4NCQA

Crystal structure of nisod h1a mutant
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
112
structure length
112
Chain Sequence
CGVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Nickel superoxide dismutase: structural and functional roles of His1 and its H-bonding network.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 50
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 4ncqA00
1Q0GA 1Q0FA 3G50A 4NCQA 3G4ZA 1T6UA 1Q0KA 1T6QA 1Q0MA 1Q0DA 3G4XA 1T6IA
chains in the Genus database with same CATH superfamily
1CGNA 4JC7A 5AC5A 1RKEA 2V3CC 3LESA 1YVIA 2LFFA 4MVZA 4PK4A 2NPUA 3U2MA 4MTOA 3KYJA 5DQZA 1BDJB 1OKKD 2W9YA 4MNDA 4DVZA 1VK5A 2WZLA 3H65A 3JT1A 1OW6A 1VYKA 1EQ1A 5L0HA 3IPMO 1ZW2A 1M57C 2J0WA 3JRTA 5AC4A 2YLIA 2B0HA 1MMAA 2KSFA 2PF4E 2NUPA 3DXJF 3GEHA 4HEAJ 1CGOA 3EH2A 2ASRA 2LD6A 2R25A 2IM8A 2ZXOA 1T01A 2R05A 1OXKA 4YL1A 2LP4A 3IQ5A 3SYNA 4R32A 4NC3A 3UMHA 3ASNC 1NSGB 4YJWA 4XLPF 1QPUA 1R5ID 4JTCB 3HLZA 3SNHA 2R7QA 2Q7RA 1APCA 1VLSA 5JT4A 2VASA 3I4UA 2F22A 2HJ3A 4RD9A 4CJOA 5DVWA 2ETSA 3EGDA 3Q7LA 3CSKA 3QW0A 5JLIA 4K1OA 3IQTA 4ULWA 1D1AA 3A11A 4XTKA 1D0XA 4GYTA 5FZTA 1OW7A 3UR3C 1L3PA 4H54A 5L0CA 1W2WA 2A0BA 3IQCA 3R2PA 3PCVA 3UMIA 4AE4A 2OQMA 4YL0A 2CNWD 5JVEA 2A6HF 3LLKA 3G4ZA 3JYHA 3PHF2 1ORYA 5KYUA 4AL1A 3ZVRA 2L9JA 3EZIA 3CQZA 3KPHA 2OG2A 3EFOB 2PNOA 3GORA 4K0DA 4O79A 4XPXA 2NUTA 2Z15A 4DBQA 1MQVA 3RKOF 2WL8A 4PR9A 2A68F 2M64A 4JEAA 1TFOB 4JURI 4YT4A 3S90A 1ZYRF 2CDQA 4WGZA 1F1MA 2LQGA 2P0NA 1KNYA 3W2VA 3K33A 1HE1A 3DJNB 4NTFA 2A6EF 2XM0A 2R7RA 1TKNA 2XS8A 1OKKA 3LLIA 5DS4A 4OIRF 4QI0A 1G8XA 1VMAA 3CAXA 2YEVA 3C62A 3FHDA 4PACA 4QI2A 1RKEB 1EKYA 1QZXA 2I15A 3ZWIA 1GM5A 4J32B 5GPGB 1A7DA 1PV3A 4IB4A 3DI5A 3FAJA 1VYIA 4WJ0A 1WASA 4I1MA 2R7UA 2EPLX 4WGYA 1LS1A 4I3MA 3SP1A 4G0HA 3KYIA 4ER9A 2ZXPA 2EIJC 2HKVA 4LACB 4LLCA 3AOUA 2ZXRA 3POVA 2QNLA 4J7YA 4C3BA 3HNJA 2J9UA 2ZXWC 1RKCA 2MHRA 1WGWA 2LFDA 2XL6A 2DB4A 4CBEA 4YK5A 4FAPB 3PMRA 5JSLA 4CDVA 1HW1A 1K05A 3Q6MA 3HNLA 4YT2A 4JCZA 4BJ1A 3NRHA 3WG7C 4MW3A 1YA7O 3B0PA 3M4BA 2P61A 1LE4A 4MTGA 4MVMA 1GS9A 4U5HA 1Q0KA 4BJTA 3U0CA 3N24A 1I5NA 3B0VC 4H4KC 1LE2A 3NKEA 2WVQA 4U5BE 4XEVA 4B6IA 2VCCA 4JZAA 3J06A 4MVRA 3C63A 2CNWA 2YRFA 4IARA 1ZU5A 5CI9A 4CS8A 3L8JA 1DOWA 1E83A 3JZ0A 1AUEA 2Q9CA 3DAGA 4FWVA 2YVKA 3EFOA 4YN0B 4A4AA 2G3KA 2Q00A 3LS1A 2EPMX 4DJ9A 1YA9A 4EKWA 3W2WA 5A6BD 3EPVA 4JRZA 4BJ6A 3F47A 4O6NA 4NY3A 1DOVA 1YZAA 4N4WA 5T3TA 1K40A 1ORJA 2WVOA 4OIQF 2R7XA 1LIHA 2VCAA 2G3VA 4HFFB 5F28E 1E84A 2OJQA 3WAQA 4WABA 4EHPA 5KYXB 1XZPA 4G78A 5D91A 3RQFA 4Q4ZF 2R7VA 4ZLDA 2QTVA 1FAPB 2YLDA 5BQHA 1MMGA 3H2UA 4I1OB 3NDBB 3GWNA 1C02A 5IY5C 3LNRA 3GEEA 3F46A 5DS5A 1LS4A 3LS0A 1V74B 3ECSA 2KGOA 1NFOA 2EIKC 2HZ8A 2QLAA 2HSBA 3SXKA 3U3FA 3K1IC 3EQLF 1ZVZA 4PFPA 3JCUQ 1TR2A 3ITFA 1G4US 1M56C 2CCYA 3AQBA 256BA 3OWTA 3V5ZA 2KNHA 4LDKA 1NLXA 4O6MA 2H7OA 5A6KA 3MFNA 3ZTMA 4FESA 3EH1A 3U3BA 1QSPA 4CX9A 5A6JA 2OCCC 3G4XA 1HE9A 2Q4FA 2JD3A 1JPJA 3CEXA 2A1DD 2XLDA 2XL4A 2ZD9A 3AQCA 3DKAA 1WOLA 2Y3DA 2YL1A 5BUOA 1I4ZA 3LEOA 4CDAA 3DAFA 3AG4C 2XL8A 1YYJA 3FOPA 2XSEA 3V5YA 1YDIA 3LJBA 1L7CA 1OQCA 2H8AA 1TWAA 4E18A 2EIMC 2KW3C 1D1CA 2VB6A 2Q9AA 4JE9A 5A6AA 1WN0A 1BR1A 1AVOB 2R02A 2CYDA 4MVUA 2W4BA 4U5GA 1I4YA 2XLEA 4U9DA 2YL7A 3ZQVA 3VF0A 2KK1A 1ZZPA 2MYSA 4MTFA 2HS5A 1NBBA 4U5CE 3RW0A 1AEPA 3C7JA 2KJGA 4XWJA 2JPUA 3K6BA 1VB5A 3L1MA 3TOLA 4DRIB 1T6IA 4EIYA 4ULVA 2XM4A 1Z3IX 3LUTB 5A6BA 4OD4A 4PJMA 1GQAA 4D4XA 2DI3A 2QY9A 2YL3A 1S05A 4OD5A 5COGA 3ZIBA 4F4BA 3SZRA 1MNEA 3EJNA 4DRHB 2HUJA 5KYXA 3FVYA 1TWGA 1CGME 2IBFA 4MS2A 4I44A 3BRJA 1IW7F 4Z9JA 2KC3A 2TMVP 3E70C 1TFKB 3NMKA 2QE9A 3MYFA 3JSEO 1LI7A 3O10A 1NG1A 1U6HA 4ONSA 3MX3A 2IXMA 4QDLA 1ST6A 3ZTZA 4E7SA 5FCLA 4Q7CA 3NMIA 2L7AA 1UFBA 4KI2A 2NSFA 2CGEA 4RBNA 5D92A 2H7VC 2DGJA 1Y6DA 3RIPA 1S7ZA 2J7PD 3ZQYA 3TJ6A 4CS9C 3QTHA 4JEBA 1SMYF 4D4NA 4MVSA 4X0RA 3SXZA 3SXMA 5L0JA 2QUPA 3B9QA 1FR0A 2BL2A 3QVYA 3FDQA 3DE8A 3EGXA 1LKXA 2ZPAA 4IJJA 3FXHA 1HMDA 2FFHA 3JSZA 1BR4A 4UDVA 1GGQA 3MYIA 3NYLA 5L0DA 1Q0FA 2DYSC 5A69A 1RCPA 3MBGA 3K66A 5HV9A 4J7TA 3KKBA 2VC9A 2WZGA 4BJ5C 5EHHA 3RQEA 5BQIA 1J8MF 2M4EA 4EBKA 4W8PA 3RVZA 3Q7GA 4NTBA 4C7OB 3T6BA 2HMQA 1EA8A 1Z6AA 2R9RB 4EWCA 1T6QA 1Q0MA 2WVNA 2P1AA 3DZAA 3UGPA 1QLEC 3GWLA 2VCBA 3TD7A 1ZHZA 4C3EA 1E85A 2L6HA 3R7CA 1VOMA 1CPQA 2Y69C 2YL0A 3ABMC 3K1HA 4BJ5A 2JX0A 5JRAA 1KU2A 1M2VA 1OCRC 2J9BA 3UNGC 2WB7A 4CDYA 3CZ6A 4NCQA 1OCCC 1LI5A 3N2ZB 3FMSA 3LEVA 2Q9BA 2XLVA 5L0FA 3U9MA 1FMVA 3W4YA 2LIGA 5E3AA 5COMA 2KYHA 3T4RA 2MWQA 3C8GD 4EBJA 4YWQA 4GQHA 5B3IA 3C8GB 3DJUB 1D0YA 2IXOA 4P9FA 2A0UA 1JAFA 2NSGA 2XLHA 2XRHA 2H7BA 4CIPA 3Q6NA 3ASOC 3C8ZA 4IRUA 1BR2A 1H6GA 4U5FE 4ZLCA 5B3SC 4KBLA 1T9KA 5CIVA 3S84A 3FOOA 5KYYB 1XZQA 1QKRA 1D0ZA 4L6RA 4YT5A 3E9VA 2NG1A 3N0TA 4LDQA 2D5RB 5L0GA 2BC5A 2Y3GA 4PFOA 1SF8A 2J9WA 1OR3A 3HNKA 2J46A 3FAPB 1VTMP 3AG1C 4U5DE 4E7ZA 1RJ9B 3IEEA 2GFHA 2WZFA 2XXAB 2J7PA 3GODA 5EK0A 2C04A 3A9CA 2HJMA 3C18A 1C03A 1M6TA 3HNIA 4LDRA 3V7OA 3TOMA 2C03A 2PX3A 3U9JA 1YLMA 5TJ5E 1O3UA 1Q0GA 2GAQA 4XEKA 2Q3TA 5L3QA 3S0XA 2X51A 3M15A 4BPMA 1FNTc 3UGOA 2AU5A 1C17M 3DM5A 3IQ6A 3KH2A 1FFTC 2RD9A 3VYWA 3I5PA 3WODF 1A7VA 4DRJB 3EHMA 2GDCA 2HSQA 4FX5A 1A7EA 2L81A 2XS1A 3EGXB 3HKKA 4C7OA 3W8HA 3GANA 1IZMA 3BEHA 4P9TA 3LAYA 4YL3A 4XPYA 2AWCA 1Z7Qc 3KL4A 3GEIA 4JKVA 5DLJA 3NKDA 2OU6A 3K1IA 4E17A 4XQ1A 5AGFA 2V26A 3OA1A 4PJLA 1Z23A 5E33A 3GM2A 4DXWA 1JMWA 4RDAA 4DBRA 5EGYA 5HSWA 2VH3A 3DD7A 1NZEA 1WTYA 4IAQA 3L0IA 5BQGA 4NTAA 3KMIA 3U8PA 3U2LA 4DOZA 4PJNA 5L0IA 1CPRA 1G5ZA 2GA0A 4LERA 3C8GA 4CSAC 3RF3A 1RXQA 1KTMA 2EPOA 1EI7A 1M2VB 5E3CA 4EBBA 4XPWA 1QQ3A 1O5HA 1JOGA 5CI8A 3US6A 1V55C 3GM3A 4PJJA 3VRCA 4CJGA 1PCXA 3QW1A 3TULA 1A0BA 3GM1A 3ZSUA 1HW2A 4N06A 1BZ4A 2P6VA 1ZHWA 4JTAB 4YT8A 5KYYA 2PBEA 3U5SA 2OKUA 5K0IA 2G62A 2GWWA 3DM9B 3VM6A 2PX0A 4CSAA 3MLGA 3QMKA 2J45A 3I5QA 4JTDB 1HY5A 4M63A 3LNMB 4BEJA 4MVOA 2HV7A 2LCHA 5B1AC 1FMWA 1H7IA 1O87A 3QVZA 2Y3HA 3ABLC 1RJ9A 4KNVA 4MW8A 4A2NB 1H9GA 5KYWB 4NQFA 3TJ5A 4MQ9F 5E2QA 4IGGA 1ZHTA 1YZCA 1R4TA 4EUKB 1ZW3A 3S28A 1ORSC 4JJFA 3RH3A 4JCHA 1Y4CA 4BG0A 5T3WA 2X0CA 5JUAA 3M79A 4XLNF 2BE5F 1FFHA 2IOQA 1D1BA 3UMKA 3ATPA 3TQOA 3EG9A 2P7VA 3L8IA 4GEHA 1UG7A 4E0HA 1NU9C 1MNDA 4HFKB 3U8VA 2A69F 2LK4A 3VAYA 3DMDA 2YZSA 3O55A 3IHUA 3RQGA 2UUHA 2J9VA 2YQYA 3S29A 2KQ9A 5B1BC 1JPNA 3NYJA 4JIOA 3RYLA 1BBHA 1MMNA 1OCOC 1PD1A 2OEVA 3SXYA 4O6YA 2Y3BA 4CS9A 3H2VA 3M4CA 4C3DA 1Z63A 3RFYA 1N1CA 1TWCA 1SYQA 2W45A 1B68A 1WWPA 3X2QC 1XWJA 1VLTA 3ZC4A 4KC9A 1YAUO 2L6FA 1RMVA 2O9XA 3AGUA 1V4AA 3ZDLA 1E86A 3HJCA 3RVYA 2OOCA 2YWAA 3PDMP 2R7WA 1M2OA 1Z5ZA 4U9EA 1TWHA 2Y39A 4Z9HA 1JR8A 3S9OA 4N6HA 4OIOF 1MMDA 2J8WA 4BEMJ 4Z9IA 1LPEA 2AVKA 3EHNA 3V5XA 1SZIA 1OXBA 1JRAA 2AP3A 4JW1A 2RSEB 4DVYP 3B29A 5T1DB 2R03A 4AX2A 3B0UX 2YLGA 3DWWA 2YHSA 1LVKA 3NG1A 2J0XA 3AJMA 2B0JA 4G7HF 1G4WR 1U89A 3AGTA 2LSEA 4AL0A 2EPKX 1TQGA 4CIHA 2NUPB 2L6GA 1YJGA 3ABKC 2XLOA 3M1CB 5L3VA 2W4MA 4O7GA 2HMZA 4XEFA 4AK9A 4CS8C 1H9TA 4OIPF 1U0BB 3X1OA 2DYRC 4E0IA 5KYWA 4CS7A 2IXNA 3OEOA 2R7SA 1SR2A 5COFA 1Q0DA 5JS5A 1FTSA 2HV6A 1J8YF 2PP4A 3TK0A 3L34A 1ZU4A 1ZHXA 4N6CA 1HMOA 4Q5SF 3G50A 5F5FA 2OEXA 4IWBA 4G7OF 1NU7D 4BJ6C 2D4UA 2EPNA 4U5EE 1PD0A 2UUIA 2XLWA 3SEOA 1LM3B 1QVXA 1K04A 2XLMA 3NYMA 4IAOA 4JJGA 5KYNA 4HE8D 1T6UA 2OJED 3WHNA 3ZG1A 2XXAA 2I8BA 1YYXA 1T5OA 4G7ZF 3EGDB 4JVSA 5DQTA 3NMJA 1WATA 2EINC 3QZCA 4J30B 3T6GB 3JRMO 3DE9A 4KNWA 3T6JA 2IYLD 5JP7A 3K7DA 3EG9B 3S27A 3W8IA 2ICWG 4AE4B 1E2XA 3O39A 2PFDA 4ANJA 2FAPB 5DS6A 1A41A 4MVQA 1YARO 2FGYA 5F5HA 5KYUB 2R7TA 3JTLO 3B71A 2EILC 1ZHYA 2R7OA 3AG3C 4P6IC 4W8KA 3T9OA 2IXPA 2NUTB 3O6XA 2AWYA 1V54C 4LLEA 4K7BA 2YKZA 1OCZC 3AG2C 1OW8A 2E87A 4OINF 1NFNA 2HFIA 3HTKC 3JYYA 1OR2A 3EZHA 2CW0F
chains in the Genus database with same CATH topology
1Q0GA 1Q0FA 3G50A 4NCQA 3G4ZA 1T6UA 1Q0KA 1T6QA 1Q0MA 1Q0DA 3G4XA 1T6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0G A;  1Q0F A;  3G50 A;  4NCQ A;  3G4Z A;  1T6U A;  1Q0K A;  1T6Q A;  1Q0M A;  1Q0D A;  3G4X A;  1T6I A; 
#chains in the Genus database with same CATH topology
 1CGN A;  4JC7 A;  5AC5 A;  1RKE A;  2V3C C;  3LES A;  1YVI A;  2LFF A;  4MVZ A;  4PK4 A;  2NPU A;  3U2M A;  4MTO A;  3KYJ A;  5DQZ A;  1BDJ B;  1OKK D;  2W9Y A;  4MND A;  4DVZ A;  1VK5 A;  2WZL A;  3H65 A;  3JT1 A;  1OW6 A;  1VYK A;  1EQ1 A;  5L0H A;  3IPM O;  1ZW2 A;  1M57 C;  2J0W A;  3JRT A;  5AC4 A;  2YLI A;  2B0H A;  1MMA A;  2KSF A;  2PF4 E;  2NUP A;  3DXJ F;  3GEH A;  4HEA J;  1CGO A;  3EH2 A;  2ASR A;  2LD6 A;  2R25 A;  2IM8 A;  2ZXO A;  1T01 A;  2R05 A;  1OXK A;  4YL1 A;  2LP4 A;  3IQ5 A;  3SYN A;  4R32 A;  4NC3 A;  3UMH A;  3ASN C;  1NSG B;  4YJW A;  4XLP F;  1QPU A;  1R5I D;  4JTC B;  3HLZ A;  3SNH A;  2R7Q A;  2Q7R A;  1APC A;  1VLS A;  5JT4 A;  2VAS A;  3I4U A;  2F22 A;  2HJ3 A;  4RD9 A;  4CJO A;  5DVW A;  2ETS A;  3EGD A;  3Q7L A;  3CSK A;  3QW0 A;  5JLI A;  4K1O A;  3IQT A;  4ULW A;  1D1A A;  3A11 A;  4XTK A;  1D0X A;  4GYT A;  5FZT A;  1OW7 A;  3UR3 C;  1L3P A;  4H54 A;  5L0C A;  1W2W A;  2A0B A;  3IQC A;  3R2P A;  3PCV A;  3UMI A;  4AE4 A;  2OQM A;  4YL0 A;  2CNW D;  5JVE A;  2A6H F;  3LLK A;  3G4Z A;  3JYH A;  3PHF 2;  1ORY A;  5KYU A;  4AL1 A;  3ZVR A;  2L9J A;  3EZI A;  3CQZ A;  3KPH A;  2OG2 A;  3EFO B;  2PNO A;  3GOR A;  4K0D A;  4O79 A;  4XPX A;  2NUT A;  2Z15 A;  4DBQ A;  1MQV A;  3RKO F;  2WL8 A;  4PR9 A;  2A68 F;  2M64 A;  4JEA A;  1TFO B;  4JUR I;  4YT4 A;  3S90 A;  1ZYR F;  2CDQ A;  4WGZ A;  1F1M A;  2LQG A;  2P0N A;  1KNY A;  3W2V A;  3K33 A;  1HE1 A;  3DJN B;  4NTF A;  2A6E F;  2XM0 A;  2R7R A;  1TKN A;  2XS8 A;  1OKK A;  3LLI A;  5DS4 A;  4OIR F;  4QI0 A;  1G8X A;  1VMA A;  3CAX A;  2YEV A;  3C62 A;  3FHD A;  4PAC A;  4QI2 A;  1RKE B;  1EKY A;  1QZX A;  2I15 A;  3ZWI A;  1GM5 A;  4J32 B;  5GPG B;  1A7D A;  1PV3 A;  4IB4 A;  3DI5 A;  3FAJ A;  1VYI A;  4WJ0 A;  1WAS A;  4I1M A;  2R7U A;  2EPL X;  4WGY A;  1LS1 A;  4I3M A;  3SP1 A;  4G0H A;  3KYI A;  4ER9 A;  2ZXP A;  2EIJ C;  2HKV A;  4LAC B;  4LLC A;  3AOU A;  2ZXR A;  3POV A;  2QNL A;  4J7Y A;  4C3B A;  3HNJ A;  2J9U A;  2ZXW C;  1RKC A;  2MHR A;  1WGW A;  2LFD A;  2XL6 A;  2DB4 A;  4CBE A;  4YK5 A;  4FAP B;  3PMR A;  5JSL A;  4CDV A;  1HW1 A;  1K05 A;  3Q6M A;  3HNL A;  4YT2 A;  4JCZ A;  4BJ1 A;  3NRH A;  3WG7 C;  4MW3 A;  1YA7 O;  3B0P A;  3M4B A;  2P61 A;  1LE4 A;  4MTG A;  4MVM A;  1GS9 A;  4U5H A;  1Q0K A;  4BJT A;  3U0C A;  3N24 A;  1I5N A;  3B0V C;  4H4K C;  1LE2 A;  3NKE A;  2WVQ A;  4U5B E;  4XEV A;  4B6I A;  2VCC A;  4JZA A;  3J06 A;  4MVR A;  3C63 A;  2CNW A;  2YRF A;  4IAR A;  1ZU5 A;  5CI9 A;  4CS8 A;  3L8J A;  1DOW A;  1E83 A;  3JZ0 A;  1AUE A;  2Q9C A;  3DAG A;  4FWV A;  2YVK A;  3EFO A;  4YN0 B;  4A4A A;  2G3K A;  2Q00 A;  3LS1 A;  2EPM X;  4DJ9 A;  1YA9 A;  4EKW A;  3W2W A;  5A6B D;  3EPV A;  4JRZ A;  4BJ6 A;  3F47 A;  4O6N A;  4NY3 A;  1DOV A;  1YZA A;  4N4W A;  5T3T A;  1K40 A;  1ORJ A;  2WVO A;  4OIQ F;  2R7X A;  1LIH A;  2VCA A;  2G3V A;  4HFF B;  5F28 E;  1E84 A;  2OJQ A;  3WAQ A;  4WAB A;  4EHP A;  5KYX B;  1XZP A;  4G78 A;  5D91 A;  3RQF A;  4Q4Z F;  2R7V A;  4ZLD A;  2QTV A;  1FAP B;  2YLD A;  5BQH A;  1MMG A;  3H2U A;  4I1O B;  3NDB B;  3GWN A;  1C02 A;  5IY5 C;  3LNR A;  3GEE A;  3F46 A;  5DS5 A;  1LS4 A;  3LS0 A;  1V74 B;  3ECS A;  2KGO A;  1NFO A;  2EIK C;  2HZ8 A;  2QLA A;  2HSB A;  3SXK A;  3U3F A;  3K1I C;  3EQL F;  1ZVZ A;  4PFP A;  3JCU Q;  1TR2 A;  3ITF A;  1G4U S;  1M56 C;  2CCY A;  3AQB A;  256B A;  3OWT A;  3V5Z A;  2KNH A;  4LDK A;  1NLX A;  4O6M A;  2H7O A;  5A6K A;  3MFN A;  3ZTM A;  4FES A;  3EH1 A;  3U3B A;  1QSP A;  4CX9 A;  5A6J A;  2OCC C;  3G4X A;  1HE9 A;  2Q4F A;  2JD3 A;  1JPJ A;  3CEX A;  2A1D D;  2XLD A;  2XL4 A;  2ZD9 A;  3AQC A;  3DKA A;  1WOL A;  2Y3D A;  2YL1 A;  5BUO A;  1I4Z A;  3LEO A;  4CDA A;  3DAF A;  3AG4 C;  2XL8 A;  1YYJ A;  3FOP A;  2XSE A;  3V5Y A;  1YDI A;  3LJB A;  1L7C A;  1OQC A;  2H8A A;  1TWA A;  4E18 A;  2EIM C;  2KW3 C;  1D1C A;  2VB6 A;  2Q9A A;  4JE9 A;  5A6A A;  1WN0 A;  1BR1 A;  1AVO B;  2R02 A;  2CYD A;  4MVU A;  2W4B A;  4U5G A;  1I4Y A;  2XLE A;  4U9D A;  2YL7 A;  3ZQV A;  3VF0 A;  2KK1 A;  1ZZP A;  2MYS A;  4MTF A;  2HS5 A;  1NBB A;  4U5C E;  3RW0 A;  1AEP A;  3C7J A;  2KJG A;  4XWJ A;  2JPU A;  3K6B A;  1VB5 A;  3L1M A;  3TOL A;  4DRI B;  1T6I A;  4EIY A;  4ULV A;  2XM4 A;  1Z3I X;  3LUT B;  5A6B A;  4OD4 A;  4PJM A;  1GQA A;  4D4X A;  2DI3 A;  2QY9 A;  2YL3 A;  1S05 A;  4OD5 A;  5COG A;  3ZIB A;  4F4B A;  3SZR A;  1MNE A;  3EJN A;  4DRH B;  2HUJ A;  5KYX A;  3FVY A;  1TWG A;  1CGM E;  2IBF A;  4MS2 A;  4I44 A;  3BRJ A;  1IW7 F;  4Z9J A;  2KC3 A;  2TMV P;  3E70 C;  1TFK B;  3NMK A;  2QE9 A;  3MYF A;  3JSE O;  1LI7 A;  3O10 A;  1NG1 A;  1U6H A;  4ONS A;  3MX3 A;  2IXM A;  4QDL A;  1ST6 A;  3ZTZ A;  4E7S A;  5FCL A;  4Q7C A;  3NMI A;  2L7A A;  1UFB A;  4KI2 A;  2NSF A;  2CGE A;  4RBN A;  5D92 A;  2H7V C;  2DGJ A;  1Y6D A;  3RIP A;  1S7Z A;  2J7P D;  3ZQY A;  3TJ6 A;  4CS9 C;  3QTH A;  4JEB A;  1SMY F;  4D4N A;  4MVS A;  4X0R A;  3SXZ A;  3SXM A;  5L0J A;  2QUP A;  3B9Q A;  1FR0 A;  2BL2 A;  3QVY A;  3FDQ A;  3DE8 A;  3EGX A;  1LKX A;  2ZPA A;  4IJJ A;  3FXH A;  1HMD A;  2FFH A;  3JSZ A;  1BR4 A;  4UDV A;  1GGQ A;  3MYI A;  3NYL A;  5L0D A;  1Q0F A;  2DYS C;  5A69 A;  1RCP A;  3MBG A;  3K66 A;  5HV9 A;  4J7T A;  3KKB A;  2VC9 A;  2WZG A;  4BJ5 C;  5EHH A;  3RQE A;  5BQI A;  1J8M F;  2M4E A;  4EBK A;  4W8P A;  3RVZ A;  3Q7G A;  4NTB A;  4C7O B;  3T6B A;  2HMQ A;  1EA8 A;  1Z6A A;  2R9R B;  4EWC A;  1T6Q A;  1Q0M A;  2WVN A;  2P1A A;  3DZA A;  3UGP A;  1QLE C;  3GWL A;  2VCB A;  3TD7 A;  1ZHZ A;  4C3E A;  1E85 A;  2L6H A;  3R7C A;  1VOM A;  1CPQ A;  2Y69 C;  2YL0 A;  3ABM C;  3K1H A;  4BJ5 A;  2JX0 A;  5JRA A;  1KU2 A;  1M2V A;  1OCR C;  2J9B A;  3UNG C;  2WB7 A;  4CDY A;  3CZ6 A;  4NCQ A;  1OCC C;  1LI5 A;  3N2Z B;  3FMS A;  3LEV A;  2Q9B A;  2XLV A;  5L0F A;  3U9M A;  1FMV A;  3W4Y A;  2LIG A;  5E3A A;  5COM A;  2KYH A;  3T4R A;  2MWQ A;  3C8G D;  4EBJ A;  4YWQ A;  4GQH A;  5B3I A;  3C8G B;  3DJU B;  1D0Y A;  2IXO A;  4P9F A;  2A0U A;  1JAF A;  2NSG A;  2XLH A;  2XRH A;  2H7B A;  4CIP A;  3Q6N A;  3ASO C;  3C8Z A;  4IRU A;  1BR2 A;  1H6G A;  4U5F E;  4ZLC A;  5B3S C;  4KBL A;  1T9K A;  5CIV A;  3S84 A;  3FOO A;  5KYY B;  1XZQ A;  1QKR A;  1D0Z A;  4L6R A;  4YT5 A;  3E9V A;  2NG1 A;  3N0T A;  4LDQ A;  2D5R B;  5L0G A;  2BC5 A;  2Y3G A;  4PFO A;  1SF8 A;  2J9W A;  1OR3 A;  3HNK A;  2J46 A;  3FAP B;  1VTM P;  3AG1 C;  4U5D E;  4E7Z A;  1RJ9 B;  3IEE A;  2GFH A;  2WZF A;  2XXA B;  2J7P A;  3GOD A;  5EK0 A;  2C04 A;  3A9C A;  2HJM A;  3C18 A;  1C03 A;  1M6T A;  3HNI A;  4LDR A;  3V7O A;  3TOM A;  2C03 A;  2PX3 A;  3U9J A;  1YLM A;  5TJ5 E;  1O3U A;  1Q0G A;  2GAQ A;  4XEK A;  2Q3T A;  5L3Q A;  3S0X A;  2X51 A;  3M15 A;  4BPM A;  1FNT c;  3UGO A;  2AU5 A;  1C17 M;  3DM5 A;  3IQ6 A;  3KH2 A;  1FFT C;  2RD9 A;  3VYW A;  3I5P A;  3WOD F;  1A7V A;  4DRJ B;  3EHM A;  2GDC A;  2HSQ A;  4FX5 A;  1A7E A;  2L81 A;  2XS1 A;  3EGX B;  3HKK A;  4C7O A;  3W8H A;  3GAN A;  1IZM A;  3BEH A;  4P9T A;  3LAY A;  4YL3 A;  4XPY A;  2AWC A;  1Z7Q c;  3KL4 A;  3GEI A;  4JKV A;  5DLJ A;  3NKD A;  2OU6 A;  3K1I A;  4E17 A;  4XQ1 A;  5AGF A;  2V26 A;  3OA1 A;  4PJL A;  1Z23 A;  5E33 A;  3GM2 A;  4DXW A;  1JMW A;  4RDA A;  4DBR A;  5EGY A;  5HSW A;  2VH3 A;  3DD7 A;  1NZE A;  1WTY A;  4IAQ A;  3L0I A;  5BQG A;  4NTA A;  3KMI A;  3U8P A;  3U2L A;  4DOZ A;  4PJN A;  5L0I A;  1CPR A;  1G5Z A;  2GA0 A;  4LER A;  3C8G A;  4CSA C;  3RF3 A;  1RXQ A;  1KTM A;  2EPO A;  1EI7 A;  1M2V B;  5E3C A;  4EBB A;  4XPW A;  1QQ3 A;  1O5H A;  1JOG A;  5CI8 A;  3US6 A;  1V55 C;  3GM3 A;  4PJJ A;  3VRC A;  4CJG A;  1PCX A;  3QW1 A;  3TUL A;  1A0B A;  3GM1 A;  3ZSU A;  1HW2 A;  4N06 A;  1BZ4 A;  2P6V A;  1ZHW A;  4JTA B;  4YT8 A;  5KYY A;  2PBE A;  3U5S A;  2OKU A;  5K0I A;  2G62 A;  2GWW A;  3DM9 B;  3VM6 A;  2PX0 A;  4CSA A;  3MLG A;  3QMK A;  2J45 A;  3I5Q A;  4JTD B;  1HY5 A;  4M63 A;  3LNM B;  4BEJ A;  4MVO A;  2HV7 A;  2LCH A;  5B1A C;  1FMW A;  1H7I A;  1O87 A;  3QVZ A;  2Y3H A;  3ABL C;  1RJ9 A;  4KNV A;  4MW8 A;  4A2N B;  1H9G A;  5KYW B;  4NQF A;  3TJ5 A;  4MQ9 F;  5E2Q A;  4IGG A;  1ZHT A;  1YZC A;  1R4T A;  4EUK B;  1ZW3 A;  3S28 A;  1ORS C;  4JJF A;  3RH3 A;  4JCH A;  1Y4C A;  4BG0 A;  5T3W A;  2X0C A;  5JUA A;  3M79 A;  4XLN F;  2BE5 F;  1FFH A;  2IOQ A;  1D1B A;  3UMK A;  3ATP A;  3TQO A;  3EG9 A;  2P7V A;  3L8I A;  4GEH A;  1UG7 A;  4E0H A;  1NU9 C;  1MND A;  4HFK B;  3U8V A;  2A69 F;  2LK4 A;  3VAY A;  3DMD A;  2YZS A;  3O55 A;  3IHU A;  3RQG A;  2UUH A;  2J9V A;  2YQY A;  3S29 A;  2KQ9 A;  5B1B C;  1JPN A;  3NYJ A;  4JIO A;  3RYL A;  1BBH A;  1MMN A;  1OCO C;  1PD1 A;  2OEV A;  3SXY A;  4O6Y A;  2Y3B A;  4CS9 A;  3H2V A;  3M4C A;  4C3D A;  1Z63 A;  3RFY A;  1N1C A;  1TWC A;  1SYQ A;  2W45 A;  1B68 A;  1WWP A;  3X2Q C;  1XWJ A;  1VLT A;  3ZC4 A;  4KC9 A;  1YAU O;  2L6F A;  1RMV A;  2O9X A;  3AGU A;  1V4A A;  3ZDL A;  1E86 A;  3HJC A;  3RVY A;  2OOC A;  2YWA A;  3PDM P;  2R7W A;  1M2O A;  1Z5Z A;  4U9E A;  1TWH A;  2Y39 A;  4Z9H A;  1JR8 A;  3S9O A;  4N6H A;  4OIO F;  1MMD A;  2J8W A;  4BEM J;  4Z9I A;  1LPE A;  2AVK A;  3EHN A;  3V5X A;  1SZI A;  1OXB A;  1JRA A;  2AP3 A;  4JW1 A;  2RSE B;  4DVY P;  3B29 A;  5T1D B;  2R03 A;  4AX2 A;  3B0U X;  2YLG A;  3DWW A;  2YHS A;  1LVK A;  3NG1 A;  2J0X A;  3AJM A;  2B0J A;  4G7H F;  1G4W R;  1U89 A;  3AGT A;  2LSE A;  4AL0 A;  2EPK X;  1TQG A;  4CIH A;  2NUP B;  2L6G A;  1YJG A;  3ABK C;  2XLO A;  3M1C B;  5L3V A;  2W4M A;  4O7G A;  2HMZ A;  4XEF A;  4AK9 A;  4CS8 C;  1H9T A;  4OIP F;  1U0B B;  3X1O A;  2DYR C;  4E0I A;  5KYW A;  4CS7 A;  2IXN A;  3OEO A;  2R7S A;  1SR2 A;  5COF A;  1Q0D A;  5JS5 A;  1FTS A;  2HV6 A;  1J8Y F;  2PP4 A;  3TK0 A;  3L34 A;  1ZU4 A;  1ZHX A;  4N6C A;  1HMO A;  4Q5S F;  3G50 A;  5F5F A;  2OEX A;  4IWB A;  4G7O F;  1NU7 D;  4BJ6 C;  2D4U A;  2EPN A;  4U5E E;  1PD0 A;  2UUI A;  2XLW A;  3SEO A;  1LM3 B;  1QVX A;  1K04 A;  2XLM A;  3NYM A;  4IAO A;  4JJG A;  5KYN A;  4HE8 D;  1T6U A;  2OJE D;  3WHN A;  3ZG1 A;  2XXA A;  2I8B A;  1YYX A;  1T5O A;  4G7Z F;  3EGD B;  4JVS A;  5DQT A;  3NMJ A;  1WAT A;  2EIN C;  3QZC A;  4J30 B;  3T6G B;  3JRM O;  3DE9 A;  4KNW A;  3T6J A;  2IYL D;  5JP7 A;  3K7D A;  3EG9 B;  3S27 A;  3W8I A;  2ICW G;  4AE4 B;  1E2X A;  3O39 A;  2PFD A;  4ANJ A;  2FAP B;  5DS6 A;  1A41 A;  4MVQ A;  1YAR O;  2FGY A;  5F5H A;  5KYU B;  2R7T A;  3JTL O;  3B71 A;  2EIL C;  1ZHY A;  2R7O A;  3AG3 C;  4P6I C;  4W8K A;  3T9O A;  2IXP A;  2NUT B;  3O6X A;  2AWY A;  1V54 C;  4LLE A;  4K7B A;  2YKZ A;  1OCZ C;  3AG2 C;  1OW8 A;  2E87 A;  4OIN F;  1NFN A;  2HFI A;  3HTK C;  3JYY A;  1OR2 A;  3EZH A;  2CW0 F; 
#chains in the Genus database with same CATH homology
 1Q0G A;  1Q0F A;  3G50 A;  4NCQ A;  3G4Z A;  1T6U A;  1Q0K A;  1T6Q A;  1Q0M A;  1Q0D A;  3G4X A;  1T6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...