2YHSA

Structure of the e. coli srp receptor ftsy
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
308
structure length
308
Chain Sequence
EKPTKEGFFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN FTSY
publication title Lipids Trigger a Conformational Switch that Regulates Signal Recognition Particle (Srp)-Mediated Protein Targeting.
pubmed doi rcsb
source organism Escherichia coli
total genus 125
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2yhsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yhsA02
2PMKA 2MSCB 3EG5A 4M53A 4JZKA 1E2DA 1KDPA 2IUSA 1XD8A 3W5IA 5EE5B 3UWOA 3Q85A 3CR8A 1E9AA 4PHHA 1N6IA 4B3XA 3VHLB 2GEDA 3CB4A 4OQNA 1TQ6A 4GP6A 2ZJBA 3LW7A 4C0LA 2DYKA 3SI7A 3CF6R 2NGRA 3QF4B 2PLFA 2O8CA 3AM1A 1BYIA 1QRAA 4TQUS 1S3GA 2CCKA 3EIQA 3U60B 1FUKA 2ODEA 4DIEA 1JBKA 5FOSA 3EIEA 2IUTA 2JJ2A 5KDOA 3VMFA 2MMCA 1E1QD 3C4JA 4ZDKA 4Q00A 4B44A 1ZM4A 4CEJA 2PCLA 3OIYA 1KKMA 4Q1AA 4EPVA 5B64A 5FBQB 3LBNA 5KSOA 1ZW6A 4LV5B 4U02A 2GCNA 2ZI7A 5FUWA 5BWMA 4TMTA 1GL9B 2HCJB 2IC5A 4BFSA 3IILA 4LYFA 4KYUA 2OFWA 4JT2A 3NBYC 4FD2A 2V6JA 3QEOA 1G8YA 1M74A 4QFMA 1R4AA 4IOJA 5DH9A 2Z6VA 4Q1EA 3B1XA 5F3WB 1KKLA 4MKFA 5AJWA 4IOMA 3L0PA 1T91A 3PJRA 4I1VA 4MUBA 5DE3A 1GTVA 2ZJZA 1G291 4BQSA 1JQJC 2YOHA 5E4FA 1QDEA 5J5CA 1VECA 1W0JA 1PLLA 1ZD9A 3BH7A 1UDXA 4IHQA 3EPHA 3AP1A 1XBTA 1E2NA 4N3NA 3BC1A 3KTAB 2IEZA 2R6CA 2YV5A 1DEKA 4AG6A 5JMTA 1KMQA 2A5FA 1N6HA 1XX6A 2QRNA 3WBJA 2ASEA 1RJ9A 1Z22A 4H9GA 1Z5ZA 1Z0AA 1ZIOA 2H17A 3U4QA 2GXQA 2H5EA 2NPIA 3SE0A 1XU4A 2Z5FA 4TYPA 5D3QA 2BBWA 1UKZA 3EXAA 1ZUNB 2AKAB 1UEJA 2CMKA 2PJZA 3TE6A 2V6IA 5CITA 4EPRA 1G7RA 3RAPR 1VTKA 5DSZA 2WJIA 3ZIAA 1MABB 3OFNA 2JLYA 3R9IA 1RVDA 3AVQA 4HAUA 3CIOA 3HPRA 1Y63A 3LLUA 1O87A 3MD0A 2ZR7A 4LBVA 4B32A 4BE7B 2XTNA 1NKSA 2ZPTX 1E9EA 1XEXB 4Q4HA 3R9XA 1NSTA 2F1JA 3AVOA 4IXMA 2GXAA 1G8HA 1E2IA 4JVSB 4UNPA 1Z0FA 1D9ZA 2IBMA 2JLZA 4EFLA 4OQMA 4Q4JA 3M1IA 4GOXA 1GAJA 2NZJA 5G41A 1NMZA 1UF9A 4EJSA 4JBXA 3CKLA 4Q21A 4DLZA 4B34A 1UAAA 2ZE5A 2QENA 4FINA 2E1RA 3TVDA 1RPZA 1XJ0A 3QJYA 2ODNA 4RD3A 2VSOA 1U90A 2FU5C 2J41A 2QL6A 2WKPA 5DI3A 5FFMA 1PUJA 2EU8A 2HT1A 4LI0A 1XJCA 2DWQA 4HAWA 1CR0A 5AUQA 3WY9A 4C2UA 2D7DA 1Z6XA 5E3HA 1KO1A 4M21A 1RYFA 1NG1A 3KB1A 3W5JA 1MRNA 2F1IA 5EE3A 1FUUA 2ZQ5A 5KO2A 3MRSA 3K1JA 3O8BA 3VFDA 3DL0A 1UBCA 2FWRA 4Z8XA 2ZSAA 3E1SA 1RFLA 1OH5A 4QBGB 3DM9B 2GJAA 3GJ3A 5H68A 3ZQJA 3JVVA 1VHTA 3ZDQA 3MGCA 4XWAA 2VYFA 3EZ7A 3CF2A 4KYIB 1EWQA 4GZLA 3E70C 4EQ6A 1KO8A 4X8LA 1XTJA 1IN6A 3GJ8A 4KI0A 3IEUA 3ADDA 3A1TA 1FQKA 3GJ5A 1VCOA 2OFOA 2W2TA 3PUXA 3T12A 6Q21A 1WBBA 1JR3A 3DPUA 4PO1A 5E7IA 1PUIA 2I3BA 1BMFA 1NVUQ 1XWIA 1SZPA 2ZRKA 1US8B 5SZIA 4Y0VA 1VIYA 5TARA 1OPXA 3IGFA 4PX9A 4OHZA 1GZSA 2GJ8A 1I2DA 4L5BA 4A36A 2JA1A 2XTZA 1XTKA 4IDNA 5FL3A 4DLTA 1XZQA 4QGFA 4EUNA 4LUCA 2YVUA 4R2HA 3VR1A 3U7HB 4B3BA 2O5VA 3D7MA 1KI6A 3B78A 2QUZA 2WAYA 2DBYA 4GOJA 1P4SA 4WAUA 2JLUA 2VHUA 1E2QA 2A30A 1K8RA 4XTCS 2P6NA 4OQFA 5KHOC 4JLAA 2ONKA 1NN1A 2BEKA 3T1OA 4BFUA 3VR3A 2HLDA 4QHTA 1C1YA 2GAAA 1HT1E 5JWRA 3ZH9B 4B74A 5C1BA 3Q5EA 3OIUA 5K8IA 1XPOA 3C5HA 1KDRA 1ANKA 4KXFB 1OH7A 1HT2E 1LV7A 4YXWA 3SEAA 3SJZA 1XCPA 1Q44A 3N2EA 4KSCA 1JPJA 1AQYA 3W6NA 3KXKA 5F9FA 4D25A 1Z6YA 1OJLA 2Q9AA 1R0WA 1NP6A 1SXJA 2OCBA 1EXMA 1KI3A 3RDPA 2WMOB 3U2QA 4D2IA 1KI9A 1D5CA 1NBMA 2CVFA 3MUFA 1JAIA 2QU8A 2WJJA 5JHHB 2O8CB 4EAQA 3AVYA 5LPNA 2RKOA 2WZQA 4X8HA 4JS0A 5K8LA 3BGWA 1P3JA 1W49A 4EPWA 1WDTA 2ZU0C 2BEJA 5KNDA 1FFHA 4CGZA 3T5DA 1G7TA 4MYCA 4CEJB 4PZYA 2VSFA 5FI0B 1UPTA 1VDZA 4RY2A 4WOPA 2BMEA 4QBIA 4C0SA 3LNCA 4TMVA 3WYAA 4CZ2A 2IYSA 5C2JB 2EFCB 2ZVQX 4HB0A 1KJYA 2PZGA 3KX2A 5BXQC 1AN0A 1OLOA 3QXSA 4LHWA 5CLLA 4URVR 1G5PA 4Q4LA 3NEJA 3ZD6A 3AVTA 4O2LA 5FOTA 3OEHA 2GJKA 3WBKA 4I1SA 2WTUA 4G3XA 4A2WA 2J0VA 4TLEA 4DC9A 2PH1A 1D8TA 2XB4A 4C0QC 2YWHA 2ZSEA 5JI3E 1E1QA 2GRJA 5CYPA 1UJ2A 2QTFA 2XOKD 5TB5A 4CEIA 2C99A 3NTUA 2DPXA 1RW4A 4XJXA 4ZCMA 1RRFA 3CPJB 3K0CC 4Q5IA 4L4UA 1XTQA 5CDFA 1IM2A 4HUTA 1O3YA 3WRYC 3B9PA 5L3RA 2JLSA 1RJ9B 4KBFA 2AD1A 2AHOA 3U4QB 2WMNB 1KI1A 4UXIA 4IKEA 4B6EA 1E32A 3X1YA 4A6XA 3GLIE 2WOJA 3KJEA 4RVCA 2HT6A 4O3MA 2ZJ8A 4LHVA 2D62A 4OK5A 3SU8A 4TL9A 1EGAA 521PA 4AI6A 2GXSA 4GDFA 2D4HA 1A2BA 3BXZA 1ELOA 1S3SA 1OHHD 1GNRA 4TTQA 4RKFA 5FPYA 2HYIC 5HCNA 1IY2A 1Z0KA 2BKEA 4Q4HB 1HYQA 3O47A 3FWYA 1G6HA 2JAQA 4A9AA 3B5JA 1E2EA 3F0TA 2GHIA 4Q4JB 2FG5A 1OIVA 3OE7D 5KSYA 1CF4A 1OKKA 2QAGC 1TQ2A 3P26A 3SNHA 3VQTA 4EJSB 3KXIA 3VR6A 2N1BA 2B7CA 2PZEA 2R6AA 3C16C 4Z8YA 2GF0A 5KUTA 1IY1A 3PG5A 2ONJA 5DI3B 1U98A 4PHTA 4LYHA 5FTMA 2R6FA 4MUAA 4ZKDA 1E94E 4XIGS 3LX5A 3CZQA 2REBA 5BQ5A 4AKEA 2GBLA 2OEPA 4ZCIA 3U61B 3SOPA 2DY1A 4XVUA 3VU9A 1R0YA 3I8XA 1XB2A 2FZLA 2ZE8A 5EP1A 5L3QA 1N6OA 1R6BX 4LJ8A 1AZSC 1JEDA 2XNSA 3B1VA 4PHGA 2VTKA 1I4LD 2NO1A 2FGKA 4EQ6B 3H2YA 5DIFA 1YZGA 4NE2A 4AIIA 5H1YA 1BOFA 1G7SA 4L8GA 5CM8B 5LD2C 3UKDA 2JJ8A 1S9HA 5FPSA 1KI8A 3OAAD 2HYDA 4LJYA 4LPSA 5FPHA 4DSTA 4JT4A 3AF4A 1HEIA 2C9CA 4MGYR 4NYMQ 1I4DD 1FL9A 5CYOA 3LWNA 3Q8XB 4KLZA 2C9OA 3R9WA 3L43A 4B6FA 3LFUA 1Z08A 1AKEA 2CL7X 1N6NA 2V1XA 3W3AA 4GZMA 2WWFA 3QKSA 1TQ4A 1G3UA 1P9RA 2ZRJA 4BEJA 3AF0A 3HWSA 3CPHA 2QP3A 4KLNA 2ZS9A 1KI6B 4X8MA 3VX3A 2CHVA 2QE7D 1JB1A 4IDOA 4PC3A 5LDDC 1XJQA 2V9PA 3AKDA 2ZAMA 5FTLA 1DADA 4HAZA 5HTKA 1N5KA 4OHVA 1VG0B 4M1YA 4DRZA 1SGWA 3SN6A 2OESA 1OYWA 4DZZA 4NU0A 5HE9A 2YINC 5KSZA 2OILA 4KSBA 4Q18A 1U0HC 2AWOA 3BWDD 2CHQA 1NY6A 4V0MA 4R7ZA 1NVXQ 1P75A 1JQLB 3JZAA 3K0FA 2O8FA 4B3FX 1CRQA 1M1YE 2QTVB 1SXJB 3H4MA 2FJUA 5JECA 4TWZA 4FCVA 3AF2A 2AXNA 4HI0E 2CLDX 3RABA 221PA 3I62A 1N5IA 2FSHA 2ORVA 3NC1C 4BFWA 4P4SA 5GJWC 1QZXA 2HDNB 2AXPA 1EX7A 2J7KA 3KZ1E 1VKJA 2WAXA 3NKVA 4ON9A 1R5OA 2R8RA 2WJYA 3TAUA 1XTRA 5KSPA 4MKIA 3I92A 1BO6A 4HB2A 3L2OB 4BGDA 2JLXA 2A5DA 1I2MA 3MG9A 2DFNA 1E0AA 1H8HD 2JJ1A 3AP3A 1NVVQ 5JZVA 3GJ7A 1Z0DA 2IXFA 4OK3A 4LRWA 4QOSA 5UKDA 3TAHA 4LV6A 1KK1A 5A0FA 3BFVA 1Q3HA 4MGZR 1W47A 2VP2A 2F9LA 2IK8A 3KUCA 4JKYA 2X77A 2Y8EA 1SVMA 1BIFA 1U9IC 2ZRCA 4WVFA 4A8JC 3LXRA 1NN5A 1QG4A 1OXVA 1OE0A 3KKMA 4CEIB 5K8UA 3QY0A 4M9XA 4N0EA 4P4UA 1QVAA 4UXHA 4B71A 1WQ1R 2ZRFA 3G82C 3NBXX 3OIVA 4RZ2A 1M2OB 1CIPA 2WVJA 2FEOA 1ESMA 1NJGA 4V0OA 4Q9LA 2ZRBA 4LJ5A 3T1QA 2O8EA 2CK3D 3QVVA 4BLPA 1Q0UA 5SZHB 4B3GA 4HLUC 1S1CA 1GNQA 2V7QD 1HQYE 1IY0A 2RGGA 4G5GA 4F4CA 4JLOA 4RKEA 4NCNA 1H8EA 2YC4C 2FFBA 3EZFA 3TVTA 1XMJA 3K0AA 4E09A 2P6RA 1CJUC 3IBYA 4P33A 1W4CA 3SS8A 3IIMA 1KSHA 4DJTA 5JEEA 1TQDA 1KDTA 4D0GA 2ZUCA 3DEFA 3T06B 3CO5A 3CR7A 4BRUA 2OHFA 3DDCA 4JIMA 2CHGA 2FEMA 1VYTA 4ZPXA 1J7KA 1E3MA 1ESNA 4M22A 1QHIA 1S8FA 1QVRA 3VR4A 4PPGA 3H0KA 2NO9A 3P4XA 4PTLA 4TTRA 2GJSA 4DUGA 3GLFA 1DAGA 3MJRA 3CPEA 1MV5A 4JLPA 1S2MA 1E96A 1P62B 2QBYA 3IUYA 3A1UA 2P67A 3BJIC 3PUZA 4XD7A 2WM9B 5AJYA 3W8RA 1IQPA 1ZU4A 1P2TA 1LVGA 4A0GA 2NZ8A 3DMDA 2IYXA 1OHHA 5G40A 2VHCA 3CWQA 3TR0A 2WKRA 3FTQA 4NYJQ 3WHKA 4GSYA 2ZANA 3VHXA 4NCHA 4DDVA 1CJVC 1AS0A 1IBRA 4Q1DA 4V0NA 3VU9B 1ZP6A 2IA5A 3GJ0A 1II0A 5CK4A 1W2HA 3D6TB 2F1RA 3NEYA 3PUVA 3BOSA 2AN9A 1N0WA 2JIZD 5L3QB 1PLJA 2ATXA 1DG1G 2O0JA 4ARZA 2O0KA 2LCFA 4ERNA 1KAGA 1YHNA 2G88A 2FFAA 4M1TA 4LOAA 1M7BA 3K70B 2JEOA 4M1MA 5HPYB 5HKKD 1SHKA 2NO7A 1YE8A 4Q48A 1LS1A 4M0LA 3EX7C 2R44A 3KUDA 2LKDA 5JWOA 2YKGA 4CEHA 4Q7KA 1GKIA 2ZI9A 1E9RA 4K81B 4DCTA 4ITRC 4TMXA 1YZTA 2WSSD 3LH5A 2Q6TA 4MITA 2YHSA 4TZ0A 4RCYA 3B85A 4ZIRA 4D0LB 4JYBA 3PITA 4US2R 2EWVA 3GFTA 1E0KA 1TL7C 4YMWA 4TYNA 2EYUA 3WMGA 3QKSB 4MRVA 2BCJQ 3VKHA 1OFIA 2ZJ2A 2VL7A 3FHCB 1DTSA 3KJGA 1COWA 3BERA 4KHZA 1ZUHA 4WXRA 5IK2D 3CH4B 1TMKA 4MDEA 2OAQ1 3GLHA 2ZRLA 4DLSA 1A1VA 1KNQA 3OAAA 4GMDA 1G1MA 4D80A 4DEXA 1G8GA 4M2LA 1SVOA 1F60A 2LKCA 4XSGA 2DHRA 1JR6A 2PT5A 2FZ4A 1H65A 4WZBE 2JLWA 3S1AA 3H84A 4W7SA 4FMDF 4LJ4A 4US1R 3ZVRA 4X8OA 3HU1A 4TSFD 1N6PA 3I3SR 4TL6A 2OSBA 2XZPA 4UJ3A 2XNDA 4QM7A 2NTYC 3B8HA 1G8PA 2EYQA 4L9SA 4DDUA 2O8FB 3K0FB 4E03A 4L9WA 2PEYA 2QE7A 4LC0A 2QSZA 1UFQA 4C0KA 1SKYB 4G5SA 1IN4A 2FH5B 3IPXA 3EPLA 5J4YA 2PJRA 2C78A 2ZSBA 3M6AA 3A4LA 1B23P 1U8YA 4OHWA 2GK6A 4P4TA 3FFAA 5EE1A 3A58B 4C0JA 1AIPA 1E69A 1Q1ZA 4P4SB 2IL1A 2VO1A 2JGNA 4HB4A 4HDCA 1EESA 1LFDB 4ZCLA 1ZM7A 1Q20A 2FPLA 4NYIQ 4BFVA 4DCNA 2J3EA 4QJ4A 3IKJA 3WYGA 3X2SA 5CJPA 3PFIA 3ZLJA 5GVRA 3AKYA 3GJ6A 2XX3A 3X1ZA 3EZ2A 4GOKA 1LY1A 2QT1A 4HSEA 5FL7D 3IIKA 1ZNWA 4PXAA 3THWA 3LQQA 4Q19A 3RS3A 4DSUA 1M6NA 1KK0A 1TPZA 4RZ3A 3RRMA 4OHXA 1PJRA 4BLQA 3OF5A 4MDFA 2OZEA 3LVQE 3V4RA 3P32A 3AUXA 3ND9A 1WP9A 3B82A 3LRPA 3AH8A 2J87A 3EZ9A 5E7MA 3QKUA 1OB2A 2QP4A 1X1SA 4AD8A 2ERYA 1E79A 4PC1A 2WJVA 1P7CA 1W36B 3WP1B 2PX0A 5J4KA 2R6GA 2F7SA 2HXYA 3PV0A 5B58C 2ZJYA 4US0R 2DFLA 4A0HA 1WA5A 2O8EB 4TYQA 4D4MA 3A6PC 5J4VA 2BM1A 1XMSA 2EFGA 3THOA 1AM4D 1KMHA 5EJEA 3AVVA 2ZE7A 3M0EA 1GDDA 1R2QA 4KVGA 2P65A 4MRRA 1N6RA 2P5TB 5H8WA 3K0AB 3PUWA 2Q9CA 1E2MA 3IHLA 1D6JA 3ZVNA 1IXSB 3W6PA 1ZCBA 1LNZA 2H8KA 1NJFA 1HE1C 3A36A 1Q3TA 3KJHA 4CVNA 2ZRAA 3BB3A 3EW9A 2QT0A 1P5ZB 1Z6AA 1G41A 4MGIR 3UG6A 1TTTA 3NG1A 1D2MA 1KSJA 4LPKA 3HR8A 4H1UA 2BBSA 2CK3A 4A92A 2OBNA 4FIDA 4JSTA 1B0UA 2GDJA 5GJBA 2WPDD 3GLFB 4YLGA 1CR2A 2IUUA 2JASA 2WHXA 3WP0A 4TQ9A 2IYWA 4YC7A 4OQLA 1M34E 1Z28A 4A0RA 1W7AA 2QBYB 4YMUA 2G0TA 1WRBA 2QY9A 4BFYA 1GL6A 3EC2A 3DZ8A 3BAFA 2W83A 1OXSC 3AF1A 4FMBB 1OXXK 1XTIA 2FF7A 4LHZA 3UXMA 2J46A 2IXEA 3I1FA 1G6OA 4P31A 3QSYA 1HUQA 1G5RA 1XP8A 2VQSA 1RYHA 2I1VB 1KJWA 1V43A 2ZSFA 1T8UA 2GILA 5FOUA 2WWGA 4PHFA 4B2LA 3CNNA 4Q9JA 4ARZB 5JRZA 1SVWA 1JR3E 3FMIA 3FKSD 2IYLD 3FMPB 3IQXA 2O8DA 1T0JB 1UKYA 4YMVA 4GMXA 1VHLA 4NP6A 3THXA 4CEHB 3ND8A 1MR3F 4TMWA 3BE4A 3LAWA 1CS4C 1E0SA 2OM2A 1Z2AA 2WWIA 4C0AC 5JJIA 4ZIRB 3U3KA 5G53C 5FUYA 3AV0B 3UG7A 4W9MC 3HYTA 2X2EA 1X6VA 4UJ5A 2J45A 2QMEA 2BCGY 1IHUA 3SQXA 1RRCA 4NYMR 3ZJYA 1Z0JA 1II8A 2VF8A 2YWEA 3LY5A 1AA9A 2HUPA 4WBSA 5EZ6B 2QMOA 4V0KA 1OV4A 1X8LA 3GLHB 1XEWY 2F1HA 2KI5A 3UMRA 3RYTC 2Z43A 5KTYA 1SQ5A 2RCNA 3WXMA 2GF9A 2J0QA 2QI9C 2GK7A 3IIJA 1NN3A 4ASUD 2UVQA 1ONBA 2PZFA 1NRJB 3FB4A 2IYRA 3MMPA 3S1AB 3TR5A 3VKWA 4PZZA 4Z1MA 3B1ZA 1HE8B 2XSZA 5EP3A 1SXJE 4TMKA 5EXXA 1EFCA 3OEEA 4NBSA 1KY2A 4ACBA 1E4VA 1XEWX 4QNMA 3QIAA 1E9CA 1E1RA 1NBME 1L7VC 3GEHA 1ZC3A 4K46A 1LS6A 1QHSA 2JDIA 3HU3A 5J4HA 1EFRA 4KBGA 1GRRA 3PEWA 4LCBA 4JMPA 1DAHA 3G5UA 1E9BA 1T3SA 5JJKA 1E2LA 1EWRA 1JJVA 1TEXA 2RHMA 2WBLC 2XJ4A 4TT3D 2FMXA 2L0XA 1N5JA 2Q0HA 5EZ5A 2QPOA 3KQLA 2BC9A 4QNRA 4C3ZA 3EAQA 4B3DA 2C95A 1NG9A 1V5WA 1T8TA 2F9MA 5AR1A 2UKDA 5FBRB 3AVUA 1XEFA 1KIMA 2J0UA 2ZE6A 3UPUA 2IYVA 2PCJA 3KB2A 4BEBA 4O2RA 4IW3B 1YVDA 1E99A 2Z0MA 1M8PA 4TQAA 2J1LA 2FOLA 4HAVA 2DB3A 3TNFA 3BFKA 4LBWA 5D3MA 5FUXA 3HJNA 1FOEB 4BLRA 4TLBA 3THWB 1IN5A 2X2FA 3B7GA 3E2IA 3EZ6A 2J7PD 3TJZA 2CEAA 2QP9X 1ZJ6A 4G5OA 3IDQA 1YU9A 2ZM5A 1Z06A 2G9NA 3B1YA 3H86A 4S35A 3GQBA 4JKIA 5FUVA 3SZRA 3IBGA 2XEXA 5CDFE 1WGWA 2EWWA 2ZEJA 3KFVA 4KFTA 8OHMA 1NVVR 2ZI5A 1W5TA 4C2TA 3FHTA 4U00A 4PSVA 4RJLA 2GVDC 4ESHA 2AX4A 1K5DA 2J9RA 4C0BA 4PC6A 4EDHA 1Z0IA 4PAOA 4D82A 5BN4A 1NN0A 3H1TA 1KMHB 1HH4A 1YR7A 1VG9B 2YC2C 3UK6A 3VR5A 3HDTA 2PL3A 1YRAA 4HZUA 1SVIA 3DM5A 1BH2A 2BWJA 1RZ3A 2X19A 4ESVA 2Q21A 4EPXA 2AFHE 4KITB 2ZROA 1R10A 2ZS7A 4DWJA 3FFBA 3LA6A 4BZPA 3P27A 2DWPA 3BH0A 1HV8A 3EPJA 4KCGA 4URUR 3NH6A 4ZDWA 3MAAC 1YRBA 2FN4A 1G17A 4OHYA 3GFPA 4OI0A 4TTPA 1J90A 2CNWD 2WWHA 3K0CA 2CL0X 2GWHA 5AWFC 3LBHA 4FI3C 4Q9HA 3TIFA 2BDTA 4JYCA 1XXHA 2RGDA 4FMDB 2FFQA 4RD6A 1LB1B 2QG6A 1T5IA 3RRYA 1N5LA 3L0IB 1NLFA 2YWGA 3WRXC 3EPKA 4TYYA 2OAP1 4QHYA 1E98A 4IDPA 2NIPA 5LBIA 3WMFA 1CJMA 2EFHB 5TDHA 4E5UA 3NH9A 2IS2A 1C9KA 1SKQA 4PQRA 3K09C 1X8KA 1E2KA 1NNEA 3TRFA 1NIJA 1IONA 3MWLA 1G20E 3U3MA 4A4DA 4A15A 4BFXA 2KBEA 2VP4A 2WPDA 3TLXA 1T9HA 3FVQA 4B43A 4MKHA 1WXQA 2OBMA 2W0SA 2EVWX 3U6BA 2QAGA 3D31A 4NYJR 2O8DB 3MCAA 4XTRA 4DXAA 2ZYUX 5EP2A 3RS2A 1ZNYA 4AKIA 3R20A 2J59A 4N1AA 4B48A 3C8UA 3THXB 3WNBA 4DLVA 3IPYA 3HU2A 3GJ4A 4BLOA 4EKDA 3W34A 1G3RA 2G6BA 5E7JA 5EE9A 1GOTA 3LX8A 2J0SA 3KFXA 5FBWB 3REFA 4RD1A 5A5GA 5HE8A 2LWIA 4W5WA 3KQUA 4M9ZA 3TSZA 4DCVA 4QC2A 4DBLC 2IEYA 2P5SA 2C77A 4M1OA 5JEDA 1GKUB 4G1UC 2A7QA 4IVRA 3LW8A 1X1RA 2ZRHA 3L0OA 3QXHA 5FBLB 3AGPA 1NVWQ 3K0SA 1II8B 1T0HB 1TF5A 3MWKA 1NMXA 2QM7A 4PPQA 2D2EA 4QKQA 4GI7A 1WF3A 4Z51A 1Q22A 4JVMA 3SYKA 3QXCA 721PA 5KDDA 2FNAA 2ZR0A 1AK2A 1K5GA 3N2IA 4MH0R 4URYR 5DYGA 4V0ME 2QMHA 3LD9A 1KZ7B 2ZREA 4I99A 1WBDA 4OYHA 1DAEA 2ZRNA 4F4IA 4MYTA 3P4YA 1Z63A 3BK7A 1DVRA 1G8FA 1ZMXA 5CJ2A 4G0NA 1BS1A 1SKYE 2DCUA 2UZ3A 2WICA 3TW8B 5AK0A 1N6KA 4NCKA 2X1VA 3FGNA 2Q3MA 4R2IA 3U3JA 1E9DA 4LY6A 2VH5R 5HZKA 1DAKA 3RLFA 4ZI3A 3K8YA 2IX3A 4BLTA 2ORWA 5CIWA 2AR7A 2OXCA 4LC1A 2IF0A 3RVBA 4A6PA 2D3WA 2GEVA 4J0QA 3RWOA 2BKUA 4ASUA 4QM6A 3SJCA 2OXRA 2R62A 2JJ2D 2Z4SA 3EWAA 1RRPA 4UNSA 4MYUA 4OL0A 3AQ4A 3OHMA 4NCIA 1XCGB 1UADA 2J0UB 4HZIA 3FPAA 3B9QA 3ECCA 1E0JA 2R65A 1TADA 4MKGA 1XD9A 5JJLA 1GIAA 4BFTA 3UMFA 3FOZA 1SVSA 2XB2A 3LLMA 3TW4A 5D3MB 3PR1A 1ZM3A 2FSGA 4EFMA 1W2GA 1T6NA 2A5JA 4LBYA 4V02A 5DYIA 3QEJA 2JATA 2W2VA 2ZRGA 3FMFA 2QSYA 1Z3IX 4LJ7A 4NYIR 1YKSA 2DFTA 3SR0A 5GJVC 1CXZA 4DCSA 1AGRA 5CM9C 5JI2E 3DVLA 4LYJA 4AKGA 2IS6A 5AJXA 3L82B 3TGPA 2VP6A 3NDBB 3FYHA 4LDJA 4KODA 1KOFA 4PSAA 4IFBA 4HLCA 1U81A 1X3SA 5JCZA 4LX0A 2NQ2C 1PVOA 3CLVA 1GM5A 1NKTA 4NL4H 1FQJA 4PAMA 2IHBA 2A78A 4B2PA 2OCPA 4AWXA 2AK3A 1XNJA 3EC1A 3LO5A 3TH5A 2FV8A 3UWKA 2DR3A 3KKOA 2NMVA 4LSGA 2RGNC 4HZUB 1SVKA 1UM8A 2NO6A 4H1VA 2V8OA 3ZIAD 3OFND 4BZQA 4PFSA 3JZMA 1EK0A 2MMGA 4E07A 2KSQA 1S4QA 2C9YA 4V03A 3CX7A 1G4UR 4HATA 4QJ3A 2OV2A 1U8ZA 1U9IA 1UBGA 2XOKA 4BZXA 1CULC 4A8JA 3RRZA 3ZGXA 3TQCA 3GLFE 5DLQC 4QBHA 2AK2A 2IF2A 3UANA 2OFXA 5FR1A 2V54A 4D6PA 4NCJA 2KBFA 2BMJA 3BBPA 2F6RA 1XXHB 621PA 2FDCA 3RC8A 4HLUA 4OI2A 1QHHA 1FP6A 1TNDA 4BRWA 2VHJA 1SVLA 4IFEA 5CIQA 1J8YF 3RS4A 4D4LA 4MGKR 1ODFA 4IVQA 3TKLA 2C2HA 1QHNA 3QXJA 5DISB 1MOZA 5G3ZA 2QZ4A 2MSEB 4BPBA 1UKEA 3JVUA 5LB2A 2WSMA 3C41J 3E5HA 4Z54A 5F98A 5M04A 2W6ID 3GLGA 2GZDA 3V00A 2QNRA 2W0MA 4JBWA 3RWMB 1GWNA 1AQUA 1JALA 2GNOA 1DELA 2ODWA 3CRW1 5CK5A 1OF1A 3U6KA 2ZS8A 2BJVA 2CNWA 5JS7A 4XSHA 1S0UA 4OI4A 1HY3A 4ZI2A 3CRRA 4KFUA 2D74A 2JLQA 4G5RA 4I1OA 2IYTA 4Q4AA 4Q66C 3U3OA 3OE7A 3I4LA 2ZETA 3ZVMA 2GJ9A 3SYNA 3BB4A 3TSWA 4HYYA 1DAFA 3KKQA 2QAGB 1JJ7A 2DFKB 4BASA 3DMNA 2VHTA 1GITA 3NBFA 3PEVA 4AYTA 1GL7A 4KVAA 2KJQA 3I61A 1WE2A 1F5NA 1JR3D 1R7RA 4O0MA 3F3YA 3WNCA 1A4RA 5EE0A 4FW9A 1BMFD 3QPUA 3SFVA 3OZXA 1LW7A 1LTQA 4FN5A 1HQCA 1RIFA 4W5JA 4CT5A 4R98A 4AKHA 2G1KA 4AG5A 4KV9A 2GA8A 3GLHE 4B47A 2ZITA 2BMDA 2RGCA 1XFAA 2BOVA 2PLRA 3F8TA 3THYA 3VNUA 5F2EA 4OJKA 4M1KA 3AKEA 2Q3FA 1PV4A 2ZU6A 3PENA 4FCTA 2QEQA 5LD2B 3D8BA 3REGA 2OG2A 121PA 5IRCD 4TYWA 2PX3A 3HR7A 2HLDD 2CDNA 1KO4A 4F7WA 1G64A 2A5GA 1SULA 3QOFA 2A3RA 1DS6A 5JLJA 4JLJA 3G0HA 1Z29A 2B8TA 1KGDA 2IS1A 1T4GA 4FXPA 4C30A 3GJXC 4YXWD 4LWZA 1NLYA 2VBCA 3I8SA 1G18A 1TUIA 3LV8A 3N5CA 5DNYB 4PC2A 3RSOA 2X8AA 3A4MA 4TN1A 3EIHA 2HV8A 2YYZA 4C7OA 1D9XA 5C46F 3VAAA 1SXJD 4K8OA 1XRJA 4LJAA 1G16A 3HP1A 1N6LA 4DLWA 1OH8A 1NIPA 4OQXA 3W3ZB 3SBDA 3I32A 2ZYVX 4YMSA 2FSIA 4XWOA 2K5UA 4KFSA 4TMZA 5TXGA 1NBMD 2B6HA 1W0KD 2Z83A 5EQTA 1OH6A 3PCRB 2VIIA 1D2EA 3KQNA 2G1JA 1CLUA 1Q12A 3QVUA 4M1WA 5EXTA 5F9HA 1OIXA 3ZZ0A 3Q9LA 5HR5A 1T3LA 1EFHA 1S9DA 4M9SA 4Q7JB 4HDQB 3TQFA 3RS0A 4JL8A 1ZC4A 3SDZA 1ZIPA 4GL2A 1UKVY 4LGMA 2QM8A 1PZNA 1QG2A 4WZ6A 2ZI3A 3A1WA 3CW2A 5BN3A 1ZNXA 3D3QA 4Q1CA 3OEHD 4XWKA 5C18A 5GVSA 4D4KA 1KAOA 1F2UA 2PMDA 2RGXA 2C98A 4JLMA 4ZDIA 5TVKA 1MO4A 4DB2A 3X1DA 4C9BA 3T1TA 4LJ6A 5FOXA 2IXGA 4YDSA 3HPQA 4CIDA 2HF8A 3NXSA 1NF3A 1OFHA 3AGQA 4OKSA 1KHTA 1JECA 4O25A 4DT1A 3AUYA 2A2ZA 3P1JA 3W6OA 4DLUA 1L8QA 1T5LA 3CH5A 421PA 4ACAA 1OSNA 3RSLA 4C0HA 4PSKA 1FMJA 1CJTC 5JRJA 2E87A 1H8HA 2JLRA 3LXXA 1Q57A 2D7CA 3NC0C 3MSXA 3LVRE 2WJHA 3EWSA 2REXB 2IWRA 5C4MA 1UDWA 5CLQA 3C7KA 4TLCA 5B30A 2C5LA 4DIDA 3RHFA 3WYFA 1NMYA 1XCMA 1EFTA 2UZIR 4CW7A 1GILA 2V4ZA 2YJTD 1KSGA 4PO9A 2OLJA 1QBKC 4MA4A 3SJAA 4JBYA 5GJCA 4F91B 2XTMA 1R8SA 3TUZC 1AKYA 2FGJA 2QA5A 1VIAA 4NH0A 3QG1A 4POAA 4PAQA 4A8JB 1XZPA 5ANRB 5HZHA 3O8CA 2N42A 1CJKC 2RB4A 5HCIA 1CEEA 3KL4A 1ZVQA 5IHPA 1OIWA 2B92A 2P2LA 4M9QA 1G9XA 4EJSC 2FE4A 2ODBA 4DLYA 1IJFA 2BBOA 1OKKD 1II9A 1MRSA 1KI4A 1N25A 2V7QA 2AL7A 1OT3A 4ILEA 3R8CA 4D0NA 1JNYA 1QHHB 1P60A 3KQKA 3OESA 2G77B 3HYRA 4NTZA 4F92B 1QHXA 2ZTSA 2CL6X 2O8BA 3NHBA 1HURA 4RFSA 2VRWA 3A8TA 3DKPA 3Q72A 5JBQA 3BRWD 1NLZA 1OYYA 3CBQA 3U5ZB 5L3VA 2HEIA 4KO8A 1T3HA 3GLGB 2R2AA 3L8YA 1TX4B 4BWYA 3LQRA 2ZSDA 1EX6A 3N70A 1A7JA 3BFXA 4DKXA 2WWWA 1QHYA 4Q9IA 4YQFA 2EQBA 5DO9A 3WNDA 3VTKA 1GVNB 4IRUB 3VKGA 3PUYA 4Q1BA 1CP2A 2O0HA 4XVQA 4Q4AB 1LF5A 1IJEA 4FMCF 2B7BA 1G7CA 2WWYA 1XPUA 3CRQA 2ANCA 3K53A 4JLVA 5EUMA 3TK1A 3FKQA 4D81A 1DOAA 3K70D 2VP5A 2QROA 5EXSA 2W2XA 1R0XA 2ZRIA 2A9KA 2P0EA 3QKRA 4FWTA 2ZIAA 3GFOA 3DOEA 1S1MA 1WCV1 2R9VA 1DO0A 1VYUA 4AYXA 1E2GA 2GCOA 1XMVA 3M4YA 4JLDA 5CB8A 1MH1A 4KJZA 4MRNA 2W6IA 1CKEA 3QPVA 4IJMA 3VR2A 2JLVA 1LF0A 2QQEA 3L8ZA 3QF7A 1L4UA 3KKNA 2OO7A 2C04A 1KK2A 5J47A 1YJ5A 2CJWA 1GNPA 4DLRA 2F55A 1GP2A 3T1VA 2V3CC 1FP7A 5B57C 2JIZA 4IXNA 3V4FA 1NSFA 3EASA 2OE2A 3BD9A 3NIBA 3BIFA 4IEIA 1BKDR 5HKKA 4B35A 1DPFA 5P21A 4OI1A 4QBFA 3THYB 4GP7A 4BECA 1OB5A 4YMTA 2ERXA 2ZJOA 4TLAA 4AYWA 3QBVA 3QPWA 2GESA 1UBEA 1ZU5A 4JJZA 4JJKA 2WSSA 4QXAA 2CLCX 4JSYA 5KPDA 2FSFA 3CX8A 4DDTA 3AEZA 4BLSA 2W6JD 5JHGB 5SZKB 1W4BA 5L3SA 5J4LA 1M7HA 5E95A 1S96A 4I1UA 2CCGA 2ZYTX 4NHOA 1QHGA 1SXJC 2GXUA 1GKYA 2VLIA 2OCYC 4U7DA 4ZV4A 4C7OB 2JCSA 4JVNA 1P6XA 3B2EA 1BYUA 1AS3A 5ELXA 2H57A 3C5CA 5IK2A 3NDPA 5FPKA 1ZBDA 1JI0A 1I4TD 2YZ2A 2ZAOA 3DO6A 3W90A 5AUPB 1MKYA 3AB3A 3RC3A 5FOWA 4YDHB 1GRQA 5DN6D 1Q21A 1YZNA 1ZNZA 2XXAA 2WV9A 1U99A 1CU1A 5IT5A 1RRGA 1VCNA 3QXXA 3Q7PA 4Q1FA 1G3MA 1XF9A 1G4AE 3CNLA 4AC9A 2XAUA 1VPLA 1ZD8A 5EUQB 5KU1A 2QPAA 2ZUDA 4LHXA 1FW6A 4TSFA 4DCUA 3PQCA 5BN5A 2YNMA 4B3CA 3ADKA 5KNBA 2XITA 1DAMA 1P73A 1R8QA 2WOOA 2ZRMA 4IDQA 4UKDA 2JJ1D 3IO3A 3SHFA 3ZD7A 2WWXA 4XOIA 3B1WA 3W9YA 2XZLA 1YR8A 3WHLA 1W0KA 4B76A 5SZJA 1KK3A 1Q1QA 1KDOA 1TU3A 1P9NA 1ZYUA 2TMKA 4R71A 3A1VA 5JSZA 3U44A 4N0DA 2NO0A 1F2UB 4HAYA 1DBSA 4WW0A 4JL6A 3MWYW 3VNVA 3CNOA 4QGHA 2VP9A 2D06A 1XD2A 3EARA 1YZUA 2F3TA 1OXUA 4P0TA 4IDHA 4KAXA 3QBTA 2BVNA 2G0NA 3UIEA 1VG8A 4DT1B 3PVSA 5G3YA 1W36D 2NOAA 3F5FA 3TUIC 3GEIA 3QI2A 4D4JA 5FL7A 4QRHA 1VCMA 1E9SA 1ZM9A 1J2JA 4DSNA 4C4PA 2AKYA 5GADl 1P61B 4GT1A 2W58A 3CF0A 1E2HA 2H92A 5FBVB 1U0LA 1C4OA 1K6MA 3TUJC 3IEVA 4CDGA 1XTSA 2OUKA 3GD7A 1JEEA 4RSGA 1H8ED 3FHOA 4NKRA 1KJZA 3MJHA 3QQ5A 3SFZA 2WJGA 1JPNA 1J8MF 1KYIA 4UQOA 3PEYA 1A2KC 2IHYA 1OW3B 1YQTA 4RD0A 3IHWA 2I4IA 1D2NA 3A4NA 5BYKA 4RZXA 2BHRA 2GEUA 1XXHE 2OBLA 2NG1A 4EFNA 5KDLA 4F93B 5DHAA 1OFTA 1UEIA 2OLKA 2VF7A 2Q3HA 1U0JA 2BBTA 3CRMA 2H18A 2YWFA 4DUGD 1F48A 4DVGA 1R5BA 4R9UC 4EPYA 4FWIB 2CE2X 2ECKA 4WXPA 1VMAA 1AS2A 1SHZA 4XD7D 3FMOB 4NDZA 2XZOA 5FTJA 1KI2A 4F4JA 4AK9A 3X1WA 1XMIA 2E9SA 2PEZA 4HEJA 3ZZTA 2O8BB 4CRWB 1ZINA 4RFSB 2GBLC 2IT1A 2CVHA 4MQBA 1GG2A 3GLIA 1JXMA 2CE7A 2F43A 4L15A 2RMKA 3W8NA 2CBZA 4QG7A 4Q01A 4F38A 5KPJA 3RS7A 1FNNA 4JVLA 4Q03A 1W4RA 4DB4A 2CXXA 2ZUBA 5AJVB 4E22A 2HJGA 5J40A 4II7A 3K70C 5FPTA 1IN8A 1Z07A 2AWNA 2W00A 2IYQA 3AP2A 1Z2CA 4Q02A 4B2IA 2FPKA 1YZLA 2BIFA 3QKRB 5DI9A 1P9WA 1N3BA 1E9FA 3C15C 1RC8A 5C4GB 4UXJA 1Q1BA 1RKBA 1W46A 4KU4A 5KYKA 3RANA 2GCOB 4Q47A 1Z8FA 3WMEA 1L4YA 3L0SA 1P2VA 1TF7A 4PO8A 1X8JA 1FX0A 3DKVA 4URZR 1PLKA 3AF3A 3K09A 3ADCA 5FH9A 2QMUA 4XVRA 2CJWB 2QRZA 1MO5A 4G5QA 4HUQA 4ABYA 5TY0A 2XGJA 2RGEA 1GSIA 4PPNA 2RGBA 2VHQA 3KKPA 3OIWA 2RHDA 4MRPA 1COWD 3ETLA 1DO2A 1W48A 4PQFA 3CX6A 2KB0A 3FKSA 3R7WA 1FMLA 1ZCAA 4BUJA 1XDBA 4WIAA 5FOVA 3A37A 1UBFA 2BMFA 5A4JA 2ZRPA 3MWJA 3PEUA 2ORIA 4Y0AA 4EPTA 1KO7A 1KNXA 4M8NE 2QORA 4CYMA 3ICQB 2QN6A 1VYVA 3Q7QA 3NBZC 2H7VA 5JS8A 2NPFA 3FDIA 3B60A 3ADBA 1TEVA 4PR0A 5IDVA 2FPMA 4Q7MB 2C8VA 1E2JA 2BJWA 5K8TA 5L3SB 2VA8A 1CTQA 3I5XA 2P6UA 2SHKA 4TLDA 3ZVLA 4PANA 2EW1A 5FR2A 2EFDB 1ZUIA 2XNDD 4TZ6A 2BV3A 3CM0A 1TU4A 1A5TA 1P2UA 1Z83A 3RS5A 4I4LA 1F2TA 1DAIA 1Q1EA 4RD4A 4HAXA 1TUEA 4Q7LA 2IYYA 1ZRHA 3J81k 2AD5A 4UNRA 4A0FA 3KQHA 4DEYA 2XXAB 1EFUA 2C96A 2J5XA 2W6JA 1Z6TA 3CONA 1JXOA 4P32A 5KNCA 1P2SA 1ZD1A 4LV8B 1FTNA 3TSOA 2HJVA 3V9PA 2WIAA 4U5XA 3ZS9A 3GP8A 1VCIA 2ZJAA 2GAOA 1CR4A 2HF9A 3TMKA 2QGNA 1Y3AA 2F3RA 2ZI4A 3K0EA 2OT3B 3LDAA 4A82A 2MSDB 3EA5A 3QENA 1MT0A 3NHAA 3ASYA 2KWIA 1G19A 4JLBA 4LZZA 1HTWA 2N46A 4AURA 5BYJA 3QF4A 4M1SA 5DN6A 1G3IA 3SQWA 1E4YA 2GVZC 4TT3A 4TL7A 1A82A 5JSZB 1DG3A 2IW3A 3U44B 4EIWA 3BB1A 4FMCB 2QPTA 2FFHA 4QHSA 4DLXA 5DGXA 1XD2B 1Z6GA 1E6CA 2ZRDA 4IOLA 2R6DA 4GRAA 3SC3A 3SHWA 2ZXUA 3EA0A 1W36C 2RGAA 1W0JD 1E2FA 1E79D 1VG1A 4AY2A 4IOKA 1NI3A 4L16A 1AGPA 2FA9A 1AZTA 2VSXA 3MFYA 4HB3A 1W1WA 3T5GA 5TMPA 2G3YA 1DARA 4OBEA 5JCPA 4QJ5A 2Q9BA 5TV2A 3O8DA 4HLQB 1CR1A 4QL3A 2PBRA 2J7PA 3B13B 3IQWA 5EXPA 3P20A 3ZZUA 2IWHA 2ZI6A 3U3RA 3T35A 4GBMA 4UNQA 4JLKA 2ZVPX 2QQ0A 4OK6A 4PZLA 4LHYA 3QUSA 4RD2A 4RCZA 3A1SA 1DE0A 2V55B 5KOYA 1F6BA 1OFUX 1OXTA 5L8VA 4ZKEA 5FI1B 4LK2A 4V0LA 2PT7A 2IYUA 1J70A 5FTNA 3I5YA 3GMTA 1KSFX 3K9LA 4A2QA 2VP0A 1G21E 1Z47A 2BM0A 2GKSA 1IAQA 3KTAA 2G83A 1R5NA 3K9GA 3KDSE 2GETA 3SYLA 4LYAA 1U94A 2IS4A 1HA3A 3KXLA 4BFZA 1KTVA 3BORA 2HXSA 3UATA 2FX3A 2ZJ5A 3CUEF 4B73A 4CT4B 3X1XA 4G01B 4NZYA 1ETUA 3QE0A 3U7GA 4UNNA 1JAHA 3I73A 3GLGE 2GTPA 3AKCA 821PA 1GUAA 2RGNA 2AFIE 3ONWA 1MABA 3ASZA 3QG5A 4JLNA 2CLSA 2H16A 1FNMA 4GFDA 3PIRA 4PC7A 4GPTA 4QGGA 2ZR9A 3DHWC 5CB6A 3GLIB 1FZQA 2F43B 1XEXA 2Z4RA 3T15A 4DDWA 4ZDJA 5H70A 4DHEA 1IXRC 3AVWA 4WZAE 4FCWA 2KE5A 3K9NA 4PPFA 1IOZA 2QTHA 1FPMA 3NVAA 5AJZA 2C03A 5BW8A 1NY5A 3CRVA 3NWJA 2YOFA 2GCPA 2XJ9A 3DOFA 4WA7A 2QAJA 4IVPA 4PQYA 4A1FA 3SBEA 1KO5A 1FTSA 1F3OA 1N2CE 4I81A 3ZS8A 1P72A 1W44A 3ZQ6A 2RAPA 1CRPA 3QNUA 3FE2A 3K9HA 4KFRA 5LB4A 1ZM2A 2CCJA 2H1LA 5EP4A 2IYZA 1YZQA 3SJBA 5B2ZA 2OCAA 1GFIA 1FX0B 5JWHA 5IF9A 1W5SA 1WMSA 1X86B 3ZYCA 2DWOA 2WKQA 4LJ9A 3B6EA 4URXR 4HUQB 4CF7A 4IEEA 2D2FA 1G5TA 1TAGA 4HLDA 1KZGB 3KJIA 3AVPA 1IXZA 4DSOA 1XPRA 2O52A 3AVXA 5AUNB 3GEEA 3I72A 4P3YA 4GNKA 3BS4A 3R8FA 2I1QA 2ZYWX 3R7WB 4RZUA 1N0UA 3ICEA 3TBKA 1L2TA 3U7FB 1U2RA 1E2PA 3Q3JB 5AUOB 3U7EB 1YZKA 3MLEA 2EFEB 4MYHA 4JL5A 4NPHA 4QGAA 1G3QA 4B33A 1MO3A 1R0ZA 2HCBA 1YR6A 1GRNA 1MO6A 2P3SA 3GCGA 1US8A 3IO5A 4M4SA 1CBUA 4B75A 1AJEA 4NMMA 5JFGA 4Z1MD 2GZHA 1M7GA 2XSZD 1QF9A 2VEDA 1NL3A 3CZPA 4A2PA 1EG7A 3OEED 1TF2A 4XH9B 5DHFA 1ZAKA 4W5HA 3T34A 2GZAA 4Q9KA 1KY3A 1YR9A 3GPLA 1E1RD 3DZDA 1U8AA 1W4AA 4TL8A 4S2EA 5FTKA 3C14C 3RNLA 2JDID 2WIBA 1EFRD 2RH5A 1J99A 1F2TB 3QKTA 2B8WA 3PXGA 1RE0A 2YOGA 4LBZA 2REOA 4YONB 2QGZA 2VPPA 2ANBA 1WB9A 1KI7A 3LBIA 3T61A 2ATVA 4OJQA 4RFVA 3RRNA 3O8RA 3BH6A 3VX4A 4MRSA 4NONA 2V1UA 4URWR 2B21A 3CWZA 4D26A 2A5YB 1IN7A 1N0VC 3UMSA 4HDOB 3Q5DA 4ZO4A
chains in the Genus database with same CATH superfamily
2O9XA 5LYJB 5FD8A 4X85A 2OO5A 4OREX 1DX9A 4PWYA 4OFZA 4JB0A 3ZNQA 3LW7A 1NRWA 4UARA 1V3QE 2NPUA 2X7HA 4OMUA 4R7TA 4CL2A 5FOSA 4D9FA 5KDOA 1RBQA 2NSJA 1B14A 4CEJA 2YN2A 1TCBA 2IHNA 4ZYTA 4UM5A 3NBYC 3QEOA 3ZDCA 1GGEA 4CR6A 1T91A 5HKBA 4O4HA 1G291 2F90A 1XMPA 1GNVA 2VHWA 1VECA 2PFGA 1ZJJA 1TT5B 4MR9B 2IUYA 2A5FA 1L1RA 1XX6A 1L5NA 1RHJA 3F7OA 1Z5ZA 1JVNA 1Y6QA 4MVJP 1P1KA 4CS9C 1R4NA 5B1EA 1ZUNB 2FKAA 2HMVA 1L5HA 4TV8B 3K0KA 4WFIA 4TKZA 3MD0A 2B9EA 2ZPTX 4JP3A 2XA9A 2PUBA 2F1JA 1ZGAA 3FCOA 1D9ZA 4OQMA 1W2WB 1T5BA 4X44A 2IU6A 1JNXX 4KRGA 4JBXA 1XZEA 2ZE5A 1TMGE 2QTCA 3AI7A 5LCXA 4XPXA 5LIRA 2K6GA 3FNEA 3E9EA 1RFLA 3IKVA 1UPAA 3KEQA 1GS9A 5EN4A 2YIVX 1RU3A 4KL8S 1MMNA 5JATA 3KE9A 5JCJD 5E9AA 5DIZA 5K2OA 3D54D 3NBMA 2WQZA 2IEAA 3TOCA 3CB2A 1EFVA 2EKDA 5LWHA 2OL4A 4B09A 1QLJA 3OP1A 1JIIA 5FAXA 3IODA 4LRSB 1CJSA 2QT9A 1L1FA 3AF5A 2BEKA 3VR3A 3RFCA 3Q5EA 2JFQA 2XDWA 3NXKA 2BDUA 3HTKC 2YWXA 1LSJA 4ZCQA 1SBHA 3W6NA 4TRMA 4D25A 3WWDA 2YLDA 1JPVA 1R0WA 3TX6A 1RC0A 3VC2A 1X1AA 3A6LA 4ZAZA 5ENVA 1NBMA 3FCAA 1JAIA 4YP9A 2O8CB 3CXRA 3QITA 3D7KA 1IK6A 1YJQA 3CG0A 5GM2A 4WOPA 4QBIA 1CW2B 4K9KA 2PZGA 1C1XB 3I9JA 3FWNA 2YHAA 3GJTA 1KH3A 2XB4A 2ZSEA 3FN4A 1ABEA 4MJLA 4ZZ1A 3RJMA 4CEIA 5F1KA 5ALFA 3FMGA 3K0CC 3GW8A 2JIOA 1PG0A 3B9PA 2O8VA 3TQHA 5GV8A 4TVBA 3W6ZA 3UT6A 2O3JA 5IH3A 1NXQA 3OZSA 4CT0A 3CNBA 1ORHA 5D84A 3OT4A 1QYVA 2B9VA 1DT3A 3GFGA 3GY0A 4FWVA 2AN5A 5D5HA 2PKCA 3P26A 4ZYXA 2IZ6A 1PF7E 4KYVA 3PD0A 4K9PA 4MUAA 1D4OA 1GGFA 2FPRA 4ZCIA 4RHUA 5JROA 2IEIA 3F5SA 1EB8A 4BC0A 4HX2A 1R9GA 4EQ6B 3A9SA 3PS9A 3LLVA 1YS4A 3TO5A 1HLDA 3GB9A 3LFUA 1AKEA 5I7WA 2ST1A 4B6SA 3GF4A 4GZMA 4YJ3F 3A2MA 2XY4A 1L5LA 1X7ZB 3GLKA 2ZAMA 3V48A 3KMIA 3EQZA 3VXKA 4TXLA 3BJMA 1RWWA 3GCWA 4DZZA 4Z9BA 5KTOA 2JAXA 1CRQA 1U3TA 3I6YA 1H4TA 4BTVA 4DV2B 2PX8A 1M2FA 4WINA 2XHEA 2WDPA 3ZTYA 3M5WA 2PXCA 3V80A 1U6JA 1R5OA 4FD3A 3AUJB 1ZRSA 3JRWA 1RSZA 3ICPA 4LSZA 1Y8QB 1P19A 3C39A 3WLEA 4LRWA 1FR0A 2P6PA 4LV6A 1KK1A 5A0FA 2C2XA 3BFVA 1MP0A 3NIDB 3TTTA 1UK7A 3IALA 3CHYA 1L7MA 3MHPA 4LJ5A 2WFAA 5CI9A 1QF6A 4HF7A 4AF8A 5SZHB 1HQYE 4JLOA 1PEDA 1ACJA 3JWHA 1JLLA 1EPUA 3ROGA 3QLTA 1SOUA 1DAGA 2WUDA 4FOOA 4ZOLA 4C3UA 4KO3S 1WQ4A 2ZXOA 5G40A 4WNYA 3RF3A 3KKKA 4I3MA 1CJVC 4NZNA 2OBYA 5CK4A 3E53A 4NS1A 4D74A 2O3QA 3MLAA 1LS1A 4FE4A 3R0QA 1TI7A 3TMYA 2AJDA 3EIFA 2ZI9A 2VDJA 3LY7A 3GFTA 3LYLA 4F2GA 4TYNA 2EL9A 4RD9A 1RE1A 1ICEA 1COWA 1VKRA 4PYJA 1R3UA 3IUBA 2YBDA 1PFVA 4P36A 3IQ6A 4XQ0A 1ULHA 4INPA 5DWDA 3LDUA 3L7AA 5KOJB 4EW6A 1NW5A 1L1EA 4I4NA 3QMMA 4IHJB 1S7CA 1GAQA 3LNRA 2C78A 1DQZA 3DE2X 1OCCC 4HYQA 1QIDA 3WYGA 3X2SA 5CJPA 2F8SA 2AB0A 4LXIA 4FGKA 4U7JA 1EUZA 3GG2A 1E8DA 4WVLA 3GUHA 3HVJA 2Q2NA 5TQ2B 3LRPA 3U7QA 1LRJA 2F3SA 2J87A 4TWRA 2QJOA 4R3UC 2XLHA 2BM1A 4FEGA 4R1QA 4UCFA 4IKPA 1A97A 1R2QA 1C9DB 1IXSB 5DZSA 1URPA 2BE5F 5CDHA 2G70A 5IVKA 1B0ZA 4BCBA 4JYMA 1XRLA 2QM0A 1UZMA 2OBNA 4FIDA 1PD0A 1PBTA 5EQDA 4W4TA 2RK3A 4E2ZA 2IUUA 2JASA 4RQTA 4DJFC 1ZR4A 4PLYA 5FNZA 1WOYA 3PNSA 1YK1A 4ZV7A 1HG1A 1HUQA 3VC3A 2IU3A 3NV9A 2D5CA 1UPUA 4KQMA 4DA6A 3CNNA 1PG5A 4JI1B 3PQFA 3TQOA 4GMXA 4NP6A 1PAUA 2HIAA 3L18A 1XZIA 2XUAA 5GTDA 1IXKA 3S27A 2Q41A 5G53C 5KTPA 3GELA 4RL4A 3MQ2A 3NS7A 2BEWA 1DEAA 3DL2A 4LERA 4DADA 5ECGC 3MMPA 4JB8A 1RC1A 3VKWA 2XSZA 3LI2A 1YVIA 2HF2A 2D5LA 3UYKA 4OAOA 1GGJA 1DFGA 1NBME 2ZJ6A 1MJGM 1QHSA 1UJ4A 3O83A 3L6OO 2XJ4A 4NMWA 4I9GA 2YDYA 3ZV4A 3TCXB 1B7GO 5JAIA 2EEZA 4OQ4A 3MCVA 1YVDA 3QFTA 1ZN2A 3EQLF 3GA0A 3TXXA 2IY7A 4MQ6A 4L51A 4BO3A 1MV8A 4E4RA 2FW1A 3GJQA 3H86A 1V45E 1BRMA 5FUVA 3SZRA 3UT5A 3DEIA 2Q9UA 4N3GA 5DLDA 4ZHSA 3DZKA 2A4KA 4R41A 4YEDA 2UUCB 1QO9A 4CMBA 4N54A 3I42A 4EGSA 4Z7OB 4V3CA 4UDNA 4Y2JA 4IINA 5JZOA 1CY8A 3KXDA 4IIXA 4OI0A 4TROA 5HOQA 2R66A 2BDTA 3WRYA 3S84A 2FEKA 4KAJA 3O3OB 2YWGA 4TYYA 4EBBA 3NH9A 1F6DA 3K5WA 1ULBA 2A6EF 4XPIB 1PQ4A 5LQCA 3MYIA 2BZ1A 1NONA 3ZW8A 3D31A 3R4CA 3BK1A 2D6FA 1FTQA 3KQVA 1R6UA 1LUAA 4RULA 5FBWB 5HA5A 5HRAA 1YMUA 3GRCA 3JQ7B 1EGMB 5E6SA 4G1UC 4M0FA 3RVDA 1GQAA 5DQZA 1G5QA 1IWPB 3WYCA 2AUMA 3TEJA 3GFBA 1J9GA 4JX8A 2ZR0A 1JDJA 3ZWCA 2BFBB 4DOZA 2ZREA 3JYPA 3BK7A 4B2YA 4TKUA 1Z25A 1G4WR 3U3JA 5BQPA 1E85A 1Y1SA 3OZFA 1M10A 3K8YA 4C3DA 3SXJA 3STXA 5CIWA 5IYZF 3RVBA 4A6PA 1M8KA 4QM6A 3ZCSA 5EERA 5CT5A 3INRA 4QLOA 3EPPA 1XCGB 4G97A 5ILQA 3ECCA 4B4DA 1CIVA 3UMFA 2XB2A 4IWNA 1ZM3A 1WG8A 1T6NA 2JEZA 2XLBA 3OJCA 3PR3A 2ZRGA 5IAGA 2J3MA 2Z6UA 2QW1A 3FYHA 1KOFA 3T7IA 4PSAA 1ZXXA 4JCOA 4NBNA 4TXMA 4Q16A 4YI5A 5TMDA 2G67A 4PAMA 3AMVA 3ZXYA 1FC0A 2BKLA 3L0BA 2FV8A 2DKFA 4CKZA 4BZQA 4E07A 4IO0A 4QJ3A 2W2NA 5AM4A 2OV3A 3RRZA 3GLTA 1WDWB 2FQXA 3AR3A 1FXSA 5BWOA 1X7XB 1LRKA 4NCAA 4DXWA 1ECCA 3EUFA 5IARA 1FP6A 4N6CA 5AKLA 4DGQA 5AOVA 1NU7D 1HE5A 2W4QA 5AHOA 1C1HA 4KO4S 4PNHA 2CLMB 3RWMB 5DGDA 2RHWA 4P5PA 1JSXA 1OF1A 4CI0B 2BE9A 4Q4AA 3DNFA 4KLAA 5CNJA 4ZQIA 1DRKA 3SEOA 3F3YA 5G0UA 3H5RA 4UDOA 3OZXA 1RIFA 5JD4A 4Z3OA 4AG5A 1YMVA 1QP8A 2VTBA 2BMDA 4ETWA 4DV4B 3K15A 1GCOA 3PFKA 2V0GA 4D8WA 3IDZA 5KI6A 3KELA 3D8BA 3TCNA 2OY0A 3F74A 4DC1A 1BC5A 3BKXA 2A3RA 1T6QA 4M8IA 4QUBA 1QP7A 1L4KA 3K8ZA 5ESWA 1QDUA 2L6FA 2AUTA 2VNAA 2BGWA 2O4CA 2HMAA 4DLWA 2QTLA 1QHFA 4D7AA 4ZVUA 3HKKA 3AHEA 2AUNA 4TN5A 2M6SA 1L4BA 5JCXA 3GAZA 3G5TA 1CLUA 4FFBA 3C3AA 4Y2UA 1S2DA 1C9YA 4XLNF 1SWWA 1UKVY 2O57A 3HB9A 1QQTA 4WZ6A 4BB0A 1M2KA 3RKSA 4JI2B 4DLKA 2X1LA 5DBEX 1D4FA 5GVSA 1COZA 2CZCA 4P86A 4C9BA 3HSSA 2VNKA 1X7HA 3NXSA 2PS9A 4O25A 3LVFO 5FWAA 3KU4A 3FWKA 1EIWA 3WQSB 1TVKA 3UJCA 5H5JA 4MPTA 1DBRA 3H9UA 3NC0C 1DAOA 5CA0B 5KNLA 1PN3A 4DIDA 4AZWA 2VZ0A 3I9OA 1WAMA 1M73E 2XTMA 3TUZC 1BU8A 3KVOA 4BWVA 1UKAA 2GKGA 1CEEA 2QLMA 1PVDA 4HDKB 3S7ZA 1N25A 3JQBC 4F11A 4YRMA 4FYYA 2ODPA 1YAHA 5DGTA 3BWCA 3L8YA 3PZBA 4QECA 4J9VA 4YRRA 4E1AA 4IRUB 3UZUA 3CRQA 1YR2A 1QKKA 5B55A 1U2QA 1XZ8A 3RUHA 2ZIAA 1MTZA 3X2FA 3I6QA 5CA1A 3A2NA 5B4TA 3RTAA 3RYCA 1DOWA 1I33A 1KK2A 5B3AA 3RK0A 1T6ZA 4EGJA 1DPFA 3THYB 2Z3WA 2B5OA 2POQX 3E35A 1HT0A 5FYDA 1KPGA 5K0FA 4DAOA 3WLMA 5AVYA 3U62A 3CX8A 1V8BA 4BLSA 5I45A 4MV9A 3BMQB 4X1IB 2R8YA 1I2ZA 4BKQA 2OCYC 3IAM1 2AH5A 4LKOA 3W90A 3FR8A 3G0GA 5DN6D 1LLCA 2DVMA 3ZKAA 4MW0A 5B58T 4ISCA 3H19A 3JQ6A 1N3IA 2PHZA 1Z4NA 4KXLA 3ZV7A 5CB0A 1T9CA 3W9YA 4LDAA 4XUEA 4R71A 4X63A 5JSZA 2HIGA 1R4MA 3GQVA 3EQ9A 3T6BA 4G0UA 1QYWA 3MS7A 3GJYA 3OY7A 3MLGA 2XT0A 1FXWF 4C3OB 1E5DA 4MR8A 5GADl 1U0LA 1KJZA 4GLLA 3C4VA 3IV9A 2QNBA 5AKIA 4A23A 3R3ZA 1ZY2A 5KDLA 1B42A 3HP7A 4J32B 1Z6PA 3L49A 1XTZA 4MUNA 3OE5A 1SUAA 5AW1A 4D9BA 4DY6A 2DHQA 2VRNA 2GBLC 4EMUA 5MN4A 3DWWA 5DP2A 5J63A 2F43A 2IE8A 1EVYA 5ALSA 3EGXB 4M49A 1D7OA 2CWWA 1DIAA 5FPTA 2R7QA 2Y77A 5C4GB 3C7DB 2Q6OA 1JV2B 4WY8A 1ZUD1 4QTZA 1P8JA 3HKDA 5FH9A 5TY0A 4HCJA 2MU1A 3KKPA 3I9MA 1H2ZA 3R7WA 3CZ9A 2ZSHA 1QK4A 5FOVA 3STVA 4YP0A 4WERA 2XIQA 3Q7QA 4C1BA 3HJUA 1UOQA 3CE6A 2VA8A 1YZFA 5D91A 3W4YA 4KBYA 3LBAA 3L1HA 1U0TA 4BNMA 2VYVA 1CGNA 3ISVA 4Q7LA 5KHLB 1E61A 3PU6A 4NJMA 4DEYA 1ZHWA 4YUWA 2C96A 4ZOCA 4LV8B 1O6GA 1A04A 1EDOA 2I71A 5TLSA 4DNOA 3ZNPA 5I9TA 3KHSA 3K0EA 3LDAA 4OGGA 4MWOA 4TKMA 3L41A 4ALJA 4HG2A 5EKSA 3SQWA 3E05A 5K7SA 1DIOB 2H2AA 3QI7A 3TLEA 1E6CA 4LDPA 4J30B 2ZXUA 5LP6B 3QMKA 3G2PA 1V95A 1CRZA 2O1XA 3LSYA 4CM9D 3A6GA 1X0XA 3CCCA 3L7DA 4ZAWA 3JTMA 4RKQA 5EXPA 1LSOA 2XMRA 5IM4F 1JFFB 2BSAA 2WT8A 2QUKA 3KNZA 2FFJA 1DEOA 3TPCA 1CQXA 2W9YA 1NQVA 4IDFA 4BFZA 1A5AB 2IRWA 1XRQA 3G79A 5COAA 1KE1A 2YW9A 3F7NA 4N4AA 4X7MA 3TL3A 2OGUA 1JG2A 3NFRA 3P97A 4PFOA 1PHPA 2YMLA 1ZK4A 3U80A 5K3DA 1IXRC 1ES9A 4WDQA 1J7JA 3FNHA 3MK31 2FN3A 3TNDA 1HDIA 5BW8A 2XJ9A 4CM8B 1TWHA 4A1FA 4HFNA 4PYQA 3UJ7A 3NONA 2RGUA 3EJ6A 3UGTA 4U0KA 1RLMA 1YZVA 4YK5A 2X76A 1XCJA 4FILA 1RQGA 4EVQA 3JT1A 1L9KA 1TZCA 3LC2O 4J49A 5AUNB 4FDUA 2QW0X 5EJAA 4EG5A 1YZKA 2CKDA 1CZKA 4IJKA 3MJVA 1P1HA 1OXKA 4KLRA 2JDID 3HP4A 2IOHA 3QKTA 1V3VA 5EYPA 2EAUA 2QU7A 2XMBA 3QEBZ 1SKMA 1IN7A 2XW6A 3IT0A 2AMYA 3UMVA 3H2UA 3E9DA 4E46A 4ZMRA 5FWYA 4JU9A 1XZMA 3F73A 1SUWA 2P1ZA 3L06A 4Z9XA 3MILA 1K7SN 1Q0LA 4M37A 4RPHA 1GRVA 1PFGA 2MMCA 4YIHA 1ZM4A 1G38A 2H4XA 2PCLA 5KSOA 4DV6B 3BRQA 1HMOA 4TMTA 1CUWA 3NAGA 2CT8A 5IAKA 4MKFA 3BE5A 4I1VA 4O33A 5B7GA 2OD7A 2ZBPA 2BZSA 1BX3A 3EPHA 3JQ8B 5HJ2A 1CS0B 1E59A 3T7EA 4Y1RB 4AG6A 5EESA 4IG4A 5FKJA 5BV2P 4N6NA 5B3IA 4CCSA 4OSPA 4EPRA 3RAPR 5IPFA 3ZIAA 4QXRA 2WU4A 1R37A 1O87A 2KS6A 1E9EA 2Q8NA 2YN0A 5JBNA 4P3XA 2RDMA 1QUEA 3ER9A 1UAAA 3TVDA 3JQ9C 1NKVA 5DI3A 4W6ZA 2DQ4A 2BM8A 5JE8A 3H04A 5LBTA 5BN1A 5IKEA 2BKXA 2IEDA 3RVRA 1OXBB 1EWQA 3S5UA 4XYLA 3GJ8A 2BLLA 4R40A 3EIOA 2H8AA 1Y8RB 3MGBA 1JHPA 4MW2A 1YVRA 2X8JA 1Z33A 3HWRA 3GRYA 2DC1A 4JXXA 1I2DA 1KQFA 1QH1B 3A9UA 3D7MA 3GGDA 1MQAA 2P6NA 3GJSA 1FXUA 4QHTA 1C1YA 1DX4A 3UXYA 5DP1A 5K8IA 5LNK6 2JIQA 2VDMB 5FI5A 1H1LB 1JR4A 1JG3A 2Q5QA 3ZC4A 4ML3A 2J9ZB 2CVFA 1W1UA 4AM8A 3RVPA 1E1NA 2QVCA 4KR3A 3BVPA 3VHRA 1M1NA 4YFVA 2C4WA 3LNCA 4I5DA 1ZH6A 4LHWA 2J0VA 2JCYA 2QUJA 3AFIA 4F21A 5LBUA 4YVFA 4RKWA 1TUBA 1MJGA 4ZCMA 2VNHA 5CDFA 1LBTA 4HUTA 5AVUA 5JZSA 1YOBA 2X0CA 1E32A 1VPWA 5KWEA 4HWOA 4I4TF 5D85A 4B0PA 4WNCA 1O5HA 1IY2A 3TQTA 2SNIE 1RWXA 2JBHA 5IN5A 2QD5A 3D4BA 1GA4A 3Q0TA 2IZ5A 3L4BA 2QAGC 1CF4A 2C5EA 4MUGA 3C16C 2C58A 1FP4B 2JFPA 4J4HA 5LDHA 2REBA 4I55F 2DY1A 4WH0A 3QK7A 4OQPA 5C7LO 3I8XA 5SYMA 4RKRA 1M56C 4PJLA 2VHVA 2OENG 1RXWA 2UYGA 2TS1A 1O7JA 4K03A 4H0FA 1M83A 4LJYA 1NE7A 4KLZA 2A1IA 3KPYA 3Q6MA 3IB6A 2V1XA 4S2UA 4YX9A 1ODKA 4BTLA 1TQ4A 1P9RA 4A16A 1PK8A 3MYYA 5LDDC 4LF5B 2V9PA 4WJZA 5ECYA 2VWGA 5FTLA 4H7KA 1G2OA 2MWQA 1U0HC 1NVXQ 3MRTA 4ZCPA 2C5SA 1F0YA 2CLDX 4LXQA 2ORVA 2Y4OA 4P4SA 5COGA 3KZ1E 3ORSA 2QX8A 4W8PA 3DZJA 4ALMA 4NNOA 3RSHA 3A10A 4MVJD 1BS9A 5K05A 1VMKA 1LDEA 2WJ3A 1T9GS 5A6JA 1YYJA 1KFEB 3LYUA 4MGZR 5CBKA 4KMRA 3K9QO 1X42A 4E5YA 1T8SA 1OE0A 3KKMA 4UXHA 3NBXX 1OTXA 3HL0A 1NJGA 5LOVB 2CK3D 3QVVA 1CQPA 1Q0UA 4YGXB 1S1CA 5BV1A 4H6XA 3SNKA 3E48A 2P6RA 4H4EA 1YACA 4DJTA 1TQDA 1LPNA 1KDTA 3N05A 4MCJA 3U39A 3AESA 2ZVDA 1DAPA 2A92A 3V1MA 1ZXBA 5AKYA 1P62B 3IUYA 1TGVA 4A0GA 1CGOA 3VHXA 3ULKA 1D0SA 4V0NA 3CJTA 3GJ0A 1NVTA 2AN9A 1BD3A 2ECQA 2IZOA 4OMDA 4M1MA 5HKKD 4AO7A 3BMCA 2PSJA 1NW8A 3JATA 4CJGA 4G37A 3MJSA 2K4MA 2XCIA 2GHRA 5TNXA 1E0KA 1JHZA 1I3KA 3W2WA 1OFIA 3FHCB 3WVNA 3BERA 4MDEA 3GLHA 3CWCA 2WVNA 1S7ZA 3KVYA 3L4SO 2Q2VA 4IIEA 2Y3DA 2ZWPA 5DCWA 3OLWA 1KWGA 3AIMA 4UJ3A 2XNDA 1W73A 3O4IA 3DLCA 3OJFA 5J23A 1U8YA 2F3PA 3KAPA 1U0SY 4G2TA 5BORA 2X2PA 2IL1A 3V6LA 3DO8A 3NHPA 2VXYA 3VKFA 1YE3A 1CVLA 1CX9B 2CXHA 1M6NA 5WRFA 3MZ0A 1PJRA 1HRDA 2OZEA 1R9NA 1FNDA 5GOZA 3BG5A 3B82A 3CUVA 3QW2A 3V1NA 1JEYB 4DARA 1U6HA 3QKUA 3F8WA 3JD3A 1WWPA 4UQLA 2BHTA 1Y4SA 1NXOA 2DFLA 4M0EA 4A0HA 4FYPA 1G42A 2CVPA 4TYQA 2G63A 1O5TA 5ER6A 3HKCA 5H8WA 3HY3A 4Q3KA 2OC4A 1F0KA 1NJFA 1KH1A 5JG7A 2Q1SA 1KSJA 4DIFA 5EJ2A 3Q3IA 1Z2OX 2CYDA 2FR8A 4Z99A 3NLLA 4TQ9A 3BAFA 2WT4A 5AO9A 1VPDA 5CT9A 1O94D 4K6FA 3UXMA 4TLMB 2J46A 1ECPA 2H65A 2ZFUA 3HB1A 3EZLA 2F9FA 3L40A 3E9RA 2AN1A 4F6RA 2ZWIA 2VBGA 4DLNA 3QJ5A 3L7NA 3LHIA 3EVFA 4EB8A 4ZVOA 3LAWA 5G1OA 1P2FA 4EHNA 5IC5A 1STOA 2QSJA 3WXBA 5FUYA 1JQEA 3OHPA 4MWSA 1G98A 3TDKA 2QMOA 2NUBA 4Y2YA 1RS0A 2FWAA 4C6TA 3ZWWA 4P3KA 4QU8A 2VJLA 4DJ5X 3O3NB 2EFYA 3C24A 4TMKA 3DFZA 1CJCA 3KC2A 4ACBA 2HOQA 3QVXA 5CNMA 3O8NA 2DHCA 3L05A 2C00A 3GNLA 5CT8A 2O1SA 4XD2A 1SCUA 1KIMA 2Y1LA 3TLJA 1QFZA 1SM4A 5FQOA 3MS2A 4MW4A 5TX7A 3E2IA 1R5ID 4NAVA 3OZDA 4EVSA 2R7XA 4Q1VA 1C1DB 3O74A 2JI8A 5CDFE 4XLZA 1CCWA 3MBIA 4KIFA 2ZI5A 3FHTA 2Q1XA 5C4IA 2DOKA 1VSQA 4L5AA 4MCIA 3UK6A 1MDBA 3LQ2A 1W29A 1SB8A 5LQDA 4GBJA 1QIGA 1YRAA 3WGHA 4Q6BA 4PX3A 2X19A 2AJBA 2F22A 2BGLA 1QIEA 1QB8A 4MNDA 2CB0A 1KU6A 2YBEA 3IEIA 4UASA 2DGDA 5HM6A 4RD6A 3NGXA 1PJ8A 2RK6A 3EPKA 3DMPA 4E5UA 1SHLA 4DAEA 2BFMA 1TPYA 2K7FA 2B3DA 1VLJA 1OYVA 2XKBA 3TLXA 3KD3A 4RXMA 3W5HA 3IPYA 1A5BB 4FOPA 3IQGX 5A5GA 1OJ7A 4QC2A 2P5SA 5HZMA 1KNYA 1LVHA 3UAXA 3QXHA 1Z6QA 2O7NA 3UJBA 1NVWQ 3HJGA 3WGIA 1PWEA 3VUFA 1Q22A 3GEGA 3ZN2A 5MN5A 4NNJA 3NBQA 1XQXA 1H9GA 4URYR 1CZNA 1HM5A 2FDRA 2FK8A 4JC0A 3I09A 4GLBA 3AR5A 3CG4A 1N6KA 3FGNA 1K6XA 4RH3A 1L4NA 2HB6A 2X0NA 2Q2QA 4B4OA 3V8PA 4BMNA 3UGJA 3MMNA 5CLHA 5JNSA 3FPAA 3LO8A 2ZYIA 3Q7SA 3FGOA 5EKXA 2WJAA 3F9CA 4BRSA 5L0HA 1MJ5A 4B6RA 1IUPA 1UINA 4HLCA 1YJAA 1Z18A 1O57A 4RC9A 4Y3UA 4IICA 1EMDA 2QDXA 2A35A 3HCFA 1JEQB 1GCUA 1ID8A 1UM8A 3ZU6A 4ESEA 1YAJA 3UUEA 2LSEA 4GUDA 4EHBA 1LEHA 2ID7A 2AF3C 2O19A 1PCXA 1PT8A 1QLWA 1NZFA 5AXAA 3GX1A 2AK2A 4YJHB 2OFXA 4JI6B 1YUNA 1LM3B 1QFXA 1Y89A 3BFPA 4BO2A 1VKOA 4WJLA 4D4LA 4RA6B 2PKXA 2FW8A 4R9NA 2WSMA 1MB9A 1Y3BE 2QTWB 5JXHA 5DM70 3TZKA 1QDLB 1JALA 1DELA 1ONOA 3KDPA 4NENA 2P9EA 5JS7A 5AW7A 3EGCA 1IMJA 1JTVA 3PF9A 1DAFA 5EJMA 4DILA 3PEVA 1TA9A 2YMPA 1Z3CA 2KJQA 5D87A 1J8DA 3MT8A 4FHEA 1PEAA 2RHTA 1LQUA 4LWQA 2ZBUA 3GLHE 3T99A 1UXIA 1FFTC 4E5MA 4YMHA 4M1KA 2DU8A 2QEQA 4NWIA 121PA 3OCVA 1N32B 1ZW2A 3U1BA 1DS6A 5C53B 1KGDA 3QLUC 1T4GA 1PDWA 2IXBA 2CMHA 2YNMD 5C46F 3OKPA 3VAAA 3JWPA 5DTMA 2DUUA 4XWOA 2J6HA 4V1CI 3U3FA 4TMZA 1P5HA 4KXQA 1WZ2A 2OK7A 1M76A 3KT0A 3VU0A 4JT9A 3UJNA 4M1WA 1EFHA 4J90A 1A7AA 4A6EA 3FNQA 1NWHA 1ZC4A 3RV3A 4GMFA 1LBHA 3AEQA 1ZIPA 4O8CA 2VCEA 2XQFA 1RBMA 3KWFA 1E1CB 1U7OA 2CNOA 4J3FA 4X7BA 3RJ5A 1H2EA 2FR1A 5FOXA 5IVHA 3HPQA 1KVQA 2UUOA 4DT1A 4HL6A 4J43A 5A4IS 1T5LA 5I8PA 1ZLYA 4FYXA 3KYIB 4P6VF 3EGIA 1T35A 4JOSA 3ITKA 5BPHA 1W59A 3UNXA 2UZIR 1BE8A 2YJTD 2ZD9A 1JU4A 3KOXA 4DLAA 5GJCA 3LFHA 3O4HA 1ZVJA 3O8CA 2IZ7A 4D4GA 2ODBA 4ZK6A 1OKKD 4FS8A 1VE7A 5B7NA 1X39A 1H9CA 1SUDA 2PGAA 1H2YA 2DERA 1ESCA 5B3JA 1WOMA 4UHJA 1B6TA 4MQMA 4IJ6A 1A7JA 2GN6A 1QHYA 4YQFA 3L8FA 4C7BA 5ARDA 4BATA 1V1MA 1QUFA 2E6UX 1G7CA 2J4CA 2WZDA 5FWXA 1R0XA 4AMYA 4UU0A 2JFWA 1GZ7A 1HDRA 1XMVA 3L9XA 4M9CA 1V16B 4CBVA 2INGX 3U1VA 4RTKA 1GP2A 3L6BA 3BGDA 2V3CC 3EBLA 4HN4B 3TGWA 4IXNA 3QPDA 3BD9A 4IEIA 4RYLA 5JASA 1OB5A 1U31A 3KSBC 2X4DA 4AO8A 3Q1LA 4EBJA 4Q7QA 3A6EA 4CKBA 2UZ1A 4QXAA 5H9WA 1D8AA 2AP3A 3PXUA 4K3UA 2QRVA 4HRYA 2V9ZA 1GPDG 2C2OA 4P0QB 2PGDA 1QHGA 2GXUA 3OFSA 3SLGA 1EEXB 4R2MA 4C7OB 4KX5A 3SSOA 2YZ2A 5AUPB 3I64A 5AXBA 1U3VA 4FYMA 4LDZA 7MDHA 3DFUA 5BWBA 2XAUA 2ZUDA 1FW6A 4JENA 5BSFA 4XGQA 3C63A 4O1IA 2ZRMA 2HIMA 4IDQA 2H0RA 1QVXA 2AG0A 2XZLA 1W0KA 5LP1A 3UH0A 2GCIA 4KAXA 1JVSA 3TOVA 5C8YA 4U5BE 2H4FA 4WGYA 2G4VA 5CGQB 3G2QA 3N8NA 1E2HA 3PLAE 4BAZA 3F1LA 2WJGA 4QOGA 5JNUA 1YZ3A 4F93B 1N2SA 1TVCA 3TBFA 3CRMA 2R03A 2H18A 1FTWA 3N59A 2SECE 3T5CA 1EBBA 1KFCB 1PK9A 1HDOA 4EVIA 4FFDA 5F1OA 1HRKA 1UC5B 5BWLA 3IVRA 1Y8ZA 1Z8FA 2BF7A 3L0SA 4URZR 1R6VA 3C8GA 1LI5A 5D8DA 4RACA 4ABYA 3T5PA 4KG7A 5ENZA 3PJEA 3KOUA 3OIWA 2I78A 4OFXA 1XDBA 4J8PA 4KE8A 3MWDA 1J5XA 4BNFA 2I2AA 1EDEA 3EHNA 4MNTA 3HE3A 1HFEL 3LCVB 3B60A 3T5TA 2FPMA 4Q7MB 2C8VA 3VDQA 1TM5E 4QXPA 3UJ3X 1WSDA 1DSSG 2JCGA 2SHKA 3PXBA 1ZUIA 2BV3A 3GIWA 5TPZA 4PLFA 1L8LA 5BQIA 2W6PA 1TYAE 2IYYA 4FDLA 3AQBA 1YBHA 5KNDH 4MTGA 3W79A 1P2SA 2WIAA 3SKYA 5BN5B 2NU6B 1AGNA 4R9SA 4LZZA 1G19A 3PVZA 1RJFA 3KRTA 5A3VA 5CFPA 4TT3A 1Q0SA 2D13A 2IW3A 4HH1A 4F1WA 4C05A 2AZ4A 3DDNA 2QLBA 2UYCA 1U2DC 1W0JD 2XVYA 3HFRA 2B2CA 1XA4A 2FA9A 4V0RA 1RZVA 4QJ5A 5TV2A 4ONSA 1CR1A 3KZNA 4GI5A 2PBRA 1HF3A 2V4UA 4JLKA 5J2UB 2ZVPX 2BFCB 2P4HX 1ATIA 2HJSA 3HB4X 4ZKEA 1N1GA 1DKOA 1KORA 2YX1A 1KSFX 1MB0A 3BHNA 4L4SA 3ZBTA 2Q2OA 3E3LA 5AIBA 3TOLA 1P1RA 1JSLA 1BFUA 2OMEA 3NJ8A 3AKCA 1MRZA 3JSEO 3PIRA 4LZOA 4QEKA 5D6NA 5CB6A 2LRHA 2E3JA 1GLNA 5JQGB 3MHTA 4DHEA 2IBTA 3VGPA 3U4IA 5KWVA 5AJZA 4G07A 3Q88A 2I6XA 2SBTA 2QAJA 1A7KA 2X0EA 3E3NA 3D6AA 4YLEA 5C3UA 1CRPA 3BPSA 3K6RA 3KOMA 1YZQA 2PMEA 2CF5A 4UM7A 3O9VA 4L5CA 1WMSA 3UV6A 5IT9A 3CLKA 1M1ZA 5KMGA 4E4TA 4P83A 4U2BA 4DSOA 1M0EA 2ZYWX 4ETIA 1PVVA 1KF0A 4AKTA 3F2VA 3ER8A 3GDWA 1AD2A 4K7JA 3IO5A 3IP3A 3G4ZA 1CBUA 4NMMA 3A3KA 2GZHA 1M7GA 1QF9A 2GZAA 5DW0A 2GZSA 1YR9A 3JZFA 2PVCA 3V4LA 4RW0A 4W5NA 4OA8A 4Y67A 3WHPA 1KI7A 1Z39A 3T61A 2J9GA 3CLUD 4BTEA 3CWZA 1ZSYA 1SIUA 5C0OE 4M53A 4LE2A 2JGLA 5EE5B 5KC8A 4Y2GA 3H05A 5K09A 1N6IA 2GEDA 1NGSA 1Z12A 1NF2A 2Q4OA 4DVJA 2DYKA 2NGRA 1I5OA 1FUKA 3J7TA 4E88A 3OKAA 4NBTA 5T3WA 1JYEA 2K2QB 3AUKA 4MUYA 2HK7A 3HVUA 1ZVZA 1MEEA 4YJ2F 4U02A 5HQ3A 3T1YB 3LZDA 1AHHA 1KA9H 4IOJA 2W8ZA 4A4AA 1W5BA 1XO1A 5F3WB 4XDYA 3P0EA 3STWA 2F17A 4GM1A 1JQJC 1E3SA 1MZVA 4JXJA 5KVAA 4BWFB 2FVXA 2IEZA 1NBIA 4FBLA 1W581 1Z22A 4F7DA 3U4QA 2GXQA 4JC4A 4N5LA 1SIOA 4AJPA 3OQOA 3R5TA 3I28A 1Y63A 3LLUA 4ZU3A 3TI7A 1X1CA 3BE8A 2ZOSA 2WNIA 1Y98A 3Q6IA 1GAJA 1ZPDA 1NMZA 5A0VA 1L7RA 1PU2A 2VN8A 4C20A 3DTVD 2YS6A 3OPYA 4UHBA 4I19A 2OGSA 5E3HA 2DBVO 3B7PA 3HSYA 2PT6A 3NEAA 5DSXA 4M0UA 1KO8A 3UEOA 1MMDA 3ZZMA 6Q21A 5FLXA 4TX1A 4N3CA 4R1OA 2NWQA 1BMFA 1NVUQ 4J0GA 3CLRD 5IUKC 2IYFA 2GJ8A 4F3RA 1JRAA 3RTBA 3D6MA 4IDNA 3SF8A 4R8SA 5JPIA 4C06A 3ETDA 1Z23A 4EUNA 3N7AA 4R2HA 4B3BA 1HQDA 4DJDC 3N8HA 1GHTA 1VL6A 1JJIA 1JIVA 2EZTA 2E4UA 2IUFA 1WW3A 2G4CA 4LYDA 5A4MS 3ZDYB 4GWLA 2VNJA 3OIUA 2Q3BA 5BO5A 3VISA 1B73A 2FW7A 1XYGA 4M6WB 3N2LA 5DWVA 3SEAA 2VRBA 3DSRA 2QTVA 1D5CA 3PYLA 4AF7A 2FW0A 4XEVA 2RKOA 4ZEVA 5DFAA 1W49A 4D4XA 4UTNA 3QWFA 3FAKA 3VO1A 3ZI0A 4DYHA 3EFOB 2BMEA 3KOZA 4TWBA 2IYSA 5C2JB 4TV9A 4EX7A 4ZCRA 2R25A 3HXQA 3ZE7A 4DC9A 1YTUA 4C0QC 1A7VA 1NDQA 3T7DA 2GRJA 5TB5A 2FB9A 4R1LA 4YYEA 5E6UA 1ZH2A 2C2GA 4MS1B 4ZARA 3EAGA 4O6YA 4FQ8A 3UMIA 2VCCA 5EMNA 2P35A 1UPFA 3BDAA 2IW1A 1FA9A 4GX2A 5FPYA 5KC9A 3FWYA 4P0PB 4O4IF 3B5JA 5E2AA 2GD2A 4CLHA 4EI2A 4OVKA 2DPHA 4EJSB 2YHUA 4KH0A 2DJ5A 2A1DD 2BTQB 4BNVA 4CUKA 2R6FA 1E94E 4EHAA 2L42A 2PU7A 2OEPA 3HNRA 3H42B 2J9BA 2LDBA 2ZSKA 4A5OA 2XNSA 1I4LD 1O8CA 4NE2A 5LD2C 1BOFA 5CM8B 1AVTA 3OAAD 3K9WA 2PPLA 4QFCA 5EGSA 3IJRA 2WWRA 1ISMA 3AF0A 2CVQA 4NF2A 4IDOA 1JB1A 1XNQB 2DLNA 3UYLA 5IJ0A 4HAZA 1N36B 4DA7A 1SGWA 3L7KA 3LGSA 1EEHA 4R0MA 2AWOA 4R7ZA 5EHQA 4BAGA