4NCQA

Crystal structure of nisod h1a mutant
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
112
structure length
112
Chain Sequence
CGVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nickel superoxide dismutase: structural and functional roles of His1 and its H-bonding network.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Ni]
total genus 50
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 4ncqA00
3G4ZA 1T6UA 4NCQA 1T6IA 1Q0FA 1T6QA 1Q0GA 1Q0KA 3G50A 1Q0DA 1Q0MA 3G4XA
chains in the Genus database with same CATH superfamily
2ZD9A 1VB5A 3BEHA 3NMKA 2EILC 4FWVA 4MVRA 5L3VA 3GM1A 2YLIA 2C03A 1A41A 3SZRA 2BE5F 2C04A 3TQOA 2R7XA 2PP4A 2PX3A 4NTBA 4JZAA 4IAQA 1YA7O 4EBBA 3GM2A 3ZVRA 4CJGA 3R7CA 1RKEB 1OR3A 2Y3BA 1OW8A 2IXNA 2HKVA 2NPUA 2ZXRA 3GM3A 4E0HA 4EBJA 1J8MF 3FOOA 3S9OA 4JKVA 3ZG1A 2HMZA 3LNRA 5E3AA 2A1DD 4OD4A 4MW3A 2VCAA 2Y3HA 3B29A 2LK4A 3EGXB 1SYQA 2KSFA 2DGJA 3DZAA 5JLIA 4ONSA 2A0BA 4IWBA 4O6MA 4DJ9A 1VMAA 1LM3B 4IGGA 2DI3A 5EK0A 2DYSC 2H7OA 3FVYA 5BQGA 3H2VA 4XLPF 2QNLA 5AC4A 1RXQA 4AE4A 1E85A 1QQ3A 1VYKA 4XEFA 2R7TA 1EI7A 4DBRA 2J9VA 3DI5A 2J9WA 5L0FA 2CCYA 1APCA 2CGEA 2FFHA 2R05A 4MVZA 2LFDA 1U6HA 3A11A 5COGA 4PK4A 3IQCA 3WHNA 1XZQA 1H9GA 5L0IA 3TJ6A 2KQ9A 3ASNC 1EQ1A 1AVOB 1TWGA 1K05A 3AQCA 3VRCA 2OCCC 2CNWA 3ZQYA 1T6QA 2Y3DA 4HE8D 4CDVA 3S90A 3M4BA 1D1AA 1G4US 3B0UX 4CS7A 3AGTA 4LDKA 4ULVA 1M2VB 2XLWA 3UMKA 1V55C 1ZHWA 3TJ5A 1V74B 3KH2A 3L1MA 4C3BA 3ZTZA 1Q0MA 1C17M 1N1CA 1R4TA 1QSPA 3HLZA 2XL4A 2RD9A 2ICWG 5KYYB 4OIPF 3V5YA 2Q4FA 2OU6A 2YL3A 3C8ZA 4XPWA 2XXAA 4LLCA 1WASA 3JSEO 2Q9CA 4H54A 4DXWA 4Q5SF 4CIPA 3POVA 2NSFA 2W4BA 3IQ5A 3HKKA 3EG9B 3QTHA 1E83A 1LKXA 1KNYA 1TFKB 3IHUA 2WL8A 3LUTB 1RJ9B 4NTFA 1VYIA 4Z9IA 3BRJA 3NYMA 4E18A 2R02A 4WGYA 4AL1A 3ITFA 1GQAA 3NYLA 2HMQA 1JAFA 2GFHA 4OINF 3IPMO 4AX2A 4PFPA 1RKCA 2O9XA 4BJ6A 3IQ6A 1OCOC 1JPJA 2Q00A 4ULWA 1FFTC 1Q0GA 1MNDA 2LSEA 4LDQA 3RKOF 4CDYA 2R7SA 1YVIA 1ZHTA 2IM8A 5IY5C 4KNWA 3GWLA 1WN0A 2X0CA 4P6IC 3EJNA 4KNVA 4M63A 4KC9A 5L0JA 1YLMA 3M4CA 3RQFA 1K04A 5JVEA 1MMGA 3UGOA 3ABMC 2R9RB 4WABA 3J06A 1M2OA 3GEIA 3NMIA 4J7TA 3SXYA 3ZDLA 4BPMA 2OG2A 2JX0A 3EFOB 2GAQA 5B1AC 1QLEC 3FDQA 4G7HF 2WB7A 1OW7A 2EPKX 5HSWA 1FFHA 2JPUA 1WGWA 2Z15A 3GANA 1JOGA 2B0JA 3LNMB 4GQHA 4MTFA 3ASOC 1RCPA 5FZTA 1M56C 4DBQA 4YL1A 1UG7A 2GDCA 5JRAA 3KMIA 1BR1A 3QW1A 1H7IA 1WTYA 4BG0A 1V4AA 1NU7D 2YRFA 3QVZA 5JT4A 3ZIBA 4QDLA 5E2QA 1BR2A 2LCHA 4G7ZF 4YT2A 2P1AA 2P61A 4YT5A 4XEVA 3X2QC 2I8BA 1IZMA 4MVMA 2OKUA 2Q9AA 2R7QA 256BA 5KYUA 1PD1A 3T4RA 3HNIA 3RIPA 3U2LA 2AWCA 1NG1A 4OIRF 4C3EA 2XS1A 2ZXOA 2PX0A 2XL8A 2OEVA 1ORSC 2G3VA 5B3IA 2JD3A 2UUIA 3RVYA 3X1OA 1K40A 1XZPA 2RSEB 1Y6DA 4XWJA 2AVKA 1HE9A 4DRJB 3ZSUA 5DS4A 3U5SA 2R25A 1S05A 5EHHA 3PDMP 3ABLC 4O79A 1YYXA 2XLEA 2L6FA 2Y69C 4JE9A 1FMVA 1D1CA 2WVNA 3K7DA 3RFYA 1WOLA 4U5DE 3FHDA 3O6XA 1TFOB 1YDIA 2VCBA 3S27A 3M79A 3RW0A 1ZW3A 1D1BA 2YLGA 2ZXWC 3V5ZA 4K1OA 1Q0KA 4U5FE 3G50A 4U9EA 2XRHA 4WJ0A 4EHPA 4PACA 2Y39A 1L7CA 3G4XA 2D4UA 1YJGA 3ABKC 3K1IC 5L0DA 3C7JA 5COFA 3EH2A 4JEAA 4LLEA 5K0IA 2L81A 3V7OA 2OJQA 4IB4A 4RBNA 2V26A 2ZPAA 1HMDA 3OA1A 4JRZA 3WAQA 3EH1A 2J0XA 4I44A 3JTLO 4U5CE 3T9OA 2R7UA 3EFOA 4MVSA 4EWCA 2TMVP 3PCVA 2VH3A 4QI0A 3VF0A 3U8PA 1ZHXA 3SXMA 3QZCA 4IAOA 4CX9A 5A6BD 1U0BB 4RDAA 4QI2A 4MTOA 4DVYP 2J7PA 3RVZA 3ZTMA 4Z9HA 5L0HA 3VAYA 4H4KC 3S0XA 4RD9A 4UDVA 3TD7A 1NFOA 3AG4C 2WVQA 3ATPA 4G0HA 4N6CA 5E33A 4BJTA 3JYHA 4J32B 1DOWA 1LI5A 1ZHZA 2ASRA 2L9JA 2NUTB 3GORA 3FXHA 3K66A 5CI8A 1F1MA 3C62A 1QPUA 5CI9A 1A7DA 2E87A 3NRHA 3T6GB 2A0UA 4XPXA 2HJMA 2FAPB 1ZHYA 3W8HA 4JCZA 3HNKA 3C63A 1YARO 3U3BA 3DJNB 3S84A 3DAFA 4IARA 2EPMX 3AJMA 1I5NA 3K33A 3JRMO 3LJBA 4I1MA 2X51A 5KYWA 1VTMP 4JEBA 4CJOA 4JTAB 5L3QA 2AWYA 5DLJA 1TR2A 4U5HA 1FMWA 2GWWA 1E84A 2QTVA 2A69F 1HW2A 4CS8A 1CGOA 3LEVA 3DM5A 3W2VA 1RJ9A 1T5OA 2AP3A 1LPEA 3FOPA 1Q0FA 2LFFA 2LD6A 2OOCA 3SNHA 3HNLA 3K1HA 3UMIA 3AQBA 3O55A 4CBEA 2QUPA 3UR3C 3L8JA 4NY3A 4PJJA 3Q6NA 4MVOA 1OCZC 3SP1A 1O87A 1Z63A 2H7VC 2PF4E 2D5RB 3O10A 3U9JA 1JMWA 2F22A 1JRAA 3AGUA 3CAXA 2CDQA 4A4AA 3FMSA 1M2VA 1ZW2A 3RQGA 3US6A 3MYFA 1ZU4A 1E86A 3I5PA 4MW8A 1VLSA 3K6BA 4N06A 2VB6A 3IEEA 2HS5A 2MWQA 3JCUQ 3JT1A 4XLNF 3MX3A 4EKWA 3NDBB 4ZLDA 2EPLX 3E70C 3ECSA 2VC9A 3NKDA 1PD0A 3SXZA 3HNJA 4DRHB 4BJ6C 3DXJF 4MTGA 1BDJB 3WG7C 3DE9A 5BUOA 4PR9A 1W2WA 5B3SC 1SR2A 5CIVA 2H8AA 3CZ6A 1KTMA 2YHSA 4FESA 3GODA 5TJ5E 1JPNA 4CIHA 4ANJA 4G78A 2M4EA 2KW3C 2G62A 4XQ1A 4YL3A 2CNWD 2L7AA 2KK1A 4YK5A 4AE4B 4CS9C 5L0CA 3U8VA 3ZC4A 1FAPB 1MMNA 3EZHA 2YLDA 3TOMA 1FR0A 1ST6A 5KYUB 2A68F 1HY5A 1U89A 2MHRA 2YKZA 3GEHA 2OEXA 1YA9A 4JJFA 4YN0B 2GA0A 4MS2A 5T3TA 1HW1A 4J7YA 5BQIA 3C8GA 4JTCB 4YJWA 3TK0A 5JS5A 2YVKA 4KI2A 1TKNA 2J46A 2UUHA 1SMYF 1M57C 1T9KA 2XLDA 3DWWA 3N0TA 4K0DA 4L6RA 5E3CA 4XTKA 4EUKB 1OXKA 2QE9A 4OIQF 1LS1A 2KGOA 2NG1A 1LVKA 2WVOA 2IXPA 1I4ZA 1BR4A 1CGME 4E0IA 4Q4ZF 2R7OA 3AG3C 1A7VA 1Y4CA 3DM9B 3LAYA 2XL6A 2OJED 4EBKA 1WATA 2EIMC 1Q0DA 2XLHA 2QY9A 1TWCA 3DE8A 4O7GA 4YL0A 3L8IA 2W45A 2EIJC 1G5ZA 3U3FA 3WODF 4YWQA 1Z3IX 4IJJA 3B0PA 4JC7A 5BQHA 2R7RA 5F5FA 1ZYRF 3A9CA 3LESA 3MLGA 2EPOA 2WZLA 2R03A 3AG1C 4PFOA 2NSGA 3NG1A 3L0IA 3DKAA 1ZVZA 1Z23A 3MBGA 2XS8A 4JJGA 4E17A 4CSAC 1SZIA 2EIKC 3CQZA 4PJNA 5A6BA 3E9VA 1VOMA 1JR8A 4JURI 1A0BA 2LP4A 2PFDA 2P0NA 2I15A 2MYSA 4XPYA 4DOZA 3QMKA 1TWAA 4GYTA 4AK9A 1MMDA 3NYJA 1UFBA 1FNTc 4OD5A 1GGQA 3KKBA 5DVWA 1M6TA 1C03A 2QLAA 1OCCC 1O5HA 4MNDA 2WZFA 1VK5A 4CS8C 2WZGA 1FTSA 3JYYA 1V54C 5GPGB 5B1BC 1BBHA 2LQGA 3EGXA 4DRIB 5JUAA 4CDAA 2EINC 1O3UA 2H7BA 4B6IA 3C8GD 4D4NA 1KU2A 2YWAA 2G3KA 2HJ3A 5HV9A 4C7OB 1T6IA 3JRTA 3I5QA 5A69A 2YL7A 1ZU5A 3Q7GA 3F47A 3KL4A 1EA8A 1D0ZA 1WWPA 1YZCA 1Z6AA 2XLVA 2KNHA 3S29A 1NU9C 2A6HF 2L6GA 4O6NA 2R7WA 2R7VA 1Z5ZA 4C7OA 1LE4A 1EKYA 1L3PA 4U5GA 5AC5A 4ER9A 3L34A 2DYRC 1A7EA 1OXBA 3DAGA 2BC5A 3PMRA 2Q3TA 2BL2A 1NLXA 2XM4A 3T6BA 4JIOA 2J45A 1DOVA 4ZLCA 1CPQA 1D0XA 1RKEA 3EHMA 1H9TA 3U9MA 4LERA 3B71A 1MQVA 2A6EF 5A6KA 3FAJA 4JTDB 2CYDA 3LEOA 4OIOF 2IXMA 2KJGA 4J30B 2IOQA 2J8WA 3KYIA 4W8KA 1NBBA 4JW1A 1S7ZA 3LLKA 1HE1A 1SF8A 1OKKA 2J0WA 3AG2C 5COMA 4BEJA 3LS1A 2Q7RA 3C8GB 3AOUA 4PJLA 4MQ9F 1OW6A 3GEEA 3T6JA 2Y3GA 1LS4A 3OEOA 3MYIA 3H2UA 3Q7LA 5F28E 2IYLD 4AL0A 5KYYA 3MFNA 3LLIA 5A6JA 3EZIA 4I3MA 3HJCA 4MVQA 4Z9JA 3S28A 1RMVA 5DQZA 1QVXA 1E2XA 2HV6A 3EGDA 4N4WA 4G7OF 1TWHA 5JP7A 3TOLA 1GM5A 3EG9A 1YZAA 4R32A 3QW0A 1ORYA 2YL0A 1Z7Qc 3HTKC 4BJ5C 3Q6MA 1XWJA 1D0YA 2YEVA 4N6HA 4NTAA 5F5HA 3KYJA 3JSZA 3GWNA 2VCCA 1YAUO 1YYJA 2W4MA 4W8PA 3G4ZA 1T6UA 2HSBA 2XXAB 2W9YA 3R2PA 1LIHA 3RH3A 4E7ZA 3TULA 4IRUA 4FAPB 3QVYA 1ZZPA 2B0HA 4YT4A 3LS0A 5A6AA 3M1CB 3EPVA 4CSAA 4PJMA 3JZ0A 1C02A 4BJ1A 1R5ID 4EIYA 3DMDA 4X0RA 3EHNA 2LIGA 4NCQA 4C3DA 2HUJA 1BZ4A 1J8YF 4XEKA 1CGNA 5KYXB 3N24A 1GS9A 1OCRC 5DQTA 4BEMJ 2L6HA 1B68A 4HFFB 3ZQVA 2XSEA 1CPRA 3M15A 3OWTA 2DB4A 3FAPB 4P9TA 4U5BE 4WGZA 3K1IA 4NC3A 2AU5A 4E7SA 5JSLA 5DS6A 2XM0A 4A2NB 1LI7A 5KYXA 3W8IA 2KC3A 1T01A 3SXKA 3B9QA 4D4XA 5KYWB 2M64A 3RQEA 4Q7CA 1IW7F 2IXOA 2NUTA 4CS9A 2FGYA 4I1OB 4JVSA 4NQFA 2PBEA 3UMHA 2J9UA 1TQGA 2YZSA 1H6GA 3W4YA 5KYNA 3C18A 1HMOA 2P6VA 1NFNA 4FX5A 4HFKB 3RYLA 1ORJA 2HSQA 1NSGB 3U2MA 3ZWIA 2YL1A 3F46A 5FCLA 3RF3A 1G8XA 1MNEA 4BJ5A 2VASA 1NZEA 4KBLA 3W2WA 2HV7A 4MVUA 3H65A 2YQYA 5D91A 2HFIA 4HEAJ 5EGYA 2Q9BA 4JCHA 3N2ZB 2CW0F 1QZXA 2P7VA 2J7PD 4K7BA 3DJUB 3KPHA 2OQMA 4LACB 5AGFA 5T1DB 1G4WR 3SEOA 3UNGC 3VM6A 4F4BA 3B0VC 4O6YA 2KYHA 3NKEA 4U5EE 5T3WA 1I4YA 1OR2A 2NUPA 3CSKA 3EQLF 3UGPA 2V3CC 2HZ8A 1PCXA 1VLTA 2ETSA 2EPNA 2ZXPA 3CEXA 4P9FA 3V5XA 1QKRA 3VYWA 2IBFA 4LDRA 1AUEA 2XLOA 2J9BA 1AEPA 1OKKD 1OQCA 3NMJA 3U0CA 1MMAA 5L0GA 3SYNA 1LE2A 5D92A 2NUPB 4YT8A 3O39A 3EGDB 4GEHA 3IQTA 3DD7A 4U9DA 3PHF2 2PNOA 3I4UA 1PV3A 5DS5A 2XLMA 4DVZA
chains in the Genus database with same CATH topology
3G4ZA 1T6UA 4NCQA 1T6IA 1Q0FA 1T6QA 1Q0GA 1Q0KA 3G50A 1Q0DA 1Q0MA 3G4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4Z A;  1T6U A;  4NCQ A;  1T6I A;  1Q0F A;  1T6Q A;  1Q0G A;  1Q0K A;  3G50 A;  1Q0D A;  1Q0M A;  3G4X A; 
#chains in the Genus database with same CATH topology
 2ZD9 A;  1VB5 A;  3BEH A;  3NMK A;  2EIL C;  4FWV A;  4MVR A;  5L3V A;  3GM1 A;  2YLI A;  2C03 A;  1A41 A;  3SZR A;  2BE5 F;  2C04 A;  3TQO A;  2R7X A;  2PP4 A;  2PX3 A;  4NTB A;  4JZA A;  4IAQ A;  1YA7 O;  4EBB A;  3GM2 A;  3ZVR A;  4CJG A;  3R7C A;  1RKE B;  1OR3 A;  2Y3B A;  1OW8 A;  2IXN A;  2HKV A;  2NPU A;  2ZXR A;  3GM3 A;  4E0H A;  4EBJ A;  1J8M F;  3FOO A;  3S9O A;  4JKV A;  3ZG1 A;  2HMZ A;  3LNR A;  5E3A A;  2A1D D;  4OD4 A;  4MW3 A;  2VCA A;  2Y3H A;  3B29 A;  2LK4 A;  3EGX B;  1SYQ A;  2KSF A;  2DGJ A;  3DZA A;  5JLI A;  4ONS A;  2A0B A;  4IWB A;  4O6M A;  4DJ9 A;  1VMA A;  1LM3 B;  4IGG A;  2DI3 A;  5EK0 A;  2DYS C;  2H7O A;  3FVY A;  5BQG A;  3H2V A;  4XLP F;  2QNL A;  5AC4 A;  1RXQ A;  4AE4 A;  1E85 A;  1QQ3 A;  1VYK A;  4XEF A;  2R7T A;  1EI7 A;  4DBR A;  2J9V A;  3DI5 A;  2J9W A;  5L0F A;  2CCY A;  1APC A;  2CGE A;  2FFH A;  2R05 A;  4MVZ A;  2LFD A;  1U6H A;  3A11 A;  5COG A;  4PK4 A;  3IQC A;  3WHN A;  1XZQ A;  1H9G A;  5L0I A;  3TJ6 A;  2KQ9 A;  3ASN C;  1EQ1 A;  1AVO B;  1TWG A;  1K05 A;  3AQC A;  3VRC A;  2OCC C;  2CNW A;  3ZQY A;  1T6Q A;  2Y3D A;  4HE8 D;  4CDV A;  3S90 A;  3M4B A;  1D1A A;  1G4U S;  3B0U X;  4CS7 A;  3AGT A;  4LDK A;  4ULV A;  1M2V B;  2XLW A;  3UMK A;  1V55 C;  1ZHW A;  3TJ5 A;  1V74 B;  3KH2 A;  3L1M A;  4C3B A;  3ZTZ A;  1Q0M A;  1C17 M;  1N1C A;  1R4T A;  1QSP A;  3HLZ A;  2XL4 A;  2RD9 A;  2ICW G;  5KYY B;  4OIP F;  3V5Y A;  2Q4F A;  2OU6 A;  2YL3 A;  3C8Z A;  4XPW A;  2XXA A;  4LLC A;  1WAS A;  3JSE O;  2Q9C A;  4H54 A;  4DXW A;  4Q5S F;  4CIP A;  3POV A;  2NSF A;  2W4B A;  3IQ5 A;  3HKK A;  3EG9 B;  3QTH A;  1E83 A;  1LKX A;  1KNY A;  1TFK B;  3IHU A;  2WL8 A;  3LUT B;  1RJ9 B;  4NTF A;  1VYI A;  4Z9I A;  3BRJ A;  3NYM A;  4E18 A;  2R02 A;  4WGY A;  4AL1 A;  3ITF A;  1GQA A;  3NYL A;  2HMQ A;  1JAF A;  2GFH A;  4OIN F;  3IPM O;  4AX2 A;  4PFP A;  1RKC A;  2O9X A;  4BJ6 A;  3IQ6 A;  1OCO C;  1JPJ A;  2Q00 A;  4ULW A;  1FFT C;  1Q0G A;  1MND A;  2LSE A;  4LDQ A;  3RKO F;  4CDY A;  2R7S A;  1YVI A;  1ZHT A;  2IM8 A;  5IY5 C;  4KNW A;  3GWL A;  1WN0 A;  2X0C A;  4P6I C;  3EJN A;  4KNV A;  4M63 A;  4KC9 A;  5L0J A;  1YLM A;  3M4C A;  3RQF A;  1K04 A;  5JVE A;  1MMG A;  3UGO A;  3ABM C;  2R9R B;  4WAB A;  3J06 A;  1M2O A;  3GEI A;  3NMI A;  4J7T A;  3SXY A;  3ZDL A;  4BPM A;  2OG2 A;  2JX0 A;  3EFO B;  2GAQ A;  5B1A C;  1QLE C;  3FDQ A;  4G7H F;  2WB7 A;  1OW7 A;  2EPK X;  5HSW A;  1FFH A;  2JPU A;  1WGW A;  2Z15 A;  3GAN A;  1JOG A;  2B0J A;  3LNM B;  4GQH A;  4MTF A;  3ASO C;  1RCP A;  5FZT A;  1M56 C;  4DBQ A;  4YL1 A;  1UG7 A;  2GDC A;  5JRA A;  3KMI A;  1BR1 A;  3QW1 A;  1H7I A;  1WTY A;  4BG0 A;  1V4A A;  1NU7 D;  2YRF A;  3QVZ A;  5JT4 A;  3ZIB A;  4QDL A;  5E2Q A;  1BR2 A;  2LCH A;  4G7Z F;  4YT2 A;  2P1A A;  2P61 A;  4YT5 A;  4XEV A;  3X2Q C;  2I8B A;  1IZM A;  4MVM A;  2OKU A;  2Q9A A;  2R7Q A;  256B A;  5KYU A;  1PD1 A;  3T4R A;  3HNI A;  3RIP A;  3U2L A;  2AWC A;  1NG1 A;  4OIR F;  4C3E A;  2XS1 A;  2ZXO A;  2PX0 A;  2XL8 A;  2OEV A;  1ORS C;  2G3V A;  5B3I A;  2JD3 A;  2UUI A;  3RVY A;  3X1O A;  1K40 A;  1XZP A;  2RSE B;  1Y6D A;  4XWJ A;  2AVK A;  1HE9 A;  4DRJ B;  3ZSU A;  5DS4 A;  3U5S A;  2R25 A;  1S05 A;  5EHH A;  3PDM P;  3ABL C;  4O79 A;  1YYX A;  2XLE A;  2L6F A;  2Y69 C;  4JE9 A;  1FMV A;  1D1C A;  2WVN A;  3K7D A;  3RFY A;  1WOL A;  4U5D E;  3FHD A;  3O6X A;  1TFO B;  1YDI A;  2VCB A;  3S27 A;  3M79 A;  3RW0 A;  1ZW3 A;  1D1B A;  2YLG A;  2ZXW C;  3V5Z A;  4K1O A;  1Q0K A;  4U5F E;  3G50 A;  4U9E A;  2XRH A;  4WJ0 A;  4EHP A;  4PAC A;  2Y39 A;  1L7C A;  3G4X A;  2D4U A;  1YJG A;  3ABK C;  3K1I C;  5L0D A;  3C7J A;  5COF A;  3EH2 A;  4JEA A;  4LLE A;  5K0I A;  2L81 A;  3V7O A;  2OJQ A;  4IB4 A;  4RBN A;  2V26 A;  2ZPA A;  1HMD A;  3OA1 A;  4JRZ A;  3WAQ A;  3EH1 A;  2J0X A;  4I44 A;  3JTL O;  4U5C E;  3T9O A;  2R7U A;  3EFO A;  4MVS A;  4EWC A;  2TMV P;  3PCV A;  2VH3 A;  4QI0 A;  3VF0 A;  3U8P A;  1ZHX A;  3SXM A;  3QZC A;  4IAO A;  4CX9 A;  5A6B D;  1U0B B;  4RDA A;  4QI2 A;  4MTO A;  4DVY P;  2J7P A;  3RVZ A;  3ZTM A;  4Z9H A;  5L0H A;  3VAY A;  4H4K C;  3S0X A;  4RD9 A;  4UDV A;  3TD7 A;  1NFO A;  3AG4 C;  2WVQ A;  3ATP A;  4G0H A;  4N6C A;  5E33 A;  4BJT A;  3JYH A;  4J32 B;  1DOW A;  1LI5 A;  1ZHZ A;  2ASR A;  2L9J A;  2NUT B;  3GOR A;  3FXH A;  3K66 A;  5CI8 A;  1F1M A;  3C62 A;  1QPU A;  5CI9 A;  1A7D A;  2E87 A;  3NRH A;  3T6G B;  2A0U A;  4XPX A;  2HJM A;  2FAP B;  1ZHY A;  3W8H A;  4JCZ A;  3HNK A;  3C63 A;  1YAR O;  3U3B A;  3DJN B;  3S84 A;  3DAF A;  4IAR A;  2EPM X;  3AJM A;  1I5N A;  3K33 A;  3JRM O;  3LJB A;  4I1M A;  2X51 A;  5KYW A;  1VTM P;  4JEB A;  4CJO A;  4JTA B;  5L3Q A;  2AWY A;  5DLJ A;  1TR2 A;  4U5H A;  1FMW A;  2GWW A;  1E84 A;  2QTV A;  2A69 F;  1HW2 A;  4CS8 A;  1CGO A;  3LEV A;  3DM5 A;  3W2V A;  1RJ9 A;  1T5O A;  2AP3 A;  1LPE A;  3FOP A;  1Q0F A;  2LFF A;  2LD6 A;  2OOC A;  3SNH A;  3HNL A;  3K1H A;  3UMI A;  3AQB A;  3O55 A;  4CBE A;  2QUP A;  3UR3 C;  3L8J A;  4NY3 A;  4PJJ A;  3Q6N A;  4MVO A;  1OCZ C;  3SP1 A;  1O87 A;  1Z63 A;  2H7V C;  2PF4 E;  2D5R B;  3O10 A;  3U9J A;  1JMW A;  2F22 A;  1JRA A;  3AGU A;  3CAX A;  2CDQ A;  4A4A A;  3FMS A;  1M2V A;  1ZW2 A;  3RQG A;  3US6 A;  3MYF A;  1ZU4 A;  1E86 A;  3I5P A;  4MW8 A;  1VLS A;  3K6B A;  4N06 A;  2VB6 A;  3IEE A;  2HS5 A;  2MWQ A;  3JCU Q;  3JT1 A;  4XLN F;  3MX3 A;  4EKW A;  3NDB B;  4ZLD A;  2EPL X;  3E70 C;  3ECS A;  2VC9 A;  3NKD A;  1PD0 A;  3SXZ A;  3HNJ A;  4DRH B;  4BJ6 C;  3DXJ F;  4MTG A;  1BDJ B;  3WG7 C;  3DE9 A;  5BUO A;  4PR9 A;  1W2W A;  5B3S C;  1SR2 A;  5CIV A;  2H8A A;  3CZ6 A;  1KTM A;  2YHS A;  4FES A;  3GOD A;  5TJ5 E;  1JPN A;  4CIH A;  4ANJ A;  4G78 A;  2M4E A;  2KW3 C;  2G62 A;  4XQ1 A;  4YL3 A;  2CNW D;  2L7A A;  2KK1 A;  4YK5 A;  4AE4 B;  4CS9 C;  5L0C A;  3U8V A;  3ZC4 A;  1FAP B;  1MMN A;  3EZH A;  2YLD A;  3TOM A;  1FR0 A;  1ST6 A;  5KYU B;  2A68 F;  1HY5 A;  1U89 A;  2MHR A;  2YKZ A;  3GEH A;  2OEX A;  1YA9 A;  4JJF A;  4YN0 B;  2GA0 A;  4MS2 A;  5T3T A;  1HW1 A;  4J7Y A;  5BQI A;  3C8G A;  4JTC B;  4YJW A;  3TK0 A;  5JS5 A;  2YVK A;  4KI2 A;  1TKN A;  2J46 A;  2UUH A;  1SMY F;  1M57 C;  1T9K A;  2XLD A;  3DWW A;  3N0T A;  4K0D A;  4L6R A;  5E3C A;  4XTK A;  4EUK B;  1OXK A;  2QE9 A;  4OIQ F;  1LS1 A;  2KGO A;  2NG1 A;  1LVK A;  2WVO A;  2IXP A;  1I4Z A;  1BR4 A;  1CGM E;  4E0I A;  4Q4Z F;  2R7O A;  3AG3 C;  1A7V A;  1Y4C A;  3DM9 B;  3LAY A;  2XL6 A;  2OJE D;  4EBK A;  1WAT A;  2EIM C;  1Q0D A;  2XLH A;  2QY9 A;  1TWC A;  3DE8 A;  4O7G A;  4YL0 A;  3L8I A;  2W45 A;  2EIJ C;  1G5Z A;  3U3F A;  3WOD F;  4YWQ A;  1Z3I X;  4IJJ A;  3B0P A;  4JC7 A;  5BQH A;  2R7R A;  5F5F A;  1ZYR F;  3A9C A;  3LES A;  3MLG A;  2EPO A;  2WZL A;  2R03 A;  3AG1 C;  4PFO A;  2NSG A;  3NG1 A;  3L0I A;  3DKA A;  1ZVZ A;  1Z23 A;  3MBG A;  2XS8 A;  4JJG A;  4E17 A;  4CSA C;  1SZI A;  2EIK C;  3CQZ A;  4PJN A;  5A6B A;  3E9V A;  1VOM A;  1JR8 A;  4JUR I;  1A0B A;  2LP4 A;  2PFD A;  2P0N A;  2I15 A;  2MYS A;  4XPY A;  4DOZ A;  3QMK A;  1TWA A;  4GYT A;  4AK9 A;  1MMD A;  3NYJ A;  1UFB A;  1FNT c;  4OD5 A;  1GGQ A;  3KKB A;  5DVW A;  1M6T A;  1C03 A;  2QLA A;  1OCC C;  1O5H A;  4MND A;  2WZF A;  1VK5 A;  4CS8 C;  2WZG A;  1FTS A;  3JYY A;  1V54 C;  5GPG B;  5B1B C;  1BBH A;  2LQG A;  3EGX A;  4DRI B;  5JUA A;  4CDA A;  2EIN C;  1O3U A;  2H7B A;  4B6I A;  3C8G D;  4D4N A;  1KU2 A;  2YWA A;  2G3K A;  2HJ3 A;  5HV9 A;  4C7O B;  1T6I A;  3JRT A;  3I5Q A;  5A69 A;  2YL7 A;  1ZU5 A;  3Q7G A;  3F47 A;  3KL4 A;  1EA8 A;  1D0Z A;  1WWP A;  1YZC A;  1Z6A A;  2XLV A;  2KNH A;  3S29 A;  1NU9 C;  2A6H F;  2L6G A;  4O6N A;  2R7W A;  2R7V A;  1Z5Z A;  4C7O A;  1LE4 A;  1EKY A;  1L3P A;  4U5G A;  5AC5 A;  4ER9 A;  3L34 A;  2DYR C;  1A7E A;  1OXB A;  3DAG A;  2BC5 A;  3PMR A;  2Q3T A;  2BL2 A;  1NLX A;  2XM4 A;  3T6B A;  4JIO A;  2J45 A;  1DOV A;  4ZLC A;  1CPQ A;  1D0X A;  1RKE A;  3EHM A;  1H9T A;  3U9M A;  4LER A;  3B71 A;  1MQV A;  2A6E F;  5A6K A;  3FAJ A;  4JTD B;  2CYD A;  3LEO A;  4OIO F;  2IXM A;  2KJG A;  4J30 B;  2IOQ A;  2J8W A;  3KYI A;  4W8K A;  1NBB A;  4JW1 A;  1S7Z A;  3LLK A;  1HE1 A;  1SF8 A;  1OKK A;  2J0W A;  3AG2 C;  5COM A;  4BEJ A;  3LS1 A;  2Q7R A;  3C8G B;  3AOU A;  4PJL A;  4MQ9 F;  1OW6 A;  3GEE A;  3T6J A;  2Y3G A;  1LS4 A;  3OEO A;  3MYI A;  3H2U A;  3Q7L A;  5F28 E;  2IYL D;  4AL0 A;  5KYY A;  3MFN A;  3LLI A;  5A6J A;  3EZI A;  4I3M A;  3HJC A;  4MVQ A;  4Z9J A;  3S28 A;  1RMV A;  5DQZ A;  1QVX A;  1E2X A;  2HV6 A;  3EGD A;  4N4W A;  4G7O F;  1TWH A;  5JP7 A;  3TOL A;  1GM5 A;  3EG9 A;  1YZA A;  4R32 A;  3QW0 A;  1ORY A;  2YL0 A;  1Z7Q c;  3HTK C;  4BJ5 C;  3Q6M A;  1XWJ A;  1D0Y A;  2YEV A;  4N6H A;  4NTA A;  5F5H A;  3KYJ A;  3JSZ A;  3GWN A;  2VCC A;  1YAU O;  1YYJ A;  2W4M A;  4W8P A;  3G4Z A;  1T6U A;  2HSB A;  2XXA B;  2W9Y A;  3R2P A;  1LIH A;  3RH3 A;  4E7Z A;  3TUL A;  4IRU A;  4FAP B;  3QVY A;  1ZZP A;  2B0H A;  4YT4 A;  3LS0 A;  5A6A A;  3M1C B;  3EPV A;  4CSA A;  4PJM A;  3JZ0 A;  1C02 A;  4BJ1 A;  1R5I D;  4EIY A;  3DMD A;  4X0R A;  3EHN A;  2LIG A;  4NCQ A;  4C3D A;  2HUJ A;  1BZ4 A;  1J8Y F;  4XEK A;  1CGN A;  5KYX B;  3N24 A;  1GS9 A;  1OCR C;  5DQT A;  4BEM J;  2L6H A;  1B68 A;  4HFF B;  3ZQV A;  2XSE A;  1CPR A;  3M15 A;  3OWT A;  2DB4 A;  3FAP B;  4P9T A;  4U5B E;  4WGZ A;  3K1I A;  4NC3 A;  2AU5 A;  4E7S A;  5JSL A;  5DS6 A;  2XM0 A;  4A2N B;  1LI7 A;  5KYX A;  3W8I A;  2KC3 A;  1T01 A;  3SXK A;  3B9Q A;  4D4X A;  5KYW B;  2M64 A;  3RQE A;  4Q7C A;  1IW7 F;  2IXO A;  2NUT A;  4CS9 A;  2FGY A;  4I1O B;  4JVS A;  4NQF A;  2PBE A;  3UMH A;  2J9U A;  1TQG A;  2YZS A;  1H6G A;  3W4Y A;  5KYN A;  3C18 A;  1HMO A;  2P6V A;  1NFN A;  4FX5 A;  4HFK B;  3RYL A;  1ORJ A;  2HSQ A;  1NSG B;  3U2M A;  3ZWI A;  2YL1 A;  3F46 A;  5FCL A;  3RF3 A;  1G8X A;  1MNE A;  4BJ5 A;  2VAS A;  1NZE A;  4KBL A;  3W2W A;  2HV7 A;  4MVU A;  3H65 A;  2YQY A;  5D91 A;  2HFI A;  4HEA J;  5EGY A;  2Q9B A;  4JCH A;  3N2Z B;  2CW0 F;  1QZX A;  2P7V A;  2J7P D;  4K7B A;  3DJU B;  3KPH A;  2OQM A;  4LAC B;  5AGF A;  5T1D B;  1G4W R;  3SEO A;  3UNG C;  3VM6 A;  4F4B A;  3B0V C;  4O6Y A;  2KYH A;  3NKE A;  4U5E E;  5T3W A;  1I4Y A;  1OR2 A;  2NUP A;  3CSK A;  3EQL F;  3UGP A;  2V3C C;  2HZ8 A;  1PCX A;  1VLT A;  2ETS A;  2EPN A;  2ZXP A;  3CEX A;  4P9F A;  3V5X A;  1QKR A;  3VYW A;  2IBF A;  4LDR A;  1AUE A;  2XLO A;  2J9B A;  1AEP A;  1OKK D;  1OQC A;  3NMJ A;  3U0C A;  1MMA A;  5L0G A;  3SYN A;  1LE2 A;  5D92 A;  2NUP B;  4YT8 A;  3O39 A;  3EGD B;  4GEH A;  3IQT A;  3DD7 A;  4U9D A;  3PHF 2;  2PNO A;  3I4U A;  1PV3 A;  5DS5 A;  2XLM A;  4DVZ A; 
#chains in the Genus database with same CATH homology
 3G4Z A;  1T6U A;  4NCQ A;  1T6I A;  1Q0F A;  1T6Q A;  1Q0G A;  1Q0K A;  3G50 A;  1Q0D A;  1Q0M A;  3G4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...