LP0A 2D4UA 1JOGA 4PACA 5D6EA 2BW3B 4OD5A 3W4YA 3ZG1A 3J06A 3NKEA 1W5SA 2FX0A 2J46A 1OFCX 3C8GD 5LGTA 5KYXA 1BOBA 4IOAF 4Q48A 2HZTA 1TNTA 4HBLA 1R1UA 1ZRDA 2DA7A 2LRDA 3U5SA 3I4UA 4KMUX 3I4NJ 3CQZA 3Q9VA 3JT1A 2E5ZA 4PK4A 1PYVA 3C3WA 1JTYA 1LDKB 5K7HA 1Y1VJ 1ULYA 4MFDA 2OQRA 3JSPA 3TOMA 1VF9A 1Z7Qc 5KVRA 5LRSA 3CO6C 4BHBA 2CRGA 2G0EA 4HSTA 3RPUA 4BNCA 4DVYP 3BWGA 4UY8I 5E20A 2R93J 2Y3BA 4QLCU 3CCRI 5JLWA 4D1QA 1X1DA 2RAEA 4RB2C 3K1PA 3Q3SA 5DYMA 2GA1A 4M74A 5IP7J 5DM7F 3US6A 2K86A 3CTAA 2ZD9A 1P6RA 1A31A 2XHKA 4FAPB 5JT4A 4CYDA 4DIQA 2R7XA 3SEZA 4CYCB 2BY3A 2J5PA 2P5LC 3KIOA 1WJCA 3V7CA 3F6OA 3OV8A 4ZYAA 1P4XA 4ZC3A 3MKWB 2XC7A 3E6DA 3JCUQ 3A4CA 2HYJA 1PJRA 1SZIA 3HZJA 2EIJH 4GO1A 3CCMI 3BT9A 5GADJ 3ONQA 1S7EA 3LSKA 3NMIA 1KQ9A 2JTVA 2O7OA 1G8XA 2XDVA 4EGYA 4MEXF 3T9OA 2LDUA 1LDJA 2G3KA 2QVOA 2H7BA 3OYCA 4DYRA 2WB7A 3HJCA 2J8WA 1XG1A 1GHCA 4LDKA 1G3TA 2MD0A 2K9LA 3S2HJ 3M07A 4XM3A 4MNDA 2ZCWA 1M57C 4ASNA 2GWWA 4II2A 1KQ8A 4ESFA 4OIQF 4M9ZA 4D7MA 1LE8A 1LEBA 2NS8A 3OYFA 4IB4A 3H9QA 3HOWJ 5KYNA 2GXBA 2G3VA 3W8HA 1A6IA 2FNAA 1RNLA 3L2QA 4UB6C 4XBFA 2IGNA 4A3EJ 5HLTA 1TL8A 1SR2A 5COFA 1YW7A 1OR7C 3TJ5A 4JQFA 3G71I 4F91B 3JRTA 4MTEA 1BR4A 5FRNA 4G7OF 1RKWA 1T38A 3RVZA 1R23A 4RAGA 3T6JA 2R02A 3MZYA 4EV0A 1X3UA 4XQ1A 2EPMX 2TRTA 4CS7A 3CAXA 1EKYA 3HOXJ 2OU6A 2M4KA 2XL6A 1YZAA 3AKZA 3MZHA 2EJRA 2PBEA 1Z05A 1FC3A 1SEUA 1VZ0A 2DDBA 3QYBA 5F0HA 1ORYA 4IEJA 3H36A 3K4LA 4LGWA 3RVYA 5CJ9A 1OCCH 4XRSA 1FOWA 2W1OA 4GXOA 4BH9A 4Y13A 1Z21A 2HVQA 4AIKA 4HRIA 1BI0A 4KISA 1TWGA 2MWQA 2XLWA 3FXUA 3S3OA 2J9WA 1BR2A 3SZPA 1KYZA 5ICCA 1QU3A 3PIOF 3KP5A 3I4PA 4CXFA 1X2NA 1ORJA 2FFHA 1OR7A 1E84A 5L0JA 2OU2A 1FBUA 2P5VA 5HS8A 3HGYA 1G59A 3GTLJ 3HEFA 4H0EA 2IS4A 3ZMVA 1ZR2A 1WTYA 3AQCA 3ASNC 3HXLA 3GMEA 2J0WA 2QUFA 5DDGA 3N2ZB 4M73A 1XCVA 2NPUA 3VM6A 1B68A 2O8XA 4FE7A 3GORA 4QWQA 1B8IB 1Y6DA 2YSRA 1U0BB 4YL3A 3DE8A 3L8IA 2QM3A 1N78A 1RCPA 4HNVA 4DNCA 4I09A 4B47A 4XEFA 2DYSC 1IJWC 1M2VB 2NSGA 3T6BA 3L7WA 2Q2EA 4ZZLA 3DBLB 1FBSA 3M8FA 4RD9A 5CQGA 4AYBA 3F21A 3RQFA 2XRLA 3VFZA 2H09A 4V2FA 3KYJA 1C0WA 2KJBA 4KYWA 2VH3A 3HNLA 1PD0A 2WL8A 2XS1A 3J81K 3LUTB 2H6CA 4HFFB 4C3HJ 2QY9A 3FXQA 2QTVA 4U9EA 4AC0A 3F8NA 3GTOJ 2QQ9A 1RKCA 2XF5A 5COGA 2VXZA 2VOPA 2L01A 2CQXA 2XRHA 4JTCB 4N9HA 1ZHYA 1ZAOA 3L2UA 5L0CA 3HNIA 5L0GA 3OS0A 1EA3A 1WPKA 3SFZA 9ANTA 1X1PA 4KT5C 2V6CA 1ENHA 1SMTA 2ZO4A 1VQMI 4OIPF 2XAHA 4JJFA 4P9TA 1Z91A 1FT9A 2B7EA 3KP2A 4HX8A 1TTYA 4UXNA 3AG3C 3A11A 3LA7A 2HXIA 4ZDPA 5C4JJ 5IYDJ 4CSAC 4CSWA 4WX9A 4MQ9F 1Z6RA 2V9PA 2IAIA 2UXNA 2V9VA 2M0MA 1WQ2A 1ZN2A 4GDFA 3ASNH 3H5RA 3Q5FA 1D8KA 1M2VA 4YK5A 3KZZA 2H8AA 2P7CB 4IRGA 1JTXA 3MCZA 4M6VA 3VSLA 1ZK8A 2LBFB 3VPRA 2GDCA 1BOAA 5LRRA 4UUVA 1FP2A 3CF2A 4I44A 3R0JA 4O6JA 2AP3A 3E5UA 2HOAA 3EUAA 3FDYA 2KIQA 3J80K 2D45A 3VYRB 1IRXA 1WWXA 1K78A 3I5UA 2IT0A 4CDAA 1D5VA 4MFEA 1LI5A 5DS6A 2QKLB 1A35A 1BI3A 1WH7A 4UDVA 2LVSA 1M1EB 2M45A 3IRRA 4OMZA 2DA6A 1VQ5I 1OW7A 2J45A 3U8PA 3CMMA 2F2EA 1FWZA 3IHUA 4NNJA 4XMYA 5HLIA 3W6KB 1F36A 1Z0XA 3I9V2 3F46A 3NYLA 2XRNA 1XPXA 3LQQA 3ML6A 2CQNA 2KDZA 4U5GA 1IDYA 4YL1A 2LREA 1QHGA 4KUMA 3T8RA 3V7RA 2ZXJA 4ZH4F 1JHHA 5HNFA 2PMUA 5J1RA 1XDUA 4LFUA 3T1BA 2VCCA 2WZGA 1LE4A 4U9DA 2DCEA 1BBHA 1XSVA 2KRCA 1Y0UA 3B0UX 5TISC 3P9KA 1ORSC 1JT6A 2I15A 2IOQA 2RKHA 3FBNB 4XEKA 1DPUA 2EA4A 4XLAA 3GXOA 2FD5A 3F23A 3HB9A 3ZQVA 2AO9A 2HR3A 2V1NA 1XMKA 1XGMA 3HBLA 4RM2A 3TBIA 2D5VA 3J7AO 2A5WA 2EZIA 1I4ZA 4J01A 3CEXA 1BDJB 1QVXA 2H1KA 2EILC 4HEA2 3CCVI 3BG9A 1EKEA 1S72I 2OEXA 1X1CA 1A41A 2L7ZA 4JURI 3KP4A 5FKMA 2Y0SN 3V4GA 3U2MA 2ME0A 1J0RA 2FXAA 3H3ZA 4CCKA 4M9SA 4A0ZA 4D9JA 5ICGA 2ZMEB 2I10A 3V42A 2ZB9A 5LHHA 2WWYA 1R58A 1W0UA 3CUQA 3ABLC 3WU0A 3V8LA 2JA5J 2CNWD 5ILUA 1S7ZA 1J9IA 4XL9A 4O5VA 2VL8A 3F8CA 3QYFA 2ZXRA 1XMAA 3OYIA 3FKJA 2YZSA 2GIZA 4ANJA 2G7UA 3I56I 4BACA 3S17J 3DCFA 4N06A 2K85A 4OOIA 4U5DE 3FZVA 1FOXA 3PM1A 3MWMA 2XLMA 3K2AA 1H8AC 1LFUP 1KU9A 1LEAA 1JGSA 3CSKA 5E17F 1ZKGA 5KNLA 3K4MA 1U3EM 2FQ4A 3IL2A 4CICA 4HDUA 1AKHA 3S93A 1V5FA 2OTLI 2KT0A 2F6CA 1K6YA 1AKHB 3E6CC 2IS6A 4G78A 2O9XA 3NMKA 2VJ4A 1NG7A 5CI9A 2V79A 1QQ3A 2EPOA 4M9XA 3GWZA 4YRVA 5F0CA 2DT6A 1TKNA 2E71A 1LS1A 2LFFA 3MYFA 2GA0A 4MW3A 2JWTA 4XSXF 3HNJA 1GDTA 4U0WA 1I4YA 2BXYA 2CJJA 3BTJA 3DQVC 2DQRA 4KT6A 1TQMA 2YLGA 2CUZA 3K6BA 4BBSJ 2XGDA 5M5YJ 1MGTA 2XM4A 1PP7U 1XSXA 1K40A 4FCYA 4XN3A 1T6QA 1JKRC 4HQEA 1VFCA 5J8CA 4IHTA 4EVIA 1C02A 2ZXWC 2K3FA 1T56A 5IT9K 1V55H 3DXJF 3S16J 4BKXA 1Y1WJ 4BXXJ 3M4OJ 4YG2F 1W4MA 3HRSA 1R5HA 4CDGA 4CCOA 2M4EA 1BJZA 2LFBA 3MMYB 2IXNA 1RI7A 3W8IA 1WGWA 4XNFA 1YYJA 1FBQA 4E18A 5H2FC 1E85A 5IYBJ 5BUOA 2F4OB 5E1XA 1OCZC 1LFPA 2HFIA 3KP3A 2OUMA 1YAUO 5EHHA 5A2QK 2NVUB 1K79A 3DEUA 2PMHA 2Y48A 4XLFA 1ON2A 2A69F 3ZGKA 5DUIA 1A5JA 1SMYF 2KQRA 1IRZA 4W97A 2Q9AA 4J7TA 1X4PA 2KGOA 2E1OA 2IEKA 2V26A 4ULVA 4IRHA 4NC7A 1X3WB 4LJZF 1UAAA 2CFOA 2XSDC 2YX4A 3RZOJ 4MVUA 2XKPA 1R49A 3RYPA 5HOOA 2E5NA 2RNJA 3OYGA 3HL2A 2X1DA 4E7SA 4O6YA 2K9MA 5L3VA 1U78A 3PHF2 4HQMA 1ZVZA 4II3A 4JCZA 1T39A 1IN4A 4KFCA 3TOBA 5D8LB 1ZGJA 3RH3A 5AC5A 2VOOA 1MMAA 3HOSA 3TO7A 4RAZA 3JZ0A 4UNOA 2HS5A 1T8IA 3LNRA 3U1KA 3S8PA 4U5BE 1X58A 2DJIA 4XOTA 1LS4A 2YHSA 2FMLA 4OAYA 4MO7A 4G7ZF 4WWCA 5JLXA 3HRTA 2XVCA 4FHTA 1HQCA 3OEOA 3GTJJ 3F22A 3RQIA 3B6CA 2WAEA 2H8WA 2ZXHA 4E7HA 1BA5A 3G50A 2VQCA 3MKLA 2M8EA 3FXMA 3ZMUA 4ZJZA 5DCFA 1YO5C 2R7TA 2IXMA 3HSFA 5F6FA 5HDNA 1ETXA 2GXGA 4IO9F 2OPTA 2LD6A 5K7ZA 3NRVA 5LLQA 1WATA 1U89A 1IN7A 2RC4A 3Q0VA 4B8XA 2WVQA 5TJJA 2XKOA 2CYDA 3UGOA 4ER9A 1AWCA 2DMNA 2OC6A 2X85A 3LEVA 3WTZA 3S1RJ 2A3SA 4LLGF 1OKKA 3TW6A 1T5OA 2VC1A 1MMSA 3PUFA 4JBAA 3WU1B 1VQ8I 2V6EA 3U3FA 3NARA 3SQNA 5K5RA 3GTGJ 4I02A 4KNWA 2F5DA 2M34A 3NRHA 4M3FA 3LA2A 1YLMA 3WGIA 5FLVA 2HWVA 3U8VA 3O3KA 2IS2A 1J59A 2CGEA 1VQNI 3JAMK 2BHYA 2ZNYA 3VYTB 3C1DA 4AWXB 2H6BA 4X0RA 4A0YA 3EFOA 3ZQFA 1R71A 4C3IJ 4LITA 4U88A 1ZU5A 4AL0A 1D1CA 2BHZA 3K0LA 1E3PA 4NHJA 2O03A 3RW0A 5E1WA 3RTRA 3JCUC 4MW8A 3CCQI 3U9MA 2JUCA 2EINC 1ZGWA 2DLLA 1KTMA 3H3VK 4YIRX 1Y56A 4HEAJ 2HQAA 3L2CA 2R5YA 1FSHA 4KBLA 1BI1A 2EQRA 4NBQA 3WTWC 3Q6MA 4M71A 2HEOA 4ONSA 1I3AA 3LSPA 3CZ6A 3DZAA 4EGZA 1NZEA 3VEPA 3I71A 4YN0B 1UFMA 1PUFA 5L3BA 1M56C 2BVMA 1FTZA 3TL4X 3S2DJ 2K9QA 2ACJA 1OYYA 1YVIA 5B3SC 4UUSA 3AQBA 1IDZA 3CESA 3R0AA 2LK2A 4RGUA 1S9HA 1IF1A 4KC9A 4R1HA 2K40A 2XAFA 1HF0A 2RSEB 1ZARA 2LTPA 2EZHA 3LSMA 2RQPA 3S14J 2AWCA 4JVSA 2HOTA 4GYGA 1FOKA 2PJPA 5JRAA 2F5CA 3LS1A 1LFBA 3CCYA 5ICEA 3JRGA 4HA8A 2OAZA 3LWFA 3MKZA 1A7VA 2MBFA 1X1BA 5EJCA 5TJ5E 4RGXA 1IZ1A 4F55A 2PBIA 1RKEA 4LG3A 4A5MA 5LEJA 1BI2A 4O7GA 1O7FA 4BDZA 2JPUA 5H20A 1R9TJ 1HLVA 1DUXC 2VQLA 5J4YA 5K7FA 2P81A 3I59B 3SNHA 1AVOB 2PX0A 1TWAA 1NG1A 3HSEA 1Q1HA 4P96A 1W1WE 2HSBA 3HC7A 4XPWA 1R4NB 5CPRB 3I5PA 2J5OA 2E36A 2M30A 3VF0A 2W85A 3ECHA 5KYYB 2VBWA 2ZC2A 3OS1A 2JA8J 4BJ5A 2LMDA 1WJEA 3QP6A 2JA6J 1SVMA 3MKYB 4B1RA 3HPHA 4RLQA 2Y69H 3CQZJ 4ENJA 1DGRM 2M3AA 2XROA 1KGSA 2CFXA 1VQOI 3DEWA 3G73A 2VXDA 1J2XA 1R5ID 4EM1A 3DU6A 4MVQA 3HKZA 2HGCA 2HTSA 1QZEA 1D8JA 3B6AA 2YS9A 4G8XA 3N97A 3EPZA 3OYMA 3HRUA 4NQWA 4HLYA 2XL4A 2L0KA 4FT8A 5FROA 6PAXA 2KK1A 1IAWA 3SXKA 4DVZA 2QLAA 1P7IA 4GRIA 4OINF 3DLLF 3CJQB 4XKCA 4DZJA 1W7PA 1GV5A 2VJ5A 3FBIB 2R05A 2CQQA 5F04A 1MJ9A 1T33A 4OAZA 5B3IA 1PP8F 5EEHA 3T8TA 2DPUA 4PFOA 5IYCJ 1F43A 3KZIC 2OQGA 1RR8C 1PV3A 2KNHA 3JYHA 3QYEA 4Y4RA 3LSTA 1TFOB 3DD7A 3FOPA 5LHIA 3M1CB 2LY1A 2XLEA 3F9KA 3L0IA 2ESHA 1MMGA 3PFIA 2LQGA 1TWFJ 4HV6A 3F3XA 3LQRA 4NTBA 2ZFUA 1ZHXA 5EZHA 2HQNA 3O8HA 1MJAA 1I5ZA 1LJ9A 1ZLJA 1QBJA 3PSFA 2AVKA 5JSLA 1W2WA 2CNWA 3WHCA 3MFKA 3DAGA 5E1ZB 1FNTc 1R4MB 2QGUA 4O6NA 2K3PA 2MC3A 1YYVA 4IHYA 1L3PA 2J0XA 2ZSIB 2E2JJ 4CJGA 3HUGA 2EZLA 1L0OC 4MQVA 4XRSG 4RDUA 4E6KG 4B44A 4K2EA 2CCYA 4KIBA 3QW0A 1XGSA 2M7AA 3CCEI 4JEBA 2AQEA 1BM9A 4XQFA 1E3OC 5DVWA 3T6GB 3ZCOA 1MBEA 2BEOA 1GT0C 3PSIA 5ED4A 4H54A 2HKOA 1IO2A 4B09A 2UUHA 4LLEA 1U9NA 3IQ6A 4PJ0C 1K6OA 3HSRA 3Q9SA 3TKYA 4IAQA 5D4SA 3ZMTA 4V19K 3F8FA 3K1MA 3JR9A 3RYRA 1LQ1A 4HF1A 5LHGA 2F4MB 5FZTA 1IV6A 2CV1A 4UUSB 1LPQA 4FE4A 2VQGA 3T4RA 3WTSC 1WFXA 1G6NA 3IRQA 3HLZA 3PMRA 4NCQA 4Z9IA 2IGOA 3PO3J 4BEHA 3TO6A 3ZQYA 3H0GJ 3S2WA 2OOCA 3I64A 3WGHA 1ZW2A 2A0BA 3EUHC 3HYIA 1I6HJ 1OMIA 4ZYDA 4C7OA 2PN6A 5KCMA 1LI7A 4AVPA 2YU3A 3ESWB 2IBFA 2L81A 4I99C 2R0QC 2AS5F 3A03A 3L09A 3H65A 4HZFA 4CUGA 4BY7J 1ITYA 2M0CA 4BGDA 4HDVA 1JXSA 1YW9A 4E70A 5BOXA 5HVQC 2BC5A 1WKMA 4QTRA 4JRZA 2ISYA 2F4IA 4FETA 4DZPA 1MNDA 4A0XA 2R7DA 2Y30A 2FJ1A 3ZRGA 1TT0A 4WXHA 1RIOH 2DPDA 1R7JA 5KYWB 2VKVA 2Z1DA 3OR1C 3HNKA 5KYWA 2R7FA 2KMUA 2O6GE 3EQLF 3I0TA 3VRCA 3DEEA 3GANA 3CJRB 3RKQA 4DRJB 3FIWA 1B59A 2DT7B 2E7WA 4AE4A 2J7PD 4UUTA 1TLHB 2A6EF 4C2TA 3ZDLA 1HA8A 2BBYA 2QYOA 3FHZA 2EIKC 1G3WA 2V3CC 1JMWA 5EGYA 1LPEA 4XWJA 3OS2A 1HKTA 4DRHB 1ETVA 4EBJA 4Y7NJ 2DBBA 1I5NA 1RC9A 4C7OB 2Y3DA 2Z9OA 1J09A 5H6QA 1SFEA 3AGUA 4XORA 1BC8C 4CJOA 4KITB 3RQEA 2L7MP 5A6BD 4I6ZA 5GAHJ 3FDQA 3JRBA 3LL7A 4I7HA 3JRDA 2XAUA 1DQUA 2JVHA 3PQKA 1A0BA 4XONA 5CVVA 1S5LC 4O79A 1TW2A 2PMZA 1STZA 1WN0A 2HDWA 3U2RA 2L2OA 1OISA 2LR8A 2UXXA 2QENA 3V8KA 1CGPA 3ZSUA 5A69A 1HW2A 5EG0B 4W8KA 3CCSI 5EDNA 3S3MA 2R7OA 1HCRA 2JUGA 2NS0A 3ZMDA 4JZAA 2OG2A 3AG2C 1W5TA 2Y3HA 2LF7A 2XSJC 3LJBA 3EDPA 2DA1A 4IHXA 3CLQA 2CMPA 1ZZPA 4C3JJ 5TRDA 3K4JA 2ADUA 2Y31A 3KYLA 3S29A 1UELB 4HF0A 4M63A 1VNDA 4XLPF 4WXCA 1OKKD 3IAS2 1S7AA 1FYLA 1G4WR 3FAPB 1YI2I 1VQLI 3IV5A 4OU0A 3UMHA 5DQTA 5D92A 2L9NA 4HAMA 2X0LA 2K5CA 4BQOA 4HFKB 4EBBA 2PFBA 5FKNA 1WWPA 2L54A 5JHUA 4OWRB 1VYIA 3EHMA 1WJAA 2Q8KA 4Q7CA 5DS5A 3BROA 1HXDA 3RKWA 2ME6A 3W6JB 4CSAA 4U5CE 5FFXA 3I53A 2PX3A 1XMXA 2AHQA 4KDPA 5L0HA 3O55A 2BZTA 1H7IA 4EKWA 4I0BA 2DFFA 2FA5A 3LNQA 2NVYJ 2CYYA 4UV8A 5IT9Z 1TW3A 4IAOA 4JTDB 4U5HA 5DD4A 2QQAA 1HKQA 4K7BA 1L7CA 3DTKA 2E2HJ 1PVEA 2EFNA 2HVRA 1XCBA 3ASOC 1B4AA 2VB6A 2VBXA 2WAQA 3LNMB 3CCLI 3JRIA 1P92A 1LE2A 2PMZN 1OCOH 3OWTA 4D5CA 1SVLA 4BQNA 2DA3A 1I39A 1SD4A 1BW5A 2GOMA 1EJ9A 1ACIA 2X6YA 4EJTA 2V4JC 2X1EA 4ETSA 4K0DA 4RBNA 2MW8A 4KIGA 3IP4B 4PZJA 3QPHA 2IM8A 3EZIA 1T6SA 5FD6A 2GWRA 2E1CA 4WGZA 4BPMA 3EH1A 1YS6A 4LOCA 1FP1D 3GVAA 1SVOA 3KEQA 1XZQA 4MTFA 1FX7A 3BG3A 1K83J 2Y9ZA 3KYCB 1U5TA 4IRUA 2FAPB 5HSWA 4R79A 3A02A 2J7PA 1R1VA 1CGOA 3LSHA 1FMWA 5BQGA 3A01B 3RKOF 4YFXF 5FJ8J 2MA3A 2XB5A 4C3EA 3MX3A 3BR3A 3RJPA 5FLMJ 1NSGB 2IGKA 5A6JA 3R60A 1OCTC 4BHCA 3S9OA 2R4GA 4NY3A 1LVKA 2HSQA 3SP1A 2PFDA 3ZTMA 1YITI 2R92J 4A3FJ 2CV2A 3ERMA 1ETWA 2MH2A 2BY1A 2VKHA 5L0FA 4QDLA 3I59A 4IF4A 2K27A 5M5WJ 2FEZA 3VODA 3GZNB 1M2OA 1TWGJ 4ENNA 3PNVA 5L3CA 3RI4A 3GZ5A 1B72B 5IOZA 3TP3A 4MS2A 3B29A 1JUPA 3G6EI 4A3JJ 3OSGA 2LSEA 2WAFA 2RVCA 3OYKA 2W7NA 1JI8A 1PD1A 5E3CA 4RB0A 4B3XA 1NU9C 1H88C 2X4HA 1JKOC 4XLCA 1S05A 5D4RA 3WE3A 4WABA 1ZTRA 2AQFA 3GCMA 2GM4A 2DTRA 1MZBA 2MC4A 3SJMA 2HXOA 4FTHA 3OSFA 1ZRCA 5BNGA 3OYDA 3PDMP 4LDQA 2DFHA 3GX4X 3FOOA 5KYUA 1LVAA 2YEVA 4C3BA 1YIOA 4FX5A 5KYUB 1D3YA 5CVUA 4E7ZA 1GM5A 1Z5ZA 3BY6A 4RLFA 3ABMC 3ZWIA 2DA5A 3I3LA 4M6YA 3FMSA 4M72A 4A3GJ 4YT5A 4IL6C 5FD5A 5E2QA 1XTAA 2FE3A 1TBXA 2F48A 1U0JA 3HKZN 5BS6A 3PJRA 2YRFA 1SFXA 1ODDA 3F8BA 5AC4A 2JPBA 3CMAI 2W82A 2LBFA 1UHWA 2XGXA 1Y39A 2DFIA 3WHBA 4BG0A 2JMWA 1Z3IX 4X0GA 3DKWA 1ZG5A 2EPFA 2XL8A 3CC7I 3S0XA 3QTHA 4A3CJ 2A05A 1E17A 2FRHA 3HG9A 1IUYA 5D5VB 3JRFA 1FYKA 1BC7C 1Z1DA 2B0JA 2PF4E 2IVMA 2QWWA 1XSDA 3LLKA 5CI8A 4N4NB 1FSEA 4PJNA 4CGZA 4BBRJ 3K4CA 3HHGA 4EJOA 1FFTC 4CS9C 1IV8A 5ERIA 2BGCA 2O3FA 3DPTA 3WU2C 1M6TA 4UVAA 4YIIA 4CS8A 1IW7F 1EH8A 2DMTA 3BTIA 3QQAA 2ID6A 1D0XA 2K4BA 3GM1A 2WTEA 4A3BJ 4HX4A 4L5IA 3GWLA 3N4MA 4JX6A 3TP0A 3C63A 5DM6F 2ZFWA 3GEHA 2R7SA 2DTZA 5HS7A 2YL3A 1T95A 3ZTZA 3QU3A 1MBJA 1FFHA 2EFWA 3IUOA 5KYYA 4N0BA 3N05A 2Z3YA 3FMQA 3I58A 3H92A 3GYHX 3TJ6A 1ERDA 3GWNA 1B1BA 3EGXB 3U1DA 2YU9J 4PFPA 1I1SA 2ZNZA 3C18A 3MQ0A 1V3FA 1FJLA 3ZQIA 4QIWN 4ZDOA 4OIRF 4YJWA 1WJ5A 2D2WA 3LSIA 1JKQC 4CCJA 2WC2A 2OTJI 1XDSA 2IPQX 2VLAA 3S1MJ 3TD7A 4C2MJ 5CLSA 1YQAA 4MVOA 2H8RA 1D0ZA 1HKSA 1MMNA 2PQ8A 2ELKA 3D5SC 1MDMA 3HTKC 2M87A 4A3DJ 3VYWA 1QPIA 2ELJA 2EV0A 4EM0B 2L9SA 4BXUA 2M64A 4YFNF 1YA9A 4HF2A 4ESJA 3S1QJ 3E9VA 4MTGA 4PGGA 5F28E 2X1CA 2KL4A 1Y6IA 2Q7RA 1RETA 3M7GA 3BZCA 5L3QA 1FAPB 2K9NA 2VKDA 3IQCA 1G3YA 5ILVA 2IP2A 1UG7A 2DK5A 1R6RA 1O3SA 4UVBA 2FBKA 2ASRA 4BEJA 3PCVA 3SDGA 3AFHA 2K4JA 1T6UA 2CS3A 2PI0A 1PUEE 1OW8A 4LIVA 5CVJA 4L9JA 5DUKA 2MSYA 2L3DA 3KCCA 3MZ8A 5FLXK 2PEXA 1HE9A 2EV5A 2L4MA 1F1ZA 5GAEJ 1A7EA 1LIHA 2O0YA 3SYNA 3EYYA 4P6IC 2KIFA 3HRMA 2RQQA 1MNMC 3MAJA 1YX5A 4XLHA 2XXAB 2R7QA 4WJ0A 4XKVA 3K33A 1IN6A 1X19A 1P4AA 3L9FA 1QGPA 1RPWA 3QOEA 4F4BA 3W2AA 4XKBA 2PLYA 1MBHA 3CC4I 4XTKA 5DD8A 1VQPI 1B72A 1N77A 2LFDA 3U3BA 1QKRA 2UUZA 4IPAA 3U0CA 2WY7Q 4GCVA 2F5EA 4I3MA 2MFZA 2WVOA 5D91A 2E60A 5AONA 2HUJA 1HW1A 3UNGC 2NUPA 2XLVA 4MEYF 2NUTB 3K10A 2EFOA 3ZR8X 4DRIB 4Y15A 2KHMA 3F8MA 2QF7A 2OJQA 2NVQJ 3CJNA 4KNVA 1Y4CA 3ZMZA 3OOUA 4Y52J 2OZ6A 2QQBA 2P6TA 2JQ7A 2ZJQF 1BL0A 1HOMA 4OD4A 4J7YA 3FF5A 3EGDB 1USSA 2W57A 3NAUA 4H4KC 3BJAA 2LCHA 4J19A 2AXLA 4BE1A 5IT3A 3JTGA 5HS9A 2VE9A 1RJ9B 3PNTA 2HV7A 4FESA 1NU7D 1MH4A 3WG7H 4A69C 1DP3A 1I50J 3SFIA 1LM3B 2IYLD 4E7IA 5DV5A 2A07F 2DYRC 1OR2A 4JCHA 4OIOF 1F5TA 1A04A 3CCJI 1D5YA 1WOLA 1UHSA 1S8NA 4N6HA 1ZLKA 4RMNA 5JS5A 2IRFG 2EBIA 3R4KA 1K05A 1MBFA 2ZMEA 1J8YF 1OR3A 5L0DA 4CCMA 4QSHA 4AIJA 2W9YA 1WH5A 4L0ZB 2P0NA 4AK9A 2PG4A 5CKTA 4D4XA 3NYMA 2Z2SB 3QAHA 2KW3C 1DU0A 2O8KA 4GQHA 2VN2A 1I27A 3VOEA 2KRFA 4PSWA 2FMYA 4J00A 3HIFA 2LLKA 3MLGA 1YTYA 4HNTA 2YX7A 2XB0X 2XGEA 3BR1A 2IA0A 3FM5A 2CQ7A 3UGPA 3PUBA 5E33A 3NEUA 4I1MA 3OL4A 3B0PA 3HKKA 4JE9A 2ZPAA 3SEOA 4ITVA 3EETA 4BQAA 1JPNA 4ZLCA 3E5QA 5E18F 3ISPA 1YE9A 4BQQA 3DJNB 4B4CA 3GBGA 2COMA 4A3IJ 4OMYA 3REOA 2C6YA 4EBKA 1GV2A 3UKGA 5E8GA 2FQ3A 1T01A 3JTHA 4HV5A 3VDXA 4CO8A 3U2LA 3GEIA 5KAFC 4B6IA 2X51A 5FFZA 3QVZA 3OIOA 2IXPA 2KZGA 3CCUI 1EF4A 1N25A 4A6DA 2E7XA 4IOCF 4U7DA 2O9LA 4A93J 3VWBA 1S7OA 2LNBA 3ABUA 4A2UA 4B3AA 1JJ6C 4S04A 2QBYA 2Q1ZB 2A0UA 2DDAA 3IH4A 4GYIA 5EYRA 3TW7A 5F1JA 4E0HA 3GTKJ 3NDBB 2JSPA 3C8ZA 4EMSA 1APCA 2H94A 2B63J 256BA 3DPUA 1DGWY 1CGME 3NWTA 4NDLA 4RAFA 1B8IA 3CC2I 1YFHA 2JPCA 4NQFA 1S3JA 5JR3A 2WB1A 3ITFA 1MSEC 2Y0SA 2DODA 1YIJI 2CW8A 4AM3A 3M1EA 1WVRA 1EA8A 2CDQA 3BLYA 4ENMA 4ENKA 5BPIA 2X6OA 1Y0NA 4I01A 5J40A 1QSPA 2Q0OA 4ABZA 3KH2A 4EIYA 1E3HA 3D5LA 2V1UA 1JT0A 4AD9A 2Q00A 3C8GB 3FVYA 1ETOA 3A0HC 5ICFA 2ISZA 3O6XA 1J8MF 5CYVA 5M5XJ 2VKEA 4LMYA 5E3OA 3OL3A 4QI2A 3FWEA 2NYXA 3G4SI 1SAXA 4PDKA 4N9IA 4E7KA 4HOBA 1H9TA 4XR6A 3ZQHA 3E6BA 1YYXA 1UHMA 3NKDA 1U6HA 3KPHA 1E2XA 1WCMJ 2XF6A 3EGXA 3IQ5A 4YEJA 1ZH5A 4IHSA 3MN2A 4IZZA 5EF6A 2DAOA 4BL0B 1HY5A 4FX4A 3AL0C 2DGJA 2HV6A 3DAFA 2CUEA 2KJGA 3IEEA 1FPQA 5LFAA 3QZCA 4PJJA 3Q6NA 3UR3C 2BY0A 2VCAA 2L6FA 3RZDJ 2ZJRF 4KNYA 1H9GA 2VPRA 3K4KA 2I8BA 3BZKA 2BVLA 2K02A 3KKBA 1I6XA 3FX3A 1VQ4I 2XLDA 2BXZA 1OQYA 2Y2ZA 4IVNA 4WXDA 4BJ1A 2E35A 1LNWA 5BQTA 3LSGA 3ABMH 4NUBA 1O4XA 3ECSA 4UV9A 4CCNA 4CHUA 2DT5A 2ID3A 1RKTA 5C3EJ 2YR2A 4WK8F 2NOJB 5GTHC 4A2NB 4A6EA 4V2GA 2WADA 2CGPA 3JYYA 2M1BA 4DXWA 3DI5A 1RXQA 5B1AH 2Q2EB 2RDPA 3BTCA 3ZIBA 4A5NA 4RA2A 2QEXI 3P7NA 1NHAA 2M9HA 1FY7A 4W1UA 5LBQA 3GTPJ 1VOMA 2DN0A 5J8FA 5GPGB 3RDIA 5KK1A 3GO5A 1K4SA 2AWYA 2KYHA 3LS0A 2H27A 5L3EA 2QCOA 3KETA 4KIFA 1Z7UA 3KP6A 4DGWB 1FEXA 2L7FP 1OCOC 3G1OA 1JHFA 3BTLA 3MVPA 3V7OA 1EQ1A 1NLXA 1ZG3A 2NXNB 1V74B 3J80Z 4NTAA 3K1IC 2X6XA 1X1AA 4F52A 2WV1A 3LFUA 4XLNF 1IRGA 1YG2A 2XUBA 2HKXA 5JHFA 1U8BA 2VODA 1BBYA 2CWEA 3E1SA 3TGNA 2H7OA 4PJLA 1Z67A 5IP6A 2ETHA 2UWMA 1UG0A 4LB5A 5FGMA 4YFKF 1XN7A 3ZP5A 3HUGB 2HOEA 3UMIA 5KYXB 1R22A 3DM9B 2YKZA 5AGFA 2HQ5A 4IHWA 1ZG1A 5EK0A 5IY5C 1IXCA 5HNHA 1ETYA 2R5ZA 3G4ZA 2MABA 2HPIA 5K5OA 4CH7A 5HV9A 3CJTB 1CQTA 3TQNA 3B9QA 4MVMA 3QOPA 1A6QA 1E83A 2L02A 1K78B 4MHGA 2OQMA 2YWAA 3LAYA 1BIBA 4BHPA 5F5FA 2JN6A 3ELKA 1LUJB 4YIFA 2NVXJ 1YA7O 2EA2A 2GAQA 1GUUA 1JR8A 1OPCA 4FQGA 4BJTA 2X0CA 3K1IA 1Z6TA 1U2WA 1TQPA 1UMQA 2FU4A 3RKYA 2OA4A 3CUOA 1Z3YA 2P7VB 5DEQA 3COAC 4EATA 1JUMA 2VT2A 2VJIA 2LC2A 1EH7A 1VQKI 3TOLA 2IXOA 2FOWA 1JGGA 1C03A 1T6IA 1IN5A 1UCRA 5GPAA 1N1CA 2E19A 3G1LA 3M4BA 1MNEA 4CS9A 3H5NA 3GF2A 4D4NA 2ZKZA 3ZOBA 3M4CA 2Z16A 1FR0A 1OXBA 3BCAA 1ZHTA 3ULQB 3FXHA 3VSKA 3CP8A 3VAYA 2EINH 1WI9A 3FHDA 3DLAA 2IW5A 2DQLA 4XEVA 2IBDA 2QQ8A 4MGRA 4ZYEA 2MLKA 1ZR4A 1H6GA 1HC8A 3DBHB 2AU5A 3E70C 4DBRA 4N4OB 2Z99A 5EGOB 2KPMA 5CVIA 3A1YA 1K7AA 5COMA 3L2WA 3OYHA 2Z33A 1P9QC 2DO7A 2VCBA 5B3SH 1T0FC 2OCEA 2VT3A 5D6FA 4IHVA 2A68F 3K69A 2ZXOA 2HVSA 1Q0KA 3GODA 1HMOA 3E0JB 4MVSA 3EUKL 2CV0A 1TWCJ 1QHHD 3DF8A 2PJRA 1P7JA 2DK8A 4NTFA 2L9VA 3IWZA 1YJNI 2TDXA 4MLOA 4N4WA 2VBYA 1P2FA 3N0TA 1V4RA
chains in the Genus database with same CATH topology
4HW0A 3FMRA 1KU2A 4RS8A 3ZPLA 4LLLA 4L9TA 2P5KA 2D1HA 3ECOA 3GFIA 1RZ4A 2FOKA 4TV7A 1S29A 4L9VA 1G4DA 5D8KB 1U6GA 3J81Z 2HDCA 1F9NA 2EK5A 5DCMB 2FNPA 4ESBA 3R6SA 1XB4A 4LD5A 1O57A 3D0SA 4I2OA 1ZHFA 2V1DA 3V7SA 5H6RA 2DI3A 3KLOA 4A12A 3JAMZ 2NNNA 4XRFA 3DP7A 1EH6A 2MH9A 1R1TA 2CG4A 1CF7B 5F64A 3GUDA 2STWA 2CO5A 2M5WA 2D1VA 3ZN1A 1OYIA 1ONVA 3JW4A 4WF2A 2JT1A 1H0MA 3CO7C 1U5TC 2EWNA 3DV8A 2OD5A 4G9YA 4KN7X 2GA2A 4UHTA 4RB1A 3F72A 1T2KA 4L5JA 1GVJA 2XAGA 3BP8A 2GAUA 4IJAA 3GW2A 5D5WB 1BN5A 1RUNA 1P4WA 4RAYA 2F5FA 2EFPA 1YS7A 3WTUC 3H3UA 2IJLA 4G7HF 4RB3C 3IWFA 1R00A 1O3TA 2DW4A 4IXAA 3EYIA 1XGNA 1WRJA 2FF4A 4Q4ZF 3TO9A 2RV8A 3MEXA 2RN7A 3I54A 3HHHA 3WODF 4P55A 1ZRFA 4KA4A 4EJVA 1JE8A 3AAFA 2BYVE 3DFGA 4PGHA 1U8RA 3G3ZA 4Q5SF 3E97A 1QQIA 3WTYC 3VB2A 4Q47A 3WG9A 2HFHA 3FM3A 2NAZA 1TNSA 1ZREA 3QRFF 3ERED 2NRAC 2QLZA 3TDZC 4ZYGA 2LSOA 4U0VA 1IXSB 4D0PA 1O3QA 3O6BB 3JSOA 1KU7A 3R61A 2Y0MA 4HLXA 1O7LA 2DU9A 4KICA 5FLXZ 3GFJA 5L3DA 2G9WA 1KQ0A 2E1NA 2LF8A 3RIRA 5HDGA 2XAQA 1QO0D 1FLIA 3HTUA 5A2QZ 2KIMA 1GXPA 3CLOA 1EV7A 3BPXA 4RGRA 5E8IA 3SXYA 5K5QA 3IKTA 1AOYA 4G6DA 5HDKA 2P8TA 1T0FA 2BE5F 3T5XA 4KMFA 1REPC 2XV4S 5EEGA 3CUQB 1XD7A 3SXZA 3TDUC 1YLFA 4L18B 3KLNA 5L3GA 4GGGA 5ILSA 2QBYB 4XSZF 2EB7A 3M9AA 4F7ZA 1QPMA 3BJ6A 3SXMA 2YPRA 4G6QA 4EJUA 3TOAA 4G94A 3U9GA 2A61A 3GFLA 2IA2A 1J75A 1PDNC 4KN4X 2FBHA 3BJOA 1MDMB 1J7KA 1SD6A 2IA1A 1SD5A 1DPRA 2MD5A 2ELHA 2BV6A 3P9CA 2CQKA 1QNTA 2P4WA 1WSUA 1W7PB 3WTXC 3E6MA 3B73A 5K1YA 2VE8A 4MTDA 2STTA 2HQRA 3BOQA 1DP7P 3WTVC 1IN8A 2JRTA 4M6XA 3KE2A 2ESNA 1QZZA 3LAJA 4P5OA 1UB9A 5HLHA 5LGUA 1L3LA 1IXRC 4P9UA 3ZQ7A 3BDDA 3O2PE 3K1NA 4MNUA 3BPVA 1OKRA 2Y75A 4U7BA 1LB2A 2VONA 1QZYA 1GXQA 2KIUA 5F1RA 3RKXA 1G3SA 1I1GA 3SHFA 3DPLC 3GFMA 1J5YA 4ZYHA 2GIVA 1ON1A 1O3RA 2KJCA 1KU3A 2KKOA 5LGNA 3V8JA 1HSTA 4ON0A 5JVTA 1F4KA 2ZJ2A 4I98B 4EQQA 3LAPA 5AIQA 4LB6B 3KP7A 5BPDA 3ZMSA 1SD7A 5D5XB 2V1XA 3QU6A 2HTJA 3GEZA 5CVRA 1ZGAA 4EM2A 4DQ2A 3LA3A 3KFWX 1MJBA 4JK1X 2MLGA 1FZPB 5JI6A 1BJAA 4WCGA 1IRFA 1W7PD 2CW0F 1TQIA 1HW5A 1B6AA 2P6SA 4HYEA 4P9FA 1B9NA 2FSWA 1YW8A 2OBPA 2EV6A 2GZWA 2W84A 1B9MA 2XAJA 3T0YA 3ROUA 3ZN0A 4BYYA 1KA8A 2CSOA 2A6HF 2B0LA 4LK1F 1SFUA 1LDDA 5FO5A 2WV0A 4RGSA 3E5XA 5FB2A 3EUHA 5JFRA 2JZYA 1DDNA 2G7HA 5D5UB 3LFKA 4LK0F 1HSJA 4I0AA 4PCQA 3FXRA 4HX7A 1BIAA 1FYMA 4LG0A 1MD0A 2L4AA 1XGOA 3HOTA 5J6XA 4LG0B 2ZBKA 4L9NA 2FBIA 1R36A 3F6VA 2OZUA 3SZTA 3E3VA 3IKVA 3PQJA 1FNNA 4L0YB 1VTNC 1HBXG 3NQOA 4U0YA 1MKMA 2UZKA 3P9IA 5HLGA 3BZ6A 2QZ8A 3IC7A 3ABTA 3CDHA 1U5TB 3OOPA 4IRIA 1S6LA 2W24A 5DCMA 1KYWA 4Y17A 4Z2YA 5BMZA 2EFQA 3GZ6A 4R8HA 3QPTA 4LLNA 3WE2A 4BAYA 4ZZDA 3L00A 2GQQA 2HYFA 3CUQC 3HTSB 2Z5UA 2R3SA 1R5GA 4EJWA 3KZYA 3RPQA 1RUOA 2RGVA 4CZZA 3K9TA 2O61A 3B02A 1ZYRF 2K7LA 1Z9CA 2HYGD 5AIPA 2XIGA 4UVCA 2JSCA 2VBZA 2A5YB 2NNYA 2XASA 5LEKA 4O3MA 1OYWA 1CF7A 1USTA 2VC0A 4FX0A 3WTTC 5L3FA 3K2ZA 4NB5A 3M8EA 2LKPA 3QP5A 2W25A 3KEOA 1T98A 3WGGA 3GLXA 3C7JA 4S05A 4AIHA 5D6EA 1W5SA 5LGTA 4Q48A 2HZTA 1TNTA 4HBLA 1R1UA 1ZRDA 4KMUX 3Q9VA 3C3WA 1LDKB 1ULYA 2OQRA 3JSPA 5KVRA 5LRSA 3CO6C 4BHBA 4BNCA 3RPUA 3BWGA 5E20A 4QLCU 4RB2C 3K1PA 5DYMA 2GA1A 4M74A 2K86A 3CTAA 1P6RA 2XHKA 4CYDA 2P5LC 2J5PA 3V7CA 3F6OA 3OV8A 1P4XA 3E6DA 4GO1A 1KQ9A 2JTVA 4MEXF 4EGYA 2LDUA 1LDJA 2QVOA 1GHCA 1G3TA 2ZCWA 4ASNA 1KQ8A 4ESFA 4OIQF 4M9ZA 1LEBA 2GXBA 2FNAA 1RNLA 4XBFA 1YW7A 4JQFA 4MTEA 4G7OF 1T38A 1R23A 3MZYA 4EV0A 1X3UA 3MZHA 2EJRA 1Z05A 1FC3A 4LGWA 5CJ9A 4GXOA 4BH9A 4Y13A 4AIKA 1BI0A 3FXUA 3SZPA 1KYZA 5ICCA 3KP5A 3I4PA 4CXFA 1OR7A 2OU2A 1FBUA 2P5VA 5HS8A 4H0EA 3ZMVA 2QUFA 5DDGA 4M73A 1XCVA 2O8XA 4QWQA 2YSRA 2QM3A 4DNCA 4I09A 3L7WA 2Q2EA 4ZZLA 1FBSA 3M8FA 3F21A 3VFZA 2H09A 1C0WA 2KJBA 4KYWA 3J81K 2H6CA 3FXQA 3F8NA 2QQ9A 2VXZA 2VOPA 2L01A 4N9HA 1ZAOA 3SFZA 4KT5C 2V6CA 1SMTA 2ZO4A 4OIPF 2XAHA 1Z91A 1FT9A 3KP2A 4HX8A 1TTYA 4UXNA 3LA7A 4WX9A 4MQ9F 1Z6RA 2UXNA 2V9VA 1WQ2A 1ZN2A 3Q5FA 1D8KA 3KZZA 2P7CB 4IRGA 3MCZA 1BOAA 5LRRA 4UUVA 1FP2A 3R0JA 4O6JA 3E5UA 3J80K 1K78A 2D45A 1WWXA 3I5UA 2IT0A 1D5VA 1BI3A 2M45A 3IRRA 4OMZA 2F2EA 1FWZA 3IHUA 5HLIA 3W6KB 2XRNA 3LQQA 3ML6A 4KUMA 3T8RA 3V7RA 2ZXJA 4ZH4F 1JHHA 2PMUA 1XDUA 4LFUA 3T1BA 1XSVA 1Y0UA 3P9KA 2RKHA 1DPUA 2EA4A 3GXOA 3F23A 2HR3A 1XMKA 1XGMA 3J7AO 3KP4A 3V4GA 5ICGA 1J0RA 2FXAA 3H3ZA 4M9SA 4A0ZA 2ZMEB 5LHHA 2WWYA 1R58A 3CUQA 3WU0A 3V8LA 5ILUA 1J9IA 4O5VA 3F8CA 1XMAA 2G7UA 4OOIA 3FZVA 3MWMA 1KU9A 1LEAA 1JGSA 5E17F 1U3EM 3IL2A 4CICA 4HDUA 3E6CC 2V79A 4M9XA 3GWZA 4XSXF 4U0WA 3DQVC 2DQRA 1TQMA 1MGTA 1PP7U 1XSXA 4HQEA 5J8CA 4IHTA 4EVIA 5IT9K 3DXJF 4YG2F 1W4MA 3HRSA 1R5HA 4CDGA 1RI7A 1FBQA 5E1XA 3KP3A 5A2QK 1K79A 3DEUA 2PMHA 2Y48A 1ON2A 2A69F 5DUIA 1SMYF 4IRHA 4LJZF 2YX4A 2XKPA 3RYPA 5HOOA 2RNJA 1U78A 4HQMA 1T39A 1IN4A 4KFCA 3TOBA 5D8LB 1ZGJA 2VOOA 3HOSA 3TO7A 4RAZA 4UNOA 2HS5A 2FMLA 4G7ZF 4WWCA 3HRTA 2XVCA 4FHTA 1HQCA 3F22A 2M8EA 3ZMUA 5DCFA 1YO5C 3HSFA 5F6FA 5HDNA 2GXGA 3NRVA 5LLQA 1IN7A 2RC4A 4B8XA 5TJJA 2XKOA 1AWCA 3WTZA 2A3SA 4LLGF 2VC1A 4JBAA 3WU1B 3SQNA 5K5RA 4I02A 2F5DA 3LA2A 3WGIA 2HWVA 3O3KA 1J59A 3JAMK 2ZNYA 4AWXB 3C1DA 2H6BA 4A0YA 4U88A 3K0LA 4NHJA 2O03A 5E1WA 3RTRA 2DLLA 3L2CA 1FSHA 1BI1A 3WTWC 4M71A 2HEOA 4EGZA 3VEPA 3I71A 1UFMA 5L3BA 2ACJA 1OYYA 3R0AA 4RGUA 1IF1A 4R1HA 2XAFA 1ZARA 2RQPA 4GYGA 1FOKA 2PJPA 2F5CA 5ICEA 4HA8A 2OAZA 3LWFA 2MBFA 4RGXA 1IZ1A 2PBIA 4A5MA 5LEJA 1BI2A 1O7FA 5H20A 1DUXC 3I59B 3HSEA 1Q1HA 4P96A 2J5OA 2M30A 2W85A 3ECHA 2VBWA