3IHUA

Crystal structure of dna binding protein (yp_298823.1) from ralstonia eutropha jmp134 at 1.92 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
205
structure length
205
Chain Sequence
SASDTVFFGIMSGLELGTFVPGQRLVETDLVAHFGVGRNSVREALQRLAAEGIVDLQRHRGAVIRRLSLQETLDVLDVAERMTGLLARAATRGSGNQPQVQALRASVQALVAAEKAQDGETFSNARRHFYRTLLEMGDNRELRRLFPTIHMPIVHAQHRLASLRQMRLDDYRRIATAVLAGEPDAAEAAGAAHVKNVRGAILDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, GntR family
publication title Crystal structure of DNA binding protein (YP_298823.1) from Ralstonia eutropha JMP134 at 1.92 A resolution
rcsb
source organism Ralstonia eutropha
total genus 80
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
A PF07729 FCD FCD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ihuA01
1.20.120.530 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) GntR ligand-binding domain-like 3ihuA02
5ICFA 2EWNA 2V6CA 2M1BA 1SD7A 2FMYA 2XRNA 3CJNA 3LA7A 1W7PA 4Y15A 2JSCA 2O3FA 1QO0D 5DYMA 1UB9A 2YR2A 3RKYA 1XGOA 5AONA 3HSFA 4A6DA 1XDSA 1MDMA 4WXDA 1W7PB 1XD7A 3F8FA 2VT2A 1IXSB 2HS5A 3KETA 5DEQA 4GYGA 1UFMA 1I1GA 2WC2A 4Q5SF 1WQ2A 2O03A 2VBYA 2MLKA 4WK8F 1FWZA 2RKHA 3TO9A 1LEAA 3J80Z 2VONA 2XKPA 3TDZC 4YIIA 2QZ8A 1R1TA 5LHGA 1YW8A 1B4AA 2A69F 1DPUA 4WF2A 3AAFA 3R6SA 1LJ9A 3SZTA 1HKQA 2HOEA 3R60A 2OU2A 4FX0A 1STZA 2PLYA 2QQ9A 5HDNA 1SMTA 2X0LA 5FD6A 2PEXA 4R79A 1W5TA 2IP2A 3IC7A 1YFHA 5L3BA 2F5FA 4A2UA 1O57A 1FP1D 2HTSA 3CDHA 5IT3A 2FBKA 3VEPA 3HHGA 4OIQF 1AWCA 2XAJA 4IXAA 2MD5A 3FX3A 1USSA 4IF4A 3WTYC 2AXLA 3DQVC 3E6MA 4EMSA 4OINF 2UXNA 1DPRA 1IRFA 3F8CA 1YTYA 5J8CA 1K79A 2P7VB 4L0ZB 3QAHA 4MQ9F 1E2XA 5D5XB 3FMRA 1ZLKA 4EV0A 4UV9A 3IRRA 2A07F 1BOAA 5LHHA 2A68F 5DV5A 2COMA 2EFNA 3ROUA 2K02A 1Z91A 2HKXA 4KN7X 3GO5A 1YS7A 3SZPA 1MKMA 2A5YB 2EB7A 3ECHA 4RGSA 2VT3A 1U2WA 2VC1A 2IRFG 3GZ6A 3HRUA 1IXRC 2GXGA 4FT8A 2BYVE 4XRFA 4ZZDA 2HYFA 1IN8A 2A6EF 4P96A 1IN4A 4AIKA 2V1DA 4UVCA 2LKPA 3EQLF 4HF1A 3LQQA 3TQNA 1ZREA 4HX8A 1F4KA 4K2EA 1SD4A 1USTA 2MH2A 2VBZA 2F5DA 2W24A 3L9FA 2JT1A 4ZYHA 1YYVA 3K2ZA 4R1HA 4ETSA 3RTRA 1R36A 2F5EA 1R58A 1Z05A 4S05A 1CGPA 4WX9A 3C3WA 1KQ8A 3E6BA 3H3UA 2V1UA 1C0WA 3R0AA 3KZZA 5LGNA 1PUEE 1QGPA 1XMKA 5ED4A 4A12A 1MJ9A 1HW2A 1XCBA 5CVJA 2RN7A 2M45A 3BJOA 4G6DA 4OMZA 3D0SA 5BPIA 3MZHA 1IN5A 1U78A 1I1SA 3QOPA 1RI7A 3KP5A 2BV6A 3DKWA 3VFZA 5ILSA 2D45A 1ZRCA 2FEZA 1EH8A 5H20A 5JFRA 2F5CA 4Q4ZF 1S7AA 4EVIA 5E1ZB 2DAOA 1ZRDA 4F7ZA 2ISYA 4ENJA 3SHFA 4I2OA 4ASNA 4E70A 2M87A 2JRTA 1J2XA 5F64A 1ZG5A 2A3SA 2XVCA 4FX4A 2PMUA 5F6FA 1ON2A 4GO1A 5ERIA 2VN2A 2P5LC 1S8NA 3ECOA 2DQRA 3E6CC 4I01A 4OIRF 4HLYA 1BIAA 2XROA 2QWWA 5E18F 2KRFA 1JHFA 3IHUA 3VODA 3QU3A 1TQPA 1G3SA 4ZZLA 1SFUA 1AOYA 1K6OA 5D8LB 3J81K 3KEQA 5CVIA 3JSOA 5L3CA 4TV7A 3EUHA 2CQKA 4L9TA 1V4RA 1IUYA 3N97A 1YW7A 2PJPA 1ZG3A 4M6YA 4NQWA 3SXYA 1FNNA 4L9NA 1W7PD 4EM0B 1RNLA 2PG4A 3WTWC 4MEYF 2Y48A 4CICA 4MTDA 2RC4A 3ZN0A 4HAMA 3RDIA 1RUNA 2OQGA 1WKMA 1J5YA 1OMIA 3GZ5A 3HYIA 4UXNA 3V7RA 2P5KA 1BIBA 5DCMB 1BI1A 4P9FA 2L3DA 2Z3YA 1W4MA 2YU3A 2DLLA 3HRTA 4KIGA 1FZPB 5LHIA 1MJBA 2DK8A 1ODDA 3WE3A 2V79A 5AIPA 2JTVA 2XHKA 3COAC 5FLXZ 4U88A 1JE8A 2K27A 1YQAA 5LEKA 2MA3A 4I0BA 4LLNA 2YSRA 3FMQA 3U2RA 2IJLA 1JXSA 4AIJA 2ZMEB 1KU2A 2P5VA 3CUQB 3TOAA 3ZMSA 2CYYA 3GF2A 4G6QA 2FXAA 4ESJA 2ZJ2A 5CVVA 4UVAA 1OYYA 3FHZA 2OQRA 3KFWX 2UXXA 2DW4A 1I27A 5BPDA 2VOPA 4L9JA 3V8LA 3BP8A 1YLFA 4MQVA 1WSUA 1WWXA 1LDKB 1R5GA 4OIPF 3M8FA 2HDCA 3TO7A 1IZ1A 2XASA 4WXHA 2Z9OA 5FB2A 4RB3C 2Z99A 2QVOA 2EFOA 3H92A 2QBYA 1U5TB 4ON0A 2GA2A 3PQKA 1LQ1A 3V4GA 3EYYA 3FMSA 3FWEA 3RIRA 4O6JA 4HDUA 3C7JA 1B1BA 1KYZA 4WCGA 2EK5A 4LFUA 2O8XA 3I0TA 3EYIA 2IPQX 1KQ9A 1FYKA 2FE3A 5IT9Z 4RB2C 1DP7P 3KP3A 3M9AA 4BHPA 3MFKA 2STTA 4IPAA 3MCZA 4DNCA 4RGRA 5DUKA 5LGTA 3I53A 5TRDA 4HQEA 4HBLA 2BE5F 1L0OC 2DK5A 3FXQA 2EFQA 2XIGA 4AIHA 4S04A 5BMZA 3F8NA 2Y75A 1XSXA 4QLCU 3IKTA 3JTGA 3WTUC 6PAXA 1U6GA 3HRMA 1EH6A 4ENKA 1SAXA 2G7HA 2XAQA 3F22A 1XMAA 2NNYA 1P4AA 3GFJA 1P6RA 1FBQA 1FSHA 1HXDA 2QLZA 4HQMA 1BC7C 1XCVA 3LWFA 1OYIA 3LSTA 3MEXA 2J5OA 3GVAA 4G94A 1BN5A 2H94A 4N0BA 4YFNF 1ZH5A 4L5JA 2QYOA 1R00A 1SD6A 1H9TA 4B09A 3WU0A 3EDPA 3M8EA 4UV8A 3WE2A 4KMFA 3SFZA 3I4PA 3W6KB 2YX7A 2JZYA 1XSVA 2ESHA 4Q47A 1KYWA 4DQ2A 4KICA 1IRGA 3SXMA 4HX4A 1TNSA 4KT5C 4ZYEA 4IRIA 4N9IA 4BHBA 3SXZA 2HEOA 2MLGA 3QP5A 1OR7A 5CLSA 1I6XA 1ZARA 2HGCA 3ISPA 1HSJA 1D3YA 2QM3A 3K1MA 4BQAA 1SMYF 2FQ3A 3KLOA 3RYRA 1KQ0A 3BZ6A 4XSZF 1H9GA 2HZTA 3I64A 3J7AO 2DO7A 4RGXA 1KU9A 3BJ6A 1OKRA 4CGZA 3CO7C 1ON1A 3GFLA 3RPQA 3T1BA 3EETA 4Y13A 4PGHA 4KIFA 4PZJA 2E7XA 1F5TA 1KU7A 4IHTA 1J75A 1ZGJA 2O6GE 1FPQA 3I54A 2D1HA 3V8JA 3R4KA 3ZPLA 3ML6A 3I58A 3D5LA 3KZYA 2OAZA 2X4HA 1GXPA 4OIOF 5H6RA 1UHWA 3IRQA 4HZFA 2XAHA 1BBYA 2W84A 4P55A 3QPTA 4RAZA 4PGGA 4A0ZA 1HQCA 4M9ZA 1IXCA 1KGSA 3ZMUA 4U7DA 3WTXC 1MJAA 2ZFWA 3GYHX 4LG0A 1BC8C 5ICCA 2ZKZA 3E3VA 4IRHA 2KIUA 1ZYRF 3RYPA 4MTEA 5ILVA 5EEGA 4LG0B 2NRAC 2L02A 4M73A 3B02A 5L3DA 2DQLA 1LVAA 1FBSA 3G3ZA 5E1XA 2VODA 4HV5A 3VOEA 4A0YA 1RZ4A 1S29A 3L00A 4ZYDA 1F1ZA 2XKOA 2CFXA 5FD5A 2KIFA 3IWZA 1BM9A 1KA8A 2JPCA 4RGUA 4HX7A 1FSEA 3U9GA 5DCFA 4KMUX 4BH9A 3JAMK 3LAJA 3K0LA 4AVPA 1ULYA 3DP7A 4NHJA 5HS7A 1R23A 4EM1A 5LEJA 2EJRA 3F23A 4CZZA 4UNOA 1H0MA 3GEZA 2EV0A 3ULQB 4L5IA 2XAFA 2K7LA 3B73A 3QRFF 3L7WA 1V3FA 5JI6A 1U8RA 2GA1A 5TJJA 3LFKA 1BI2A 3T8TA 2G9WA 2A6HF 2HR3A 4I02A 3SQNA 3ERED 4YIFA 3E97A 1D8JA 1K78B 2P8TA 1SFEA 4IHSA 4BAYA 1O3RA 1GHCA 3BY6A 4G8XA 4OMYA 3HOTA 3IWFA 3F8MA 5CVRA 4QWQA 5D6FA 2W25A 2VE9A 4KN4X 2L4AA 2Z5UA 5D6EA 2FF4A 5JR3A 4ENNA 2UZKA 1F9NA 2QQAA 3QU6A 4CHUA 1LNWA 3FZVA 1XB4A 1FP2A 1J9IA 2CSOA 4MEXF 2P7CB 5HOOA 2RV8A 2VBWA 1FY7A 5HS8A 4U0YA 1QBJA 4XSXF 1TLHB 5CVUA 1HSTA 1D8KA 4M9SA 1PDNC 3DXJF 1TNTA 5A2QK 3KP6A 4HA8A 5LGUA 1DUXC 1QPMA 2XV4S 3HSRA 4IJAA 1GXQA 4KYWA 4UVBA 5DD8A 2QUFA 5D5VB 2DFIA 4LK1F 4WWCA 2W85A 4EGYA 3BROA 2DPUA 4G7OF 2R3SA 2XUBA 3I59B 4HLXA 1SFXA 5DCMA 2VE8A 2HKOA 4GCVA 5KVRA 2RGVA 4YG2F 2DT5A 2Z33A 3SXKA 2Q2EA 2UWMA 2M8EA 4HF0A 1B9NA 2P6TA 2MH9A 3HOSA 2DU9A 2ZMEA 4G9YA 3CUQA 3WTSC 3I5UA 1S3JA 2LDUA 3RKWA 3FM5A 2WTEA 3J80K 1DDNA 1MZBA 4Q48A 1ZGAA 3GFIA 2EA4A 3O3KA 1IF1A 2OD5A 1Z6RA 3FM3A 1FLIA 2TDXA 1G4DA 3PQJA 1TQMA 2GZWA 4RB0A 1Y0UA 2VC0A 2RVCA 4EJOA 5L3EA 4U0VA 4KNYA 2IW5A 5E20A 2RDPA 5LBQA 3BDDA 2ZXJA 3MZYA 4LGWA 1U5TA 1XSDA 2ZNYA 5BOXA 1Z9CA 4CXFA 5BQTA 2E1NA 3WU1B 2OBPA 1B9MA 4O5VA 2H27A 2Y0MA 1L3LA 3TDUC 3JW4A 3GW2A 3L09A 5FFZA 2RQPA 4YFKF 4EJWA 3RPUA 2V1XA 3QPHA 4CYDA 2FA5A 4XBFA 1WRJA 2F2EA 3RKXA 3Q5FA 3MQ0A 1S7OA 3K69A 2PBIA 1J59A 1A04A 3JTHA 3L2CA 2YPRA 2ELHA 4I09A 2IA1A 3BPXA 4LK0F 2B0LA 1RUOA 2D1VA 2VXZA 1SD5A 1YIOA 2H09A 3DPTA 3KP2A 4MHGA 3HUGA 2HTJA 1NHAA 4UUVA 2HWVA 4L18B 1J7KA 3ZQ7A 3BWGA 3H3ZA 2L01A 3FXUA 2IT0A 4EJUA 3HTUA 1ZG1A 4Z2YA 2EV6A 1YO5C 5HDKA 1P4XA 2CW0F 3E5XA 4OU0A 2M5WA 2GAUA 1IN7A 4XLNF 3KLNA 4NB5A 1QNTA 1LDJA 4I0AA 4ESBA 1XGSA 1K7AA 1ONVA 3IKVA 3RJPA 3REOA 1KU3A 3KE2A 1QQIA 3LA2A 3ZMVA 5HVQC 4LB6B 4A5MA 2LF8A 5DDGA 5H6QA 2LF7A 4HW0A 3ABUA 3DPLC 4GXOA 1XGNA 5J6XA 2L54A 4LLGF 2KJCA 4A5NA 2L4MA 1MDMB 4LB5A 4HV6A 3TOBA 3TO6A 4P9UA 1WI9A 3W6JB 1R5HA 2BGCA 2K4JA 3P7NA 2FNAA 4A6EA 2A61A 3GX4X 5FGMA 1G3WA 3E5UA 3P9KA 5K5QA 4XLPF 3WGIA 2PFBA 3JSPA 3MWMA 4PDKA 5J8FA 4BHCA 3V7SA 5DUIA 4CO8A 3U1DA 3F6OA 5HLHA 3T5XA 2V9VA 4I7HA 1OPCA 2G7UA 4JQFA 4MNUA 4BNCA 5K5OA 4ZYGA 4L9VA 1R7JA 2J5PA 2PI0A 1O3SA 3GFMA 5LRRA 3CUQC 3E6DA 4UHTA 5ILUA 1TBXA 3WTVC 2H6CA 2HQNA 2IVMA 3M1EA 2IA0A 3T8RA 3TGNA 1ZAOA 3MAJA 1FOKA 3WGGA 2XGXA 2FBIA 1HBXG 3ABTA 1D5VA 1TW3A 1R22A 4EJTA 2ETHA 3F72A 1G3TA 4M6XA 4I98B 5FO5A 3GUDA 1UHMA 1U5TC 1BJAA 1IW7F 3OOPA 2C6YA 2PN6A 5L3FA 3CO6C 4EM2A 3O6BB 3R61A 3HSEA 1YG2A 2K86A 4G7HF 1IAWA 3CUOA 1B59A 1T38A 3KP4A 2CG4A 5DD4A 1T6SA 4EJVA 2MBFA 1S6LA 5K5RA 1HW1A 5HLIA 4N9HA 5KK1A 2AS5F 3GLXA 2FU4A 2ZNZA 2OZUA 4LD5A 2FSWA 4LMYA 3NRVA 2ADUA 3CLOA 3ZMTA 5LRSA 4CDGA 2HFHA 1QZYA 1MD0A 2VBXA 5FLXK 3K1NA 1PP8F 5D8KB 3P9CA 3C18A 4BXUA 3NEUA 3LA3A 2VOOA 3FF5A 1FYLA 1TQIA 5E8IA 1XDUA 3ZMDA 4U7BA 1BI0A 1YW9A 3QP6A 1K78A 3F8BA 5CJ9A 3LAPA 5L3GA 4OOIA 2GXBA 1W5SA 2NNNA 1TTYA 3F6VA 1HKTA 1QZZA 3KP7A 3F3XA 3K9TA 2FMLA 1TW2A 2NS0A 3F21A 4H0EA 2Q8KA 2DI3A 3LQRA 4AWXB 2O61A 2ISZA 1T39A 2EA2A 1U3EM 4Y17A 2BBYA 2CWEA 4PCQA 1Z7UA 4HOBA 1O7FA 1HKSA 5AIQA 1FX7A 2RNJA 2LNBA 2K4BA 2DBBA 2YX4A 5D4RA 2GQQA 3GXOA 4LJZF 1I5ZA 1OYWA 3I71A 5E1WA 2CO5A 5IT9K 4A0XA 1FC3A 2KKOA 5HDGA 2EV5A 4HF2A 5FFXA 2W57A 4RB1A 5E8GA 3CTAA 4GGGA 2OZ6A 3WTTC 2ACJA 3V8KA 4M71A 2FRHA 3N4MA 3V7CA 4KDPA 2LSOA 2M30A 4AD9A 4KA4A 2HYGD 3I59A 1XN7A 4EGZA 1ZLJA 3IL2A 2HQRA 2NAZA 3KEOA 2MC3A 4IRGA 3WG9A 1RIOH 2O0YA 1HW5A 2CGPA 5D5WB 1FBUA 4G7ZF 3RI4A 1Z6TA 1ZHFA 3S2WA 3OV8A 2IA2A 1CF7A 4O3MA 1G6NA 3HTSB 1LDDA 3BPVA 4BYYA 3KCCA 4ESFA 1P4WA 2ZCWA 1FT9A 4ENMA 2R7FA 1CF7B 4GYIA 1B6AA 1EV7A 2FNPA 2QQBA 2ESNA 2STWA 4HDVA 3HIFA 4P5OA 1P92A 4R8HA 1J0RA 2D2WA 1Z1DA 3DV8A 5CYVA 1O3QA 2QENA 1JGSA 3K1PA 1MGTA 1ZRFA 3ZP5A 2FBHA 2WWYA 3Q9SA 1Q1HA 5BS6A 3PFIA 3JAMZ 1XGMA 3M7GA 4JK1X 2ZBKA 4KUMA 1BI3A 3Q9VA 4LLLA 1EH7A 3E5QA 4ZH4F 1X3UA 2GWRA 3G73A 2DPDA 2OA4A 4M74A 3WGHA 1P2FA 4L0YB 5JHUA 2H6BA 1YS6A 1T0FA 4U0WA 3GWZA 2Q0OA 1LB2A 3ZMZA 1IN6A 1E17A 1G3YA 4WXCA 1O3TA 1UCRA 5EEHA 3NQOA 3TKYA 5HLGA 2P4WA 5K1YA 2ZO4A 5ICEA 3DFGA 4M72A 1REPC 1PP7U 3T0YA 3ELKA 1GVJA 4KIBA 2NYXA 4MGRA 2PMHA 5LLQA 2BEOA 3O2PE 3BOQA 3P9IA 4HYEA 2QBYB 3HHHA 5D4SA 2KJBA 1T98A 2E1CA 3WODF 1R1UA 3VB2A 2JPBA 2XAGA 4JBAA 5HS9A 2PQ8A 3WTZA 4IVNA 4B8XA 5ICGA 1ZN2A 3BJAA 4D0PA 2FOKA 2WV0A 1VTNC 1LEBA 3J81Z 1FYMA 5A2QZ 1R1VA 3FXRA 1JHHA 5F1RA 4EQQA 3ZN1A 2GIVA 5D5UB 2KIMA 5E17F 2R7DA 3R0JA 4KFCA 4RS8A 2EFPA 4M9XA 3HRSA 2E7WA 3DEUA 4YFXF 1T2KA 5JVTA 4FHTA 3DF8A 4RAYA 2P6SA 3C1DA 1O7LA 2DTRA 2EFWA
chains in the Genus database with same CATH superfamily
5ICFA 2QSGX 2HDWA 2QCOA 2EWNA 3LESA 2V6CA 2M1BA 1TQGA 3CMAI 2VCCA 2VH3A 1SD7A 2FMYA 2JVGA 4RLFA 3K2AA 5F1JA 2XRNA 1JAFA 3CJNA 3UMHA 3LA7A 3ZTMA 3AOUA 1W7PA 4Y15A 3MFNA 1X1DA 3GWLA 2H7BA 2BVLA 2I8BA 3HOVJ 1KONA 2JSCA 3CCRI 5E3AA 2O3FA 3G4ZA 1QO0D 2EIJH 5DYMA 4XORA 1UB9A 2YR2A 3U21A 2V1NA 3ZIBA 3RKYA 2JPUA 3G50A 1XGOA 5AONA 2QA4I 1QSPA 3HSFA 4A6DA 1TWHA 1XDSA 1MDMA 2LD6A 1P9QC 1O5HA 3G4XA 5E3OA 4WXDA 3BR5A 3RVYA 1PUFA 1Q1VA 1EA8A 1W7PB 3V5YA 3SZRA 1JUPA 1XD7A 3F8FA 3Q0UA 2VT2A 5CQEA 4RAFA 3I5PA 1R4NB 3AQCA 1IXSB 3NRHA 2HS5A 3KETA 5DEQA 4GYGA 3NDBB 3X2QH 2IS2A 3RKOF 1UFMA 3M79A 1I1GA 2WC2A 4Q5SF 1WQ2A 2O03A 4YN0B 2VBYA 2MLKA 2YUSA 4WK8F 3M07A 1FWZA 1X1AA 1VZ0A 2RKHA 2LG4A 3C2GA 1PUFB 1LS4A 1K40A 3TO9A 2Q9AA 2K5CA 1Z63A 1LEAA 4M3DA 2ECCA 3ZQYA 3J80Z 1TL8A 3OYJA 1EKYA 2VONA 1RXQA 2XKPA 5L3VA 3TDZC 2F22A 4A3JJ 4YIIA 1AHDP 3DKYA 4B4CA 1ZELA 2OKUA 1O87A 2QZ8A 1DGWY 3RKQA 3BCAA 5GAHJ 1R1TA 2X6YA 5LHGA 1U0BB 2YLDA 4U5GA 5H2FC 4MTGA 1ZHTA 1YW8A 1WTYA 1B4AA 2AQEA 1YI2I 2A69F 4IJJA 2UUIA 2X51A 2GWWA 3KYLA 1LM3B 1DPUA 5EG0A 4WF2A 3AAFA 3R6SA 5EZGA 4B48A 5FKMA 1LJ9A 1H89C 1X3WB 3SZTA 1HKQA 2HOEA 2BC5A 1QQ3A 5T1DB 4DW6A 3VDXA 4M63A 3GM2A 4ZYAA 3R60A 2VQLA 5B1BH 1D0XA 2OU2A 3AG4C 4FX0A 1STZA 2PLYA 1XZPA 3JTLO 2QQ9A 2R5YA 1I4ZA 5HDNA 1SMTA 2X0LA 5FD6A 2PEXA 2M4KA 2XPWA 3O8HA 4J01A 4R79A 1W5TA 2IP2A 2VKEA 3IC7A 1YFHA 3GMEA 5L3BA 4N06A 2F5FA 1MNMC 4A2UA 3JZ0A 1T6UA 1O57A 4F93B 2KK1A 5B66C 1FP1D 3BR1A 2HTSA 4FQGA 3G2BA 3CDHA 5B5EC 2HKVA 2LFDA 3QVZA 4RD9A 4E6KG 5IT3A 3CAXA 1VQOI 3DE9A 1ETYA 2FBKA 2PX3A 3L1MA 1FTTA 3VEPA 3HHGA 3S8PA 4OIQF 2AP3A 4JYKA 3CC4I 1AWCA 3FHDA 4DRIB 2XAJA 3LSKA 4IXAA 2MD5A 3PNYA 3CMYA 3FX3A 1IC8A 2WB1A 2R7ZJ 1I6HJ 1USSA 4IF4A 3WTYC 3ZRGA 4IL6C 5L0HA 1U8BA 4XR6A 2AXLA 2ZPAA 4AK9A 3PUBA 3DQVC 3E6MA 4EMSA 1QHGA 5KYYA 3ZDLA 4Y52J 4OINF 5A6JA 3RQIA 5TGTA 2DMTA 2UXNA 3JYHA 1DPRA 2W4BA 4PJMA 1IRFA 3F8CA 3JRCA 1YTYA 1NU7D 5J8CA 1OXBA 1K79A 2P7VB 4BXFA 3ECSA 1S7ZA 4L0ZB 2KSFA 3QAHA 4MQ9F 2EPOA 2YHSA 1E2XA 4I3MA 2Y69H 5D5XB 3OYHA 3FMRA 1ZLKA 3WHBA 1V4AA 4EV0A 4UV9A 2E1MB 3IRRA 2A07F 1DU0A 1BOAA 5LHHA 4WGZA 2A68F 4YT5A 2AXTC 4V2GA 5DV5A 5JLWA 3KZIC 5JS5A 2COMA 3OEOA 2Y39A 4XOTA 3BTLA 3GTMJ 4QDLA 4XTKA 2GOXB 1X2MA 2G0EA 2EFNA 4NC7A 3ROUA 3IQ5A 2K9LA 3HNKA 3FXJA 2K02A 4Q7CA 1T0FC 3A02A 3BR3A 2JWTA 2ZJPF 1Z91A 3BC8A 2HKXA 4KN7X 1Z67A 1RJ9B 4UB6C 1TP4A 3GO5A 1YS7A 3SZPA 1MKMA 2A5YB 2ZXWH 4JJFA 2EB7A 3PNVA 1YJ9I 3ECHA 1QLEC 5L0IA 3FISA 4RGSA 4AYBN 2VT3A 2NVUB 3T6GB 1U2WA 2VC1A 2BHZA 2IRFG 3GZ6A 3HRUA 1IXRC 2GXGA 2ELJA 1DQUA 2NG1A 4FT8A 1RPWA 2RQQA 1E84A 2BYVE 4XRFA 4ZZDA 5KAFC 3U3FA 4U87A 5M3FJ 4BQQA 2NOGA 2HYFA 1IN8A 4CCLA 2Y3BA 5J4YA 2FUG2 2A6EF 2FFHA 4P96A 2OCCH 2EPFA 4YK5A 1IN4A 4AIKA 2V1DA 4Z6YA 4UVCA 2LKPA 3EQLF 1ZR2A 1ZKGA 4HF1A 3LQQA 3HDDA 1ST6A 2EZLA 3TQNA 1ZREA 3FBIB 3HJEA 3A4CA 3DLLF 3P5JA 4XRMA 2XGEA 1WJEA 1AKHB 5GTIC 4HX8A 2YRFA 1F4KA 4K2EA 4XIDA 3TMOA 1SD4A 1USTA 2MH2A 2O9LA 2VBZA 2PJRA 3O6XA 2ELKA 2F5DA 2W24A 4CJOA 3IQTA 4NTFA 2O7OA 3L9FA 2LSEA 2JT1A 1X1CA 4ZYHA 1YYVA 2LP0A 3K2ZA 4R1HA 4ETSA 5IP6A 1J09A 3RTRA 3LS1A 3SNHA 1R36A 3S32A 5AC5A 2VCBA 1E86A 2F5EA 1R58A 3OYNA 1Z05A 5J40A 3GTJJ 3HKZA 2P0WA 4S05A 1CGPA 2WAEA 1OCOC 4WX9A 3C3WA 2TRTA 4EATA 1FTSA 4QI2A 2L9SA 1KQ8A 3H5AA 3DJNB 4FETA 4BBSJ 4XNFA 3U2LA 3E6BA 2G3KA 4C3JJ 3H3UA 5F0CA 3JRIA 2PFDA 2HUJA 1WASA 1O4XA 4KNWA 2V1UA 2Z16A 1ETWA 1C0WA 3R0AA 1ERDA 2ME0A 3KZZA 3CQZA 5LGNA 3QQAA 2H1LA 3M15A 2CUJA 1I39A 3HC7A 1PUEE 2JSPA 2XB0X 3AKZA 1YAUO 1QGPA 1K04A 1XMKA 4LLEA 2F4OB 2V26A 4HRIA 3BEHA 3PDMP 1WWPA 2PBEA 1LE4A 2KZVA 1EKEA 1YLMA 3L8IA 5KCMA 5ED4A 4A12A 1MJ9A 2NSFA 3PM1A 2DMNA 1OW7A 4MIMA 1HW2A 1XCBA 4NNJA 2VI6A 5CVJA 2RN7A 2M45A 2QTVA 3BJOA 2HOSA 4G6DA 4OMZA 1T5OA 3D0SA 5BPIA 2VCAA 3MZHA 1IN5A 3HOXJ 1U78A 1I1SA 3QOPA 4DYCA 4IKFA 1R6RA 1RI7A 1UJ8A 3KP5A 2GFHA 2R5ZA 2BV6A 3DKWA 3VFZA 5ILSA 2D45A 1ZRCA 1A7VA 2NXNB 2P6VA 2FEZA 3S28A 1YZAA 4ZDPA 4EEFG 1S9HA 1EH8A 5H20A 5JFRA 3I55I 2F5CA 4QIWN 5KHDA 4Q4ZF 1S7AA 4OWRB 3TEDA 2KT0A 4EVIA 2V6EA 5E1ZB 3DU6A 2DAOA 1ZRDA 4F7ZA 4N6HA 4IQ4A 3KPHA 2ISYA 1A0BA 4ENJA 3ABLH 2CQNA 3SHFA 3L2WA 1QPIA 3UMKA 4I2OA 4ASNA 1Y1WJ 4E70A 1FMWA 3NMJA 4L5EA 3HL2A 1QVUA 2MWQA 2WZGA 2XRLA 2M87A 1M6TA 3ONQA 2JRTA 1J2XA 5F64A 4XLAA 2LMDA 2VJ4A 2XPUA 1ZG5A 4BG0A 4IRUA 2KQRA 2JUGA 1TWAJ 2A3SA 2BY2A 2QKLB 2XVCA 1KZHA 4BBRJ 2PMUA 4FX4A 1XS9A 1K4SA 5F6FA 1ON2A 4GO1A 4XEFA 3OYAA 5ERIA 2VN2A 3CLQA 3K1HA 1V55C 4BGDA 1UFBA 2P5LC 3C8GB 3FIWA 4QTRA 2P1AA 4H54A 1M57C 4CDYA 1S8NA 2NPUA 3ECOA 4BDYA 1IRZA 2DQRA 3A03A 5F27A 1XC5A 4I01A 4OIRF 5M3MJ 3E6CC 2ZSHB 2MGQA 1BIAA 4HLYA 5E3LA 1CQTA 2XROA 2B7EA 1LI7A 3K7DA 4MVUA 2QWWA 5E18F 2KRFA 4GDFA 3AG3C 3EPZA 1I3AA 1ETOA 4RM3A 1JHFA 2MABA 4BE1A 3IHUA 1Z7LA 1LVKA 1IZMA 1TWFJ 3VODA 1G4US 2CNWA 4LDRA 3QU3A 1TQPA 1G3SA 4AL1A 4B6IA 4M3EA 4ZZLA 3HOWJ 2XLOA 3PIPF 1SFUA 3R7CA 1AOYA 3S1RJ 2VQHA 1CGNA 1K6OA 2M2EA 3M4CA 2EZHA 3DU5A 5D8LB 4YL0A 3J81K 3S29A 5GP9A 4GYTA 3KEQA 4JX5A 5CVIA 4IO9F 2X1CA 4XM3A 2XB5A 3JSOA 3OIOA 5L3CA 1NK3P 4TV7A 3EUHA 2CQKA 2EZIA 2XLHA 4C7OA 1FOYA 4L9TA 3OY9A 4RM2A 2R03A 1V4RA 3H5NA 1IUYA 4J30B 3N97A 1YW7A 5DS5A 3BG3A 1BOBA 2HJ3A 3GM3A 2Y9YA 2V3CC 2Y2ZA 2IS1A 3LAYA 1Q0GA 2PJPA 1ZG3A 4M6YA 1YRNA 3QOEA 4NQWA 1NG1A 2XLDA 5JLIA 2Q4FA 3PJRA 3SXYA 1FNNA 3GCMA 3DCFA 1UMQA 4L9NA 2YEVA 4DZPA 2DOFA 1W7PD 3NYJA 3O10A 2DFFA 4LIUA 4EM0B 1MMNA 3PSFA 3DEEA 1RNLA 2PG4A 4U5DE 3WTWC 2RSEB 2DJNA 1Y0NA 4MEYF 2Y48A 4MFDA 3GEIA 3JRGA 4CICA 4MTDA 2RC4A 3ZN0A 4HAMA 3RDIA 1RUNA 3GEEA 4NDLA 2OQGA 3G4SI 1D5YA 4E7KA 1WKMA 3OYFA 2YVKA 1J5YA 1MH4A 1T56A 1OMIA 3GZ5A 3HYIA 3LSGA 2E2HJ 3AG1C 1POGA 4F92B 3AJMA 3LEOA 1WVRA 4UXNA 5EZHA 1E0EA 3V7RA 1MQVA 3JRFA 4ZDOA 2P5KA 3TL4X 1BIBA 4P6IC 5DCMB 2X1EA 2EIKH 4Z9JA 2J7PD 1BI1A 4E7LA 4P9FA 1VQ9I 2EINC 2XGDA 1Z5ZA 3Q7LA 2L3DA 3VSKA 2Z3YA 3CCVI 4E7HA 3DD7A 3HPHA 1LKXA 5COGA 1W4MA 4DBQA 3RZDJ 2B0JA 5IY5C 2A6TA 2YU3A 1FMVA 3K10A 3VYSB 4AM3A 2EBIA 2DLLA 3BG5A 3HRTA 2JA8J 4KIGA 1FZPB 3PO2J 3S1QJ 1OR3A 1RKEA 5LHIA 3FK7A 1MJBA 2DK8A 1ODDA 1JJ6C 3WE3A 3AL0B 2V79A 5AIPA 2JTVA 4MVQA 2XHKA 4NY3A 3X1OA 3ZC4A 3COAC 2JK3A 4JP0A 5FLXZ 4U88A 1HMOA 3EG9A 1JE8A 4C3EA 3EJNA 2K27A 1Z6AA 1YQAA 3QPSA 3S1NJ 5LEKA 2JX0A 2MA3A 2FOWA 3PUFA 3GTKJ 2ZSIB 3JRDA 5CIVA 4I0BA 2VKDA 4LLNA 2YSRA 3FMQA 3IP4B 3U2RA 2OG2A 2CGEA 4FAPB 2IJLA 2JVHA 2L9VA 5BQIA 5EEAA 4I44A 5B3SH 1JXSA 4AIJA 2ZMEB 1KU2A 2HOAA 2P5VA 3CUQB 3TOAA 3ZMSA 5KNLA 2CYYA 3GF2A 4G6QA 4PFOA 2PP4A 3I4NJ 2FXAA 4ESJA 1VLSA 2K9QA 2ZJ2A 2IGNA 3BLYA 3S2HJ 5CVVA 3I5QA 4UVAA 2BW3B 5KAIC 5IP9J 1OYYA 3FHZA 2OQRA 1E83A 3KFWX 2ID3A 2UXXA 4UB8C 1S72I 2DW4A 4UUSB 3DEWA 3KYCB 4EBBA 1I27A 2I8DA 5BPDA 5E3NA 2Y3DA 4O6NA 4X0RA 1BR4A 1SAUA 1JKRC 1GVDA 2GDCA 5J4VA 4C9YA 4L9JA 2VOPA 5EYRA 3SYNA 2E60A 3V8LA 3BP8A 1YLFA 4MQVA 3LLKA 3VYRB 1WHUA 1WWXA 4AC0A 1WSUA 3DBHB 1RRJA 2Q9CA 4IOCF 1LDKB 1R5GA 4IB4A 4OIPF 2LFFA 2ZXIA 4PUSA 1JKQC 2XF5A 3M8FA 2XGCA 4MFEA 2HDCA 4MVSA 3TO7A 5HNHA 5K7ZA 1IZ1A 1SVLA 4OD4A 1ITYA 4H4KC 3JR9A 2XASA 4WXHA 2E2JJ 2Z9OA 5FB2A 4RB3C 2X6OA 2Z99A 4A3BJ 4ONSA 4IEJA 2MW8A 2QVOA 2EFOA 4G0HA 1BDJB 3H92A 2YLIA 3MMYB 5LFAA 2QBYA 2PMZA 3ZQLA 5DS4A 3RVZA 1U5TB 4ON0A 3CCLI 4A2NB 2GA2A 1ZGWA 1WJCA 3RQGA 3PQKA 1LQ1A 2WBMA 3J7AY 3U2MA 1L7CA 3UNGC 3T6BA 2L7KA 3V4GA 3EYYA 1OFCX 3FMSA 3FWEA 3AG2H 3RIRA 1AA7A 4O6JA 4LIVA 4YEJA 4HDUA 3C7JA 4Y7NJ 1QKRA 1TR2A 2NUTB 3SP1A 1X1BA 1B1BA 4X6AJ 4FISA 2YLGA 1KYZA 1K4TA 3I3LA 4WCGA 4BKXA 2EK5A 2CS3A 4LFUA 2O8XA 4XONA 3OYKA 1W0TA 2M0CA 4G78A 5D92A 3NYLA 4N4NB 3BTIA 2A1DD 3U3BA 3ZWIA 3I0TA 3EYIA 2CV0A 2WAQN 4F52A 2KFDA 3DTIA 3EUAA 2DDAA 1N78A 1WJ5A 2HMQA 5GAEJ 2IPQX 1KQ9A 2VJIA 1RC9A 4A3EJ 1FYKA 5FLVA 3AGUA 4XICA 5DTDA 3GANA 1ZK8A 5IOYA 2FE3A 2R7VA 4RBNA 1F36A 1S7EA 4IHXA 5IT9Z 3O55A 1M2VB 2OUMA 4RB2C 1DP7P 1OQCA 3KP3A 3M9AA 1UHSA 4BHPA 2GAQA 3MFKA 2J9VA 5BNGA 4XPYA 2STTA 4IPAA 3MCZA 4DNCA 1W36C 3CCMI 4RGRA 2XSDC 5DUKA 5LGTA 2HU9A 2AO9A 3I53A 5CPRB 4U5BE 5KYUB 5TRDA 1T6IA 1N75A 1PYVA 4HQEA 2EZKA 5KYWB 4HBLA 2BE5F 5EGYA 2GM4A 4DJ9A 4NQFA 1L0OC 2DK5A 3OYDA 3FXQA 2EFQA 2XIGA 1ETXA 4AIHA 4S04A 5BMZA 1BA5A 3NYMA 3BT9A 1JR8A 4N6CA 3F8NA 4ZTJA 2IEKA 4CUGA 2Y75A 1XSXA 4QLCU 4KI2A 5BQGA 3BZCA 3LS0A 3PNTA 2QEXI 3LNRA 3IKTA 3G1LA 1XTAA 3OL4A 3JTGA 3ZQCA 2IOQA 5J1YA 3WTUC 1BL0A 1MW7A 6PAXA 3ATPA 2J0WA 1U6GA 2CRGA 2VQGA 3HRMA 5KYXA 1EH6A 5HLTA 4ENKA 2R05A 1SAXA 2G7HA 4HFFB 2NUPB 2XAQA 3QWLA 3F22A 3FDQA 1XMAA 2NNYA 3VRCA 2HOTA 1P4AA 1A36A 4BJ6A 3UGOA 4IWBA 3GFJA 1X19A 1P6RA 1FBQA 4A3MJ 4IHVA 1FSHA 4I99C 3TQOA 3CZ6A 3FXHA 1HXDA 1OW6A 2QLZA 4HQMA 4PJJA 3SEZA 1BC7C 1XCVA 3LWFA 1OYIA 3LSTA 2D5RB 3MEXA 2J5OA 3GVAA 2D4UA 2R02A 5KYXB 3W8IA 3ZVRA 3A11A 1GGQA 3DKXA 1UAAA 1SR2A 3ABKH 4G94A 4E18A 5F04A 1IRXA 1BN5A 2BXZA 3AFHA 2H94A 4N0BA 4YFNF 3B29A 1ZH5A 4L5JA 2JMWA 4A3DJ 5DS6A 2QYOA 1R00A 1OCCC 1SD6A 1F1MA 3DAGA 1YVIA 3PL8A 5K7HA 4XLHA 2WVNA 2B9SA 4IOAF 3HTKC 1H9TA 2J7PA 3HG9A 2JN6A 2EH3A 1JOGA 2F4MB 2E2IJ 4B09A 3WU0A 3EDPA 1YOVB 4I1OB 3M8EA 2JRMA 3HEFA 4UV8A 4YT2A 3WE2A 4KMFA 3SFZA 4KT6A 4LDKA 3I4PA 3W6KB 3S3NA 3JRHA 4NBQA 2YX7A 3PSIA 1ACIA 4HPQA 2JZYA 3RQEA 2VXDA 4NUBA 1TZLA 1XSVA 2ESHA 4MTOA 1MIJA 4WJ0A 4Q47A 1KYWA 3V5XA 4DQ2A 4W8PA 3B9QA 2HXOA 1XX5A 3QZCA 4KICA 2R25A 2ZD9A 1W36D 1OCZC 1IRGA 3SXMA 2XM0A 3K70C 5EF6A 4HX4A 3KX2A 2BVMA 4M6VA 4ULWA 2YL0A 3RH3A 3EUHC 5JRAA 3CD6I 3EFOB 2QNLA 1TNSA 4YELA 1U6HA 4KT5C 1YJGA 4ZYEA 4CX9A 2LC2A 4A3IJ 2LTPA 4IRIA 4N9IA 4BHBA 3SXZA 3L2QA 2HEOA 2W48A 2MLGA 3QP5A 1OR7A 3WAQA 2VPRA 3S27A 1ZR4A 3DZAA 1SVMA 1G59A 4FTHA 3O8GA 1GLNA 1P7JA 1ZHXA 2OPTA 3N0TA 5CLSA 1I6XA 4FE7A 4D5CA 3AGTA 1JRAA 1ZARA 2HGCA 2Y3HA 1SVOA 1UG0A 3AG1H 3ISPA 4MLOA 2WZFA 3OIQA 3SJMA 2JD3A 1HSJA 1MMSA 2VLAA 1D3YA 4M3BA 2QM3A 3K1MA 4BQAA 3H1CA 2YWAA 1SMYF 2DA6A 2FQ3A 1GS9A 3KLOA 3RYRA 2Y30A 3KYDB 1KQ0A 5JUAA 3BZ6A 3H2UA 4XSZF 1H9GA 1OCPA 2HZTA 3I64A 3J7AO 2NOJB 5L3QA 3C8GD 1ZZPA 2DO7A 4RGXA 1KU9A 3HOZJ 2BXYA 3PIOF 3J7ZI 5E2QA 2HVQA 4Y4RA 5B1AC 1W5CC 3QMKA 4N4OB 1Y8RB 3BG9A 1XWJA 3BJ6A 5B3IA 2L7MP 2RD9A 3AL0C 1OKRA 3RYLA 1TWCJ 1EA3A 2OQMA 2HNHA 3A0HC 4CGZA 2V9KA 2EPKX 2K9SA 1SYQA 2DYSC 5F5HA 3CO7C 3DMDA 3NKEA 4JC7A 1ON1A 1WI3A 1YITI 3GFLA 4IGGA 3RPQA 2P7VA 4BL0B 1RKCA 3A2KA 3G1OA 3T1BA 3EETA 3TJ5A 2FX0A 2I10A 3K4KA 4Y13A 1ORJA 4PGHA 2ZJRF 4KIFA 4PZJA 3M4BA 2V4JC 2E7XA 4CSAA 1F5TA 3WG7C 3HOYJ 1KU7A 4IHTA 3OA1A 1J75A 1ZGJA 1BJZA 2O6GE 1FPQA 3I54A 1Q0DA 2D1HA 3LMMA 3V8JA 1JUMA 1OCRH 3ASOH 3R4KA 2CNWD 4HSTA 3ZPLA 3DKAA 1CGOA 2M64A 2EIMC 3ML6A 3N05A 4FX5A 2HPMA 1JMWA 1A41A 3I58A 4DBRA 3D5LA 1WJDA 2R93J 3KZYA 4CYCB 2OAZA 2Y9ZA 2X4HA 1GXPA 5A69A 2DFEA 1RJ9A 3E7LA 4OIOF 1MSEC 1SANA 2PF4E 4R32A 1C03A 3H9QA 3K6GA 1PV3A 3GM1A 3K70D 2IXPA 4G12A 2J46A 2XLVA 2CYDA 3ZQHA 5H6RA 1UHWA 3IRQA 4HZFA 2BY1A 1BBYA 2XAHA 2CW8A 2W84A 1FTZA 1I4YA 3ASNH 3KEYA 4P55A 4ANJA 1G5ZA 5M5YJ 3Q7GA 1Z0XA 1RKWA 2DOEA 2KHMA 4D7MA 3QPTA 4RAZA 4JEBA 4PGGA 4A0ZA 1HQCA 4M9ZA 2DA3A 5J3LA 1IXCA 4D1QA 1KGSA 3ZMUA 4JCHA 4EUKB 3ZTZA 2UUZA 4U7DA 3CSKA 1HDDC 5EDNA 3WTXC 4OAZA 1ETKA 1MJAA 1MMAA 1V5GA 2OC6A 2DA2A 2ZFWA 3GYHX 4YT4A 1DP3A 1NG6A 1B68A 4LG0A 1BC8C 3S16J 4F3QA 5EHHA 5ICCA 3OYMA 2ZKZA 4EKWA 4BEJA 1WGXA 3E3VA 2IM8A 4XMYA 2VJJA 1SEUA 3OYGA 4BDZA 2UUHA 4IRHA 1I5NA 4D4XA 2KIUA 1ZYRF 2J45A 2KGOA 3RYPA 2XF6A 4DGWB 2XS8A 3GWNA 3Q6NA 2HSBA 4MTEA 3HJCA 5ILVA 1AKHA 5EEGA 3FK6A 2MC4A 3IAM2 5FKOA 3JREA 1CPRA 3Q6MA 4LG0B 2NRAC 4XKWA 2L02A 1FFTC 4M73A 5C4JJ 1ETQA 2IGKA 3N2ZB 3B02A 1SC7A 4IZZA 5L3DA 2DQLA 4MW3A 1LVAA 2XC7A 4P9TA 3I56I 2IGMA 1FBSA 2L2OA 3G3ZA 1ENHA 5E1XA 2VODA 2F6CA 4HV5A 4YT8A 2EQRA 3G6EI 3VOEA 4A0YA 1RZ4A 4XLEA 1N1CA 4BACA 1VQ7I 3F46A 1S29A 3IV5A 3L00A 2CV2A 2CU7A 3TULA 4ZYDA 2CQQA 4YWQA 1F1ZA 2XKOA 4UUTA 4C2UA 2CFXA 3JCUC 4E7ZA 1H88C 4JTCB 5FZTA 5FD5A 2KIFA 2MSYA 3IWZA 1BM9A 1KA8A 1JJ8C 2JPCA 4RGUA 4XLCA 4HX7A 1FSEA 2GIZA 3U9GA 3QTHA 1BR1A 2LRDA 2VIXA 5DCFA 1U9NA 2GA0A 2LREA 4AL0A 4JX4A 3DM9B 3EUKL 4KMUX 4BH9A 3U9MA 4NC6A 4BEMJ 3JAMK 2NS8A 3FXMA 3TW7A 2XSEA 1A6IA 3IUOA 3K0LA 3LAJA 4AVPA 1ULYA 1V54H 3DP7A 1SFKA 4NHJA 4AYBA 5HS7A 2X0CA 1R23A 4EM1A 2P81A 1TC3C 4B47A 3L34A 4U5EE 2DDBA 4ITVA 5LEJA 2EJRA 3F23A 4CZZA 2DCEA 4IHYA 4UNOA 1APCA 3MLGA 3US6A 1OR2A 5L0JA 1H0MA 1FFHA 3U1KA 1V5EA 3GEZA 1VI0A 1XMXA 2EV0A 2LK4A 3FOPA 2QKMB 3ULQB 2L7AA 4L5IA 1MMDA 2KMUA 2XAFA 4LITA 2K7LA 2KW3C 2DTZA 3B73A 1M1EB 3QRFF 3L7WA 2BY3A 1V3FA 5JI6A 1VQPI 2GLOA 1U8RA 2GA1A 4EHPA 5TJJA 3W2WA 1HMDA 1VYKA 3DI5A 3LFKA 1BI2A 3T8TA 2IYLD 3JT1A 2G9WA 2A6HF 1P7IA 1ORSC 2HR3A 5C3EJ 4LACB 4I02A 3SQNA 3ERED 4YIFA 4X0GA 1YA9A 2DYRC 2H7VC 2HMZA 3E97A 5A6AA 3FXLA 3HNLA 4DXWA 1D8JA 1K78B 2P8TA 1SFEA 4BU2A 3H0DA 1FEXA 2X6WA 5KYNA 4IHSA 2NS7A 2X1DA 3A1YA 4BAYA 2LD5A 4BJ6C 1O3RA 1IJWC 1GHCA 2Q9BA 4IAQA 3BY6A 5LD2C 2Y0SN 3A9CA 4XPWA 2R7QA 4G8XA 4BJ1A 3HKKA 3HOUJ 2ASRA 1BBHA 4OMYA 3HOTA 1QA6A 3IWFA 3LJBA 3F8MA 4EBKA 3PMRA 5AGFA 3T6JA 5CVRA 3C8ZA 3C2HA 4QWQA 5D6FA 2VQCA 3OYEA 2W25A 4LG3A 4B3XA 2VE9A 2VC9A 4KN4X 2X6XA 4O6YA 4GQHA 2R7SA 3CF5F 2L4AA 1W1WE 2KL4A 2Z5UA 5D6EA 3LSPA 4NTBA 2FF4A 5JR3A 4ENNA 1R49A 3C8GA 5J1UA 2HVSA 2HV6A 3S0XA 3FXKA 4EWCA 4XQFA 2UZKA 4A93J 4RBOA 1NBBA 1F9NA 3QW0A 1YARO 1T33A 2QQAA 2J9WA 1R5ID 3I9V2 3QU6A 4CHUA 2XL4A 2DOAA 2WV1A 3CP2A 1LNWA 3GTQJ 3FZVA 5HV9A 2DA7A 1XB4A 3H9GA 2AVKA 1FP2A 3M3YJ 1J9IA 3CEXA 3MX3A 2KYHA 2CSOA 1VB5A 5BQHA 4MEXF 5IPAA 2P7CB 4CS9C 5JVEA 3SZGA 1QU3A 5HOOA 2TMVP 2RV8A 3K4MA 2VBWA 1FY7A 2Z2SB 4UY8I 1IGNA 2RNGA 2WY8Q 5HS8A 3BRJA 3EPVA 2K40A 4U0YA 1QBJA 1ZW2A 3EGDB 4KISA 4JKVA 1Z23A 4XSXF 1MBFA 1TLHB 2W4MA 1L3PA 5CVUA 2VB6A 3LEVA 2ZXOA 4E0HA 1HSTA 1OKKA 1D8KA 1Z3YA 4M9SA 2QE9A 3B0PA 3D1NI 3CCJI 2W7NA 2O8KA 5FROA 1PDNC 4CCOA 3DXJF 5HNFA 1TNTA 3AG4H 2I5UA 2QSHX 1LE8B 4DYRA 5A2QK 2LCHA 3KP6A 4XKVA 4HA8A 5LGUA 1DUXC 2DA5A 1OR7C 2LKXA 2CFOA 3Q0WA 2CCYA 2YL7A 1QPMA 3FHNA 2BZTA 4N4WA 4CCJA 4F55A 2XV4S 4DOZA 3S17J 3FBNB 4JZAA 2AQFA 1GUUA 3HSRA 2LYCA 4DZJA 3CMEI 4NCQA 4IJAA 5JP7A 3FAJA 3EHNA 4CA0A 4QI0A 1GXQA 4KYWA 4UVBA 2XL6A 3RSNA 1VQ8I 2ME6A 2RAEA 5DD8A 5EGOA 2QUFA 1B72B 3H2VA 3E1SA 3B0UX 2DYSH 1V5FA 1J8YF 1H7IA 3Q0VA 5D5VB 1RMVA 2DFIA 4LK1F 4WWCA 2W85A 4JVSA 3OS1A 4XWJA 4PJLA 2JA5J 4F91B 1WH5A 1BZ4A 1Z77A 4EGYA 3BROA 2LH9A 2DPUA 2EILC 3ZOBA 4G7OF 2R3SA 1PCXA 2XUBA 2R92J 4Z9IA 3I59B 4HLXA 1SFXA 5DCMA 3CF2A 5EGOB 1IUFA 3CDIA 2MHRA 2VE8A 1VOMA 2HKOA 4K7BA 1TFOB 3NMKA 1YJWI 4GCVA 1TWAA 2R7WA 1WPKA 5KVRA 1HE9A 1Z3IX 2RGVA 4AIDA 3T9OA 3QYFA 4XK4A 2DODA 4YG2F 4CSAC 3IQCA 2DT5A 2E1MC 1D1BA 2Z33A 1X3ZB 3SXKA 2Q2EA 2CUFA 2K3PA 2UWMA 4CDVA 2M8EA 4HF0A 1TKNA 1HCRA 1VQKI 2RREA 1B9NA 2P6TA 3OYLA 1Y4CA 2MH9A 1VQ5I 3QYBA 3HOSA 2DU9A 4IARA 5B1BC 3ABMC 2ZMEA 2N8GA 4G9YA 3CUQA 4HNVA 3WTSC 3CC7I 2HFIA 2OCEA 5M5XJ 2JA6J 1WCMJ 2DFHA 2Q2EB 3I5UA 1S3JA 3B6CA 2LDUA 4A3LJ 2BOLA 3RKWA 3FM5A 3RQ4A 2BW3A 4GFBA 2F4IA 5E3CA 1Z21A 2HI3A 2WTEA 3J80K 1MZBA 1DDNA 1A7DA 4Q48A 1ZGAA 3GFIA 4UUSA 1NU9C 3QW1A 2EA4A 2F48A 4CSWA 3O3KA 1IF1A 2OD5A 3EH1A 1Z6RA 3DTEA 1AU7A 2KQ9A 3E70C 1JPJA 3FM3A 2DT7B 4JTDB 1FLIA 4BQOA 5E33A 2TDXA 1G4DA 1QZXA 3PQJA 3Q3SA 2WY7Q 4JEAA 4AE4B 1LS1A 2XLEA 3TBIA 1TQMA 1IO2A 1YYXA 5FLMJ 3W4YA 2L6HA 4YL3A 2GZWA 4M3FA 3JSZA 3UKGA 4RB0A 1Y0UA 2VC0A 4B44A 1T6QA 3DBRB 2RVCA 1R71A 4EJOA 5L3EA 4X1EA 3W2VA 4U0VA 4KNYA 4CBEA 2IW5A 3H36A 5E20A 2RDPA 5LBQA 3K7AJ 4MNDA 1E3PA 3BDDA 4OAYA 1H8AC 1NLXA 4XKBA 2ZXJA 4JW1A 3MZYA 4LGWA 2GXAA 3VSLA 1W0UA 4AVZA 3WU2C 1U5TA 1XSDA 1O3UA 1V74B 2ZNYA 2Z1DA 3K4JA 3RW0A 3TD7A 5BOXA 1OLTA 1Z9CA 2WVOA 4CXFA 1NK2P 3LUTB 5BQTA 2E1NA 3WU1B 1Z7Qc 4BQNA 2Y69C 1K6YA 2K9MA 2OBPA 4BUPA 1LPEA 2LK2A 1U9OA 4NC8A 4XN3A 1B9MA 4O5VA 1YX3A 256BA 4C3DA 2NUTA 1LE2A 1MBEA 2H27A 2Y0MA 4W8KA 1L3LA 2WVQA 1LPQA 2CDQA 3TDUC 3JW4A 3GW2A 1OCOH 3G71I 2M3AA 3L09A 2O9XA 4V19K 5FFZA 2OJED 3BR6A 3EZIA 2LKSA 2RQPA 2LBFA 2V9PA 4YFKF 4EJWA 3RPUA 3WHNA 1NFOA 2HQ5A 2V1XA 3QPHA 5GPCA 4RDAA 4E7IA 4AU7A 3DWWA 4CYDA 2FA5A 4E0IA 4XBFA 1WRJA 4BEHB 2F2EA 3RKXA 3Q5FA 3L2UA 1HLVA 5FRMA 3WHCA 1J8MF 3MQ0A 2R0QC 2V7FA 4G6TB 4EIYA 2ZXWC 1S7OA 1ZQ3P 1MBJA 3F0CA 3ZR8X 2Q1ZB 3K69A 1M2VA 2LBFB 2PBIA 1ETVA 1WFXA 2M4GA 3OMYA 3OS2A 1FIAA 1GDTA 2IS4A 1J59A 1A04A 4OD5A 1YX5A 4RAGA 3JTHA 3HM5A 5CI9A 3UMIA 3GZNB 3L2CA 2PX9A 2ELHA 2YPRA 3L2RA 3U0CA 2IAIA 4I09A 5KYUA 1VQ4I 4CCNA 5FKLA 2IA1A 3C2BA 1APLC 2W1OA 1T9KA 5KYWA 3BPXA 4LK0F 4BE2A 2HVRA 4J7YA 4DRJB 2B0LA 2OCCC 2DMQA 4HFKB 2VKVA 4ZTFA 2DJIA 3U5SA 1RUOA 1TWHJ 4S0HB 2KIQA 3OR1C 2CW7A 3PO3J 3VWBA 1Y56A 2D1VA 2D5VA 2VXZA 4U9DA 1IV6A 2LIGA 3IQ6A 1I3QJ 3DPUA 1SD5A 1WJFA 4V2FA 1DU6A 1YIOA 2H09A 2NVYJ 2JJ7A 3DPTA 3KP2A 2DMUA 3IAS2 3HUGA 2HTJA 5FKKA 4MHGA 2VJ5A 1NHAA 1VQMI 4UUVA 4E7JA 1W2WA 4I1MA 5DQTA 5CQGA 3DTKA 1VYIA 2HWVA 4IQJA 2E35A 4L18B 1J7KA 3ZQ7A 2NUPA 3SEQA 2DA1A 3BWGA 1ZW3A 2KC3A 1QZEA 2CH0A 3H3ZA 4MS2A 2L01A 3FXUA 2IT0A 4J00A 4LDQA 4DIQA 3HXLA 1EQ1A 1C02A 3HTUA 2HPIA 4EJUA 1ZG1A 4Z2YA 2EV6A 3HUGB 1YO5C 3MKYB 2R7UA 5HDKA 2L7FP 3SDBA 4B1RA 2FAPB 5IP7J 1P4XA 5C44J 4Y3OA 2MYSA 2CW0F 1CGME 3E5XA 4OU0A 3HNJA 2YS9A 2R7RA 2M5WA 2XDVA 2GAUA 5DQZA 2WAQA 1IN7A 4XLNF 5IYBJ 2WB7A 3KLNA 4NB5A 1V55H 3M1CB 4MO7A 1QNTA 1LDJA 3BG6A 4I0AA 1X1PA 2IBFA 2IXSA 4LLCA 3JCUQ 4XPXA 4JURI 4U5CE 2MG4A 4ESBA 4ZLDA 1H6GA 3IH3A 1XGSA 1K61A 1EF4A 4BXXJ 2QUPA 1HF0A 3AG3H 3SYTA 2TCTA 1OJLA 4B3AA 1K7AA 5JLXA 4HEA2 1ONVA 2K3FA 3H35A 5L0CA 1DOVA 3A01A 3CCSI 3IKVA 3RJPA 3POVA 3REOA 4LOCA 1KU3A 3KE2A 3U8PA 1QQIA 4XLFA 2CQXA 3LA2A 3C62A 4DVZA 2H8WA 3DLAA 3RFYA 1E85A 2VASA 3FVYA 3ZMVA 2L0KA 4MVMA 3S2DJ 5L0FA 5HVQC 2OJQA 2AWCA 4PJ0C 1WZ2A 4LB6B 1A7EA 4A5MA 4CS9A 2LF8A 5DDGA 2J9BA 4MTFA 3A01B 5H6QA 3S93A 1WOLA 3V42A 4P1WA 4IX7A 1VQ6I 3EFOA 2LF7A 5T3WA 3S90A 2J9UA 3V5ZA 2LY9A 4HW0A 5F0HA 5DS9A 3HNIA 2HYJA 2ID6A 3ABUA 3DPLC 4GXOA 1QVTA 2R9RB 1XGNA 2GOMA 4FE4A 5J6XA 1HY5A 3ABLC 2L54A 4LLGF 4BJTA 2KJCA 2E87A 4RMNA 4M3GA 4A5NA 2L4MA 1Y39A 1MDMB 5JHFA 3I4MJ 2A0UA 4LB5A 2KRCA 4HV6A 3TOBA 3TO6A 4P9UA 1WI9A 1YZCA 3W6JB 1WJAA 2L81A 2EILH 1R5HA 4CIHA 2BGCA 2K4JA 3MKLA 3P7NA 1YJNI 2FNAA 3KYJA 3PCVA 5T3TA 4A6EA 3CCEI 4JCZA 2DB4A 1ZVZA 2A61A 5F5FA 5C4XJ 4C2MJ 3GX4X 1Z3XA 5A6BA 4XRSG 4PACA 3GLLA 5FGMA 5FCLA 3BTCA 1D0ZA 1G3WA 2Y31A 3E5UA 2M9HA 3BQYA 3MD2A 2WB1N 3P9KA 3VYTB 5K5QA 4I76A 1T01A 2R7XA 4B43A 4XLPF 3WGIA 4CH7A 3EHMA 2H7OA 4XEVA 1RETA 2WA0A 2EINH 1VNDA 2M0MA 2PFBA 3JSPA 1Q0KA 3MWMA 1X4PA 4PDKA 2PX0A 4GEHA 5J8FA 5GAGJ 3ESWB 3H0GJ 1T08B 2M8GX 4I6ZA 2XLWA 5IY5H 2ZB9A 4BHCA 3V7SA 2G3VA 4F4BA 5DUIA 3CESA 4CO8A 2G62A 3K1IA 3U1DA 3F6OA 4C3IJ 1EJ9A 5HLHA 3T5XA 2V9VA 4I7HA 1A5JA 1OXKA 2W00A 1OPCA 2G7UA 3ABMH 4JQFA 4XEKA 4MNUA 4HNUA 2YU9J 1GT0C 3NAUA 1VLTA 5EG0B 4BNCA 4A3FJ 1Y1VJ 2L5QA 2MFZA 5K5OA 4ZYGA 1S05A 2HSQA 3LOCA 4XQ1A 4L9VA 1R7JA 2J5PA 2KP6A 4CYCA 2PI0A 1O3SA 4II3A 1T8IA 5JSLA 1LFBA 5L0GA 3T4RA 2A0BA 2P61A 2XXAA 3I4UA 2ZMEC 3CCYA 3GFMA 3CUQC 5LRRA 2R5YB 3CMMA 2HZDA 3PHF2 3E6DA 4UHTA 5IOZA 5ILUA 4A69C 1HDPA 1TBXA 3ZXSA 1Y6DA 3H65A 4L6RA 1OKKD 1RR7A 3WTVC 1NFNA 2VPLA 4U9EA 2H6CA 1YE9A 1M56C 2HQNA 3TJ6A 2IVMA 3M1EA 2COBA 3RCOA 2XXAB 2CMPA 2IA0A 5FJ8J 3S1MJ 3NWSA 3T8RA 3W3CA 2VUMJ 3OSGA 1B8IA 4PFPA 3H9JA 1RKTA 4BE0A 4XN0A 3KMIA 3TGNA 1LI5A 5D91A 3LSJA 1GV2A 1ZAOA 1DOWA 3MAJA 2X9DA 1HE1A 1FOKA 1AUEA 3WGGA 1UG2A 2XGXA 2FBIA 2OTJI 1HBXG 3ABTA 2XAUA 2ETSA 1D1AA 1TW3A 3CCQI 1R22A 1D5VA 1K05A 3E9VA 4EJTA 2EIKC 4JIOA 2ETHA 4CDAA 1G8XA 3F72A 1B8IB 5KYYB 2XRHA 1G3TA 3W8HA 4M6XA 4I98B 5FO5A 2XM4A 3GUDA 1LFUP 4XKCA 2EPLX 2YKZA 4CS8A 3K33A 1UHMA 1U5TC 2WAFA 1HC8A 1ZHZA 2QY9A 1BJAA 3MYIA 2M34A 3K4NA 1IW7F 2K9NA 3OOPA 2C6YA 1OW8A 2KZGA 3CQZJ 2PN6A 4ZC3A 1EI7A 2DMPA 5L3FA 3CO6C 2ZJQF 4EM2A 3UR3C 1JKOC 4MW8A 1F43A 3BR0A 4FCYA 5AC4A 3EGXA 4E4HA 2I15A 3BG7A 3O6BB 3R61A 2LVSA 2W82A 3HKZN 3ZQGA 1QPUA 3HSEA 4EBJA 2J8WA 2OV7A 1TWCA 1YG2A 2QSFX 5K0IA 3N24A 2K86A 1U89A 2WZLA 4QPQA 4G7HF 2A5WA 1IAWA 3CUOA 1B59A 1T38A 3KP4A 2CG4A 2DN0A 4IAOA 2XSJC 1R9TJ 2B63J 3QVYA 5B3SC 3L1PA 5DVWA 4II2A 1X2NA 3EGXB 5DD4A 3GTOJ 4Y33A 4BJ5A 2M4EA 1T6SA 4EJVA 2MBFA 1S6LA 3VYWA 4DYQA 5K5RA 1HW1A 5HLIA 4N9HA 3OL3A 4RLQA 5KK1A 1JI8A 4K0DA 2BY0A 2H1KA 1ORYA 2B0HA 2AS5F 2YL1A 3GLXA 3MZ8A 1UZCA 4QSHA 3BR2A 2FU4A 2ZNZA 2OZUA 3GODA 4LD5A 3EH2A 2FSWA 1T95A 3H5RA 4LMYA 3NRVA 2ADUA 3CLOA 3ZMTA 1FOWA 5LRSA 4CDGA 2HFHA 1QZYA 2NVQJ 4AX2A 1MD0A 1MBKA 1KTMA 3B71A 1VMAA 2VBXA 5FLXK 1Q0MA 2JA2A 3K1NA 3ZQVA 2VL8A 3CCUI 1UG7A 3BCBA 2Q3TA 1PP8F 1DGRM 5D8KB 3P9CA 1K83J 3SFIA 3C18A 4BXUA 3NEUA 3LA3A 2VOOA 3FF5A 1FYLA 5IYDJ 1GV5A 3AQBA 1TQIA 3UGPA 5E8IA 3DAFA 1XDUA 4WGYA 3M4OJ 3ZMDA 2C03A 4U7BA 5BUOA 4D7NA 1BI0A 1YW9A 2PJRB 3QP6A 1K78A 3U8VA 1QVXA 4C2TA 5TJ5E 1JT0A 4J19A 5HSWA 1HA8A 1X4OA 1SF8A 3F8BA 2A05A 5CJ9A 3AG2C 4ZLCA 3LAPA 5L3GA 3LLIA 1MBHA 3E0JB 4OOIA 2GXBA 1W5SA 2NNNA 3TP0A 1TTYA 3F6VA 5DM6F 5FRNA 3CDLA 4D9JA 1WATA 4JTAB 2GBYA 1HKTA 1QZZA 3KP7A 3LSIA 1MNDA 3F3XA 1QRYA 3HB9A 2KDOA 4C3HJ 5EK0A 3RQFA 2HXIA 3K9TA 2OU6A 3ZSUA 5F28E 2FMLA 1TW2A 2NS0A 3F21A 1LIHA 1HOMA 2DA4A 4H0EA 1ZTRA 2LP4A 2Q8KA 2DI3A 1G4WR 2E19A 1OCCH 3J7YJ 5DM7F 2LR8A 1GQAA 4C3BA 3LQRA 3RPUD 4AWXB 2O61A 2ISZA 5J1RA 4A3KJ 4YRVA 4BY1J 3K4BA 3OYBA 1T39A 2EA2A 3B6AA 1U3EM 3IH2A 2H8AA 4Y17A 2BBYA 4CS7A 2E36A 2CWEA 3QYEA 4RA2A 3DJUB 1PD0A 3LSRA 2C04A 1AEPA 3BQZA 4PCQA 2VKHA 3MBGA 1Z7UA 1QHHD 4HOBA 1YIJI 3K4CA 2W9YA 1O7FA 1WJBA 1HKSA 2QQ8A 2HZ8A 1YHQI 2ICWG 3KYIA 2JQ7A 2AU5A 1MBGA 5AIQA 3LNQA 3EGDA 2R4GA 1FX7A 2R5ZB 2RNJA 3TOMA 3V7OA 1NTCA 1OCZH 2LNBA 1D1CA 2ZXRA 4DVYP 2XL8A 1VF9A 4C30A 1JTXA 3GORA 2K4BA 2YZSA 1ZHWA 2M7BA 1ORKA 2DBBA 2YX4A 5D4RA 4JE9A 2KDZA 1VK5A 2GQQA 3CJQB 3TW6A 5GADJ 3LL7A 5HODA 1LE8A 5DLJA 4CJGA 3GXOA 3KH2A 3ITFA 4LJZF 5JT4A 3FDYA 2W45A 1I5ZA 3FKIJ 4O7GA 1OYWA 3I71A 4A3CJ 2Z15A 1WH7A 2J0XA 5E1WA 2DXIA 2Y0SA 2HJMA 2CO5A 4U5FE 1IDYA 3G1MA 5IT9K 4A0XA 1FC3A 2KKOA 3OOUA 5HDGA 3GTGJ 2LFBA 3L8JA 4BY7J 1E3OC 2EV5A 4HF2A 1JUSA 1MMGA 2W57A 5FFXA 2LY1A 4KNVA 4RB1A 2QGUA 3MVPA 3NKDA 2E34A 3K66A 5E8GA 2OEVA 3CTAA 4GGGA 2Y3GA 4CZCA 3KL4A 4NC3A 1GM5A 4FESA 5COMA 2OZ6A 1B72A 3WTTC 2ACJA 2EIJC 2HDDA 3V8KA 2KISA 3ZGKA 5K7FA 1YA7O 4JX6A 4M71A 1WN0A 3ABKC 2FRHA 5E79C 3N4MA 1M2OA 1ZU4A 3V7CA 4KDPA 1FIPA 2LSOA 2M30A 4AD9A 5L0DA 3H3VK 4KA4A 1S5LC 2EPMX 1LFPA 5B1AH 2HYGD 3K4LA 3I59A 4PSWA 3SEOA 1SFOJ 1I50J 2KRHA 4KC9A 1C17M 1TWGJ 3MKWB 1Y6IA 1XN7A 4EGZA 4LERA 4O6MA 1ZLJA 2UV1A 3IL2A 3K6BA 2DT6A 2HQRA 2NAZA 3KEOA 2MC3A 2H8RA 3X2QC 3A0BC 2R7OA 1IV8A 4PJNA 4IRGA 4PK4A 3WG9A 2LLKA 2O0YA 1RIOH 2FD5A 2PNOA 4HE8D 2XS1A 3NARA 4JRZA 4HNTA 2X85A 4JOMA 3K1IC 3J06A 1HW5A 2AHQA 2CGPA 5D5WB 1FBUA 4PSXA 3WG7H 4G7ZF 3L2VA 1Z6TA 3RI4A 1TFKB 1ZHFA 2WADA 4FWVA 2CUZA 4J32B 1YYJA 3S2WA 1ZHYA 3OV8A 2IA2A 2L6GA 1X58A 3ZG1A 1CF7A 1A35A 2EIMH 4O3MA 1G6NA 3HTSB 2BL2A 2DGJA 1LDDA 3BPVA 1TT5B 1FOXA 5IYCJ 4BYYA 4C7OB 3KCCA 4ESFA 3GBGA 3BZKA 1P4WA 3IH4A 2IXOA 2CUEA 2ZCWA 1FT9A 1A6QA 2IGOA 1JGGA 4ENMA 4WABA 2Q7RA 2R7FA 1YRNB 4NQWB 1CF7B 2OEXA 3VPRA 4GYIA 1NH3A 4D4NA 2YQYA 1OISA 1B6AA 1RR8C 1EV7A 2IXMA 2FNPA 4AUXA 2QQBA 3S3MA 1MSFC 4MVRA 3U9JA 2ESNA 3LFUA 2STWA 2JUCA 4ABZA 3BTJA 4HDVA 2M7AA 5J47A 1XZQA 1Y8QB 3IEEA 3S14J 3HIFA 4P5OA 3LNMB 3CP8A 1IDZA 4ER9A 3NWTA 1MH3A 1P92A 2L7ZA 4R8HA 4AE4A 1J0RA 1UELB 2KJGA 2CJJA 3PFYA 2D2WA 3TK0A 1Z1DA 3DV8A 3ZQFA 1VTMP 5CYVA 3HGYA 1O3QA 1N25A 2QENA 1JGSA 3K1PA 1MGTA 4E7SA 1ZRFA 1PD1A 3ZP5A 3NG1A 3ZQIA 3JRTA 2FBHA 2WWYA 4HEAJ 2ZFUA 3Q9SA 1AVOB 1Q1HA 1JTYA 3OYIA 4O79A 3QODA 1KNYA 5BS6A 3PFIA 4U5HA 3JAMZ 1CPQA 2LOOA 1FNTc 1JKPC 1XGMA 2ZXPA 4CCKA 3JRBA 3IPMO 3JYYA 3DBLB 2W4SA 1SZIA 3M7GA 4JK1X 2KNHA 4Z9HA 2ZBKA 3S84A 4KUMA 5A6BD 3FKJA 1BI3A 1TWGA 4CS8C 3Q9VA 3ZQQA 2IS6A 2PMZN 1NG7A 1XG1A 4LLLA 1R4TA 2HQAA 1EH7A 4CCMA 5CI8A 1RKEB 3E5QA 4ZH4F 4XRSA 3JSEO 2OF7A 4BPMA 2XLMA 3M8JA 1PJRA 2ECBA 4FASD 1RESA 1X3UA 3NMIA 2GWRA 3G73A 2DPDA 3JRAA 3D5RC 2OA4A 3CC2I 1JPNA 4M74A 4YIRX 4DRHB 3EG9B 2E1OA 3VYUB 3WGHA 2E71A 1P2FA 4KJZA 5GTHC 1OCRC 3ASOC 3FAPB 3S9OA 4W1UA 4XL9A 4L0YB 2OOCA 3MYFA 1JT6A 5JHUA 1WGWA 4RDUA 4E17A 1LUJB 2H6BA 1VQNI 2L6FA 2ZXHA 2P0NA 4HG2A 1YS6A 2XF7A 2CQ7A 5EJCA 2OTLI 1NZEA 1T0FA 1FJLA 4CIPA 4U0WA 5JVGF 3GWZA 2Q0OA 2IXNA 4BEHA 1LB2A 3GTLJ 2F5VA 3CJRB 4XOPA 3ZMZA 3MN2A 1IN6A 1MNEA 4BJ5C 3C63A 3CJTB 1E17A 1G3YA 4WXCA 3S3OA 2ZC2A 1O3TA 2Q00A 3HGGA 1UCRA 2BHYA 3ASNC 5EEHA 3ERMA 3HBLA 5GPGB 3NQOA 3DM5A 3VM6A 1OCTC 3TKYA 5HLGA 2P4WA 3OYCA 3HPGA 4MVZA 1R4MB 3HZJA 5K1YA 2ZO4A 2E5ZA 3S15J 5ICEA 3DFGA 3HLZA 4HSRA 3VF0A 4M72A 1REPC 4YJWA 1D0YA 5CKTA 1RCPA 1PP7U 4A4AA 2X48A 5TISC 3T0YA 3B0VC 3ELKA 2L9JA 1A31A 1OQYA 2HV7A 3GEHA 4D5FA 1GVJA 1VQLI 4KIBA 2NYXA 3W2AA 4IHWA 4MGRA 2AWYA 3FOOA 2MD0A 2PMHA 1N77A 4W97A 4JJGA 2KPMA 9ANTA 2NVTJ 5LLQA 1XPXA 2BEOA 2O5RA 3O2PE 2LY2A 3BOQA 3RZOJ 4KBLA 4NTAA 3P9IA 4ZDLA 4HYEA 4KITB 3DE8A 4PR9A 2QBYB 4GRIA 4K1OA 2DYRH 3HHHA 5D4SA 3TP3A 2KJBA 1T98A 5FKNA 3VAYA 3ZCOA 2QF7A 2FQ4A 2E1CA 3WODF 4MVOA 3D5SC 5E3MA 1R1UA 3VB2A 1PVEA 2JPBA 2IBDA 2XAGA 4JBAA 4YL1A 3RIPA 1BR2A 2WL8A 1VFCA 5HS9A 3OR2C 3JRMO 2FJ1A 2PQ8A 3WTZA 4IVNA 4B8XA 1BW5A 2LQGA 5ICGA 1ZN2A 5COFA 3F47A 1BW6A 3BJAA 3FXOA 3EZHA 4D0PA 3L0IA 3O39A 1TT0A 2E5NA 1ZU5A 2K85A 3W6VA 1G2HA 3MKZA 1NSGB 2FOKA 2WV0A 1E3HA 3F9KA 1VTNC 1IG7A 1LEBA 3J81Z 2EPNA 3M1CA 5A2QZ 1FYMA 1FR0A 5F08A 5GPAA 3KIOA 3LSMA 5M5WJ 4DJAA 2NVXJ 1R1VA 3LSHA 2L9NA 3OWTA 3FXRA 4UDVA 1JHHA 5F1RA 1U0JA 4EQQA 3ZN1A 2GIVA 1V54C 2NSGA 5D5UB 4J7TA 2YL3A 1FAPB 2KIMA 4ZJZA 1YDIA 5E17F 3GTPJ 3KKBA 3TOLA 2R7DA 3OSFA 2FGYA 3OIPA 3R0JA 4KFCA 2R7TA 5A6KA 4RS8A 2EFPA 4M9XA 3SDGA 1Q0FA 5F0FA 3QPLA 3OS0A 3HRSA 2QLAA 2E7WA 3DEUA 4YFXF 1T2KA 2L9RA 4QPOA 5JVTA 4FHTA 3DF8A 4RAYA 2P6SA 4ULVA 2CV1A 4A3GJ 2JA7J 3C1DA 1O7LA 2XPVA 3R2PA 2DTRA 4BS9A 2KLOA 2EFWA 3DWLE 3RF3A
chains in the Genus database with same CATH topology
5ICFA 2EWNA 2V6CA 2M1BA 1SD7A 2FMYA 2XRNA 3CJNA 3LA7A 1W7PA 4Y15A 2JSCA 2O3FA 1QO0D 5DYMA 1UB9A 2YR2A 3RKYA 1XGOA 5AONA 3HSFA 4A6DA 1XDSA 1MDMA 4WXDA 1W7PB 1XD7A 3F8FA 2VT2A 1IXSB 2HS5A 3KETA 5DEQA 4GYGA 1UFMA 1I1GA 2WC2A 4Q5SF 1WQ2A 2O03A 2VBYA 2MLKA 4WK8F 1FWZA 2RKHA 3TO9A 1LEAA 3J80Z 2VONA 2XKPA 3TDZC 4YIIA 2QZ8A 1R1TA 5LHGA 1YW8A 1B4AA 2A69F 1DPUA 4WF2A 3AAFA 3R6SA 1LJ9A 3SZTA 1HKQA 2HOEA 3R60A 2OU2A 4FX0A 1STZA 2PLYA 2QQ9A 5HDNA 1SMTA 2X0LA 5FD6A 2PEXA 4R79A 1W5TA 2IP2A 3IC7A 1YFHA 5L3BA 2F5FA 4A2UA 1O57A 1FP1D 2HTSA 3CDHA 5IT3A 2FBKA 3VEPA 3HHGA 4OIQF 1AWCA 2XAJA 4IXAA 2MD5A 3FX3A 1USSA 4IF4A 3WTYC 2AXLA 3DQVC 3E6MA 4EMSA 4OINF 2UXNA 1DPRA 1IRFA 3F8CA 1YTYA 5J8CA 1K79A 2P7VB 4L0ZB 3QAHA 4MQ9F 1E2XA 5D5XB 3FMRA 1ZLKA 4EV0A 4UV9A 3IRRA 2A07F 1BOAA 5LHHA 2A68F 5DV5A 2COMA 2EFNA 3ROUA 2K02A 1Z91A 2HKXA 4KN7X 3GO5A 1YS7A 3SZPA 1MKMA 2A5YB 2EB7A 3ECHA 4RGSA 2VT3A 1U2WA 2VC1A 2IRFG 3GZ6A 3HRUA 1IXRC 2GXGA 4FT8A 2BYVE 4XRFA 4ZZDA 2HYFA 1IN8A 2A6EF 4P96A 1IN4A 4AIKA 2V1DA 4UVCA 2LKPA 3EQLF 4HF1A 3LQQA 3TQNA 1ZREA 4HX8A 1F4KA 4K2EA 1SD4A 1USTA 2MH2A 2VBZA 2F5DA 2W24A 3L9FA 2JT1A 4ZYHA 1YYVA 3K2ZA 4R1HA 4ETSA 3RTRA 1R36A 2F5EA 1R58A 1Z05A 4S05A 1CGPA 4WX9A 3C3WA 1KQ8A 3E6BA 3H3UA 2V1UA 1C0WA 3R0AA 3KZZA 5LGNA 1PUEE 1QGPA 1XMKA 5ED4A 4A12A 1MJ9A 1HW2A 1XCBA 5CVJA 2RN7A 2M45A 3BJOA 4G6DA 4OMZA 3D0SA 5BPIA 3MZHA 1IN5A 1U78A 1I1SA 3QOPA 1RI7A 3KP5A 2BV6A 3DKWA 3VFZA 5ILSA 2D45A 1ZRCA 2FEZA 1EH8A 5H20A 5JFRA 2F5CA 4Q4ZF 1S7AA 4EVIA 5E1ZB 2DAOA 1ZRDA 4F7ZA 2ISYA 4ENJA 3SHFA 4I2OA 4ASNA 4E70A 2M87A 2JRTA 1J2XA 5F64A 1ZG5A 2A3SA 2XVCA 4FX4A 2PMUA 5F6FA 1ON2A 4GO1A 5ERIA 2VN2A 2P5LC 1S8NA 3ECOA 2DQRA 3E6CC 4I01A 4OIRF 4HLYA 1BIAA 2XROA 2QWWA 5E18F 2KRFA 1JHFA 3IHUA 3VODA 3QU3A 1TQPA 1G3SA 4ZZLA 1SFUA 1AOYA 1K6OA 5D8LB 3J81K 3KEQA 5CVIA 3JSOA 5L3CA 4TV7A 3EUHA 2CQKA 4L9TA 1V4RA 1IUYA 3N97A 1YW7A 2PJPA 1ZG3A 4M6YA 4NQWA 3SXYA 1FNNA 4L9NA 1W7PD 4EM0B 1RNLA 2PG4A 3WTWC 4MEYF 2Y48A 4CICA 4MTDA 2RC4A 3ZN0A 4HAMA 3RDIA 1RUNA 2OQGA 1WKMA 1J5YA 1OMIA 3GZ5A 3HYIA 4UXNA 3V7RA 2P5KA 1BIBA 5DCMB 1BI1A 4P9FA 2L3DA 2Z3YA 1W4MA 2YU3A 2DLLA 3HRTA 4KIGA 1FZPB 5LHIA 1MJBA 2DK8A 1ODDA 3WE3A 2V79A 5AIPA 2JTVA 2XHKA 3COAC 5FLXZ 4U88A 1JE8A 2K27A 1YQAA 5LEKA 2MA3A 4I0BA 4LLNA 2YSRA 3FMQA 3U2RA 2IJLA 1JXSA 4AIJA 2ZMEB 1KU2A 2P5VA 3CUQB 3TOAA 3ZMSA 2CYYA 3GF2A 4G6QA 2FXAA 4ESJA 2ZJ2A 5CVVA 4UVAA 1OYYA 3FHZA 2OQRA 3KFWX 2UXXA 2DW4A 1I27A 5BPDA 2VOPA 4L9JA 3V8LA 3BP8A 1YLFA 4MQVA 1WSUA 1WWXA 1LDKB 1R5GA 4OIPF 3M8FA 2HDCA 3TO7A 1IZ1A 2XASA 4WXHA 2Z9OA 5FB2A 4RB3C 2Z99A 2QVOA 2EFOA 3H92A 2QBYA 1U5TB 4ON0A 2GA2A 3PQKA 1LQ1A 3V4GA 3EYYA 3FMSA 3FWEA 3RIRA 4O6JA 4HDUA 3C7JA 1B1BA 1KYZA 4WCGA 2EK5A 4LFUA 2O8XA 3I0TA 3EYIA 2IPQX 1KQ9A 1FYKA 2FE3A 5IT9Z 4RB2C 1DP7P 3KP3A 3M9AA 4BHPA 3MFKA 2STTA 4IPAA 3MCZA 4DNCA 4RGRA 5DUKA 5LGTA 3I53A 5TRDA 4HQEA 4HBLA 2BE5F 1L0OC 2DK5A 3FXQA 2EFQA 2XIGA 4AIHA 4S04A 5BMZA 3F8NA 2Y75A 1XSXA 4QLCU 3IKTA 3JTGA 3WTUC 6PAXA 1U6GA 3HRMA 1EH6A 4ENKA 1SAXA 2G7HA 2XAQA 3F22A 1XMAA 2NNYA 1P4AA 3GFJA 1P6RA 1FBQA 1FSHA 1HXDA 2QLZA 4HQMA 1BC7C 1XCVA 3LWFA 1OYIA 3LSTA 3MEXA 2J5OA 3GVAA 4G94A 1BN5A 2H94A 4N0BA 4YFNF 1ZH5A 4L5JA 2QYOA 1R00A 1SD6A 1H9TA 4B09A 3WU0A 3EDPA 3M8EA 4UV8A 3WE2A 4KMFA 3SFZA 3I4PA 3W6KB 2YX7A 2JZYA 1XSVA 2ESHA 4Q47A 1KYWA 4DQ2A 4KICA 1IRGA 3SXMA 4HX4A 1TNSA 4KT5C 4ZYEA 4IRIA 4N9IA 4BHBA 3SXZA 2HEOA 2MLGA 3QP5A 1OR7A 5CLSA 1I6XA 1ZARA 2HGCA 3ISPA 1HSJA 1D3YA 2QM3A 3K1MA 4BQAA 1SMYF 2FQ3A 3KLOA 3RYRA 1KQ0A 3BZ6A 4XSZF 1H9GA 2HZTA 3I64A 3J7AO 2DO7A 4RGXA 1KU9A 3BJ6A 1OKRA 4CGZA 3CO7C 1ON1A 3GFLA 3RPQA 3T1BA 3EETA 4Y13A 4PGHA 4KIFA 4PZJA 2E7XA 1F5TA 1KU7A 4IHTA 1J75A 1ZGJA 2O6GE 1FPQA 3I54A 2D1HA 3V8JA 3R4KA 3ZPLA 3ML6A 3I58A 3D5LA 3KZYA 2OAZA 2X4HA 1GXPA 4OIOF 5H6RA 1UHWA 3IRQA 4HZFA 2XAHA 1BBYA 2W84A 4P55A 3QPTA 4RAZA 4PGGA 4A0ZA 1HQCA 4M9ZA 1IXCA 1KGSA 3ZMUA 4U7DA 3WTXC 1MJAA 2ZFWA 3GYHX 4LG0A 1BC8C 5ICCA 2ZKZA 3E3VA 4IRHA 2KIUA 1ZYRF 3RYPA 4MTEA 5ILVA 5EEGA 4LG0B 2NRAC 2L02A 4M73A 3B02A 5L3DA 2DQLA 1LVAA 1FBSA 3G3ZA 5E1XA 2VODA 4HV5A 3VOEA 4A0YA 1RZ4A 1S29A 3L00A 4ZYDA 1F1ZA 2XKOA 2CFXA 5FD5A 2KIFA 3IWZA 1BM9A 1KA8A 2JPCA 4RGUA 4HX7A 1FSEA 3U9GA 5DCFA 4KMUX 4BH9A 3JAMK 3LAJA 3K0LA 4AVPA 1ULYA 3DP7A 4NHJA 5HS7A 1R23A 4EM1A 5LEJA 2EJRA 3F23A 4CZZA 4UNOA 1H0MA 3GEZA 2EV0A 3ULQB 4L5IA 2XAFA 2K7LA 3B73A 3QRFF 3L7WA 1V3FA 5JI6A 1U8RA 2GA1A 5TJJA 3LFKA 1BI2A 3T8TA 2G9WA 2A6HF 2HR3A 4I02A 3SQNA 3ERED 4YIFA 3E97A 1D8JA 1K78B 2P8TA 1SFEA 4IHSA 4BAYA 1O3RA 1GHCA 3BY6A 4G8XA 4OMYA 3HOTA 3IWFA 3F8MA 5CVRA 4QWQA 5D6FA 2W25A 2VE9A 4KN4X 2L4AA 2Z5UA 5D6EA 2FF4A 5JR3A 4ENNA 2UZKA 1F9NA 2QQAA 3QU6A 4CHUA 1LNWA 3FZVA 1XB4A 1FP2A 1J9IA 2CSOA 4MEXF 2P7CB 5HOOA 2RV8A 2VBWA 1FY7A 5HS8A 4U0YA 1QBJA 4XSXF 1TLHB 5CVUA 1HSTA 1D8KA 4M9SA 1PDNC 3DXJF 1TNTA 5A2QK 3KP6A 4HA8A 5LGUA 1DUXC 1QPMA 2XV4S 3HSRA 4IJAA 1GXQA 4KYWA 4UVBA 5DD8A 2QUFA 5D5VB 2DFIA 4LK1F 4WWCA 2W85A 4EGYA 3BROA 2DPUA 4G7OF 2R3SA 2XUBA 3I59B 4HLXA 1SFXA 5DCMA 2VE8A 2HKOA 4GCVA 5KVRA 2RGVA 4YG2F 2DT5A 2Z33A 3SXKA 2Q2EA 2UWMA 2M8EA 4HF0A 1B9NA 2P6TA 2MH9A 3HOSA 2DU9A 2ZMEA 4G9YA 3CUQA 3WTSC 3I5UA 1S3JA 2LDUA 3RKWA 3FM5A 2WTEA 3J80K 1DDNA 1MZBA 4Q48A 1ZGAA 3GFIA 2EA4A 3O3KA 1IF1A 2OD5A 1Z6RA 3FM3A 1FLIA 2TDXA 1G4DA 3PQJA 1TQMA 2GZWA 4RB0A 1Y0UA 2VC0A 2RVCA 4EJOA 5L3EA 4U0VA 4KNYA 2IW5A 5E20A 2RDPA 5LBQA 3BDDA 2ZXJA 3MZYA 4LGWA 1U5TA 1XSDA 2ZNYA 5BOXA 1Z9CA