4NCQA

Crystal structure of nisod h1a mutant
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
112
structure length
112
Chain Sequence
b'CGVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Nickel superoxide dismutase: structural and functional roles of His1 and its H-bonding network.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 50
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 4ncqA00
1Q0DA 1T6IA 4NCQA 1T6UA 1Q0FA 3G4XA 1Q0GA 1Q0KA 3G50A 1T6QA 1Q0MA 3G4ZA
chains in the Genus database with same CATH superfamily
1T6IA 1TWGA 2AP3A 2ZXRA 3ZG1A 2IBFA 1SYQA 5E3AA 2PP4A 2NUPA 2W4BA 1VLSA 3DM5A 3UMKA 2VASA 1YA9A 2R25A 4I1OB 4LLEA 4BJ1A 3TQOA 5L0GA 4FESA 3FOOA 2A6EF 4J7TA 3LUTB 1YLMA 1MMNA 2J46A 4PFPA 2J7PD 1B68A 3S28A 5L0CA 4GQHA 2AVKA 1JPNA 3EGDB 4FWVA 3CZ6A 4U5GA 1WTYA 1K04A 2NSFA 4JEAA 3NDBB 3LESA 4PJLA 2FGYA 1NLXA 2XM4A 4DBRA 4BJ6A 5KYYB 3U2LA 2X0CA 1E84A 2R7XA 5TJ5E 4BEJA 1VK5A 2Y69C 3AG4C 4NQFA 4G7HF 4B6IA 3UGPA 4E17A 3B0VC 4BPMA 4NTFA 3HNIA 1V74B 1MMDA 4U5EE 5IY5C 1SR2A 1C03A 5JVEA 1QVXA 4XLNF 2VCCA 2ASRA 4CS8C 1JRAA 2IM8A 1ZW3A 3NKDA 4EBJA 1T6UA 2P7VA 3GM2A 2R05A 2EPMX 5AC5A 2CCYA 2IYLD 1U89A 3AG2C 4WJ0A 5A6BD 3SYNA 3IQCA 4W8PA 3L8IA 1IZMA 1MNEA 1T6QA 4YT4A 2UUIA 1V55C 3ZQVA 2CDQA 2W45A 2J45A 1Q0GA 3FAJA 3NMJA 5T3WA 3WHNA 4UDVA 4PJMA 3POVA 1I5NA 1EKYA 1ORYA 1OXKA 3NMIA 3U0CA 5L0IA 2MYSA 1GQAA 1ZW2A 2L6HA 3DD7A 2OKUA 2Q9BA 1YYXA 3M4CA 1QQ3A 2CNWA 3TJ6A 3ZVRA 4LDQA 1RCPA 3HJCA 2XM0A 3ABLC 4U9DA 2J9BA 2HJ3A 2YL0A 1ZU5A 2VCBA 3EZHA 3CEXA 3IEEA 3MYIA 3RVYA 2HSBA 2OU6A 4JCHA 1RXQA 1LS4A 3K33A 3CSKA 1D1CA 3US6A 5L3VA 2R02A 3BRJA 3DI5A 3SXZA 3KH2A 3M15A 2H7BA 1T5OA 4LDKA 5FZTA 3DJUB 5DS5A 1FAPB 4CDAA 4I44A 2V3CC 1PD0A 3NYLA 1M6TA 2KQ9A 1MMGA 1PV3A 3QTHA 4JC7A 2J0WA 4YL1A 2Y3GA 3U3FA 1J8MF 2CNWD 1L7CA 4EBKA 1A0BA 1ZHZA 3EZIA 3M79A 5JT4A 3FDQA 3TD7A 3QVZA 2LP4A 5BQHA 1YJGA 5KYXB 2R7VA 4JKVA 2M64A 2QLAA 4LDRA 1D0YA 2R7UA 5A6AA 3S0XA 2MWQA 1MMAA 1PCXA 5F5FA 1CPQA 2PF4E 4IB4A 4PK4A 1OCCC 4KI2A 1ORJA 4J32B 4ONSA 4P6IC 5E2QA 4GEHA 1BDJB 4MVSA 1G8XA 5AGFA 5AC4A 3ZWIA 4LERA 4YN0B 4OIOF 3U9MA 2XS8A 3RQFA 4FX5A 4CX9A 4QDLA 1O3UA 2J8WA 3ABKC 1J8YF 2OEXA 4IRUA 1TWHA 4U5BE 2Q3TA 1FMWA 1C02A 4JVSA 5A6JA 2Q7RA 4BEMJ 4DXWA 2NUTA 3K7DA 4H4KC 2QE9A 3H2UA 3LNMB 2ZD9A 2GAQA 4HE8D 4CDVA 3EG9B 4BJ5A 4CS9A 1APCA 2G62A 4LACB 1E2XA 4AX2A 2W9YA 4BJTA 1WASA 4DRHB 4Q5SF 2Z15A 1VLTA 2RSEB 4N06A 1JPJA 2ZXWC 2XL8A 4K1OA 2HMQA 4MVRA 2YKZA 2B0JA 4MVQA 4XQ1A 3V5YA 4JTCB 3JRMO 3FHDA 4CIHA 1JAFA 1EQ1A 4YT8A 3G4XA 4DRJB 4C3EA 3HTKC 1ZHTA 3OWTA 1HY5A 3JRTA 5CI8A 1VTMP 1LI7A 2A0BA 3FAPB 1M2VA 1YARO 4XEVA 5GPGB 3RVZA 4AE4B 2YZSA 4WGZA 4YT2A 3V5XA 2I8BA 4YL3A 3ZQYA 4O6YA 1Z3IX 2J7PA 2HFIA 1S7ZA 2WZFA 2ETSA 3K1IC 1OQCA 4G0HA 3EGXA 4OINF 4CSAC 3O39A 1GGQA 2PNOA 2EINC 4MVOA 3CAXA 2KJGA 4CBEA 4MW3A 1U0BB 1FFTC 3TULA 2R7OA 5T1DB 1JMWA 4YK5A 2WVOA 3EFOA 3F47A 4O6NA 3UNGC 4JURI 3L0IA 4WABA 3J06A 1NZEA 4U5DE 1A7VA 2LFDA 3EPVA 2GFHA 2C04A 1OW6A 1YZCA 4D4NA 3AG1C 1FMVA 4IWBA 2LFFA 2XLOA 1YZAA 4XPWA 2QY9A 2R03A 4U5FE 4OD5A 3VAYA 3SXMA 4DVZA 4OD4A 3U8VA 1H9TA 2AWYA 1VOMA 1LVKA 2L9JA 4K0DA 1YA7O 5EK0A 5A6BA 1OR2A 3S29A 4JTAB 4I3MA 4G7OF 1R4TA 2YWAA 5JS5A 1ZHXA 1OW7A 2OQMA 3KKBA 3TJ5A 2MHRA 5JUAA 2YEVA 2J9VA 3E9VA 1BR2A 2AU5A 3EH2A 3PHF2 3JSEO 2I15A 2OJQA 1CPRA 3NG1A 2A6HF 5CI9A 3SP1A 2WVNA 4CJGA 1LI5A 4XPXA 2D4UA 1DOWA 2BL2A 1QKRA 5EHHA 2HUJA 1AVOB 2L6GA 4JJGA 1LM3B 3VF0A 4N6HA 3T6GB 3VYWA 3K66A 3W8HA 2HV7A 1N1CA 3DKAA 4JEBA 4NCQA 2AWCA 3LNRA 4DRIB 2KW3C 3IHUA 3C8ZA 3LAYA 3MLGA 3FXHA 4YL0A 2EPOA 2J9UA 3IQ6A 2XLVA 3GWNA 4XWJA 4C7OB 3X1OA 3L1MA 3GEIA 4JE9A 3O55A 1HE1A 1Q0MA 3U5SA 3ZTMA 4A2NB 2DI3A 3DMDA 1ZHYA 3NRHA 3ATPA 4X0RA 1HMDA 4JCZA 5HSWA 3ASOC 2LD6A 4IAQA 4DVYP 1TR2A 2NSGA 2EPLX 3C63A 4RDAA 3Q6MA 3RIPA 2EILC 3VRCA 1FR0A 2OCCC 1FTSA 2KK1A 1OW8A 3EG9A 4IAOA 2Q00A 3UR3C 3UMHA 1SZIA 2XLEA 4DOZA 1VYKA 5L3QA 1Q0KA 2R7RA 4ZLDA 3FOPA 3QW1A 2KC3A 2OOCA 3JYHA 2NG1A 3U8PA 1U6HA 5EGYA 3AJMA 2XXAB 3N2ZB 4NTBA 3B9QA 4CJOA 3T9OA 1ZVZA 1G5ZA 2PFDA 3K1HA 2J9WA 1OCZC 5B3SC 3DE9A 3R2PA 4OIPF 3JT1A 1RKEA 3JZ0A 5BQGA 5L0DA 2ZPAA 1Q0FA 3H2VA 3DWWA 3MBGA 4FAPB 1A41A 3PDMP 5F5HA 4U5CE 4Z9IA 2H7OA 3GWLA 3NYMA 4DJ9A 2HV6A 3SXYA 3RQEA 4MVMA 1DOVA 1XZQA 3NYJA 5BUOA 1YYJA 4E7SA 3GORA 1V4AA 1Z6AA 1FFHA 1LKXA 1S05A 2FAPB 2G3KA 3N24A 4AL0A 3S84A 5DQTA 4Q4ZF 1LE4A 4C3BA 1Z23A 1LIHA 2L7AA 2OG2A 5L0HA 1NU9C 1WGWA 4KNWA 3ECSA 4QI2A 1VMAA 4M63A 4E7ZA 4EUKB 3ZTZA 4R32A 5BQIA 1Y4CA 2IXPA 3RH3A 1ZHWA 1HW1A 1RMVA 5CIVA 4L6RA 4BJ6C 4Z9JA 5JRAA 2VC9A 1ZYRF 2D5RB 2P0NA 1ZU4A 2XRHA 1D1AA 1K40A 4J7YA 4RD9A 1ORSC 4YT5A 4CS8A 3EGDA 2Q9CA 1BR1A 1SF8A 3ABMC 1M57C 3GEHA 1RKCA 5JP7A 3R7CA 4AL1A 4ANJA 5FCLA 3UGOA 3HNKA 3A9CA 4J30B 3I4UA 4JRZA 4KBLA 1WN0A 2W4MA 4MTGA 5DS4A 5KYYA 4OIQF 3DZAA 3KL4A 4ULVA 2YL7A 3H65A 1A7EA 1TWAA 1Z5ZA 2KGOA 3M4BA 2A68F 1JOGA 1KU2A 2Q9AA 2VCAA 3MFNA 3V5ZA 2RD9A 4MTFA 1CGME 3AQCA 5DS6A 2DYRC 3LLKA 1D0ZA 3DJNB 1T01A 1XWJA 1EA8A 2HS5A 3S27A 2QUPA 5COFA 5E3CA 3ASNC 1YVIA 1W2WA 3G4ZA 3PCVA 4NY3A 4YWQA 5COGA 3Q6NA 5KYWB 1D0XA 1XZPA 4JW1A 2IXOA 2P61A 1ST6A 2WL8A 3C18A 3GM3A 4PJNA 4XTKA 2LIGA 3C7JA 1F1MA 5D91A 4AK9A 4P9TA 1GS9A 4A4AA 4KC9A 4H54A 5A69A 3T6JA 3HNLA 5DLJA 3QMKA 1CGNA 4NC3A 4XEKA 4C3DA 2CGEA 1O5HA 3KPHA 1BR4A 3VM6A 2OJED 2YQYA 4DBQA 4HFKB 4O79A 2ICWG 3TOLA 4EBBA 1G4WR 3TOMA 5JLIA 5K0IA 3QW0A 2XXAA 1NFNA 2Y39A 2JX0A 2VB6A 3C8GB 4HEAJ 1HMOA 3GM1A 3WAQA 2NUTB 1M2OA 3LEVA 256BA 2WZLA 4NTAA 2NPUA 3HNJA 2H7VC 4ER9A 1K05A 2G3VA 3LS1A 3EQLF 2YL3A 5COMA 3WG7C 4EWCA 1KTMA 1WWPA 3KYIA 1SMYF 3DE8A 1T9KA 4K7BA 4PJJA 3SEOA 2L6FA 3JSZA 3UMIA 3EHNA 3CQZA 4MVZA 3O6XA 1E86A 2CYDA 1V54C 2PX0A 1RJ9B 3MX3A 3RW0A 5KYXA 3I5PA 3OA1A 3QZCA 1L3PA 3U3BA 2A1DD 2XLMA 2H8AA 3Q7GA 1OKKA 4JJFA 4WGYA 4XPYA 3W2VA 1UG7A 3NKEA 4HFFB 3X2QC 2LSEA 2YLDA 3GANA 3HKKA 3RFYA 3U2MA 4E0IA 5KYNA 2FFHA 2ZXOA 3W2WA 4BG0A 3IQ5A 3AGUA 4BJ5C 4CS9C 1M2VB 2WVQA 3DAGA 2EIKC 4PFOA 3RKOF 1E83A 2IOQA 4Z9HA 2YLGA 3EHMA 2LCHA 5KYUB 3S90A 4JIOA 4Q7CA 2DYSC 2LK4A 3OEOA 3ZDLA 1OKKD 3L34A 4CDYA 3EGXB 3B0UX 3I5QA 3T4RA 3O10A 1I4ZA 1UFBA 2HZ8A 3DM9B 3W8IA 2YHSA 5B3IA 2GWWA 2NUPB 2YRFA 3C62A 3ITFA 4MW8A 1OXBA 3DAFA 4E18A 4G7ZF 1LE2A 2E87A 3EFOB 3JYYA 2CW0F 1EI7A 1LS1A 1Y6DA 3GODA 1HE9A 3SXKA 3ZIBA 1KNYA 2Y3BA 1NSGB 3E70C 2EIJC 2IXNA 2B0HA 4IGGA 4U9EA 1JR8A 3K1IA 3LS0A 1IW7F 4N4WA 4CSAA 1H7IA 2X51A 1AUEA 2BE5F 2GA0A 2HMZA 4YJWA 5L0FA 3N0TA 1WOLA 3U9JA 2A0UA 2TMVP 3KMIA 2PX3A 3SZRA 3MYFA 1GM5A 1NG1A 3TK0A 2YVKA 1C17M 1AEPA 3Q7LA 3JCUQ 1ZZPA 2R9RB 2M4EA 2V26A 3RQGA 4AE4A 4CS7A 2R7WA 3G50A 4XLPF 5E33A 2XLHA 4OIRF 1OCOC 1BZ4A 5T3TA 3ZC4A 1BBHA 1WATA 1H9GA 3B0PA 1NBBA 3F46A 5DVWA 1QLEC 2L81A 3SNHA 1HW2A 3B71A 3LLIA 3T6BA 4EKWA 1VYIA 2LQGA 1TFKB 4MNDA 4F4BA 1Q0DA 5KYWA 1OCRC 1TFOB 3FMSA 4N6CA 4W8KA 3WODF 2KYHA 3GEEA 1LPEA 1H6GA 3M1CB 3QVYA 5A6KA 4JTDB 3KYJA 2F22A 1FNTc 2XS1A 2XLDA 2YL1A 5DQZA 4MTOA 3NMKA 3W4YA 2P6VA 4LLCA 2HSQA 3V7OA 1M56C 2HKVA 2J0XA 1R5ID 2JD3A 3AGTA 3IQTA 4MVUA 1QSPA 4IJJA 4P9FA 5D92A 4G78A 2YLIA 4QI0A 1CGOA 1NFOA 2C03A 1QPUA 2QTVA 3IPMO 3JTLO 4RBNA 1Z7Qc 2WZGA 1TKNA 2KNHA 3DXJF 5B1BC 2IXMA 4D4XA 2R7TA 1A7DA 2QNLA 5L0JA 2R7SA 1YDIA 2GDCA 3C8GA 1OR3A 3LEOA 3S9OA 1NU7D 2R7QA 3HLZA 4ULWA 2PBEA 2O9XA 3EH1A 5JSLA 3RYLA 5B1AC 1MQVA 2EIMC 3FVYA 3L8JA 1PD1A 4GYTA 5F28E 4EHPA 4KNVA 4O7GA 1VB5A 3K6BA 1QZXA 3PMRA 2DB4A 1TQGA 4ZLCA 4JZAA 1RJ9A 1YAUO 2JPUA 2EPKX 4I1MA 2Y3HA 3BEHA 4U5HA 1D1BA 2ZXPA 2BC5A 3C8GD 1MNDA 3LJBA 2VH3A 2XSEA 3B29A 1RKEB 4CIPA 3EJNA 1G4US 3ZSUA 4MS2A 1I4YA 2XL6A 3AG3C 4EIYA 2KSFA 5HV9A 4MQ9F 2XLWA 3AOUA 2A69F 4PACA 4C7OA 2EPNA 2Q4FA 1TWCA 3AQBA 2DGJA 4E0HA 2WB7A 2Y3DA 2XL4A 2P1AA 1O87A 3A11A 5KYUA 2OEVA 1E85A 2UUHA 4PR9A 3RF3A 4XEFA 2HJMA 4IARA 1Z63A 4O6MA
chains in the Genus database with same CATH topology
1Q0DA 1T6IA 4NCQA 1T6UA 1Q0FA 3G4XA 1Q0GA 1Q0KA 3G50A 1T6QA 1Q0MA 3G4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0D A;  1T6I A;  4NCQ A;  1T6U A;  1Q0F A;  3G4X A;  1Q0G A;  1Q0K A;  3G50 A;  1T6Q A;  1Q0M A;  3G4Z A; 
#chains in the Genus database with same CATH topology
 1T6I A;  1TWG A;  2AP3 A;  2ZXR A;  3ZG1 A;  2IBF A;  1SYQ A;  5E3A A;  2PP4 A;  2NUP A;  2W4B A;  1VLS A;  3DM5 A;  3UMK A;  2VAS A;  1YA9 A;  2R25 A;  4I1O B;  4LLE A;  4BJ1 A;  3TQO A;  5L0G A;  4FES A;  3FOO A;  2A6E F;  4J7T A;  3LUT B;  1YLM A;  1MMN A;  2J46 A;  4PFP A;  2J7P D;  1B68 A;  3S28 A;  5L0C A;  4GQH A;  2AVK A;  1JPN A;  3EGD B;  4FWV A;  3CZ6 A;  4U5G A;  1WTY A;  1K04 A;  2NSF A;  4JEA A;  3NDB B;  3LES A;  4PJL A;  2FGY A;  1NLX A;  2XM4 A;  4DBR A;  4BJ6 A;  5KYY B;  3U2L A;  2X0C A;  1E84 A;  2R7X A;  5TJ5 E;  4BEJ A;  1VK5 A;  2Y69 C;  3AG4 C;  4NQF A;  4G7H F;  4B6I A;  3UGP A;  4E17 A;  3B0V C;  4BPM A;  4NTF A;  3HNI A;  1V74 B;  1MMD A;  4U5E E;  5IY5 C;  1SR2 A;  1C03 A;  5JVE A;  1QVX A;  4XLN F;  2VCC A;  2ASR A;  4CS8 C;  1JRA A;  2IM8 A;  1ZW3 A;  3NKD A;  4EBJ A;  1T6U A;  2P7V A;  3GM2 A;  2R05 A;  2EPM X;  5AC5 A;  2CCY A;  2IYL D;  1U89 A;  3AG2 C;  4WJ0 A;  5A6B D;  3SYN A;  3IQC A;  4W8P A;  3L8I A;  1IZM A;  1MNE A;  1T6Q A;  4YT4 A;  2UUI A;  1V55 C;  3ZQV A;  2CDQ A;  2W45 A;  2J45 A;  1Q0G A;  3FAJ A;  3NMJ A;  5T3W A;  3WHN A;  4UDV A;  4PJM A;  3POV A;  1I5N A;  1EKY A;  1ORY A;  1OXK A;  3NMI A;  3U0C A;  5L0I A;  2MYS A;  1GQA A;  1ZW2 A;  2L6H A;  3DD7 A;  2OKU A;  2Q9B A;  1YYX A;  3M4C A;  1QQ3 A;  2CNW A;  3TJ6 A;  3ZVR A;  4LDQ A;  1RCP A;  3HJC A;  2XM0 A;  3ABL C;  4U9D A;  2J9B A;  2HJ3 A;  2YL0 A;  1ZU5 A;  2VCB A;  3EZH A;  3CEX A;  3IEE A;  3MYI A;  3RVY A;  2HSB A;  2OU6 A;  4JCH A;  1RXQ A;  1LS4 A;  3K33 A;  3CSK A;  1D1C A;  3US6 A;  5L3V A;  2R02 A;  3BRJ A;  3DI5 A;  3SXZ A;  3KH2 A;  3M15 A;  2H7B A;  1T5O A;  4LDK A;  5FZT A;  3DJU B;  5DS5 A;  1FAP B;  4CDA A;  4I44 A;  2V3C C;  1PD0 A;  3NYL A;  1M6T A;  2KQ9 A;  1MMG A;  1PV3 A;  3QTH A;  4JC7 A;  2J0W A;  4YL1 A;  2Y3G A;  3U3F A;  1J8M F;  2CNW D;  1L7C A;  4EBK A;  1A0B A;  1ZHZ A;  3EZI A;  3M79 A;  5JT4 A;  3FDQ A;  3TD7 A;  3QVZ A;  2LP4 A;  5BQH A;  1YJG A;  5KYX B;  2R7V A;  4JKV A;  2M64 A;  2QLA A;  4LDR A;  1D0Y A;  2R7U A;  5A6A A;  3S0X A;  2MWQ A;  1MMA A;  1PCX A;  5F5F A;  1CPQ A;  2PF4 E;  4IB4 A;  4PK4 A;  1OCC C;  4KI2 A;  1ORJ A;  4J32 B;  4ONS A;  4P6I C;  5E2Q A;  4GEH A;  1BDJ B;  4MVS A;  1G8X A;  5AGF A;  5AC4 A;  3ZWI A;  4LER A;  4YN0 B;  4OIO F;  3U9M A;  2XS8 A;  3RQF A;  4FX5 A;  4CX9 A;  4QDL A;  1O3U A;  2J8W A;  3ABK C;  1J8Y F;  2OEX A;  4IRU A;  1TWH A;  4U5B E;  2Q3T A;  1FMW A;  1C02 A;  4JVS A;  5A6J A;  2Q7R A;  4BEM J;  4DXW A;  2NUT A;  3K7D A;  4H4K C;  2QE9 A;  3H2U A;  3LNM B;  2ZD9 A;  2GAQ A;  4HE8 D;  4CDV A;  3EG9 B;  4BJ5 A;  4CS9 A;  1APC A;  2G62 A;  4LAC B;  1E2X A;  4AX2 A;  2W9Y A;  4BJT A;  1WAS A;  4DRH B;  4Q5S F;  2Z15 A;  1VLT A;  2RSE B;  4N06 A;  1JPJ A;  2ZXW C;  2XL8 A;  4K1O A;  2HMQ A;  4MVR A;  2YKZ A;  2B0J A;  4MVQ A;  4XQ1 A;  3V5Y A;  4JTC B;  3JRM O;  3FHD A;  4CIH A;  1JAF A;  1EQ1 A;  4YT8 A;  3G4X A;  4DRJ B;  4C3E A;  3HTK C;  1ZHT A;  3OWT A;  1HY5 A;  3JRT A;  5CI8 A;  1VTM P;  1LI7 A;  2A0B A;  3FAP B;  1M2V A;  1YAR O;  4XEV A;  5GPG B;  3RVZ A;  4AE4 B;  2YZS A;  4WGZ A;  4YT2 A;  3V5X A;  2I8B A;  4YL3 A;  3ZQY A;  4O6Y A;  1Z3I X;  2J7P A;  2HFI A;  1S7Z A;  2WZF A;  2ETS A;  3K1I C;  1OQC A;  4G0H A;  3EGX A;  4OIN F;  4CSA C;  3O39 A;  1GGQ A;  2PNO A;  2EIN C;  4MVO A;  3CAX A;  2KJG A;  4CBE A;  4MW3 A;  1U0B B;  1FFT C;  3TUL A;  2R7O A;  5T1D B;  1JMW A;  4YK5 A;  2WVO A;  3EFO A;  3F47 A;  4O6N A;  3UNG C;  4JUR I;  3L0I A;  4WAB A;  3J06 A;  1NZE A;  4U5D E;  1A7V A;  2LFD A;  3EPV A;  2GFH A;  2C04 A;  1OW6 A;  1YZC A;  4D4N A;  3AG1 C;  1FMV A;  4IWB A;  2LFF A;  2XLO A;  1YZA A;  4XPW A;  2QY9 A;  2R03 A;  4U5F E;  4OD5 A;  3VAY A;  3SXM A;  4DVZ A;  4OD4 A;  3U8V A;  1H9T A;  2AWY A;  1VOM A;  1LVK A;  2L9J A;  4K0D A;  1YA7 O;  5EK0 A;  5A6B A;  1OR2 A;  3S29 A;  4JTA B;  4I3M A;  4G7O F;  1R4T A;  2YWA A;  5JS5 A;  1ZHX A;  1OW7 A;  2OQM A;  3KKB A;  3TJ5 A;  2MHR A;  5JUA A;  2YEV A;  2J9V A;  3E9V A;  1BR2 A;  2AU5 A;  3EH2 A;  3PHF 2;  3JSE O;  2I15 A;  2OJQ A;  1CPR A;  3NG1 A;  2A6H F;  5CI9 A;  3SP1 A;  2WVN A;  4CJG A;  1LI5 A;  4XPX A;  2D4U A;  1DOW A;  2BL2 A;  1QKR A;  5EHH A;  2HUJ A;  1AVO B;  2L6G A;  4JJG A;  1LM3 B;  3VF0 A;  4N6H A;  3T6G B;  3VYW A;  3K66 A;  3W8H A;  2HV7 A;  1N1C A;  3DKA A;  4JEB A;  4NCQ A;  2AWC A;  3LNR A;  4DRI B;  2KW3 C;  3IHU A;  3C8Z A;  3LAY A;  3MLG A;  3FXH A;  4YL0 A;  2EPO A;  2J9U A;  3IQ6 A;  2XLV A;  3GWN A;  4XWJ A;  4C7O B;  3X1O A;  3L1M A;  3GEI A;  4JE9 A;  3O55 A;  1HE1 A;  1Q0M A;  3U5S A;  3ZTM A;  4A2N B;  2DI3 A;  3DMD A;  1ZHY A;  3NRH A;  3ATP A;  4X0R A;  1HMD A;  4JCZ A;  5HSW A;  3ASO C;  2LD6 A;  4IAQ A;  4DVY P;  1TR2 A;  2NSG A;  2EPL X;  3C63 A;  4RDA A;  3Q6M A;  3RIP A;  2EIL C;  3VRC A;  1FR0 A;  2OCC C;  1FTS A;  2KK1 A;  1OW8 A;  3EG9 A;  4IAO A;  2Q00 A;  3UR3 C;  3UMH A;  1SZI A;  2XLE A;  4DOZ A;  1VYK A;  5L3Q A;  1Q0K A;  2R7R A;  4ZLD A;  3FOP A;  3QW1 A;  2KC3 A;  2OOC A;  3JYH A;  2NG1 A;  3U8P A;  1U6H A;  5EGY A;  3AJM A;  2XXA B;  3N2Z B;  4NTB A;  3B9Q A;  4CJO A;  3T9O A;  1ZVZ A;  1G5Z A;  2PFD A;  3K1H A;  2J9W A;  1OCZ C;  5B3S C;  3DE9 A;  3R2P A;  4OIP F;  3JT1 A;  1RKE A;  3JZ0 A;  5BQG A;  5L0D A;  2ZPA A;  1Q0F A;  3H2V A;  3DWW A;  3MBG A;  4FAP B;  1A41 A;  3PDM P;  5F5H A;  4U5C E;  4Z9I A;  2H7O A;  3GWL A;  3NYM A;  4DJ9 A;  2HV6 A;  3SXY A;  3RQE A;  4MVM A;  1DOV A;  1XZQ A;  3NYJ A;  5BUO A;  1YYJ A;  4E7S A;  3GOR A;  1V4A A;  1Z6A A;  1FFH A;  1LKX A;  1S05 A;  2FAP B;  2G3K A;  3N24 A;  4AL0 A;  3S84 A;  5DQT A;  4Q4Z F;  1LE4 A;  4C3B A;  1Z23 A;  1LIH A;  2L7A A;  2OG2 A;  5L0H A;  1NU9 C;  1WGW A;  4KNW A;  3ECS A;  4QI2 A;  1VMA A;  4M63 A;  4E7Z A;  4EUK B;  3ZTZ A;  4R32 A;  5BQI A;  1Y4C A;  2IXP A;  3RH3 A;  1ZHW A;  1HW1 A;  1RMV A;  5CIV A;  4L6R A;  4BJ6 C;  4Z9J A;  5JRA A;  2VC9 A;  1ZYR F;  2D5R B;  2P0N A;  1ZU4 A;  2XRH A;  1D1A A;  1K40 A;  4J7Y A;  4RD9 A;  1ORS C;  4YT5 A;  4CS8 A;  3EGD A;  2Q9C A;  1BR1 A;  1SF8 A;  3ABM C;  1M57 C;  3GEH A;  1RKC A;  5JP7 A;  3R7C A;  4AL1 A;  4ANJ A;  5FCL A;  3UGO A;  3HNK A;  3A9C A;  4J30 B;  3I4U A;  4JRZ A;  4KBL A;  1WN0 A;  2W4M A;  4MTG A;  5DS4 A;  5KYY A;  4OIQ F;  3DZA A;  3KL4 A;  4ULV A;  2YL7 A;  3H65 A;  1A7E A;  1TWA A;  1Z5Z A;  2KGO A;  3M4B A;  2A68 F;  1JOG A;  1KU2 A;  2Q9A A;  2VCA A;  3MFN A;  3V5Z A;  2RD9 A;  4MTF A;  1CGM E;  3AQC A;  5DS6 A;  2DYR C;  3LLK A;  1D0Z A;  3DJN B;  1T01 A;  1XWJ A;  1EA8 A;  2HS5 A;  3S27 A;  2QUP A;  5COF A;  5E3C A;  3ASN C;  1YVI A;  1W2W A;  3G4Z A;  3PCV A;  4NY3 A;  4YWQ A;  5COG A;  3Q6N A;  5KYW B;  1D0X A;  1XZP A;  4JW1 A;  2IXO A;  2P61 A;  1ST6 A;  2WL8 A;  3C18 A;  3GM3 A;  4PJN A;  4XTK A;  2LIG A;  3C7J A;  1F1M A;  5D91 A;  4AK9 A;  4P9T A;  1GS9 A;  4A4A A;  4KC9 A;  4H54 A;  5A69 A;  3T6J A;  3HNL A;  5DLJ A;  3QMK A;  1CGN A;  4NC3 A;  4XEK A;  4C3D A;  2CGE A;  1O5H A;  3KPH A;  1BR4 A;  3VM6 A;  2OJE D;  2YQY A;  4DBQ A;  4HFK B;  4O79 A;  2ICW G;  3TOL A;  4EBB A;  1G4W R;  3TOM A;  5JLI A;  5K0I A;  3QW0 A;  2XXA A;  1NFN A;  2Y39 A;  2JX0 A;  2VB6 A;  3C8G B;  4HEA J;  1HMO A;  3GM1 A;  3WAQ A;  2NUT B;  1M2O A;  3LEV A;  256B A;  2WZL A;  4NTA A;  2NPU A;  3HNJ A;  2H7V C;  4ER9 A;  1K05 A;  2G3V A;  3LS1 A;  3EQL F;  2YL3 A;  5COM A;  3WG7 C;  4EWC A;  1KTM A;  1WWP A;  3KYI A;  1SMY F;  3DE8 A;  1T9K A;  4K7B A;  4PJJ A;  3SEO A;  2L6F A;  3JSZ A;  3UMI A;  3EHN A;  3CQZ A;  4MVZ A;  3O6X A;  1E86 A;  2CYD A;  1V54 C;  2PX0 A;  1RJ9 B;  3MX3 A;  3RW0 A;  5KYX A;  3I5P A;  3OA1 A;  3QZC A;  1L3P A;  3U3B A;  2A1D D;  2XLM A;  2H8A A;  3Q7G A;  1OKK A;  4JJF A;  4WGY A;  4XPY A;  3W2V A;  1UG7 A;  3NKE A;  4HFF B;  3X2Q C;  2LSE A;  2YLD A;  3GAN A;  3HKK A;  3RFY A;  3U2M A;  4E0I A;  5KYN A;  2FFH A;  2ZXO A;  3W2W A;  4BG0 A;  3IQ5 A;  3AGU A;  4BJ5 C;  4CS9 C;  1M2V B;  2WVQ A;  3DAG A;  2EIK C;  4PFO A;  3RKO F;  1E83 A;  2IOQ A;  4Z9H A;  2YLG A;  3EHM A;  2LCH A;  5KYU B;  3S90 A;  4JIO A;  4Q7C A;  2DYS C;  2LK4 A;  3OEO A;  3ZDL A;  1OKK D;  3L34 A;  4CDY A;  3EGX B;  3B0U X;  3I5Q A;  3T4R A;  3O10 A;  1I4Z A;  1UFB A;  2HZ8 A;  3DM9 B;  3W8I A;  2YHS A;  5B3I A;  2GWW A;  2NUP B;  2YRF A;  3C62 A;  3ITF A;  4MW8 A;  1OXB A;  3DAF A;  4E18 A;  4G7Z F;  1LE2 A;  2E87 A;  3EFO B;  3JYY A;  2CW0 F;  1EI7 A;  1LS1 A;  1Y6D A;  3GOD A;  1HE9 A;  3SXK A;  3ZIB A;  1KNY A;  2Y3B A;  1NSG B;  3E70 C;  2EIJ C;  2IXN A;  2B0H A;  4IGG A;  4U9E A;  1JR8 A;  3K1I A;  3LS0 A;  1IW7 F;  4N4W A;  4CSA A;  1H7I A;  2X51 A;  1AUE A;  2BE5 F;  2GA0 A;  2HMZ A;  4YJW A;  5L0F A;  3N0T A;  1WOL A;  3U9J A;  2A0U A;  2TMV P;  3KMI A;  2PX3 A;  3SZR A;  3MYF A;  1GM5 A;  1NG1 A;  3TK0 A;  2YVK A;  1C17 M;  1AEP A;  3Q7L A;  3JCU Q;  1ZZP A;  2R9R B;  2M4E A;  2V26 A;  3RQG A;  4AE4 A;  4CS7 A;  2R7W A;  3G50 A;  4XLP F;  5E33 A;  2XLH A;  4OIR F;  1OCO C;  1BZ4 A;  5T3T A;  3ZC4 A;  1BBH A;  1WAT A;  1H9G A;  3B0P A;  1NBB A;  3F46 A;  5DVW A;  1QLE C;  2L81 A;  3SNH A;  1HW2 A;  3B71 A;  3LLI A;  3T6B A;  4EKW A;  1VYI A;  2LQG A;  1TFK B;  4MND A;  4F4B A;  1Q0D A;  5KYW A;  1OCR C;  1TFO B;  3FMS A;  4N6C A;  4W8K A;  3WOD F;  2KYH A;  3GEE A;  1LPE A;  1H6G A;  3M1C B;  3QVY A;  5A6K A;  4JTD B;  3KYJ A;  2F22 A;  1FNT c;  2XS1 A;  2XLD A;  2YL1 A;  5DQZ A;  4MTO A;  3NMK A;  3W4Y A;  2P6V A;  4LLC A;  2HSQ A;  3V7O A;  1M56 C;  2HKV A;  2J0X A;  1R5I D;  2JD3 A;  3AGT A;  3IQT A;  4MVU A;  1QSP A;  4IJJ A;  4P9F A;  5D92 A;  4G78 A;  2YLI A;  4QI0 A;  1CGO A;  1NFO A;  2C03 A;  1QPU A;  2QTV A;  3IPM O;  3JTL O;  4RBN A;  1Z7Q c;  2WZG A;  1TKN A;  2KNH A;  3DXJ F;  5B1B C;  2IXM A;  4D4X A;  2R7T A;  1A7D A;  2QNL A;  5L0J A;  2R7S A;  1YDI A;  2GDC A;  3C8G A;  1OR3 A;  3LEO A;  3S9O A;  1NU7 D;  2R7Q A;  3HLZ A;  4ULW A;  2PBE A;  2O9X A;  3EH1 A;  5JSL A;  3RYL A;  5B1A C;  1MQV A;  2EIM C;  3FVY A;  3L8J A;  1PD1 A;  4GYT A;  5F28 E;  4EHP A;  4KNV A;  4O7G A;  1VB5 A;  3K6B A;  1QZX A;  3PMR A;  2DB4 A;  1TQG A;  4ZLC A;  4JZA A;  1RJ9 A;  1YAU O;  2JPU A;  2EPK X;  4I1M A;  2Y3H A;  3BEH A;  4U5H A;  1D1B A;  2ZXP A;  2BC5 A;  3C8G D;  1MND A;  3LJB A;  2VH3 A;  2XSE A;  3B29 A;  1RKE B;  4CIP A;  3EJN A;  1G4U S;  3ZSU A;  4MS2 A;  1I4Y A;  2XL6 A;  3AG3 C;  4EIY A;  2KSF A;  5HV9 A;  4MQ9 F;  2XLW A;  3AOU A;  2A69 F;  4PAC A;  4C7O A;  2EPN A;  2Q4F A;  1TWC A;  3AQB A;  2DGJ A;  4E0H A;  2WB7 A;  2Y3D A;  2XL4 A;  2P1A A;  1O87 A;  3A11 A;  5KYU A;  2OEV A;  1E85 A;  2UUH A;  4PR9 A;  3RF3 A;  4XEF A;  2HJM A;  4IAR A;  1Z63 A;  4O6M A; 
#chains in the Genus database with same CATH homology
 1Q0D A;  1T6I A;  4NCQ A;  1T6U A;  1Q0F A;  3G4X A;  1Q0G A;  1Q0K A;  3G50 A;  1T6Q A;  1Q0M A;  3G4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...