2YHSA

Structure of the e. coli srp receptor ftsy
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
308
structure length
308
Chain Sequence
EKPTKEGFFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN FTSY
publication title Lipids Trigger a Conformational Switch that Regulates Signal Recognition Particle (Srp)-Mediated Protein Targeting.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
total genus 125
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2yhsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yhsA02
4DCVA 4G5SA 2CL6X 3U7GA 2ZSBA 2ZJBA 1XCPA 1NMYA 2ATVA 3LXRA 821PA 1II0A 2FN4A 1CKEA 3JZAA 3VHLB 3GLFE 3RS2A 4NCJA 4N3NA 1OSNA 3O8DA 4OQXA 1ZUHA 1XJ0A 4KFUA 3ZIAD 4Q7LA 4TLEA 1NVWQ 1LNZA 2BMEA 4OI4A 1COWA 3TK1A 2JLWA 1P60A 2IYXA 1E9DA 3GD7A 4NL4H 5TVKA 2GKSA 5HKKD 5KNCA 5DN6A 4L4UA 1KNXA 4MRPA 1U0LA 4XD7D 4IOKA 4B74A 5CITA 4JLBA 1IONA 4OI2A 2Z4RA 1AJEA 3JZMA 3SI7A 4A6XA 2A5FA 3EASA 4OJQA 5J4LA 2XAUA 1OXSC 2IHYA 4Q48A 1NG1A 3CF6R 4EJSC 3QF7A 1W47A 4QBFA 1XTIA 2W6ID 5LB2A 5DYIA 3U4QA 3ADDA 1YRBA 3O8RA 1Z06A 1BOFA 2G6BA 1LV7A 1Z28A 2QM7A 3P32A 4RCZA 3PR1A 2HLDD 3VR3A 4P4SA 4A9AA 2MMGA 2WMNB 3NIBA 3QVVA 4AYWA 3ZH9B 1YU9A 1FP6A 1JR6A 3BB3A 2QL6A 1L2TA 5B30A 4YMVA 2QN6A 2VP6A 4IFEA 2DFKB 3EX7C 2IYRA 2PX3A 1XPRA 2CCGA 4WIAA 2RGEA 3GJ3A 2BEJA 5FOSA 2CEAA 4NZYA 4UNQA 4ZIRA 4MKHA 2OFWA 3ONWA 1MH1A 3BGWA 3HYTA 3CONA 4HLQB 3RHFA 2IYSA 4HZIA 5GADl 1R10A 2G9NA 4ESHA 4WA7A 1DAIA 3Q7QA 4GOXA 1ZBDA 2JIZD 5L3RA 3EZ2A 4NCNA 4Q66C 521PA 2BWJA 3B1VA 3B6EA 1ELOA 1CR0A 2WICA 4N1AA 4PXAA 4Z8YA 2VH5R 4IOLA 3CW2A 3VKGA 4OI1A 4HUTA 2XXAA 3OESA 4QJ4A 2WIBA 2EFGA 4IXMA 1LF5A 3U60B 3HU2A 2F6RA 2XZOA 1TQ4A 4M9SA 1GUAA 1S96A 2OAQ1 2R65A 1V5WA 4V0OA 4ZPXA 1CU1A 2IT1A 4LWZA 3WHKA 1HTWA 2I3BA 2KBEA 2D06A 4HZUB 2V1UA 3QXJA 1Z83A 2QM8A 4O0MA 3CPEA 1G4AE 4M9QA 3KQUA 5DLQC 4XTRA 1EXMA 1S4QA 1PZNA 3QPVA 3VKWA 2DY1A 1U2RA 4XOIA 1K8RA 3DM9B 2GZDA 1IBRA 2C98A 1GKUB 1N6NA 3RVBA 4URXR 2CVFA 3L0SA 2ZI7A 3U3MA 1RYHA 5BYKA 2ZJYA 1QHSA 1P9RA 2FMXA 2F1IA 1XTSA 1XP8A 2JATA 1XZPA 4GZMA 2CE7A 2VHTA 2V7QD 4HUQA 2WWXA 4LY6A 4EPYA 3KXIA 1SXJD 3TLXA 5FPKA 3QF4A 4NYIR 5HZKA 1FTSA 1KDRA 3EZ9A 4QRHA 2IXGA 5E7IA 4QHYA 4LK2A 2G77B 4LBYA 3A4NA 1TF2A 1N0VC 2ZETA 4LSGA 5IRCD 4Q7MB 1E94E 2XTNA 1PVOA 5AJZA 1Q20A 3U2QA 5FTKA 3CZPA 4KV9A 1D2EA 1E4YA 3SNHA 1O87A 1QF9A 4JVNA 3WYAA 1OJLA 4QGFA 4HDQB 5BYJA 3PEWA 4RZUA 3RAPR 3Q9LA 3CBQA 3VX3A 5C2JB 3H1TA 2ZRCA 1E4VA 4BECA 1U0JA 3UWOA 4L16A 5P21A 3SFVA 3SYNA 5DI3B 3DKVA 4L5BA 4HLCA 1KDPA 4HB4A 4MDFA 3A4LA 1KAGA 3P4YA 2JLYA 1YRAA 3FKSD 2L0XA 4MDEA 2P6RA 5JS8A 2FGJA 3WRYC 2GAAA 1ESNA 1WDTA 2DHRA 2E87A 1F2UA 5JCPA 1OV4A 1J70A 1E2QA 4X8OA 2OSBA 3M4YA 2E9SA 1S1CA 3X1DA 3VR6A 3REFA 1S8FA 3S1AA 3NH6A 3QIAA 2DBYA 2QUZA 4DLUA 2VA8A 4GPTA 4U7DA 4B33A 4B73A 1E2IA 2GBLA 4O25A 4ZO4A 1CRQA 4C0LA 3HPRA 1P5ZB 2J0VA 2WJYA 3A1VA 3SJAA 2ZRGA 2ZI5A 2IL1A 1TU3A 1HQYE 2HT1A 2O8EA 1BO6A 1I4TD 2QA5A 2BIFA 4C30A 1MT0A 3IPYA 4TQUS 2EFEB 3SE0A 2O8FA 1GDDA 4ZKDA 1E9RA 1IN4A 1NY6A 3LQRA 3WYFA 1D6JA 2FJUA 2KWIA 1SULA 1WBBA 1ODFA 2F1RA 1QHYA 3B9QA 2VHJA 1JJVA 3CH4B 3OEEA 5FBQB 3EZFA 2Z4SA 1JJ7A 5FTJA 4BZQA 2IYVA 4HLUA 4JIMA 2FFBA 2NOAA 4X8MA 1K5GA 2J5XA 2OEPA 1R8QA 6Q21A 5EUQB 2WSSD 3LVRE 2RAPA 4PZLA 4CGZA 1AKYA 2P2LA 3P1JA 5JFGA 3W34A 5TV2A 1GFIA 2ZYUX 3KX2A 2C9CA 3CWZA 4XH9B 2FZ4A 2J46A 1NSFA 3LD9A 2JLVA 3L0OA 1OH8A 2B7BA 1G3IA 2NO7A 3KZ1E 5F2EA 4NYMR 4AKIA 2J1LA 3B1WA 3BFVA 4TMXA 5TY0A 4B6FA 2BDTA 5GVSA 2NPFA 1M6NA 4MKIA 5E7MA 3IPXA 4A36A 4D4KA 4NYJQ 1JR3A 4L9SA 4TSFA 4AG5A 1CULC 4BPBA 2FG5A 4Q21A 3U3RA 4ZCMA 5F98A 4AURA 3IIJA 4PAMA 3X1ZA 1ZUIA 1IOZA 5JSZB 3TBKA 1KI6A 4HAWA 1G3MA 3LQQA 2Y8EA 1P62B 2V6IA 4RD3A 1UBFA 2PJZA 2I1QA 2IYUA 1IY1A 2ONKA 4PZYA 4Q01A 3TUJC 4AY2A 3NWJA 4QJ5A 4PQRA 3BJIC 3C7KA 4JSTA 4MUAA 3BC1A 2V55B 4JLKA 1J90A 4RD6A 1UFQA 3E70C 2ZE5A 3D8BA 2CK3D 5DHAA 1VG0B 1E98A 2XNDA 3D7MA 4JJKA 1HE1C 1ZVQA 3UWKA 2PZGA 1QHGA 1VTKA 2FV8A 1M7HA 4NCIA 1QHIA 3VX4A 1Z6GA 3IUYA 1VIAA 3SEAA 3LAWA 3VR1A 1B0UA 1UPTA 4M1SA 4GSYA 4R2IA 1G8PA 4MKGA 3NBXX 1J2JA 3O8BA 3T12A 4PO9A 1DAMA 4ZV4A 4ABYA 1NN0A 4TZ6A 1KJZA 1ZCBA 4FIDA 4RKFA 1T0JB 3WP1B 4B3FX 2GBLC 2D3WA 2QORA 3W6NA 1OFTA 2CVHA 1KHTA 5FOTA 4CF7A 1N6IA 4Q4JA 5FR1A 4RFSB 2ODNA 2ZU6A 1WP9A 3VU9A 4HLDA 4MYUA 4M1WA 2ZI3A 5BN5A 2F1HA 4KI0A 1BH2A 3T34A 3PUZA 4M2LA 1RKBA 1Q0UA 4R9UC 3W5IA 2ZYVX 3HR8A 2RKOA 4QFMA 4A8JB 1N5JA 2GA8A 4EPXA 3D3QA 1VYTA 3A58B 1ZM4A 1KSFX 4MRSA 4B3GA 3ZS9A 2RH5A 3I5YA 1MR3F 5HZHA 2XZLA 1KI8A 1CS4C 1YHNA 5L3SB 3UMSA 2GEUA 1XEWY 3AF3A 4B76A 2J0UA 2GJ9A 1ZNXA 1P61B 2ZTSA 4Z1MA 1TMKA 1A4RA 2ZI4A 4AKHA 1G9XA 1W2HA 2QAGC 2Z83A 4HLUC 5BXQC 4OQNA 1C4OA 3TW8B 3ADKA 1E2EA 5BN4A 4B3XA 2H18A 3SYLA 5A4JA 1W7AA 5G53C 5FL3A 5K8TA 3B60A 4B3DA 2ANCA 2GVZC 4IDPA 5AJVB 4S2EA 4AC9A 4D81A 1TADA 4D0GA 1F2TB 2AKAB 4OHWA 5BWMA 2GNOA 2QI9C 1OXTA 3CIOA 1QHXA 2IYWA 1R6BX 2QENA 1D2NA 1P2UA 4BFWA 4MYHA 1N2CE 3T1VA 4Z54A 4P0TA 2XTMA 2XB4A 3QSYA 3AGPA 3ZS8A 5DE3A 2A3RA 1AZTA 3C16C 3IKJA 4EPTA 3NHBA 2RMKA 4Y0AA 1TF5A 2XOKA 1KDOA 3MWKA 4US1R 3MG9A 2NPIA 2YVUA 1BMFD 4WZBE 2ZE6A 2ZAOA 1NMXA 2FU5C 4OHXA 3T61A 2R6CA 2ZJOA 3WXMA 4NP6A 4HATA 4PO1A 5FR2A 3TW4A 2QROA 4JJZA 1FP7A 3AEZA 2FNAA 4U02A 5A0FA 2VP9A 1VMAA 1YR7A 1RFLA 3CX6A 2WPDD 3KKOA 3L8YA 3U3KA 3A1TA 4LZZA 2ZU0C 3WNDA 2JLZA 3GPLA 4OHYA 1MO3A 1E1RD 3AVQA 4O3MA 4QXAA 3LFUA 1EX6A 1VIYA 4G0NA 1ZAKA 1R0ZA 5KNDA 3AVUA 3B8HA 4DZZA 2WJJA 2PLRA 1R5BA 2FEOA 3OIWA 1Z47A 4QKQA 1UBCA 2A5GA 1NBMD 1X86B 4TYYA 3LBIA 1GSIA 3OFNA 1VDZA 3ZZUA 2Q9AA 4MITA 2HYDA 5CDFE 1EFRD 3QXCA 4ZDIA 4ZDKA 4KLZA 1VYVA 4LHYA 5GJBA 2BM1A 5CIQA 1E79D 1P9NA 2CHVA 1G1MA 3SFZA 5JS7A 5AR1A 5GJWC 1OIXA 4JVMA 1FFHA 3PUXA 1ZM3A 2JLRA 5FI1B 2GZAA 2FSIA 2KJQA 4AI6A 2BBSA 2IW3A 2AFHE 1N3BA 3B13B 2CLSA 4PANA 2JLXA 3EWSA 1US8A 1YR9A 2GZHA 4D6PA 5G40A 1ZD9A 1OH7A 2RHMA 3OIUA 4QBHA 2WOJA 1II8A 3QXXA 2BKUA 3OIVA 4H1VA 1W1WA 4D82A 1P4SA 3ZDQA 1MOZA 3TSWA 4CEIB 2WWWA 3I73A 2FFAA 3LH5A 3CRMA 1MKYA 3KXKA 1G5TA 3ADBA 1TUEA 4TQAA 5FUYA 3QE0A 5ELXA 2XZPA 2GHIA 5D3MA 2A30A 1KSGA 3GLIB 3E5HA 2BBTA 4TN1A 4R98A 2BBOA 1KJYA 1SKYB 5EP1A 2ZQ5A 3EZ7A 1P2SA 3UXMA 1H8EA 4GZLA 4KHZA 2W83A 3MUFA 4PPGA 4AWXA 4URWR 3LBNA 4JLNA 1T0HB 5HE8A 4DUGA 5FOVA 2QAJA 2QGNA 1MRNA 5EP2A 2ZUBA 1X8KA 4JLOA 4A0GA 4TT3A 4QGGA 3VHXA 3ZVRA 5JECA 4JLDA 1G6OA 1NJGA 3K9HA 4UKDA 1OH5A 1D8TA 2CLCX 4M4SA 3P20A 2O8BA 4PAOA 1BYIA 2ZRDA 3AP3A 4HB2A 1HA3A 2CLDX 1DG3A 5CJ2A 421PA 2YC2C 3K0EA 4AYXA 1YZNA 1RJ9B 4C0KA 1T5IA 2A5DA 2WTUA 2W2VA 1DEKA 1G3RA 3K1JA 1B23P 4US2R 2VF8A 4I1UA 1G18A 4FINA 621PA 3WMFA 1ZNZA 2GJAA 3TR0A 5CK5A 2FSHA 1TNDA 1OYWA 5LD2C 2C96A 4K46A 2RGNA 4RZXA 3D6TB 1XTJA 2C8VA 4W5WA 1E69A 1YR6A 1E2GA 2W00A 5B2ZA 1E9EA 1QVRA 4B43A 3TH5A 3WNCA 1ANKA 4OL0A 5FTMA 1P3JA 1P7CA 4BLPA 3RRYA 4ERNA 3THXB 2VF7A 4DB4A 2EYQA 3BORA 5EE3A 1ZIOA 3PQCA 4PO8A 5EP3A 1UEJA 3QKSB 1T6NA 2ZSAA 1T3HA 3AUYA 3IIMA 1X8LA 1Q3TA 2WJIA 2V6JA 2VQSA 1JBKA 3CLVA 2ZR9A 1UKVY 4JLVA 1OKKA 3BH7A 2YZ2A 3AP1A 4TTQA 3GLIE 2JJ2D 3GJ0A 2FPKA 2DFNA 4F91B 4XWOA 4TYPA 4MRRA 1SKYE 1TQ2A 1X3SA 1OHHA 4U5XA 1F6BA 2VP2A 4DDWA 4GI7A 4GT1A 3X1XA 4TL7A 3TVTA 3PCRB 1T5LA 1DOAA 3PENA 2VSXA 1AQYA 2OHFA 2NO9A 1RPZA 4UXIA 1A2BA 1A7JA 2JDID 2PBRA 4WXRA 3I62A 3LXXA 3N5CA 4LJ8A 3X1WA 4B48A 1PLKA 3AKEA 3MAAC 5FL7A 3QPWA 5AJXA 2FWRA 3OAAD 2PL3A 2W2TA 2AX4A 3QKRB 1IHUA 3GEEA 4KODA 5TMPA 4M21A 4O2LA 1W0KA 3ZVLA 2NG1A 1XD2A 4MKFA 4PHHA 3SN6A 1Q1BA 3SJCA 1FZQA 1GZSA 5H8WA 3AF1A 4GOJA 2JA1A 3NEYA 5JHGB 1Z5ZA 1ZD1A 2PLFA 2NZ8A 1G7TA 4QM6A 1LTQA 3A1SA 5K8LA 1F48A 5HTKA 4FWTA 1E0AA 1CXZA 2IS6A 3L2OB 1W5SA 5HCNA 4HZUA 1XNJA 1N25A 1COWD 2AD5A 4JLMA 3CNOA 2C03A 4DJTA 3KJIA 1H8HD 1RE0A 221PA 2R6FA 5DN6D 1N6PA 5IT5A 2NQ2C 2QBYB 1EWQA 1JPJA 3AH8A 1PLLA 1A5TA 4LPSA 2ZSEA 2HDNB 3KKMA 4C3ZA 1R2QA 5SZHB 4JKYA 4BLRA 4LGMA 4Q4HA 1UADA 1AA9A 3I32A 1OFUX 4BLQA 1N0UA 1R7RA 3U3JA 4DWJA 2VBCA 4E03A 5B57C 5KSYA 4Q9LA 1DS6A 3EZ6A 2AR7A 2V9PA 2IUUA 4X8HA 4HDOB 2J7PD 3QOFA 3BE4A 4QGHA 1DTSA 3IQWA 3HJNA 3AF0A 5C4MA 1N5KA 3NG1A 3LVQE 1GTVA 1W44A 3MD0A 4Q7JB 1XRJA 1WF3A 2RGNC 4QNRA 4URYR 1AN0A 2AXPA 3V4FA 2P67A 2JLUA 1NRJB 2NO1A 2O5VA 3LX8A 1HYQA 4DBLC 2IUSA 2JAQA 2HF9A 1XTRA 2QSYA 1SQ5A 2HEIA 2ZVQX 3C4JA 4KFTA 4BFZA 2QE7A 2RHDA 2FPMA 1E0SA 3TMKA 4Q4LA 1NVVQ 1RRFA 4KVAA 3K0AA 3L8ZA 2IF0A 4TYNA 3DPUA 3BK7A 5J4YA 4V0NA 3AGQA 2ZRJA 4BRUA 4TMZA 2ZS7A 4OK3A 1NBME 2EWVA 4PC1A 3ZJYA 4BEJA 3ZD7A 4EJSB 2OV2A 4A2WA 1DBSA 4PC2A 2OUKA 3B1ZA 4LJ4A 5KSOA 4OHZA 4Q9HA 2GF0A 3TUZC 2NMVA 1FOEB 3LWNA 4DEYA 3ICQB 2IWHA 2QT1A 5HR5A 3GMTA 4YXWA 2RGXA 2O8DB 1GL6A 2GCOB 2YWHA 3THOA 2CCJA 4WBSA 4KVGA 1CTQA 1CRPA 1ZC3A 3A4MA 2IBMA 1U8AA 2YWFA 4M9XA 2VLIA 3DO6A 1U99A 4V0LA 4IXNA 1NF3A 4WOPA 4C9BA 4FMCB 3IGFA 2YOGA 2FPLA 2NGRA 4URVR 4WZAE 1WCV1 2OCYC 4XTCS 3PVSA 2ODBA 3KQLA 1N5LA 2QGZA 3IEUA 3KTAB 1RRGA 4UXHA 1R5OA 3PV0A 4BFUA 3I4LA 1T3SA 4D4JA 4HI0E 2V3CC 5EQTA 4Z51A 4DIEA 4OK6A 4PQYA 1XEXB 3LX5A 2A9KA 3K0FB 5KSPA 2QMOA 4GBMA 4V03A 2RCNA 3HU3A 1HH4A 4B3CA 5KYKA 1NKSA 3LO5A 4TQ9A 2OBNA 3SQXA 2H92A 3ZZ0A 2QT0A 3R8CA 3CPJB 3ZGXA 1UBGA 4BLOA 1AS2A 2UZ3A 1KYIA 1G7RA 3RS5A 1FNMA 2W6JA 5H68A 5HE9A 3AP2A 2ANBA 1ZM9A 2C77A 5FOWA 4C7OB 5CYPA 3EWAA 3U7EB 4EFLA 1W2GA 2ZROA 5CB8A 5IHPA 2V1XA 3SZRA 4LYAA 4DSOA 1E0JA 4HEJA 1Q1ZA 2BMJA 1VCOA 4HAVA 5HPYB 4W9MC 3AF2A 2AN9A 3TGPA 4H9GA 1KKMA 2NO0A 4IOMA 4AIIA 2CCKA 2YYZA 1P6XA 4ARZB 5B64A 3W3ZB 1W36C 3IBYA 1OLOA 2JLQA 2PX0A 3HDTA 4OI0A 3Q3JB 2EQBA 4UNSA 2R6DA 4TMVA 5K8UA 1IXRC 2GCNA 1G8FA 1N0WA 1KO4A 2IC5A 4HAUA 4JT2A 1WMSA 1MABA 1Q57A 2G0NA 4Q1DA 5AUPB 3FWYA 1M74A 3BS4A 3RSLA 721PA 3GEHA 1JEDA 1KI3A 3DMNA 1ETUA 5FUWA 3QVUA 3T1QA 3A37A 3RLFA 3GLHA 3B7GA 2Z5FA 3L0IB 4Q7KA 4DLZA 1LVGA 1TEXA 3EARA 4KITB 3U4QB 1N5IA 2Q0HA 1IAQA 4D0LB 5F9FA 1NI3A 2V7QA 5CLQA 1L4YA 3VNVA 4N0DA 1E99A 3TIFA 4L9WA 1GL9B 3B82A 3MSXA 3C14C 3K70D 4UQOA 4GL2A 3P27A 2ZJ8A 4AYTA 1EFCA 3GQBA 2DPXA 1GKIA 3T1OA 2AXNA 4TL6A 3THWB 3PIRA 4GRAA 4DDUA 1AIPA 5IK2D 4LHZA 1NG9A 4FCVA 1KI7A 1Q21A 4GP6A 1AQUA 4PC3A 3QBVA 4FMCF 1GOTA 4TZ0A 2FSGA 4QBIA 1E96A 3U6BA 1HQCA 2NO6A 2C9YA 4FW9A 3DMDA 1QG4A 2G0TA 3UG6A 4LJ5A 4R7ZA 4RFSA 2G88A 3FOZA 1Q1EA 1SZPA 3EXAA 8OHMA 1Z6XA 2LWIA 2ZRMA 4EPWA 4EAQA 3K0CA 5EE0A 3RDPA 3K9LA 5EE1A 4TMTA 3KXLA 1JALA 3SOPA 3TSOA 2PEZA 4B47A 1T91A 1I2DA 2PCJA 3EIQA 4H1UA 1TF7A 2EFCB 2QZ4A 3R7WB 4DLSA 1W0JA 3AVWA 2YOFA 1EFHA 4GDFA 4NBSA 4BRWA 3CRRA 2BCGY 3QKTA 1OF1A 4TMWA 4UNPA 3NKVA 3FKSA 4Q18A 5FBRB 1AGRA 3SQWA 4RVCA 5IF9A 3PUYA 4DDVA 1OIWA 1XEWX 4KBFA 4ASUA 2ZEJA 4BFSA 2AWOA 1E9SA 1KK1A 2QAGA 2MSDB 5C4GB 1XCGB 4MGYR 1KI4A 1I4LD 4Q1FA 2ZJAA 2ASEA 4C0AC 1IY2A 1KZGB 2CHGA 1U81A 3GEIA 5AJWA 4QJ3A 1IN5A 4BFYA 5JJIA 3QEOA 1JR3D 2YWEA 1IXSB 2FA9A 4TSFD 1RC8A 4RKEA 2QP9X 2Z0MA 3ASZA 2MSCB 3NC1C 4PZZA 2UKDA 3NXSA 4KLNA 2LKCA 4KJZA 2ZS8A 5GJVC 3H86A 1KI1A 4DCNA 4PSAA 1G8HA 3RNLA 3EG5A 1KGDA 2WJVA 4HUQB 3KKQA 1OB2A 2GXAA 5EZ5A 4DT1B 2EU8A 2WWYA 2XTZA 5DHFA 3QF4B 1RZ3A 1V43A 5TDHA 1ZW6A 2W0MA 2VHUA 2RB4A 3U44A 1CF4A 3B2EA 1YR8A 4LBWA 5CYOA 1QRAA 3FMOB 3IBGA 4PHTA 3WRXC 1U90A 3A8TA 1DVRA 2XNDD 1GNQA 2FZLA 4I1SA 2UVQA 4LC1A 1N6RA 3NHAA 1C9KA 4QG7A 4QHTA 1XDBA 3AKYA 1N6OA 2QY9A 1SXJB 2GWHA 3CNLA 3DKPA 2IWRA 2OCAA 3EIHA 2BMDA 3MWYW 5JZVA 1JAIA 2F1JA 3PXGA 1E1QA 2YKGA 4OBEA 3B5JA 2BHRA 3WYGA 3Q5DA 1HURA 4YLGA 2ZJ5A 4FXPA 2VL7A 2IF2A 4LJ7A 1E6CA 2QPOA 1T9HA 4MA4A 3EC1A 2H1LA 2XNSA 4GOKA 2QG6A 3FMPB 1E2LA 1QDEA 3GFPA 1AK2A 2ZJZA 3T1TA 3CZQA 4HSEA 2UZIR 3QG5A 4BZXA 3N2EA 5LBIA 2XGJA 4OQFA 1E32A 3IHWA 3NEJA 3C8UA 3K9GA 2P3SA 4PPFA 4RFVA 2ZRIA 3I61A 4LYFA 4QC2A 4A0HA 2GCPA 1NKTA 1XCMA 3IILA 5FBVB 3TRFA 1FPMA 3KJEA 1XXHA 3QXSA 1SKQA 4P4UA 1F2UB 4QOSA 1R0WA 2VIIA 4CRWB 2NTYC 3MFYA 4TL8A 2GEVA 4XJXA 1XJCA 5JJLA 4Z1MD 1GL7A 2I1VB 2I4IA 2OXCA 3K0CC 3K70B 3BB4A 3OIYA 1Z3IX 3CKLA 2VTKA 4V0ME 2GETA 1OFHA 2D62A 3T06B 4AK9A 4CVNA 4F38A 3BOSA 4TL9A 4P31A 3H4MA 4NYJR 2ZI9A 3LDAA 4B6EA 4A8JC 1KO8A 1WXQA 3SR0A 3B1YA 4Z8XA 4ZKEA 4I81A 4A4DA 5DYGA 2DWQA 1R5NA 3TVDA 1TTTA 2BOVA 3EIEA 3LBHA 1CJTC 2NZJA 2JJ1D 1P9WA 5L8VA 1M8PA 2GDJA 5G41A 2ZRLA 3UMRA 4KYIB 4MYTA 3JVUA 1UKYA 2DWPA 4B71A 5EE5B 1NIJA 3FHOA 5FPYA 2G1JA 1CBUA 3QBTA 1XPUA 4CEHA 3LA6A 1IJFA 3KDSE 1MO6A 4CEIA 4LYJA 1SXJE 4MQBA 4TLBA 3SHFA 5FUVA 1JAHA 1E9FA 1SVLA 3WBKA 4C0JA 3LW8A 4Q03A 1VG1A 1XFAA 3AF4A 2WWIA 3QNUA 1G3QA 1OE0A 2F3TA 3EPLA 2QQEA 4DLTA 3GJ4A 4UJ3A 2BVNA 5SZKB 2J3EA 4NDZA 2XOKD 1L8QA 5LB4A 1I2MA 3L0PA 5J5CA 1N6LA 1UDXA 2ZE7A 4CIDA 4K8OA 2D7CA 1S9DA 4WZ6A 1P75A 4KSCA 2OLJA 4KFRA 1F60A 2P6UA 3ICEA 2DCUA 1VKJA 1K5DA 2QPTA 1A1VA 4MGZR 1GRRA 3PFIA 3QUSA 1EFTA 2B6HA 2IYYA 4LI0A 3CX8A 4JVLA 1JECA 2X8AA 4DCSA 2LCFA 1XZQA 4Q1AA 2CBZA 4WVFA 1CEEA 3KKPA 2V8OA 1FMLA 3THYB 3L82B 1GP2A 2ZYWX 4LUCA 4CEJB 3ZVMA 4I1VA 2ZUDA 1G5RA 4FI3C 1CP2A 1KI6B 2WKRA 4RZ3A 2HYIC 2J41A 5KDLA 1KO5A 5C18A 3HPQA 1RJ9A 1A82A 2HUPA 4C4PA 4PPQA 3ZZTA 2ZVPX 2ODWA 3FE2A 5KSZA 4FMDB 1KAOA 2R9VA 4HAYA 5J4KA 1G8GA 4B44A 1Q1QA 3HU1A 1RRPA 3RABA 4A0FA 1D5CA 2XITA 1VYUA 4D2IA 3OFND 1LW7A 3DL0A 2BEKA 4M8NE 3CPHA 1ZD8A 2HF8A 3OE7A 4XVUA 1XB2A 4TMKA 1TX4B 1LF0A 3M6AA 2AFIE 3KQKA 2ZITA 4PQFA 1UF9A 3LY5A 2YV5A 3BXZA 1G17A 3BD9A 2IX3A 4M0LA 1J8MF 1TQ6A 4I99A 1UKEA 5EE9A 1E2NA 1NVXQ 4POAA 2ZRHA 3GLFA 2QEQA 3CF0A 4IHQA 4II7A 5LDDC 5UKDA 3Q5EA 3QKSA 3AKDA 1OT3A 1JI0A 1UBEA 1UEIA 2VO1A 3VU9B 2GXSA 3ZQ6A 3QKUA 1ZU4A 3F8TA 1Z0DA 3QY0A 1JXOA 4M1KA 1GRQA 3KJGA 2TMKA 3LLUA 1D2MA 1NN1A 3Q85A 4DCTA 1WRBA 1ZYUA 4LCBA 1G64A 1W4CA 2H17A 2CDNA 4JL8A 4ZCIA 1QBKC 2ECKA 2ORIA 2YOHA 2ZPTX 4OYHA 3N2IA 2HV8A 2O0KA 4G1UC 3CUEF 3P4XA 5EXPA 4DHEA 2ORVA 2QU8A 2OBMA 2FH5B 1S3SA 3K09A 4DUGD 1C1YA 1U98A 4A2PA 3I72A 2J0UB 1W4AA 5EUMA 1H65A 1MV5A 1XD9A 2AKYA 3GJ5A 3MJRA 1JR3E 1NBMA 2FF7A 2IEZA 1E2KA 3QKRA 4TT3D 4EQ6B 3N70A 4RSGA 4B3BA 3CRQA 1N6KA 3DEFA 2K5UA 4V02A 4QL3A 4KXFB 1EFRA 5JEDA 4PSKA 2AD1A 2QMUA 3PUWA 2G3YA 1FX0A 4GP7A 1W48A 2WAYA 3BBPA 3PITA 3VR2A 1NLYA 2REXB 4YMUA 3DM5A 1G20E 5A5GA 2ZREA 3GCGA 5CB6A 2J87A 3HP1A 1JPNA 4YQFA 4ZI2A 3B9PA 2IS4A 2W58A 3BIFA 1SVSA 3CR8A 2HXYA 3QENA 4B32A 1QVAA 3U7FB 3M1IA 5JWHA 3UMFA 2VHCA 3CF2A 4MRNA 1W5TA 4Q5IA 4A6PA 1FQJA 4Q02A 3RWOA 1QHNA 2QBYA 1YZQA 4IEIA 1Z0FA 1GITA 2PT5A 5EJEA 3AM1A 4RD0A 4IRUB 1FL9A 2REOA 2CJWB 5FTNA 3AVOA 4BE7B 1ZC4A 2F55A 4QNMA 3AVYA 2HCJB 1SVIA 1DPFA 4D0NA 4ON9A 3NTUA 3BB1A 5F3WB 1N6HA 3OHMA 2PZFA 5C1BA 2EFDB 1QHHB 1KSHA 3MMPA 2RGCA 1XTQA 4C2UA 1OKKD 5KDDA 5JEEA 3ETLA 1Z0IA 4L15A 5GVRA 1EG7A 3NBYC 3VFDA 3BWDD 2GXQA 4DLRA 1OHHD 4O2RA 3ZLJA 5CIWA 4LOAA 5DNYB 2OAP1 4M1TA 4Q4AB 1KJWA 3PEYA 4KO8A 2KE5A 2Q21A 3WY9A 2B7CA 4DRZA 5DIFA 4LJAA 4NU0A 3TKLA 3TAHA 5JWRA 2BBWA 2OCBA 4JT4A 3ASYA 1FUUA 1G16A 5FL7D 1WQ1R 2CXXA 2C04A 2ZRAA 1KY2A 2Q6TA 4P3YA 3WHLA 1W0KD 3DHWC 3K53A 5FTLA 1KK3A 4EFMA 4LBVA 1NLZA 3KQHA 4HAZA 5H70A 1R0XA 2JLSA 3BFKA 3RRMA 2GXUA 1JQJC 3FHCB 3MWJA 1G6HA 4FWIB 2N46A 4URZR 2D2FA 4LHXA 1KDTA 3UKDA 3AV0B 4WAUA 2H5EA 1EESA 3FMIA 1XD8A 3K09C 4RJLA 3Q8XB 1NJFA 4TLCA 3W9YA 4C0BA 3UANA 1G4UR 1US8B 4X8LA 3IO3A 1IJEA 3A1UA 3SBEA 4NONA 1VHTA 3KQNA 4GNKA 2N42A 3R9WA 1II8B 4CW7A 5L3QB 2CMKA 1HE8B 3KTAA 1QG2A 3A36A 3OEHA 1DAEA 4CDGA 1XBTA 4F7WA 4FMBB 2W0SA 1E2JA 4JVSB 2HJGA 3K0FA 5KNBA 1HUQA 4PFSA 1X8JA 2ZYTX 4A92A 1D9ZA 1GNPA 4XVRA 4DKXA 3FTQA 2Q3HA 2JDIA 4B75A 1YZTA 4GMDA 4DB2A 1U8YA 2XSZA 4DSNA 1Z0KA 1W36D 3KFVA 4AKEA 1T4GA 4LYHA 4D80A 3OAAA 3P26A 2D74A 3KB1A 2P5TB 1W46A 1PUJA 1TL7C 4BUJA 3AQ4A 3RS3A 5EXSA 4DEXA 1XX6A 2ZIAA 3PG5A 4DLWA 4ESVA 3X2SA 3UK6A 3RYTC 2VHQA 5CJPA 1XPOA 1OPXA 3EAQA 3KKNA 1YZLA 3AB3A 5AJYA 4PAQA 3MGCA 5CK4A 1EGAA 5G3ZA 2C78A 3IDQA 1VG8A 5IDVA 1Z2CA 4ARZA 2DB3A 2V54A 2OBLA 3GLGB 4DSUA 4I1OA 4OHVA 4ACAA 3TQCA 4JLAA 2EFHB 2CNWA 5FPSA 1S3GA 1NY5A 3QXHA 1G3UA 3EW9A 4Y0VA 4YXWD 2XX3A 1NVUQ 5D3QA 4G5RA 1H8HA 3TAUA 3UPUA 1R4AA 1ZINA 1E2MA 3RS7A 3T35A 4PTLA 4F4JA 2O8CB 1Z63A 2A2ZA 1UJ2A 2OZEA 1SVOA 1TAGA 2P6NA 5GJCA 3BAFA 2FFHA 3AVTA 2H57A 1KMHB 2AK2A 4PPNA 2ZUCA 1G5PA 5DI3A 1Z29A 3CNNA 3ZIAA 1G8YA 2IHBA 3NVAA 5HKKA 2WBLC 4NHOA 2J7PA 2ORWA 1KZ7B 4XD7A 1T8TA 3H84A 1RRCA 4LV6A 4TYWA 4B2IA 2H7VA 1KKLA 4XVQA 5AUOB 1Z6AA 3U7HB 5KUTA 3MRSA 4OJKA 2OESA 1E9BA 1P72A 1YZGA 3THWA 4IKEA 1Z6TA 3QEJA 2ONJA 2W6IA 1KK2A 4Q1EA 4PC7A 4ZDJA 3U6KA 4CT4B 2F43B 4NYIQ 4HAXA 2GILA 1ZUNB 3GJXC 2D7DA 3CR7A 2KI5A 1ZU5A 2HLDA 4HYYA 4IDOA 2YWGA 2ZJ2A 4RCYA 2DYKA 1VECA 4YMWA 2R8RA 2Q3MA 5FUXA 1DG1G 4BFXA 1KSJA 5C46F 4OKSA 2DFTA 2W6JD 5DI9A 4EIWA 4B2PA 5JI2E 1ZP6A 3MCAA 1XMVA 1MO4A 4OQLA 3SS8A 3U5ZB 2OILA 2QQ0A 1E0KA 2FDCA 1GNRA 1GVNB 1WB9A 4F4CA 4LJ6A 1XD2B 4LBZA 2PCLA 3REGA 4Q00A 1M7GA 3NBZC 2P65A 3FPAA 4XIGS 5FPHA 3R7WA 2LKDA 2GJ8A 2HCBA 4PSVA 1IN7A 1NVVR 3ZVNA 2WWHA 1G7CA 2DWOA 1GILA 3NC0C 4Q47A 4B34A 4JMPA 3GLGE 2BJWA 1W49A 1YJ5A 3FYHA 4AD8A 2FEMA 1NLFA 5TB5A 3WBJA 1LB1B 2JIZA 1NNEA 5FI0B 1Z6YA 3CX7A 1UDWA 3W8NA 1E2PA 4I4LA 4Q1BA 1DARA 2MSEB 4RD2A 3VTKA 2IS2A 5E4FA 1UAAA 3RWMB 3T15A 4G5OA 2PEYA 3K0SA 2H8KA 2XEXA 3C5HA 2JGNA 2EVWX 2VPPA 4KFSA 1LS1A 1O3YA 1JNYA 2J45A 1ZMXA 1S1MA 4MYCA 4V0MA 3NDPA 1ZRHA 4Q4HB 4RZ2A 3O47A 4A1FA 4JYCA 4DLXA 4DVGA 3KFXA 2WJHA 5JWOA 4DLYA 3TQFA 4BWYA 4G01B 1W4BA 4IDQA 1L4UA 3R20A 4M22A 1M34E 4DIDA 4DT1A 2A78A 3EA0A 4JS0A 1VCIA 1GM5A 1W36B 1G41A 4IDNA 1SVKA 1J8YF 4W7SA 3PJRA 1MO5A 3KJHA 3NDBB 1SHKA 5JSZA 2BJVA 3QG1A 4LHWA 1BYUA 4FCWA 5TXGA 2QNRA 3GJ7A 5KPDA 1ZNWA 2OT3B 3W6OA 3DZ8A 1SXJA 1FUKA 4P4SB 3K0AB 2JCSA 2OFXA 2HT6A 4NPHA 5K8IA 2YJTD 2AHOA 2ZRPA 4P4TA 3U3OA 2B8WA 4F92B 1TQDA 2OM2A 5AK0A 4M9ZA 4N0EA 2J0QA 3VMFA 1RYFA 4AG6A 3ECCA 4DCUA 2IYTA 3QJYA 2Z43A 5EXXA 1JB1A 1NL3A 1VPLA 2WWFA 1P2VA 2ZR7A 4Q19A 5CM8B 2F9LA 1J99A 4NTZA 2D2EA 2WKQA 4ZIRB 1NN3A 2KBFA 2WMOB 5JCZA 2PMDA 1AGPA 2XB2A 1W0JD 1HT2E 4PC6A 3MWLA 3LNCA 3SU8A 1OIVA 1ZIPA 5FBLB 1XU4A 2G83A 2ZR0A 2R44A 4ASUD 3FMFA 1U8ZA 1PUIA 3DOEA 4LPKA 4NYMQ 3SJBA 3A6PC 4PHGA 2PZEA 5SZJA 3OEED 1RW4A 4YDHB 2YNMA 4MUBA 4FCTA 2XXAB 4R71A 4PHFA 2IXFA 1KTVA 1X1SA 4A8JA 5KDOA 2RGAA 4F93B 1F3OA 2C99A 1GAJA 5B58C 2KSQA 1ZCAA 1KMQA 1R0YA 3K9NA 2FSFA 5IK2A 4LDJA 5L3SA 2BKEA 4RD1A 1PJRA 4JLPA 3ZQJA 4QM7A 1AS0A 5KOYA 1KOFA 3JVVA 3DOFA 4CZ2A 1E3MA 4JLJA 2QTHA 3TUIC 1HEIA 1YZUA 3G0HA 2DR3A 3IIKA 3AVPA 3V9PA 1Z2AA 5E3HA 1YKSA 1BIFA 2OCPA 1YE8A 1LS6A 1AM4D 1BKDR 121PA 1J7KA 5CDFA 5DH9A 2YC4C 4RY2A 1CR2A 4D26A 1F2TA 4A0RA 4BASA 3R9IA 4EKDA 1OFIA 1M7BA 2WWGA 2WHXA 3WNBA 2B8TA 3LV8A 4NCKA 5JHHB 3O8CA 5FOXA 4JL5A 1SHZA 2GESA 2RGBA 1FMJA 3G82C 5JMTA 2J0SA 2A5JA 2ZSFA 2IK8A 1E1QD 1CR1A 1XMSA 3GJ6A 3W90A 4DDTA 1TEVA 2YHSA 3V4RA 1R8SA 2A7QA 2BV3A 4U00A 2OFOA 3EC2A 2SHKA 5LPNA 2ERYA 5FBWB 4W5JA 5AUQA 2VYFA 1NP6A 2QMEA 2OG2A 2QP3A 3BH0A 2W2XA 1MABB 1AS3A 4Q9IA 2GTPA 1KY3A 2ZS9A 2QSZA 2WSSA 3CH5A 1Q22A 1XMJA 2F9MA 2GJKA 5FFMA 4IVQA 4A82A 4E5UA 1SXJC 2ZAMA 2BMFA 2EWWA 4XSGA 3THYA 4C0SA 3GLHB 1E9CA 4CEJA 2VP0A 5F9HA 1LY1A 1DO0A 2X2FA 2XJ4A 4KBGA 4EPRA 2ZI6A 3TJZA 2AWNA 2GJSA 2IYZA 5CM9C 2AL7A 2P0EA 3AUXA 5KTYA 5JLJA 2OXRA 3UIEA 2R6GA 4YONB 3E1SA 3VQTA 4IVPA 1OW3B 4Q9KA 3T5GA 2JASA 4IDHA 4Q1CA 4FN5A 1XMIA 3PEUA 4CT5A 3S1AB 1S0UA 5DISB 2GK7A 2BC9A 4B2LA 3KUDA 2FOLA 4M1YA 3VKHA 1RVDA 3FHTA 1VCMA 3CRW1 1YVDA 1CLUA 1MRSA 4JBWA 4IFBA 4OK5A 1HY3A 1Z07A 3KB2A 2CK3A 2VRWA 4MRVA 2QTVB 2KB0A 4G5GA 1FNNA 2F3RA 3K70C 3EPKA 2X2EA 4QBGB 4URUR 2O8EB 4KCGA 1ZNYA 3TR5A 1G19A 1FTNA 2O8FB 1QZXA 1VCNA 1U9IA 4YDSA 1NSTA 2IS1A 4BEBA 1IXZA 3AKCA 4MGKR 1UKZA 1ZM2A 1G7SA 1XJQA 4HDCA 2ERXA 3NH9A 4D4MA 2WKPA 3EPHA 1U0HC 4Q9JA 2V4ZA 2G1KA 3FFBA 4UNRA 4S35A 4C0HA 2FE4A 5DO9A 4G3XA 1LFDB 2QTFA 1KO7A 2QAGB 3BERA 2GAOA 2ZE8A 2ATXA 3C41J 4OQMA 1DAGA 2IYQA 1A2KC 3QPUA 4WXPA 4XSHA 1W4RA 3GLIA 5HCIA 2C5LA 3ND9A 3FKQA 4EQ6A 2P5SA 2PH1A 4KAXA 4LHVA 3GLHE 4P33A 4TTPA 1CJVC 1E2DA 5H1YA 4M1MA 5BW8A 4YC7A 1VHLA 4EFNA 4QHSA 5ANRB 4LJYA 2GF9A 1SVMA 1DE0A 3A1WA 3I8SA 4F4IA 3I8XA 3I5XA 2IXEA 1NN5A 4ILEA 5EXTA 4BZPA 4DXAA 1Z22A 4UJ5A 2JJ1A 3W3AA 2C9OA 2Z6VA 5E95A 2Q9CA 1IQPA 3RSOA 3U44B 4ZI3A 4GFDA 3I92A 5FOUA 3F3YA 1IM2A 5SZIA 3OE7D 4YMSA 1X6VA 3UG7A 2GEDA 4TLDA 3IO5A 3MLEA 3AVVA 1T8UA 1KO1A 4EPVA 5KU1A 2CJWA 3RC3A 3DZDA 4IJMA 1TUIA 3M0EA 3FB4A 4EUNA 3ZYCA 3HR7A 3OZXA 3FGNA 1SVWA 1E9AA 2J59A 2OLKA 1E2FA 5JI3E 3SC3A 1SGWA 3SBDA 2B92A 4JSYA 1XTKA 1Z0AA 2RGGA 3G5UA 3KUCA 4NE2A 1QHHA 1ONBA 3H0KA 3W5JA 4HB0A 4E07A 1S2MA 5J47A 3Q7PA 4FD2A 4MH0R 1GRNA 1JXMA 1Y3AA 4UXJA 4XWAA 2X19A 4ACBA 1TU4A 2BCJQ 1M2OB 2ZRFA 1PLJA 5JBQA 4E09A 1VG9B 2QRZA 4BLTA 3THXA 2X1VA 4ZDWA 1IN6A 1BMFA 4TYQA 1DO2A 4Q4AA 4Q4JB 1DAKA 4TWZA 1JQLB 1XXHB 4LX0A 1T3LA 2PMKA 4A2QA 4E22A 2R2AA 5FPTA 2D4HA 2E1RA 1YQTA 3Q72A 4L8GA 5L3VA 1XF9A 3CO5A 3CM0A 2WJGA 2WV9A 2WPDA 2MMCA 4DLVA 5J40A 4ITRC 1U9IC 2F7SA 4WW0A 1E1RA 1S9HA 1KI9A 5FH9A 3SYKA 1H8ED 4LJ9A 4LV8B 1CIPA 1KI2A 3CWQA 4US0R 4CYMA 3BRWD 1OXVA 3TNFA 2WM9B 4IOJA 3EPJA 1WE2A 2O0JA 4K81B 2ZSDA 1WBDA 1TPZA 2XJ9A 4NCHA 1EK0A 3LRPA 4RD4A 4AKGA 2YINC 1CR4A 3AVXA 1CJKC 4JZKA 5CLLA 4IEEA 4C2TA 2DFLA 2EYUA 2ZANA 2VP5A 3UATA 3RC8A 1EFUA 2CL0X 4JL6A 4W5HA 5EZ6B 2JJ8A 3D31A 5L3QA 4PX9A 4CEHB 1E79A 1GIAA 4JBYA 2AK3A 1KIMA 3IHLA 1IN8A 3C5CA 1ZM7A 1IY0A 1WA5A 3TSZA 1OXUA 4JKIA 3I1FA 4LRWA 3B1XA 3B78A 1JEEA 1CJMA 3TE6A 3BFXA 2IYLD 2R62A 2C95A 3T5DA 2H16A 3GJ8A 4ZCLA 1KNQA 3LW7A 2GK6A 4C0QC 3EA5A 1Q44A 2ZRNA 4BFVA 2QMHA 2O52A 3J81k 1YZKA 5E7JA 5EP4A 1DELA 3F5FA 3VR5A 3PEVA 5DSZA 3WP0A 2WAXA 2PT7A 3DVLA 4R2HA 1Z8FA 1FQKA 1OYYA 2A5YB 4D4LA 2HJVA 1WGWA 1XXHE 1BS1A 2QRNA 2CL7X 4JYBA 1G21E 4FMDF 3NBFA 5BN3A 2J7KA 3SDZA 1HV8A 1CJUC 3FFAA 3X1YA 2IA5A 2VSOA 3E2IA 4P32A 5AWFC 1I4DD 3WMGA 4DC9A 5KPJA 3FVQA 3K8YA 1ESMA 3IEVA 2JEOA 3OF5A 4TLAA 3RS4A 3I3SR 3ADCA 1FW6A 3QQ5A 1UM8A 3R9XA 1AZSC 1G291 3KL4A 3SJZA 5J4HA 2ZXUA 1DAHA 2EW1A 2VP4A 2FX3A 5LD2B 3GLGA 3LLMA 2WOOA 3DDCA 5JRJA 2IEYA 2Q9BA 4B35A 1F5NA 4EDHA 3RANA 1K6MA 1ZJ6A 4PR0A 2IUTA 4TTRA 1P2TA 2OE2A 2O8CA 4IW3B 2CE2X 1HT1E 5DGXA 2ZRKA 3L43A 4BQSA 5KO2A 1E2HA 2QPAA 3MJHA 4EJSA 2WSMA 5TARA 2ZM5A 3WMEA 3V00A 1OH6A 1M1YE 1EX7A 2BM0A 1KMHA 3GLFB 4LC0A 4KU4A 1Z08A 4BGDA 3R8FA 1D9XA 1Q3HA 2RGDA 3PUVA 5KHOC 4KSBA 5JRZA 2O8DA 2GCOA 4KYUA 4A15A 1NIPA 2HXSA 4YMTA 1NMZA 2Q3FA 4LV5B 4M1OA 1Q12A 1AKEA 2J9RA 3OEHD 3QI2A 3VR4A 4UNNA 1RIFA 1II9A 2REBA 3C15C 2FFQA 1PV4A 3GFTA 5AUNB 4V0KA 2VSFA 1GG2A 4NH0A 2WVJA 5J4VA 2R6AA 1DAFA 2CHQA 2ODEA 4JBXA 3ND8A 3RRNA 2F43A 3GFOA 3VNUA 3W6PA 3HYRA 2OO7A 3GP8A 1EWRA 1L7VC 3W8RA 3B85A 4DSTA 2XSZD 3U61B 2ZRBA 4NMMA 2JJ2A 2N1BA 4G5QA 1X1RA 3VAAA 2PJRA 3F0TA 5D3MB 3SHWA 1XEXA 3FDIA 3ZD6A 2GVDC 1Y63A 4J0QA 1GKYA 2GRJA 3HWSA 2B21A 3IQXA 5JJKA 2C2HA 3RRZA 1OB5A 4GMXA 1U94A 1GWNA 4NKRA 4D25A 2X77A 1FX0B 1OXXK 4HB3A 1P73A 3BH6A 4BFTA 3CRVA 3RS0A 4XWKA 2FGKA 1XEFA 2O0HA 4QGAA 3H2YA 4C7OA 2NIPA 2VEDA 4MGIR 2WZQA 4M53A 1KK0A 5BQ5A 2QP4A 2WIAA 4IVRA 5G3YA 1Z0JA 1DADA 2QE7D 2O8BB 2CNWD 4BLSA 5M04A 1XWIA 3CB4A
chains in the Genus database with same CATH superfamily
5IZ4A 3UJBA 2BJHA 5KTTA 3PC4A 4X7BA 4C4OA 2PANA 1LNZA 1ENPA 3TK1A 1O4VA 2VJDA 5TVKA 3MYIA 1Q2UA 5HYVA 5JD5A 1JKMA 3KQQA 4R5HA 4JJ6A 3UHAA 1NG1A 4L5YA 1L5HA 1XTIA 1R8YA 3RK0A 5JTTA 2HQRA 3BB3A 3CLUD 5ELLA 4RLHA 5AI4A 2BGKA 1XQVA 2B1QA 4IFIA 3HA3A 1KMCA 2P30A 2B4KA 4NZYA 4UNQA 4MS1A 2OFWA 3MWEA 4ER9A 4HZIA 3QYJA 4ESHA 2FI1A 1C30B 2VH5R 1U28A 3PJGA 1Z88A 3EEFA 2YMMA 4RAOA 4F9FA 2SKEA 4DUZB 1RC1A 5F35A 4EHDA 4MO2A 3U3MA 3DLPX 3ANXA 5BYKA 5JARA 4BX3A 2CE7A 2E0IA 3DFKA 3FETA 4S1PA 3BGVA 4X41A 1AK1A 4UEWA 3WYAA 3VYUB 3VX3A 1U0JA 4Q15A 2O2XA 3P9KA 5ECYA 4BCCA 1H6AA 5AKYA 1O3UA 1K05A 3P4YA 4WXEA 3NOOA 3FKSD 4BO9A 2L0XA 4IEFB 1KYZA 3AESA 4Z9IA 2EX1A 1S8FA 2F00A 4O25A 2A0BA 1KQ3A 1OAKA 3WK5A 3LCCA 3A2MA 2ZRGA 3FBGA 5JDCC 3S8EA 2HT1A 3AF5A 1FP1D 1R5JA 5I4IA 2QVXX 1K3FA 1B8PA 1JJVA 1KYQA 1PFWA 4JIMA 5IJAA 2PNFA 5EUQB 3MRVA 3LEVA 3OKCA 2NXJA 4H35A 1QM5A 4RPKA 2AQIA 2IYOA 2P2LA 5DXJA 4TSKA 4R68A 4TTSA 1NSFA 2B7BA 3H2VA 2DF8A 1T3TA 1NXQA 4WXHA 1AF4A 4MHOA 3AJEA 3TBKA 4UFNA 1JU9A 1JDPA 2I1QA 2K4MA 4HOYA 1FVFA 1MC8A 1E7SA 4JJKA 1V25A 1B6GA 3C1AA 4YR9A 1NYQA 3GGPA 3EISA 1NVFA 3FJYA 1V95A 1R4NA 5LDGA 4JNCA 4EUFA 3JTEA 2QORA 1N6IA 1Z2NX 3A25A 3SQNA 5BOSA 3T34A 2WF6A 2ZYHA 3HR8A 1OI4A 3FUWA 3VZPA 4OCZA 2ZI4A 1T9KA 3KWJA 5HW0A 4G1FA 4HLUC 3AU9A 3UUGA 2GRUA 1Q84A 1MMGA 4DC0A 1GQQA 5K8TA 2AEFA 2VJMA 1V8FA 3MHPA 4MQLA 1KKUA 2X0EA 3KWLA 3L4EA 3GRPA 3CLTD 2VDKB 1OXTA 1WB6A 1R6BX 1ZCFA 1D2NA 3DL7A 1AUXA 1SC6A 1SBIA 1GZ3A 3IKJA 4IRUA 4F9GA 1U9YA 1VE1A 1XG5A 3A4YA 2ZAOA 1NMXA 2FU5C 4DQXA 3OU6A 1DHRA 2FNAA 4X1KB 3ADPA 2QK4A 4V1CB 3AVUA 2EV9A 2JFHA 1ULAA 4MMXB 3T3OA 1N3LA 3Q9NA 1ZK0A 4NAVA 4IX9A 5IT4A 2YVLA 5IZCA 2NV0A 3LT0A 5CIQA 3LPLA 2AA3A 2YL1A 3A06A 2XF2A 4NDNE 1FFHA 1ZM3A 2EGUA 2J0WA 2BBSA 1ZQ1A 3GY0A 2WUFA 3ZKWB 3TXAA 4NMLA 1P4SA 2BLLA 1BCSB 3VR5D 1X92A 4XGKA 1SKYB 4F12A 1FAPB 4JU9A 4Q9NA 4DUGA 2KM1A 2P2CA 1IXYA 4YV7A 2ZB7A 4W6ZA 2X8WA 2P4UA 4EA7A 4IV5A 4M9CA 2XCSB 4Y1RA 4HB2A 4AYXA 1RJ9B 3P0RA 3P7MA 2EILC 3D5EA 4EY8A 4TM7A 2WUDA 3RR2A 4B43A 1ZOIA 1U63A 1R5ID 5HIAA 4BLPA 4Q4ZF 3B3JA 3P4UA 3KZMA 4FEYA 1MB0A 3L6OO 3HBNA 5ALXA 2BTEA 1VMEA 2AQHA 3AQIA 1OR3A 4QJBA 1G63A 2Q62A 4EG6A 1JNXX 3DGEC 1HEYA 2UYQA 3I62A 4LJ8A 1KEPA 1CUCA 3INYA 5IJWA 1DEOA 3FCOA 3L1IA 1RC0A 1A9XA 3UAOA 3NR2A 4M46A 1FK8A 2WT8A 1LTQA 4Z4GA 4B6QA 1V96A 3I6MA 4NH4A 4YJ2F 5HCNA 1U2QA 1COWD 4L8FA 2C03A 4BKPA 3AY6A 3HUEA 1N6PA 3A11A 3ZXYA 1YVPA 2O1SA 4Q6WA 1I7LA 1KQPA 3EIXA 3PFHA 4JY7A 4L2IB 4BLRA 1LBSA 3LY8A 3IQWA 3A14A 4YMIA 3AF0A 2GA9A 4M7PA 4O6YA 3B53X 4CWAA 1HF3A 4KFTA 4CCYB 2E2WA 5ALNA 1E0SA 3E9NA 1RKQA 1MCZA 3VVCA 4OK3A 3H4TA 3EOZA 4EHNA 4CKCA 4NICA 1CHDA 2CUKA 3IDZA 1CRPA 3DH0A 2R7RA 2QS9A 5KMGA 3R74A 4NBVA 4RGVA 1JHOA 1SQ0A 5KJ6A 3A27A 3ED1A 4A6DA 4Y9SA 2XL4A 2IU4A 3OQIA 3K0FB 2G80A 1C50A 3LECA 3UBMA 3N6XA 2K2QB 4L7QA 4D9HA 2RAFA 3ZWPA 3S99A 1PL7A 1R0KA 3I45A 3I01M 4OSOA 3UH1A 2G8NA 3W3ZB 1S7ZA 1T9DA 4PFKA 2Q6OA 1KYYA 4O6NA 2I62A 3CC8A 3QBJA 4XVHA 1M74A 4NMHA 1JSXA 3HUUA 2HJ9A 2OVBA 4I9NA 3BTSA 3JQQA 3DXFA 3IJEB 4Q7KA 1YB5A 1ZMBA 4LZJA 2FETA 4HX2A 2BONA 2Q9UA 4J7XA 1T4BA 4O4HA 3VC2A 4UM9D 1WLSA 4FCVA 2YBDA 5CA1A 3UGPA 2AU5A 3E03A 2I33A 2VPYA 3U6BA 2WZFA 3ROFA 2PXAA 2LFDA 4C06A 4R7ZA 1VCHA 4F2WA 4A5SA 3KJZA 2LWIA 4I0WB 4OMFG 2PL1A 2C4HA 1XSEA 4ETNA 2J9UA 4P8RA 2QTTA 4UCXA 4NBSA 2F2TA 5ESDA 4P35A 2OP0A 3QU7A 2FR0A 2HXGA 4N40A 2JAPA 1E8NA 2Z0MA 5IKOA 1XLWA 1Y6DA 3Q15C 4PSAA 2HRDA 4CPDA 1A9QA 3NP9A 2BISA 1NUHA 1POXA 2B0HA 1Z4NA 3OHSX 4G2TA 4LC1A 1C9KA 3ZI4A 3DKPA 1DRWA 4PG4A 2FUG1 3AOEA 3FDZB 4RH0A 2WQZA 4CHTA 1UPXA 3F7NA 2VAPA 1UAGA 1MB2A 2DOKA 3DV2A 1REQB 5DNCA 1Q17A 2CXSA 2E49A 4PPFA 5AHXA 1L8LA 2OECA 4CS8A 3E7FA 1P3Y1 4MROA 4Z1MD 1CY1A 4HL6A 3BB4A 1JIVA 3BOSA 1DIAA 1TYCA 2R1UA 1VPEA 5COGA 4P3NA 4N5HX 4ZOEA 4PCLA 4R0NA 4GO1A 1CUXA 3L5OA 2ZWIA 5A7FA 3VZDA 5EE5B 2HCTA 3LA6A 4KDFA 5FUVA 1N2IA 2O3RA 4UDOA 3KJNA 1G3QA 1M56C 2QTBA 1YZ3A 1P1RA 2WWVD 2FMIA 4QYMA 1E6WA 2X7XA 3TOVA 4Z9HA 4I50F 4FHDA 1X13A 2LGJA 2QPTA 2PR2A 2LCFA 4K9OA 3UFBA 2Y93A 3EYAA 2HYIC 1RKVA 1KO5A 1NFNA 4C4PA 1DL5A 4RKWA 1JKIA 5I8PA 2XITA 1LW7A 3DL0A 3IP9A 3BE5A 5CCEA 4TMKA 5C5IA 2DYSC 1W73A 3BD9A 2YHAA 4I99A 5EQFA 5EE9A 3L7BA 4W5RA 3AFIA 2RKBA 1DV2A 4DV0B 1QAQA 5UKDA 3QKSA 1JFFB 3UNGC 5KZMB 2TMKA 3H9JA 3V55A 3LT1A 5K0EA 1RQRA 1PJTA 1MPXA 2OBMA 2CHEA 3ZBUA 5IUJC 5DF1A 1YFKA 1BXRB 4TT3D 4B6JA 3OZBA 1Q0KA 5SV2A 3MFNA 3RUEA 3VR2A 4CLEA 5IMBA 4YMUA 5A5GA 4HUJA 3D6HA 4ZI2A 4PGMA 1U0SY 5ITZB 1WZUA 3WWZA 1JG7A 2ASRA 4EVSA 1DEXA 3W3AH 2FWMX 4H60A 1LXCA 1Q6ZA 2PLNA 4ETWA 2XKJE 3FYUA 1VBKA 3MCWA 1SVNA 1N6HA 3THRA 4G2NA 2AJDA 1X1TA 3LQ1A 4IKPA 4WJ0A 4BYMA 3ABSB 3HRKA 3LX6A 2JFQA 3B1JA 4LOHA 3LKDA 2P9CA 4RC9A 4CMBA 4Q4AB 4CMJA 5BV2P 4CTKA 3TAHA 3RFFA 1GZ5A 1GZDA 1EA7A 3KV1A 2PQ6A 3N07A 4HGYA 4E21A 1XZFA 4HWRA 5LZ4A 3WV5A 4X8LA 2MYTA 4FHFA 4P6VF 5L7YA 2ZQYA 2HJGA 2IUEA 2XLEA 5EEHA 1RBYA 1D9ZA 2Q3HA 3V4PB 4HWOA 1KETA 1ZMTA 1W36D 3KFVA 4EMBA 1SUPA 1RP1A 5EXSA 4JXKA 1KXJA 5BVGA 4PS1A 3PD1A 1BRMA 4RPLA 1O89A 1ESDA 2C78A 1V1RB 4IAQA 1BW9A 2RK6A 2FRVA 2D2VA 3B2NA 3NKDA 2IPOA 5LJLA 3LPNA 3OX1A 1THGA 1U0GA 2OZEA 2P6NA 3OC0A 4EVQA 3BAFA 3OTGA 1G5PA 1QAOA 2Y6VA 2PGOA 2V59A 3KLMX 1BXGA 3O9VA 5LMZA 1E59A 4MSUA 5KUTA 1U9CA 2OESA 4IKEA 4ZDJA 4D3FA 1ES9A 2KI5A 2YWGA 3E9EA 4BFXA 3KIPA 2O3QA 4GE0A 1WSAA 1XMVA 2ZVDA 2MR5A 5F7JA 2JZOA 3L8IA 1NLFA 1BMQA 4MB2A 4RD2A 1Q7TA 3K0SA 2ID4A 5BPFA 4OXXA 4CM8A 1JNYA 2NSLA 2PYDA 5AMXA 4V0MA 1ZRHA 2VC9A 3G49A 4O2AA 3TQFA 3E2MA 1YVUA 1GM5A 1M73E 4ZK6A 1A9PA 3MBGA 1RQLA 3NHPA 4FCWA 1UBSB 4PLWA 5IYZA 4NFLA 1I0IA 1YYJA 1SOMA 4FNAA 3FCXA 2D6FA 1NBIA 3ITDA 2XRZA 4FESA 3JQAA 1D7OA 4QYWA 3MWLA 5U4XA 3LHFA 3UXYA 3ETGA 4U6SA 2JIBA 2PUAA 1W5FA 3A6DA 5JMWA 4PHFA 4YRJA 4R1SA 1X39A 1YDGA 4LQLA 3RJ5A 1Q11A 3ASOC 3DMRA 2WLSA 4LDJA 2BKEA 2XMBA 1PJRA 1QV6A 1E3MA 4IDBA 1PCXA 1SBHA 4L73A 4EVIA 4Q93A 2WFLA 2HZBA 3GN1A 4ENVA 2QLTA 1OFIA 5JHHB 1D09A 5DLEA 3WRWA 1YB4A 1U7HA 2IK8A 3V4RA 4JLWA 2SHKA 2YQYA 1H9TA 1E18A 1JT2A 4N01A 4Q12A 3N53A 4XSGA 3DAYA 2YL0A 4LF5B 1QE3A 3U48A 4F6RA 5ARCA 5CCDA 1PWXA 3EULA 4YLYA 3AR3A 2B94A 2FZCA 1FB5A 4F85A 4I6GA 4OD5A 3H5VA 2E6UX 4YPOA 3D3JA 5COFA 4B2LA 3C5EA 4E13A 2J9FB 5K0ZA 3M2PA 1EFPA 2B69A 2ZWVA 2Q4EA 2EAUA 2O8EB 1ZNYA 1W76A 4HGRA 1CS0A 2JF0A 2O8FB 1RPJA 3IXQA 3CQZA 3BWVA 5C1PA 3QVMA 4S35A 1OFVA 3ZQ4A 4E4TA 5TS3A 1O6FA 3WLIA 4OQMA 4YRCA 4KAXA 4FBGA 5CU7A 2AQ8A 5HWSA 1RLJA 1GZHB 5F1YA 1V7CA 1T9AA 3TNYA 1MOSA 3PDCA 5K0SA 3ISVA 2NU7A 3SKXA 3LAYA 2DUJA 5SZIA 1TCVA 5KYWB 4IFTA 2C5FA 3AVVA 1OTHA 1J1IA 4QOFA 5CA0F 3TPFA 2W5UA 2V98A 3JTLO 4YCMA 4AS1A 3FGNA 1NHWA 1ILWA 4XAQA 1AUVA 2KNHA 1U3TA 1GRNA 3JAWA 1FFWA 3BWXA 1QF7A 2BGWA 3W78A 1NR1A 2YS6A 1B8OA 2V7PA 1G2OA 3OKAA 3GNTA 3PXAA 1QH9A 3OQOA 4ZOAA 1GSAA 1YJCA 3OJXA 2Z5LA 1R9GA 4A1OA 3GWGA 3PIDA 5ALIA 1LPBB 1YZAA 5IKMA 3PQ6A 1VIVA 2ZUSA 3DEYX 4DS3A 3R3XA 5JH7F 3A6LA 2GK6A 1QVWA 3DBHB 3ROXA 5FPQA 4F6LA 4P54A 2CXUA 3HADA 1CZHA 4IYRA 4TZTA 4Z53A 3ENZA 3UBTA 3L02A 1Q0FA 1SCUB 5IH7A 1OYYA 4IDFA 1U3FA 3LTNC 2CL7X 4MB0A 4Z9AA 3SDZA 1P0FA 2IA5A 5K3BA 1AVTA 2IHJA 1OV6A 3Q7EA 3G0CA 3RVJA 1RKCA 1AZSC 1ZH0A 2IEYA 4B35A 2O9XA 1YB1A 3UC9A 5DS6A 3GLQA 4H3KB 3OZIA 4EJSA 1QGAA 2O7NA 1DZ3A 2BM0A 3RIEA 2A0KA 5KQSA 2GCOA 5HFJA 2H7YA 5K2MA 4FMPA 2HDHA 4F71A 2QTNA 2Q3FA 5MFZA 5INTA 1PV4A 3GFTA 5ICFA 4BVHA 5TJ5E 2Z2IA 1GG2A 2YWAA 1H5UA 4JBXA 3WLMA 4MVYA 3VNUA 3FNHA 2DUNA 5BSFA 4E18A 3AJRA 3R0IA 3CEXA 3F0TA 3V7WA 4EO7A 1Y63A 2C2HA 4DIMA 3DYVA 1W1UA 2X77A 3EZLA 1NFQA 2O2SA 4HEA6 2ECPA 1KK0A 4YCLA 2FOIA 1H2AS 1DADA 3CH7A 1JLLB 2VT7A 4FQ5A 5AHWA 5DCLA 3TW0A 2I76A 821PA 3DE4X 3CXRA 4JYMA 3UXHA 4LF9B 5M2QA 3NIFB 3G7NA 3GD7A 3F6YA 5J43A 5CITA 1JVNA 5ECWA 3IRVA 2XAUA 3OIFA 4I4NA 3QF7A 3U4QA 2OU6A 2G6BA 3OT5A 5ITVA 4F84A 2OV4A 4GIBA 4CCWA 3BMXA 1DKMA 1H05A 3ZDCA 4ZRDA 1TEZA 1UJCA 3SSMA 1G8AA 4UTZA 3ZWIA 4MKHA 2BP7B 1DDIA 3C45A 4JCZA 2NAPA 3SYTA 4EW2A 1M6HA 3B1VA 2GBGA 5KS2A 2OXTA 1BDIA 3OIDA 2CSXA 5KVAA 4B87A 3CPEA 4AXBA 5B7PA 3RCBA 2A4MA 3DUFA 4DBLE 3OWOA 4XOIA 1U2RA 2YQ5A 1K8RA 2PUJA 2H2GA 2FMXA 4O4IA 3OJLA 3DT8A 5CVEA 3DW1X 2NTVA 2G09A 3UHPA 4R9RA 2QZZA 5AXDA 1ZMOA 2WYVA 4CE6A 2PDAA 1CZKA 2OD7A 4JP5A 3Q9LA 1QO0A 1YC2A 2UZ4A 3HO1A 3Q41A 1NRIA 5C8VA 2WYHA 4MICA 4RENA 4EECA 2FF5A 4QELA 4J2OA 4MV5A 4DOMA 1M6TA 4RVFA 2JA2A 3F46A 3RH3A 1ESNA 1U5BB 1OV4A 4HLNA 1E2QA 3M4YA 1CZUA 4MLZA 4GI5A 4L57A 1DOWA 3AEXA 1QJCA 4K7JA 3V1UA 4C0LA 3RYIA 4LZWA 1U28C 3U56A 1HQYE 1AQJA 3G5TA 4JGGA 3OPYI 3L0CA 1Z4MA 1K6IA 3MLBA 1MX3A 5DGIA 3NRCA 1SUBA 3QUBA 1DBIA 3WGOA 3NKFA 3DUWA 1JQDA 1CDOA 5LKRA 2NOAA 1Q0PA 4NS1A 1WZIA 3INTA 1U4NA 2ZYAA 3RI3A 1WHTB 3G8CA 1NUTA 1R9JA 2JLVA 3NIWA 4X64B 3B1WA 3IJRA 4MKIA 4TXNA 1OOEA 1Q7GA 4XM0A 4ZCMA 1U1EA 2ZKIA 4WLNA 3Q8WA 4HAWA 4ZVUA 1PV2A 2Z09A 4P3XA 4MVZA 3OJEA 1QH0A 1NUQA 4G0OA 1FDTA 3OZSA 2YYYA 4WLVA 2FV8A 5E9AA 2BFDB 3R5FA 4KRXA 1CNMA 2HV9A 4KMRA 5ITWA 3O8BA 4IJQA 4ZQEA 3U40A 1ZCBA 4LDKA 4FIDA 4OTZA 2P5UA 4B4WA 3CEAA 1DUSA 5P8WA 4HLDA 4ALLA 5MDHA 3GM1A 3I83A 1GQOA 3QW1A 5J3JA 2PUTA 2RKOA 4G36A 1ZK4A 4DWVA 1WKBA 3I5YA 3QXGA 3MBKA 2GEUA 4LQDA 4DLNA 1SOWA 1TMKA 3KELA 2QAGC 4Z0PA 1SG6A 2B4TO 4F45A 2V7GA 1X1EA 4CM6A 3TK0A 1AO3A 5HGJA 1I24A 1RJEA 4R81A 4J43A 4XUCA 1M0TA 1ZH4A 1TJ3A 4BFWA 5EKDA 2XB4A 2B3DA 4YMLA 1UPBA 3NTRA 4QU0A 3S2IA 5IFLA 2Q7RA 3I3OA 2Y9PB 3GRZA 1G9TA 4US1R 3TEMA 3E4DA 3WXMA 2J5QA 4HATA 1HTBA 2XLOA 4EB6B 4IIXA 1C8LA 4E70A 4DAEA 4JR2A 1WDKA 4MPTA 5IFKA 4WH0A 2JLBA 1DIOB 1E1RD 4YBZA 1MIOA 5CT5A 4AF6A 2C4KA 3MJVA 3I2JA 3DNFA 5TVGA 2NU9B 1W88A 2C9MA 1HDCA 1L7AA 3ZXXA 4CIWA 1CJSA 5B6JA 3HSKA 2HHCA 1QKJA 3RVKA 4N9WA 2C7OA 1QFXA 2J3QA 2PGAA 4GKKB 4CIHA 1QYIA 4N18A 4U7TB 1II8A 1RAGA 1W1WA 1MOZA 4ZEOA 5IVKA 3WVNA 5H16A 4I5IA 5JG7A 4TN1A 3N74A 2P9HA 1KJYA 3EIOA 2QRVB 5HKLA 1OGYA 1Z5OA 3ZVRA 4UKDA 2VB6A 4B82A 421PA 5JQGB 2WTUA 1CV2A 1G3RA 3E53A 3JYOA 1V1JA 2CZCA 4FINA 5L0GA 2W9XA 1WDMA 3TR0A 3B9RA 1HOXA 5LD2C 2RGNA 1XTJA 2CY0A 2ECOA 1P91A 1DPGA 3OZDA 2HRCA 3IPLA 1WXWA 3BORA 1SXGA 9MHTA 2V6JA 3U9LA 2ZR9A 3MMNA 5IZCC 4U5EE 1J07A 3ODPA 5E4TA 1CJCA 3AUKA 3A2LA 1EGQA 3LXXA 4N48A 1H6GA 2WYUA 3OAAD 1X94A 2AX4A 3Q87B 5L53A 3EVFA 4Y1GA 3AERA 3I28A 4J9UE 4D4NA 4NQFA 3OT1B 1E0AA 4HZUA 1N25A 2NQ2C 3BTUA 5B3JA 2VF2A 2FLKA 3I32A 3U8PA 1U2TA 4R1PA 4Q9LA 1SWWA 4X8HA 5DT2A 4G23A 5IASA 5DWVA 5IEBA 4QGHA 5JAHA 4MINA 1WXFA 4HRVA 5KKCA 3UMIA 3OC6A 1HG0A 2NYAA 2P0YA 1YXMA 3LDFA 1VIDA 3O4RA 3G13A 1PNTA 1WLYA 4H3SA 3QE3A 1AXEA 1DBSA 3B1ZA 9GPBA 4OHZA 4CR8A 2GBIA 1L4KA 4PLPA 4ADSG 1B4DA 1P1JA 3THOA 3U9JA 1GQ2A 3K7EA 4Z0NA 2V45A 2XXBA 3PEEA 1IEVA 4HYTA 4X24A 3V4LA 4FR0A 4MVMA 3BHIA 3T3NA 1K0UA 1UZNA 1KORA 3WKEA 4ZRNA 4GC9A 2C77A 5DRTA 5FOWA 2W2LA 3EWAA 2ZUTA 1ORSC 1W2GA 5IHPA 2FMHA 2C61A 1SBTA 2JI9A 4NBRA 5C7OO 4ARZB 1H23A 4CUZA 4HVTA 2GASA 4I5EA 1N2HA 2PUFA 5GINE 1Q57A 4G7ZF 4EUSA 3P9RA 3BS4A 2WVNA 5LQAA 4HVLA 1JEDA 1MB9A 3B7GA 3L0IB 4DLZA 3AUUA 1TRKA 4PRLA 1T36B 1D1CA 2YEVA 2AZ4A 1EFCA 1IDN1 2DPXA 5A4FS 1Z2PX 2P40A 3PGA1 2DBQA 4CM9A 4FNGA 2OXFA 3QBVA 1JG4A 2XMSA 1RMTA 5IY5C 1MG5A 3UG6A 4CHGA 4RFSA 4K9DA 3I6BA 4XFDA 4D4XA 4X00A 1JALA 2ERCA 1IUOA 2VVTA 1NSGB 1OF1A 1Z73A 3ENQA 3DMGA 4KBFA 3OEOA 3IOMA 1AF7A 1EUDB 3JZDA 3FMVA 4GMFA 3UJPA 4WFJA 2PLAA 3H04A 4H16A 1Z2OX 1OWNA 5JS2A 4X3OA 2UKDA 1EUCB 1AGYA 1OB2A 4NESA 2XTZA 2CJYA 1SG0A 1EK6A 2RB4A 1HG1A 1YR8A 4R54A 3BYZA 4PHTA 4C07A 3B7WA 2AC2A 3VZSA 4EY6A 4ZZ1A 1XWFA 1USGA 3MWYW 4UTPA 1SXPA 5DQZA 1L7PA 1JILA 4YJGB 1E2LA 1AK2A 1NMSA 2D4AA 3EVTA 4BZXA 2GQ0A 4YRGA 4PN3A 4QC2A 4UC0A 1NBOA 3IT0A 3DP9A 4QOSA 1R0WA 1P6QA 1OLSA 4IWXA 3KUKA 3HBLA 1CUSA 3CKLA 3AXSA 1LH0A 3T06B 3PFWO 3WQRA 1AK9A 2P2GA 2W6OA 4A8JC 3ER6A 4F8EA 3DD7A 1R5NA 5C80A 5G41A 4U2CA 1S89A 3H2GA 3TM5A 2Y05A 3K1YA 4IHAA 2P7HA 3FWZA 4TLBA 3PHHA 3TYXA 1JAHA 5IVDA 1NF8A 3OMXA 2WWIA 3CLRD 2XEDA 5J5CA 4ED9A 2D7CA 1HY5A 1K5DA 1BS2A 1TZKA 1XZQA 2IBFA 2V0CA 4HS4A 1V4VA 3AOEC 3PLAE 2XVXA 1G2IA 1KI6B 5KDLA 3S3TA 4EY5A 4HAYA 1Q1QA 5EJ9A 4EKGA 3UHFA 5EIBC 4JR0A 4M8NE 3CPHA 2Z6UA 1TX4B 1W9HA 4PQFA 3NRHA 4CS8C 4CL8A 2D1TA 4OB7A 2ZRHA 1ZIDA 4IHQA 3AOUA 4LWQA 4HDMB 1MMFB 3RU9A 1UEIA 2C97A 2OQMA 3WAQA 4KDEA 4RTJA 1G64A 1OCOC 2Z2XA 4G65A 3K1IA 5A4DA 1YR1A 3CFYA 1U6IA 5HOQA 2GEJA 3MJRA 3C74A 4MVUA 4E0HA 3NGXA 1HBJA 2CW0F 4D99A 2QMUA 3KLNA 3VMMA 2REXB 3QLEA 3GCGA 4JJEA 4B32A 2PUVA 4WKCA 2JGDA 2N75A 4GWKA 3KEQA 1SK8A 4C20A 4QNMA 5TGZA 3BRQA 1FCJA 4K0DA 1XALA 3NYMA 3G8BA 1YAHA 3HBMA 2TECE 1QHHB 1M1XB 4UU7A 4K3VA 4CM1A 1DC3A 4ZT7A 1K98A 3FOEC 4L15A 3TAXA 4TTVA 1K7SN 2JJQA 4M1TA 1NVDA 4RDHA 4OJMX 5DIFA 2OCBA 5EMLA 4ZPJA 2CXXA 2VYND 1IEQA 4H31A 1K3TA 4OHUA 3JQEA 3WK4A 3WHLA 4HWGA 2HOQA 3KQHA 1B68A 1G6HA 4DMCA 1KH3A 2N46A 4EG3A 3UKDA 3AV0B 3HBFA 2YMQA 3HNPA 1OBCA 2BR3A 5KJCA 1UZUA 5EKTA 1US8B 3I9V1 3IO3A 1QG2A 1E6LA 5JSLA 1DOVA 1LBEA 5KQMA 3F97A 2VJLA 4CQLB 1I3OA 3FCAA 2P78A 2I4RA 3KUUA 1U8YA 3DHEA 1Z0KA 4AKEA 2IOHA 5L7TA 1UMBB 1X9GA 2OCKA 3B38A 4DLWA 2Q5OA 2H2WA 2VZEA 4DCJA 3FYUC 1OPXA 1PTJA 2W43A 3TECE 1ZA1A 1PW7A 3VUEA 4RVUA 2EP7A 4NZZA 1A8QA 3RC2A 2IXDA 3SFTA 2LVBA 2BTOA 1NY5A 2Y3IA 5DCYA 4PTLA 1PFYA 1R9MA 2BGUA 4M99A 3EVNA 2J4FA 1O9HA 3P9QA 4YGYA 1ECLA 3HEAA 5DLPA 4AICA 2HC9A 2JK1A 4HGZA 2J9GA 2B5VA 4YS6A 4DQKA 4D97A 1DP4A 5DI9A 3KHTA 3SS8A 1E0KA 5JDIA 1VC2A 3B9BA 4GM0A 1R64A 1AQIA 3P9PA 3DJNB 1T25A 1JR4A 4MJ3A 2BJWA 2B8NA 4MEBA 4PZ0A 4GRIA 3CVJA 4LHSA 3NNNA 3W8NA 5E4FA 3FROA 2OFFA 1TPYA 3C5HA 2HA3A 1I4YA 4XIFA 2ZUFA 2P69A 3OTIA 4FQ7A 1GG8A 4Q4HB 2XLVA 1Z7YA 3KFXA 3TD7A 1U2GA 2PS3A 4ZRMA 3ZGNA 1KDYA 4BTVA 1TO1E 1SHKA 1I4ZA 1VL6A 1XPJA 4GX0A 1SXJA 5I48A 5K8IA 2B1GA 2YJTD 4MQ6A 4O33A 3EQ2A 1CIJA 5IAGA 4WLEA 5JTUA 4IH9A 4OUKX 1IBSA 4UVIA 5K51A 3MT0A 4LISA 2Z6QA 3KU1A 2XB2A 2QB5A 2VJQA 5B53A 4QXMA 1OIVA 3C70A 2ZR0A 3B36A 3RC7A 2YNMA 4FYKA 4KXUA 3WO1A 4LF7B 4WCDA 4M76B 3H5IA 4FWVA 2YWJA 3A32A 3U1VA 4MDYA 1NVEA 2AJBA 2QTZA 5IK2A 2ZCVA 4JLJA 1A7KA 3PRJA 3X44A 4EUKA 3A9UA 1YE8A 4MV3A 1VKZA 3NYWA 3O5AA 1VE7A 1AN9A 1MW9X 3GJ6A 2IZ1A 2VOEA 4PACA 2XE4A 2XQGA 2B5OA 5D5PA 2ZAMA 3H0EA 2Q6IA 3U4DA 4LJKA 1LY1A 2X2FA 1LX6A 3B5IA 3C7TA 4X1KA 3C3JA 2WSBA 2X8JB 4V1CA 2XGSA 3HB9A 2B4AA 1TZCA 5HQ3B 2Q5FA 3JVEA 4HXYA 5ALKA 3I34X 3CGWA 4L6AA 3PS9A 4CL0A 1Z23A 4K05A 2Z56A 1IXZA 3GORA 3T4RA 3ZKWA 1A9TA 1Y9DA 1WCYA 1ISSA 3B1FA 2ATXA 1DAGA 1PK7A 5HCIA 3FLEA 3VVBA 1THTA 3RSHA 4I6JA 1A9OA 1KU0A 2QN3A 4F4IA 3A10A 1E7MA 5ES4B 2MOKA 4DXAA 2IVFA 3W3AA 1LA2A 3F6CA 3QZUA 2V6BA 1C9EA 3NTLA 4E6EA 2GF2A 4YMSA 3AHFA 3WWDA 2HSQA 3M0EA 2PM8A 4BVEA 5JI3E 1W5EA 1PP4A 3WDSA 2B92A 3WQSB 4XEVA 1XTKA 2Y1WA 3Q2OA 1AGNA 1VQ1A 2V5AA 3CUTA 1C3LA 1DAKA 2J5KA 1JQLB 1XXHB 2PMKA 1PNRA 5L3VA 3T94A 4X9XA 1A41A 1G1AA 2WV9A 2GM9A 2A0XA 4JHXA 3LT2A 1S9HA 3WLEA 1E5VA 4RHTA 5CLLA 5EWLB 5KX5F 3O1HB 1WSWA 3D31A 4HE8D 3FZEA 3KYDB 4JP2A 5I9LA 2AK3A 1EYZA 3H2JA 2VDRB 2AVDA 3IR5A 1F7VA 1OXUA 3TTXA 4TRRA 4PGHA 4P22A 3K6SB 3EA5A 3GLRA 2GT1A 5BWNA 2A0UA 4BFVA 5EP4A 4QQNA 3LNRA 3WP0A 5ICEA 4L2IA 7ABPA 1Z8FA 3ZQUA 4ZQBA 2HJVA 2PH5A 3KK0A 3DZIA 3FFAA 2I2FA 4G26A 1CY7A 4EHAA 1VLLA 5A0TA 2GD1O 3UPDA 1NUPA 3KUXA 5J4HA 2VP4A 4CCYA 3FBWA 2RGYA 2VT2A 1JIQA 2UUOA 2OE2A 3L43A 1V7ZA 5KNDH 1M1YE 1ZKMA 4LC0A 2O2HA 4IINA 5KHOC 1SAYA 2ZIWB 3NU1A 4YMTA 4LV5B 3BT7A 5IN4A 3QI2A 3UOWA 1XK7A 1II9A 2FFQA 3BULA 2VSFA 4GU5A 2NUPB 4AIRA 1QH1B 2QSJA 4YQZA 1EWRA 3PQ2A 4BS9A 1V45E 5A0VA 1X1RA 2PJRA 1DKOA 4YL1A 4OHPA 4MQMA 3CX3A 2D5CA 1OXXK 3IURA 1BZ4A 3PYLA 3VKFA 2R7LA 3PC6A 4LF6B 4FOLA 3SG0A 3U7QB 4BLSA 3LJBA 2DPYA 1X8XA 2M6RA 2HBZA 3U7GA 2CF5A 1U7ZA 1XCPA 3QEMB 4KO3S 4WMLA 3T9BA 1NR7A 2VZ0A 1NW8A 1CQJB 2F3PA 1YR2A 1TDJA 3GX1A 1RBQA 3I4FA 2HPAA 3RD5A 3TOZA 1T0PA 5EJ5A 4EJSC 4A9AA 3H5RA 1VL1A 5K01A 1JEYB 4MJ7A 4Q0MA 5E9JA 1G8MA 2RGEA 2I4NA 3MQFA 5JNTA 4LMAA 1T26A 3BSSA 4E30A 1DAIA 1M2HA 1T6XA 4NNOA 3OTHA 2NVWA 1SIOA 3CW2A 3LPDA 1K97A 2EFGA 4HJRA 1QIKA 4KN5A 1T43A 1CU1A 2IT1A 2PXHA 3PUJA 1QR6A 2QT9A 2AN5A 2ZIXB 3H4IA 1PZNA 2DY1A 4CIPA 3DM9B 1IBRA 1IZ9A 1QCYA 4BQQA 1ZFNA 2DCMA 1TEHA 1L7MA 5CLHA 4LN1A 3ASNC 1LKXA 3GPDG 4FDTA 3EZ9A 3QUCA 4B3SB 1DCFA 1FFBA 3AI7A 1E4YA 1P2FA 1U8TA 3FDZA 4M63A 1E58A 2EJBA 1QPZA 4CLDA 1JHPA 4E2ZA 1KEKA 3VNRA 1C9JA 5JCJD 2WUEA 4P2BA 1NNSA 1KS9A 4O4LF 2I29A 5JS8A 2CLHB 3BPSA 2HMTA 3NAQA 4U7DA 4ZO4A 4RGYA 2IXTA 3DDSA 1GGHA 3UB3A 5FYQA 3LUJA 1YB2A 1YL7A 1N2JA 4CDVA 3GMIA 1NY6A 4RACA 4X1OA 1WBBA 5BW5A 1EDOA 3G2MA 4DM3A 3OEEA 2FFBA 1RYMA 4MWBA 2E4AA 3LVRE 4KXQA 1X7DA 3IB6A 2R7WA 3HZOA 3N5KA 1LVHA 2TRSB 5LJIA 4XR9A 4B6FA 2BDTA 3K33A 2NZ2A 1M6NA 4XYMA 2IZ5A 2C7PA 3KZCA 5DM4A 1ZK3A 1ECGA 3GD5A 1U7XA 4MWSA 1GO2A 3LNMB 1UZAA 1J0EA 3MRTA 3BJIC 3HM2A 1QX3A 2BGGA 3DWEX 2UUHA 3ZVKA 1PX2A 1UPTA 3HXTA 1J22A 5D1HA 3QFCA 4ZV4A 3U1BA 3H8WA 4B3FX 2L9JA 1DOZA 5G1OA 2WYOA 2ZU6A 1WP9A 1JFFA 2CJPA 3V8PA 1YMQA 2IXBA 3RSZA 3IFSA 3UTDA 2GA8A 2F59A 1FUEA 1MZVA 2UUBB 4C4ZA 3TLYA 4DQVA 2Y27A 5BXQC 1DQPA 2GPWA 2WAOA 3KT3A 4BG0A 3ADKA 3FOWA 4HPXB 4G4IA 3TRKA 2ANCA 4S2EA 5ALMA 1QVZA 1ZZPA 4D0GA 3DMYA 2YCLA 5I9NA 4MLPA 5DW0A 3EXG2 2ISCA 4YPVA 2AFHB 5ITZA 1GPLA 5AJHA 1TF5A 3NEAA 1RHRA 1YC5A 3NT2A 1BDJB 5HA5A 1VP9A 2R1TB 4KAJA 4WZBE 5K3FB 1FYWA 1QKIA 5D6NA 3WKCA 2CKMA 2R6CA 3WLKX 1ONSA 2AJ8A 3FJ1A 1LDMA 1P44A 1NPDA 2GUWA 5DLJA 1Q1AA 1J2UA 1PGOA 4DZZA 2YYSA 1P45A 4ZOBA 4FP9A 5DGHA 3BMQA 1BJRE 3IL2A 1MTOA 3ZD8A 4J1TC 5JS7A 4OHCA 2VK4A 2IW3A 3DJFA 4PYIA 3EXEB 3MOGA 2BKUA 1HFEL 5ELXA 3WJ7A 2VDUE 3OOHA 3G9XA 5MFPA 2ZQ5A 1ODKA 1M2WA 4JLNA 3QW4B 1VA4A 5CW1A 4KLRA 4DIOA 4QGGA 2PZMA 1GGNA 4B0OA 2FR8A 2CHUA 3AETB 3W7AA 1YHZA 1NVGA 4MW7A 2YC2C 3OCXA 3MYYA 1U8EA 1CUBA 1QTIA 5AHOA 2WB7A 1V1RA 1E92A 1VL2A 5AW7A 3F47A 3L7OA 1Z33A 1V9SA 3F1KA 2UZ1A 2OLEA 2IEAA 3RKUA 2W00A 4M86A 4EB3A 1CE8B 5FTMA 4RA9A