4NCQA

Crystal structure of nisod h1a mutant
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
112
structure length
112
Chain Sequence
CGVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Nickel superoxide dismutase: structural and functional roles of His1 and its H-bonding network.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 50
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 4ncqA00
1Q0DA 1Q0FA 1Q0MA 1Q0GA 1T6QA 3G4XA 3G4ZA 1Q0KA 1T6UA 4NCQA 3G50A 1T6IA
chains in the Genus database with same CATH superfamily
3R2PA 4I1MA 2LFFA 2LIGA 3FXHA 4LLEA 4U5DE 2WZLA 4BJ6A 3U2MA 1A41A 2TMVP 3K7DA 2XL6A 4DBQA 2WVOA 1F1MA 3M1CB 4EWCA 4XEVA 1T01A 4CIPA 1Y4CA 2B0HA 2KK1A 3JYHA 4EBBA 2HS5A 2YLIA 3ABKC 4MVRA 4XEFA 1APCA 4C7OB 2H7OA 4IRUA 2J9BA 4KC9A 1Z3IX 5DQZA 1TR2A 2CYDA 3RH3A 3I4UA 4C3BA 3IEEA 3QTHA 2XLWA 2GWWA 4YN0B 2J9WA 1ST6A 2KC3A 2KNHA 3NKDA 3EH1A 4CIHA 1OR3A 5K0IA 2W9YA 2HJ3A 4X0RA 2PF4E 1E85A 2V26A 1CGME 2KYHA 4J30B 1JAFA 5KYYA 5KYUB 1VOMA 3DE9A 4HFKB 4FESA 4OD4A 2HV6A 1HE1A 2Y3BA 4MS2A 5BQHA 2YEVA 3JRMO 1H9GA 2WVQA 4LACB 4PJNA 3S29A 3HKKA 3ATPA 3M4CA 3QZCA 4O7GA 3T6BA 3T9OA 3RKOF 4U9DA 4FX5A 4Z9JA 3SP1A 1VLTA 2J0WA 4Q4ZF 1HW2A 4BEJA 3EG9B 5F28E 2YL7A 2X0CA 3RQEA 2R7RA 2Y39A 2Q9BA 3KKBA 2VCAA 2R7WA 4WGZA 4J7YA 1LM3B 3ZIBA 2W4BA 4IGGA 4JEAA 5AC5A 3ZTMA 5TJ5E 3T6JA 4JTDB 3JYYA 2OEVA 2Y3GA 1T6IA 3HNIA 1O87A 4FAPB 1TWAA 2I15A 4K7BA 2PX3A 5T1DB 3NYJA 3WG7C 4G7OF 1WATA 3L0IA 4ZLDA 3BRJA 3FAJA 3C62A 3Q6NA 5D92A 3U3FA 3UMHA 2VCBA 1HY5A 2Y3DA 1VYKA 1YARO 3GM1A 4J32B 3TD7A 1Q0FA 4OIRF 2J7PA 1QVXA 5DLJA 1YYXA 1K40A 2J45A 4D4XA 2M4EA 4EBJA 2NSGA 3RVZA 3C18A 2A0UA 2OCCC 2J9UA 2GFHA 3V5ZA 2XM0A 5L0CA 3S0XA 4XPXA 1RJ9A 3IQ5A 3LUTB 4NTBA 3GWNA 2BE5F 2Q3TA 1FFTC 1Q0MA 3AJMA 2YL1A 1T6QA 3FOOA 3Q7LA 2VH3A 2AVKA 1GQAA 1J8YF 1LVKA 5KYYB 2FAPB 4PFPA 4WGYA 3HLZA 3F47A 3MYIA 3RQGA 1FR0A 1LPEA 2J46A 3LEOA 2GA0A 1OKKA 4K0DA 1AUEA 1NG1A 2KGOA 4MQ9F 3DZAA 3TULA 4DRHB 2RD9A 3DE8A 4JZAA 1TFOB 1CGNA 3DM5A 2CGEA 2OG2A 3NG1A 1XZPA 2OKUA 4Z9IA 4MVSA 2WZGA 3HNKA 3NMIA 4H54A 4MW8A 5EGYA 4CS8A 4IAOA 3WODF 4PK4A 1YVIA 3M79A 3B71A 3DI5A 2XM4A 2O9XA 1VLSA 2A1DD 4LDKA 4B6IA 2R9RB 1U0BB 2OOCA 4QI2A 4BEMJ 1KNYA 3SXYA 2OQMA 2HUJA 2DYSC 2P61A 4XTKA 5F5FA 4O6NA 1YA7O 4ANJA 2HFIA 2X51A 5A6BD 5L0HA 3DM9B 1D1BA 1D0ZA 3EFOB 4E17A 5JP7A 4E7ZA 1VTMP 1V74B 2CW0F 5AC4A 1RCPA 1V54C 2ETSA 2HV7A 3E9VA 1AEPA 3A9CA 5DS4A 3AG1C 3CZ6A 3LS0A 1OR2A 3DAFA 2QTVA 3IPMO 4CSAA 1LIHA 1G5ZA 1JPNA 1RJ9B 2Z15A 3C63A 3CSKA 4F4BA 5JS5A 2R7TA 1BDJB 1OCOC 2EILC 1ZW3A 2CNWA 5AGFA 1OW8A 5KYXA 3KH2A 2NUTA 2H7VC 4XPYA 2XL4A 3J06A 1WN0A 3GORA 3LNRA 2R7OA 2R7QA 2EIMC 2PX0A 2QY9A 3DD7A 3PMRA 2A69F 3RYLA 1TWHA 4CDAA 1JRAA 1WWPA 3ASNC 3AGTA 3N0TA 4MTGA 1M2VA 4NTFA 3VAYA 3ZC4A 3RF3A 5B1BC 3ZQYA 5A6AA 3FDQA 3T6GB 3GODA 3SZRA 4U5HA 3LLIA 4DOZA 5L3VA 3JT1A 2GAQA 3TOMA 1S7ZA 1IZMA 3LEVA 1Z23A 4KNWA 4YWQA 3B9QA 2OJED 4PJLA 3QMKA 2YQYA 1BZ4A 4G78A 3TJ6A 3N24A 4ZLCA 4PJMA 3W8HA 2AU5A 2HZ8A 3RIPA 4GYTA 3OEOA 3K66A 3U9MA 1D0XA 4I44A 3C8GD 4YL3A 1ZVZA 3LJBA 3W2WA 4FWVA 3KYIA 2XRHA 5GPGB 2OEXA 1QSPA 1YZAA 3RQFA 5JVEA 2J0XA 2PFDA 4JC7A 4JVSA 1LS1A 4Q5SF 1WTYA 2V3CC 2DI3A 1UG7A 3KMIA 4CJOA 1MNDA 2QLAA 4NCQA 5F5HA 1AVOB 1ZHXA 4JE9A 2W4MA 4JKVA 5BUOA 5JUAA 2JX0A 1MMGA 2NPUA 2W45A 2YL0A 3VM6A 3QVYA 5DS6A 5A6JA 3FHDA 2KQ9A 3SXKA 1G4US 2LP4A 2BL2A 5KYXB 2NUTB 4BG0A 4OIOF 1E83A 3G4ZA 5T3TA 1SF8A 4JIOA 3S90A 1VK5A 2HSQA 1B68A 5JSLA 1ZHTA 3U8VA 2Y69C 3V5XA 3UNGC 3PHF2 3DJUB 3I5PA 4I1OB 1D0YA 1EKYA 1RKCA 1CGOA 1M2VB 4JCZA 4DJ9A 1NZEA 2LSEA 1U6HA 2ZXOA 3EQLF 2R05A 1C03A 4LERA 3BEHA 2YRFA 4P9TA 3W4YA 3EGDA 2R25A 1YYJA 3TJ5A 4AL1A 2QE9A 3UMKA 1QKRA 4G7ZF 3H2UA 2YZSA 3JZ0A 1MMNA 4YK5A 4AE4A 4RDAA 3Q6MA 1JOGA 3AQCA 5L0GA 4U5EE 3UGPA 1LI7A 1QPUA 2G3KA 1YDIA 2IBFA 3EFOA 3CQZA 2IYLD 4L6RA 1ZU5A 3W8IA 1SZIA 3QW0A 5DVWA 4ER9A 4PR9A 2Q7RA 1C02A 3AG3C 3L8IA 4ONSA 3DWWA 5CI8A 1K04A 2YLDA 4RBNA 3L1MA 2AP3A 2D5RB 4YL0A 4YT2A 2XLDA 4QDLA 2IXMA 4KI2A 4PFOA 4PACA 3O6XA 4W8PA 4U9EA 4E7SA 2HJMA 3LLKA 4LDQA 3ASOC 256BA 1BBHA 4NQFA 1NFNA 3DKAA 3EJNA 4HE8D 1FFHA 1TWGA 2XS8A 1V4AA 3IQ6A 3V5YA 4CDYA 2UUIA 3MFNA 2H7BA 2AWYA 1A7DA 3H2VA 3K6BA 1SYQA 1Y6DA 3TQOA 2PNOA 1Q0GA 3VF0A 4D4NA 3HJCA 1LE4A 4DRIB 2R7UA 2R02A 1JPJA 3PCVA 1FAPB 2MWQA 1MQVA 2NG1A 4Z9HA 2J8WA 4MNDA 3VRCA 4OIQF 4MVMA 3MLGA 1ZU4A 2FGYA 2ZXRA 3K1IC 2FFHA 2RSEB 4EBKA 4BJTA 1ORSC 4XWJA 5HV9A 4O6MA 2L6GA 3T4RA 3EGDB 1WOLA 1U89A 2OU6A 2A6HF 4BJ6C 5B3IA 3OA1A 4AE4B 3IQTA 1NU9C 5JRAA 3JSEO 3SXMA 3LNMB 2YHSA 4KNVA 1FMVA 1YZCA 1A7EA 1L3PA 2QNLA 3L8JA 3POVA 3ZG1A 4CS7A 2C04A 4E18A 3K33A 3RW0A 4BJ5A 2XLVA 4JJFA 4OD5A 5DS5A 2DYRC 5B1AC 2ICWG 2VCCA 1Z5ZA 4MVOA 2MHRA 3FOPA 3C8ZA 3X2QC 1OW7A 1LI5A 2KW3C 3KL4A 4JTCB 2EPNA 3E70C 4R32A 3S9OA 3KYJA 5JT4A 2KSFA 2ZD9A 1RXQA 4XEKA 1NFOA 1GS9A 5A6BA 1E2XA 2YWAA 3LESA 1SR2A 3B0VC 2EPLX 3JRTA 3U2LA 2LFDA 3ZWIA 1DOWA 1EI7A 1G4WR 1XZQA 1DOVA 1K05A 1QZXA 2XLMA 5COGA 3UGOA 3IQCA 2EPMX 3HNLA 4DVZA 3ABMC 4WABA 5KYWB 4M63A 4MVQA 1SMYF 1C17M 4C3DA 2DGJA 1CPRA 4A4AA 4LLCA 4NC3A 1HE9A 3CAXA 1L7CA 4IJJA 1ZYRF 4WJ0A 2A68F 2P1AA 5EHHA 1KTMA 2Q4FA 1H9TA 1OQCA 4JEBA 2XL8A 2EIJC 5IY5C 4E0HA 1NBBA 3JSZA 2L6FA 2C03A 5E2QA 3GANA 2CDQA 5T3WA 1BR1A 1D1CA 1EA8A 1YLMA 3F46A 4XLNF 1RMVA 4XPWA 1A0BA 4J7TA 1T5OA 3JCUQ 3NYMA 5HSWA 4CSAC 4O79A 1MMDA 3EZHA 5E3AA 4A2NB 1EQ1A 3MYFA 2PBEA 3DXJF 2HKVA 1NU7D 3NMJA 1R5ID 3GEHA 3ITFA 1PD1A 4NY3A 3B0PA 3AOUA 4PJJA 5FZTA 1FTSA 3EGXA 2DB4A 4EKWA 4CX9A 2R7VA 3EPVA 4C3EA 4H4KC 1M57C 3SXZA 1TQGA 3MBGA 4P6IC 2G62A 3ZVRA 3C8GA 4DXWA 3AGUA 1MNEA 2A0BA 2HMQA 4IWBA 1QLEC 2YKZA 2EIKC 1XWJA 3VYWA 4CDVA 1ZHWA 1I4ZA 1H7IA 2IXNA 3SEOA 1M6TA 1MMAA 2VC9A 3GM3A 1Q0DA 3EZIA 4YT4A 3C7JA 1YAUO 3AG2C 3KPHA 4K1OA 3I5QA 5L0JA 2I8BA 4MVUA 1JR8A 3U3BA 2H8AA 3QW1A 5D91A 3AQBA 5CI9A 2GDCA 2R7SA 1FMWA 1I5NA 2R7XA 2VASA 1Z7Qc 1TWCA 5A6KA 2ZPAA 1G8XA 4CS8C 3X1OA 4UDVA 4O6YA 5EK0A 2XSEA 3U9JA 2LK4A 1N1CA 3ZDLA 1M56C 3OWTA 4AL0A 3NMKA 1JMWA 1T9KA 3LAYA 2IOQA 4CS9A 4E0IA 2WVNA 4XQ1A 3GWLA 1HMDA 4JW1A 3S27A 1E86A 1OCRC 4RD9A 3ZTZA 1D1AA 2J7PD 2KJGA 4JURI 3U5SA 5L3QA 4OIPF 1RKEA 3H65A 3EHNA 4IB4A 3EGXB 4BJ5C 1TFKB 3WAQA 4W8KA 3B0UX 3ZQVA 2HSBA 3MX3A 4N6HA 4MTOA 1TKNA 3CEXA 2XXAA 3SNHA 1ZHZA 2G3VA 1BR4A 2B0JA 2YVKA 3TOLA 3V7OA 4IARA 2ZXPA 2NUPA 4NTAA 4HFFB 3GM2A 4JRZA 4EIYA 5BQIA 1ZHYA 2AWCA 2EINC 4N4WA 4OINF 5L0DA 2IM8A 3B29A 3FMSA 3C8GB 3K1HA 5COMA 3A11A 4DBRA 2NSFA 5FCLA 2UUHA 2LD6A 1OW6A 3NRHA 3O39A 2YLGA 1OXBA 1ORJA 4ULVA 2R03A 5KYWA 3RVYA 1R4TA 4N06A 1IW7F 2IXPA 1OKKD 4EHPA 2L7AA 1PCXA 2Y3HA 1H6GA 4YJWA 5E33A 1UFBA 3U8PA 2MYSA 1A7VA 4BJ1A 2E87A 2WL8A 4MVZA 2XLHA 3M4BA 4I3MA 3EH2A 2EPKX 4G0HA 4YT8A 1YJGA 3ABLC 4AX2A 1Z63A 3TK0A 3US6A 2CCYA 4U5BE 5B3SC 1V55C 4JJGA 2P0NA 1E84A 4IAQA 1T6UA 3ZSUA 2P6VA 1W2WA 4JTAB 1NLXA 3JTLO 3UR3C 4P9FA 5JLIA 1CPQA 1GM5A 4BPMA 2JPUA 3RFYA 4QI0A 4JCHA 3ECSA 3R7CA 1FNTc 1ZZPA 4YT5A 5L0IA 1WASA 2F22A 2L9JA 3UMIA 2YL3A 1S05A 3GEIA 1I4YA 4G7HF 3SYNA 3EHMA 4AK9A 2P7VA 2Q9AA 5E3CA 1RKEB 4N6CA 1ZW2A 2Q9CA 3GEEA 1PV3A 2OJQA 4DRJB 3M15A 2D4UA 3G50A 3FAPB 2M64A 3DJNB 1HW1A 3Q7GA 3S28A 2XXAB 4C7OA 2WZFA 5BQGA 1M2OA 5KYNA 2NUPB 2PP4A 1OCCC 1KU2A 1Z6AA 1QQ3A 2L81A 2XLEA 2CNWD 3AG4C 4GEHA 4Q7CA 2J9VA 3NDBB 4LDRA 1YA9A 3U0CA 1HMOA 3G4XA 4KBLA 4EUKB 4MTFA 2VB6A 2ASRA 5A69A 1GGQA 1BR2A 2QUPA 4CJGA 3DAGA 2XS1A 2LCHA 3L34A 2A6EF 2EPOA 5COFA 3W2VA 1O5HA 1Q0KA 5KYUA 2ZXWC 1LS4A 4U5GA 2LQGA 3DMDA 5CIVA 5L0FA 3O55A 2Q00A 2WB7A 1PD0A 4U5CE 2IXOA 1LKXA 3HNJA 2L6HA 4MW3A 3O10A 4CBEA 3FVYA 5DQTA 1OCZC 1ORYA 3N2ZB 2BC5A 4ULWA 3EG9A 4DVYP 1NSGB 1J8MF 3HTKC 1O3UA 1LE2A 3PDMP 1VMAA 3S84A 3IHUA 3LS1A 2JD3A 3WHNA 3K1IA 3NYLA 4CS9C 1WGWA 4GQHA 1OXKA 4U5FE 3NKEA 4XLPF 1VYIA 3QVZA 4HEAJ 4YL1A 2HMZA 1VB5A 2XLOA
chains in the Genus database with same CATH topology
1Q0DA 1Q0FA 1Q0MA 1Q0GA 1T6QA 3G4XA 3G4ZA 1Q0KA 1T6UA 4NCQA 3G50A 1T6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0D A;  1Q0F A;  1Q0M A;  1Q0G A;  1T6Q A;  3G4X A;  3G4Z A;  1Q0K A;  1T6U A;  4NCQ A;  3G50 A;  1T6I A; 
#chains in the Genus database with same CATH topology
 3R2P A;  4I1M A;  2LFF A;  2LIG A;  3FXH A;  4LLE A;  4U5D E;  2WZL A;  4BJ6 A;  3U2M A;  1A41 A;  2TMV P;  3K7D A;  2XL6 A;  4DBQ A;  2WVO A;  1F1M A;  3M1C B;  4EWC A;  4XEV A;  1T01 A;  4CIP A;  1Y4C A;  2B0H A;  2KK1 A;  3JYH A;  4EBB A;  2HS5 A;  2YLI A;  3ABK C;  4MVR A;  4XEF A;  1APC A;  4C7O B;  2H7O A;  4IRU A;  2J9B A;  4KC9 A;  1Z3I X;  5DQZ A;  1TR2 A;  2CYD A;  3RH3 A;  3I4U A;  4C3B A;  3IEE A;  3QTH A;  2XLW A;  2GWW A;  4YN0 B;  2J9W A;  1ST6 A;  2KC3 A;  2KNH A;  3NKD A;  3EH1 A;  4CIH A;  1OR3 A;  5K0I A;  2W9Y A;  2HJ3 A;  4X0R A;  2PF4 E;  1E85 A;  2V26 A;  1CGM E;  2KYH A;  4J30 B;  1JAF A;  5KYY A;  5KYU B;  1VOM A;  3DE9 A;  4HFK B;  4FES A;  4OD4 A;  2HV6 A;  1HE1 A;  2Y3B A;  4MS2 A;  5BQH A;  2YEV A;  3JRM O;  1H9G A;  2WVQ A;  4LAC B;  4PJN A;  3S29 A;  3HKK A;  3ATP A;  3M4C A;  3QZC A;  4O7G A;  3T6B A;  3T9O A;  3RKO F;  4U9D A;  4FX5 A;  4Z9J A;  3SP1 A;  1VLT A;  2J0W A;  4Q4Z F;  1HW2 A;  4BEJ A;  3EG9 B;  5F28 E;  2YL7 A;  2X0C A;  3RQE A;  2R7R A;  2Y39 A;  2Q9B A;  3KKB A;  2VCA A;  2R7W A;  4WGZ A;  4J7Y A;  1LM3 B;  3ZIB A;  2W4B A;  4IGG A;  4JEA A;  5AC5 A;  3ZTM A;  5TJ5 E;  3T6J A;  4JTD B;  3JYY A;  2OEV A;  2Y3G A;  1T6I A;  3HNI A;  1O87 A;  4FAP B;  1TWA A;  2I15 A;  4K7B A;  2PX3 A;  5T1D B;  3NYJ A;  3WG7 C;  4G7O F;  1WAT A;  3L0I A;  4ZLD A;  3BRJ A;  3FAJ A;  3C62 A;  3Q6N A;  5D92 A;  3U3F A;  3UMH A;  2VCB A;  1HY5 A;  2Y3D A;  1VYK A;  1YAR O;  3GM1 A;  4J32 B;  3TD7 A;  1Q0F A;  4OIR F;  2J7P A;  1QVX A;  5DLJ A;  1YYX A;  1K40 A;  2J45 A;  4D4X A;  2M4E A;  4EBJ A;  2NSG A;  3RVZ A;  3C18 A;  2A0U A;  2OCC C;  2J9U A;  2GFH A;  3V5Z A;  2XM0 A;  5L0C A;  3S0X A;  4XPX A;  1RJ9 A;  3IQ5 A;  3LUT B;  4NTB A;  3GWN A;  2BE5 F;  2Q3T A;  1FFT C;  1Q0M A;  3AJM A;  2YL1 A;  1T6Q A;  3FOO A;  3Q7L A;  2VH3 A;  2AVK A;  1GQA A;  1J8Y F;  1LVK A;  5KYY B;  2FAP B;  4PFP A;  4WGY A;  3HLZ A;  3F47 A;  3MYI A;  3RQG A;  1FR0 A;  1LPE A;  2J46 A;  3LEO A;  2GA0 A;  1OKK A;  4K0D A;  1AUE A;  1NG1 A;  2KGO A;  4MQ9 F;  3DZA A;  3TUL A;  4DRH B;  2RD9 A;  3DE8 A;  4JZA A;  1TFO B;  1CGN A;  3DM5 A;  2CGE A;  2OG2 A;  3NG1 A;  1XZP A;  2OKU A;  4Z9I A;  4MVS A;  2WZG A;  3HNK A;  3NMI A;  4H54 A;  4MW8 A;  5EGY A;  4CS8 A;  4IAO A;  3WOD F;  4PK4 A;  1YVI A;  3M79 A;  3B71 A;  3DI5 A;  2XM4 A;  2O9X A;  1VLS A;  2A1D D;  4LDK A;  4B6I A;  2R9R B;  1U0B B;  2OOC A;  4QI2 A;  4BEM J;  1KNY A;  3SXY A;  2OQM A;  2HUJ A;  2DYS C;  2P61 A;  4XTK A;  5F5F A;  4O6N A;  1YA7 O;  4ANJ A;  2HFI A;  2X51 A;  5A6B D;  5L0H A;  3DM9 B;  1D1B A;  1D0Z A;  3EFO B;  4E17 A;  5JP7 A;  4E7Z A;  1VTM P;  1V74 B;  2CW0 F;  5AC4 A;  1RCP A;  1V54 C;  2ETS A;  2HV7 A;  3E9V A;  1AEP A;  3A9C A;  5DS4 A;  3AG1 C;  3CZ6 A;  3LS0 A;  1OR2 A;  3DAF A;  2QTV A;  3IPM O;  4CSA A;  1LIH A;  1G5Z A;  1JPN A;  1RJ9 B;  2Z15 A;  3C63 A;  3CSK A;  4F4B A;  5JS5 A;  2R7T A;  1BDJ B;  1OCO C;  2EIL C;  1ZW3 A;  2CNW A;  5AGF A;  1OW8 A;  5KYX A;  3KH2 A;  2NUT A;  2H7V C;  4XPY A;  2XL4 A;  3J06 A;  1WN0 A;  3GOR A;  3LNR A;  2R7O A;  2R7Q A;  2EIM C;  2PX0 A;  2QY9 A;  3DD7 A;  3PMR A;  2A69 F;  3RYL A;  1TWH A;  4CDA A;  1JRA A;  1WWP A;  3ASN C;  3AGT A;  3N0T A;  4MTG A;  1M2V A;  4NTF A;  3VAY A;  3ZC4 A;  3RF3 A;  5B1B C;  3ZQY A;  5A6A A;  3FDQ A;  3T6G B;  3GOD A;  3SZR A;  4U5H A;  3LLI A;  4DOZ A;  5L3V A;  3JT1 A;  2GAQ A;  3TOM A;  1S7Z A;  1IZM A;  3LEV A;  1Z23 A;  4KNW A;  4YWQ A;  3B9Q A;  2OJE D;  4PJL A;  3QMK A;  2YQY A;  1BZ4 A;  4G78 A;  3TJ6 A;  3N24 A;  4ZLC A;  4PJM A;  3W8H A;  2AU5 A;  2HZ8 A;  3RIP A;  4GYT A;  3OEO A;  3K66 A;  3U9M A;  1D0X A;  4I44 A;  3C8G D;  4YL3 A;  1ZVZ A;  3LJB A;  3W2W A;  4FWV A;  3KYI A;  2XRH A;  5GPG B;  2OEX A;  1QSP A;  1YZA A;  3RQF A;  5JVE A;  2J0X A;  2PFD A;  4JC7 A;  4JVS A;  1LS1 A;  4Q5S F;  1WTY A;  2V3C C;  2DI3 A;  1UG7 A;  3KMI A;  4CJO A;  1MND A;  2QLA A;  4NCQ A;  5F5H A;  1AVO B;  1ZHX A;  4JE9 A;  2W4M A;  4JKV A;  5BUO A;  5JUA A;  2JX0 A;  1MMG A;  2NPU A;  2W45 A;  2YL0 A;  3VM6 A;  3QVY A;  5DS6 A;  5A6J A;  3FHD A;  2KQ9 A;  3SXK A;  1G4U S;  2LP4 A;  2BL2 A;  5KYX B;  2NUT B;  4BG0 A;  4OIO F;  1E83 A;  3G4Z A;  5T3T A;  1SF8 A;  4JIO A;  3S90 A;  1VK5 A;  2HSQ A;  1B68 A;  5JSL A;  1ZHT A;  3U8V A;  2Y69 C;  3V5X A;  3UNG C;  3PHF 2;  3DJU B;  3I5P A;  4I1O B;  1D0Y A;  1EKY A;  1RKC A;  1CGO A;  1M2V B;  4JCZ A;  4DJ9 A;  1NZE A;  2LSE A;  1U6H A;  2ZXO A;  3EQL F;  2R05 A;  1C03 A;  4LER A;  3BEH A;  2YRF A;  4P9T A;  3W4Y A;  3EGD A;  2R25 A;  1YYJ A;  3TJ5 A;  4AL1 A;  2QE9 A;  3UMK A;  1QKR A;  4G7Z F;  3H2U A;  2YZS A;  3JZ0 A;  1MMN A;  4YK5 A;  4AE4 A;  4RDA A;  3Q6M A;  1JOG A;  3AQC A;  5L0G A;  4U5E E;  3UGP A;  1LI7 A;  1QPU A;  2G3K A;  1YDI A;  2IBF A;  3EFO A;  3CQZ A;  2IYL D;  4L6R A;  1ZU5 A;  3W8I A;  1SZI A;  3QW0 A;  5DVW A;  4ER9 A;  4PR9 A;  2Q7R A;  1C02 A;  3AG3 C;  3L8I A;  4ONS A;  3DWW A;  5CI8 A;  1K04 A;  2YLD A;  4RBN A;  3L1M A;  2AP3 A;  2D5R B;  4YL0 A;  4YT2 A;  2XLD A;  4QDL A;  2IXM A;  4KI2 A;  4PFO A;  4PAC A;  3O6X A;  4W8P A;  4U9E A;  4E7S A;  2HJM A;  3LLK A;  4LDQ A;  3ASO C;  256B A;  1BBH A;  4NQF A;  1NFN A;  3DKA A;  3EJN A;  4HE8 D;  1FFH A;  1TWG A;  2XS8 A;  1V4A A;  3IQ6 A;  3V5Y A;  4CDY A;  2UUI A;  3MFN A;  2H7B A;  2AWY A;  1A7D A;  3H2V A;  3K6B A;  1SYQ A;  1Y6D A;  3TQO A;  2PNO A;  1Q0G A;  3VF0 A;  4D4N A;  3HJC A;  1LE4 A;  4DRI B;  2R7U A;  2R02 A;  1JPJ A;  3PCV A;  1FAP B;  2MWQ A;  1MQV A;  2NG1 A;  4Z9H A;  2J8W A;  4MND A;  3VRC A;  4OIQ F;  4MVM A;  3MLG A;  1ZU4 A;  2FGY A;  2ZXR A;  3K1I C;  2FFH A;  2RSE B;  4EBK A;  4BJT A;  1ORS C;  4XWJ A;  5HV9 A;  4O6M A;  2L6G A;  3T4R A;  3EGD B;  1WOL A;  1U89 A;  2OU6 A;  2A6H F;  4BJ6 C;  5B3I A;  3OA1 A;  4AE4 B;  3IQT A;  1NU9 C;  5JRA A;  3JSE O;  3SXM A;  3LNM B;  2YHS A;  4KNV A;  1FMV A;  1YZC A;  1A7E A;  1L3P A;  2QNL A;  3L8J A;  3POV A;  3ZG1 A;  4CS7 A;  2C04 A;  4E18 A;  3K33 A;  3RW0 A;  4BJ5 A;  2XLV A;  4JJF A;  4OD5 A;  5DS5 A;  2DYR C;  5B1A C;  2ICW G;  2VCC A;  1Z5Z A;  4MVO A;  2MHR A;  3FOP A;  3C8Z A;  3X2Q C;  1OW7 A;  1LI5 A;  2KW3 C;  3KL4 A;  4JTC B;  2EPN A;  3E70 C;  4R32 A;  3S9O A;  3KYJ A;  5JT4 A;  2KSF A;  2ZD9 A;  1RXQ A;  4XEK A;  1NFO A;  1GS9 A;  5A6B A;  1E2X A;  2YWA A;  3LES A;  1SR2 A;  3B0V C;  2EPL X;  3JRT A;  3U2L A;  2LFD A;  3ZWI A;  1DOW A;  1EI7 A;  1G4W R;  1XZQ A;  1DOV A;  1K05 A;  1QZX A;  2XLM A;  5COG A;  3UGO A;  3IQC A;  2EPM X;  3HNL A;  4DVZ A;  3ABM C;  4WAB A;  5KYW B;  4M63 A;  4MVQ A;  1SMY F;  1C17 M;  4C3D A;  2DGJ A;  1CPR A;  4A4A A;  4LLC A;  4NC3 A;  1HE9 A;  3CAX A;  1L7C A;  4IJJ A;  1ZYR F;  4WJ0 A;  2A68 F;  2P1A A;  5EHH A;  1KTM A;  2Q4F A;  1H9T A;  1OQC A;  4JEB A;  2XL8 A;  2EIJ C;  5IY5 C;  4E0H A;  1NBB A;  3JSZ A;  2L6F A;  2C03 A;  5E2Q A;  3GAN A;  2CDQ A;  5T3W A;  1BR1 A;  1D1C A;  1EA8 A;  1YLM A;  3F46 A;  4XLN F;  1RMV A;  4XPW A;  1A0B A;  4J7T A;  1T5O A;  3JCU Q;  3NYM A;  5HSW A;  4CSA C;  4O79 A;  1MMD A;  3EZH A;  5E3A A;  4A2N B;  1EQ1 A;  3MYF A;  2PBE A;  3DXJ F;  2HKV A;  1NU7 D;  3NMJ A;  1R5I D;  3GEH A;  3ITF A;  1PD1 A;  4NY3 A;  3B0P A;  3AOU A;  4PJJ A;  5FZT A;  1FTS A;  3EGX A;  2DB4 A;  4EKW A;  4CX9 A;  2R7V A;  3EPV A;  4C3E A;  4H4K C;  1M57 C;  3SXZ A;  1TQG A;  3MBG A;  4P6I C;  2G62 A;  3ZVR A;  3C8G A;  4DXW A;  3AGU A;  1MNE A;  2A0B A;  2HMQ A;  4IWB A;  1QLE C;  2YKZ A;  2EIK C;  1XWJ A;  3VYW A;  4CDV A;  1ZHW A;  1I4Z A;  1H7I A;  2IXN A;  3SEO A;  1M6T A;  1MMA A;  2VC9 A;  3GM3 A;  1Q0D A;  3EZI A;  4YT4 A;  3C7J A;  1YAU O;  3AG2 C;  3KPH A;  4K1O A;  3I5Q A;  5L0J A;  2I8B A;  4MVU A;  1JR8 A;  3U3B A;  2H8A A;  3QW1 A;  5D91 A;  3AQB A;  5CI9 A;  2GDC A;  2R7S A;  1FMW A;  1I5N A;  2R7X A;  2VAS A;  1Z7Q c;  1TWC A;  5A6K A;  2ZPA A;  1G8X A;  4CS8 C;  3X1O A;  4UDV A;  4O6Y A;  5EK0 A;  2XSE A;  3U9J A;  2LK4 A;  1N1C A;  3ZDL A;  1M56 C;  3OWT A;  4AL0 A;  3NMK A;  1JMW A;  1T9K A;  3LAY A;  2IOQ A;  4CS9 A;  4E0I A;  2WVN A;  4XQ1 A;  3GWL A;  1HMD A;  4JW1 A;  3S27 A;  1E86 A;  1OCR C;  4RD9 A;  3ZTZ A;  1D1A A;  2J7P D;  2KJG A;  4JUR I;  3U5S A;  5L3Q A;  4OIP F;  1RKE A;  3H65 A;  3EHN A;  4IB4 A;  3EGX B;  4BJ5 C;  1TFK B;  3WAQ A;  4W8K A;  3B0U X;  3ZQV A;  2HSB A;  3MX3 A;  4N6H A;  4MTO A;  1TKN A;  3CEX A;  2XXA A;  3SNH A;  1ZHZ A;  2G3V A;  1BR4 A;  2B0J A;  2YVK A;  3TOL A;  3V7O A;  4IAR A;  2ZXP A;  2NUP A;  4NTA A;  4HFF B;  3GM2 A;  4JRZ A;  4EIY A;  5BQI A;  1ZHY A;  2AWC A;  2EIN C;  4N4W A;  4OIN F;  5L0D A;  2IM8 A;  3B29 A;  3FMS A;  3C8G B;  3K1H A;  5COM A;  3A11 A;  4DBR A;  2NSF A;  5FCL A;  2UUH A;  2LD6 A;  1OW6 A;  3NRH A;  3O39 A;  2YLG A;  1OXB A;  1ORJ A;  4ULV A;  2R03 A;  5KYW A;  3RVY A;  1R4T A;  4N06 A;  1IW7 F;  2IXP A;  1OKK D;  4EHP A;  2L7A A;  1PCX A;  2Y3H A;  1H6G A;  4YJW A;  5E33 A;  1UFB A;  3U8P A;  2MYS A;  1A7V A;  4BJ1 A;  2E87 A;  2WL8 A;  4MVZ A;  2XLH A;  3M4B A;  4I3M A;  3EH2 A;  2EPK X;  4G0H A;  4YT8 A;  1YJG A;  3ABL C;  4AX2 A;  1Z63 A;  3TK0 A;  3US6 A;  2CCY A;  4U5B E;  5B3S C;  1V55 C;  4JJG A;  2P0N A;  1E84 A;  4IAQ A;  1T6U A;  3ZSU A;  2P6V A;  1W2W A;  4JTA B;  1NLX A;  3JTL O;  3UR3 C;  4P9F A;  5JLI A;  1CPQ A;  1GM5 A;  4BPM A;  2JPU A;  3RFY A;  4QI0 A;  4JCH A;  3ECS A;  3R7C A;  1FNT c;  1ZZP A;  4YT5 A;  5L0I A;  1WAS A;  2F22 A;  2L9J A;  3UMI A;  2YL3 A;  1S05 A;  3GEI A;  1I4Y A;  4G7H F;  3SYN A;  3EHM A;  4AK9 A;  2P7V A;  2Q9A A;  5E3C A;  1RKE B;  4N6C A;  1ZW2 A;  2Q9C A;  3GEE A;  1PV3 A;  2OJQ A;  4DRJ B;  3M15 A;  2D4U A;  3G50 A;  3FAP B;  2M64 A;  3DJN B;  1HW1 A;  3Q7G A;  3S28 A;  2XXA B;  4C7O A;  2WZF A;  5BQG A;  1M2O A;  5KYN A;  2NUP B;  2PP4 A;  1OCC C;  1KU2 A;  1Z6A A;  1QQ3 A;  2L81 A;  2XLE A;  2CNW D;  3AG4 C;  4GEH A;  4Q7C A;  2J9V A;  3NDB B;  4LDR A;  1YA9 A;  3U0C A;  1HMO A;  3G4X A;  4KBL A;  4EUK B;  4MTF A;  2VB6 A;  2ASR A;  5A69 A;  1GGQ A;  1BR2 A;  2QUP A;  4CJG A;  3DAG A;  2XS1 A;  2LCH A;  3L34 A;  2A6E F;  2EPO A;  5COF A;  3W2V A;  1O5H A;  1Q0K A;  5KYU A;  2ZXW C;  1LS4 A;  4U5G A;  2LQG A;  3DMD A;  5CIV A;  5L0F A;  3O55 A;  2Q00 A;  2WB7 A;  1PD0 A;  4U5C E;  2IXO A;  1LKX A;  3HNJ A;  2L6H A;  4MW3 A;  3O10 A;  4CBE A;  3FVY A;  5DQT A;  1OCZ C;  1ORY A;  3N2Z B;  2BC5 A;  4ULW A;  3EG9 A;  4DVY P;  1NSG B;  1J8M F;  3HTK C;  1O3U A;  1LE2 A;  3PDM P;  1VMA A;  3S84 A;  3IHU A;  3LS1 A;  2JD3 A;  3WHN A;  3K1I A;  3NYL A;  4CS9 C;  1WGW A;  4GQH A;  1OXK A;  4U5F E;  3NKE A;  4XLP F;  1VYI A;  3QVZ A;  4HEA J;  4YL1 A;  2HMZ A;  1VB5 A;  2XLO A; 
#chains in the Genus database with same CATH homology
 1Q0D A;  1Q0F A;  1Q0M A;  1Q0G A;  1T6Q A;  3G4X A;  3G4Z A;  1Q0K A;  1T6U A;  4NCQ A;  3G50 A;  1T6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...