2YHSA

Structure of the e. coli srp receptor ftsy
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
308
structure length
308
Chain Sequence
EKPTKEGFFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN FTSY
publication title Lipids Trigger a Conformational Switch that Regulates Signal Recognition Particle (Srp)-Mediated Protein Targeting.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
total genus 125
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2yhsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yhsA02
1ZCBA 4BQSA 2HJGA 4Q03A 1OSNA 4K81B 4KYIB 2OCYC 3K1JA 3ZIAA 1S2MA 3VX4A 4DSTA 3NKVA 3GJ8A 2IT1A 4A8JA 4Q4AA 4GOXA 3LA6A 3BE4A 4XTRA 3W8RA 2GXUA 2IYWA 1Z47A 5BWMA 4NL4H 1E4YA 2VPPA 1TU4A 5DE3A 5JI3E 2PCJA 1MV5A 1KHTA 4LC1A 1L8QA 1XEWY 5ANRB 1ZUHA 3A58B 4L9SA 2JLRA 2F1RA 4BRUA 1VHLA 3EASA 3OFND 4QGFA 1U0JA 1CBUA 4WXRA 1NL3A 2RCNA 2WTUA 1F2UA 5J40A 4Q48A 4UXIA 1NKTA 3TQFA 1O87A 1TEVA 4MKFA 1R8QA 1VHTA 4HAZA 1E9DA 1AGRA 3FHOA 1EFCA 3U3OA 5AUQA 4KSCA 1XD2B 3TSZA 3GJ4A 2JLYA 4QFMA 3V00A 3T1QA 3FFAA 1ZNYA 1MR3F 1EX6A 1KDRA 1Q12A 4JLPA 1SXJA 3TW8B 2ODNA 3VAAA 1WCV1 5TVKA 2F55A 5HTKA 1ZNXA 3CR8A 3K9HA 1GSIA 2ZUDA 1S9HA 1IOZA 2HCJB 2VP4A 3AKCA 3OESA 5DSZA 1DAIA 3HU3A 1L4YA 1W36D 1CJVC 1RYHA 4ON9A 1KI2A 4GPTA 4HDCA 4MYTA 3TR5A 4DDUA 1TQ2A 2N42A 2PL3A 2A30A 3VKGA 3MLEA 4B47A 4NP6A 4A8JB 4MA4A 4Q4AB 1T4GA 1Z06A 1KI9A 1LF0A 2ZPTX 3CRMA 5FPKA 1EWQA 4YDSA 1NIPA 3U3RA 1VKJA 3R20A 1P4SA 1F2TA 1FZQA 2WWGA 3TH5A 4W5HA 1R6BX 1Q3HA 1NVUQ 3BH6A 4WOPA 2NQ2C 3RRMA 2QG6A 4D4JA 3OAAA 1XU4A 2WJHA 4TSFA 2ZRPA 4URWR 5FBLB 3LY5A 2WSMA 3E70C 5UKDA 3VNUA 2WJYA 4XWAA 2V1XA 1ZP6A 3WBJA 1IN8A 1BOFA 1Z5ZA 2CCKA 1F2UB 3CKLA 4KBGA 4AG6A 1NF3A 1NLYA 1H8HA 1OXXK 4ABYA 1AZSC 4V0OA 1ZRHA 2GEUA 3QXJA 221PA 3CWQA 2YV5A 3MWKA 3PEUA 4IXNA 3TK1A 4L9WA 5EP2A 3TAHA 2X19A 4ZCMA 1JAHA 3U6KA 2IHBA 1YR7A 4XSGA 4US2R 1SXJB 4P4UA 1ZM4A 1GZSA 2GXSA 2XB4A 4AYXA 2OFXA 3AF2A 3LW7A 5JI2E 4F4CA 4QG7A 4LWZA 2ZRGA 1CR0A 3K0FA 4A4DA 4Q4HA 2RGNC 4ILEA 1UDXA 1WQ1R 3E1SA 2VH5R 3GQBA 1Z0FA 4ZI3A 5LD2C 3MCAA 4BE7B 4CZ2A 4XVRA 5J4VA 2ZANA 4LYHA 2GK6A 1M8PA 4Q9LA 4YMSA 2BHRA 2FX3A 4TMXA 3LBNA 2C9CA 4K8OA 2K5UA 4RD1A 3A6PC 1UDWA 2IYVA 3AVXA 3CNOA 4GOJA 1CR1A 3NH6A 2WWIA 4LHYA 1SVWA 4XIGS 4X8OA 1F2TB 5EZ6B 5FR1A 5SZJA 2IC5A 1LB1B 3RANA 2ZJ2A 2XGJA 4A92A 3ECCA 3ICEA 1K8RA 2ZI7A 4MRVA 4PO8A 1GL7A 2PLRA 1TQDA 1UJ2A 2LKDA 1N3BA 2OLJA 3QUSA 4PC3A 4M1YA 4M9ZA 2RGAA 4JSYA 4QBGB 2GCOA 3UANA 4LHWA 4ZCLA 3LD9A 3EIHA 1NP6A 1UF9A 1Z2CA 2ZU6A 4LJ9A 2F9MA 2ZR9A 3ASZA 3ZVNA 4Q1DA 1COWD 1DBSA 1W0KD 4TL8A 3OIVA 4C2TA 3GJ0A 2DHRA 1P9RA 2R44A 2FFBA 3IO5A 3TSWA 4DLWA 4ZDIA 2IS2A 4M1TA 4LCBA 4U00A 4GZMA 4PANA 5HPYB 3CH5A 3B9QA 2DWOA 1XZQA 2IBMA 1IN7A 2I4IA 2XITA 2ZVPX 3ONWA 2CHVA 1HY3A 4OHYA 1VG9B 2R6GA 2OG2A 4WAUA 3K0FB 3TSOA 4LI0A 1GP2A 3UG7A 3MAAC 2CL6X 2HT1A 3PEYA 4WW0A 1E2PA 5SZKB 2QP3A 3CB4A 3VKWA 1T3HA 2N46A 3DZ8A 3O8CA 1KSJA 2IYZA 2VHUA 5CYOA 2GJ9A 2TMKA 4J0QA 1G6OA 3TAUA 3G82C 2O0KA 1XMVA 1U0LA 2XSZA 3VQTA 3AP1A 3EW9A 3K9LA 1XD8A 3WRYC 2CEAA 2P6UA 4YONB 3BB1A 4Q7MB 3EZ9A 1SKYB 2G88A 3HP1A 1BYUA 2YC4C 4IOLA 2ZUCA 4JKIA 3AKEA 2QY9A 1EFTA 2V9PA 5DNYB 3EAQA 1VIAA 4WZAE 4CEHA 2YWEA 3AF0A 2NPFA 1EFRA 2YVUA 3GD7A 4IHQA 3VR6A 1KK3A 2C96A 3WHKA 4LYJA 4QGAA 2DPXA 2ZI4A 4E03A 5IK2D 3ZH9B 2RAPA 4JLBA 1OXUA 3VX3A 2VRWA 3BRWD 4CEIA 1XCPA 5BN3A 1E99A 1YR8A 2JLZA 1QHHB 2JJ1A 4D4KA 2ZE7A 3GJXC 2UVQA 3FE2A 1W1WA 4TWZA 4OK3A 3CM0A 3KQKA 3WMGA 2OXCA 4DDWA 1XNJA 3RAPR 3DEFA 5FBRB 1YRBA 2ZSBA 1QHSA 4ASUA 3W9YA 3L0IB 2ZRHA 5EE1A 4EFNA 3L8YA 1U8ZA 3DOEA 2FFAA 2VHJA 1GL9B 1U9IC 5KSYA 3PUWA 4PTLA 5D3MA 1KTVA 4AKEA 2WWWA 4PC7A 4M1MA 4DCTA 5JEEA 2G0TA 4CT4B 2JLXA 5FOWA 3TW4A 5GJVC 3ZYCA 3VU9A 4MGIR 5B30A 2VIIA 1HEIA 4P4SA 2QROA 1XXHA 3E5HA 2WBLC 3MJRA 3BH0A 1OKKD 3TUJC 1WDTA 2V4ZA 3QVVA 1FW6A 2WAXA 1DG1G 3BJIC 3DMNA 3EZ7A 1E2QA 1BYIA 2ONJA 2PZEA 3DDCA 5JHGB 1CJTC 3CRQA 3CRRA 4MQBA 2VF7A 2J1LA 2G3YA 1D8TA 3B6EA 1GNRA 4LBZA 4GBMA 2DFKB 3F5FA 5CJPA 3EPHA 2OCBA 3QPWA 4XD7A 4IKEA 2P3SA 1OFTA 2HF9A 5FOVA 5JCPA 1U2RA 3QBVA 3DHWC 4HUTA 2CLDX 4GI7A 1TMKA 1XJCA 3W6PA 2EU8A 3QNUA 5JS7A 4JLMA 2CNWA 4L15A 4LC0A 2IX3A 3D8BA 1HYQA 2IL1A 3C7KA 3LW8A 1A1VA 2KE5A 2O8FA 4JT2A 4CEIB 5GVSA 3K70D 3THOA 3GMTA 3KX2A 3UG6A 3CPEA 3DKVA 3GJ5A 1LV7A 3CWZA 3QBTA 2D74A 5B64A 1KIMA 1NRJB 5FPHA 1KDOA 1E96A 1PUIA 1MRSA 1SVIA 2OT3B 2RH5A 2FNAA 3G5UA 1ZD9A 3PXGA 2AKAB 1IXZA 1UEJA 3JZMA 2J7KA 3QQ5A 2QM7A 2JJ2D 4URUR 1YZUA 2B7BA 3NC0C 1OPXA 4UNPA 1E2KA 3A1WA 1N6LA 1R4AA 3W5JA 3OE7D 4B3XA 3FMPB 4X8MA 1VYUA 1AN0A 3E2IA 1OFUX 5JJKA 1S8FA 1NMYA 1RE0A 3VU9B 2W6ID 4B2LA 1D2EA 1OFHA 3BBPA 2ZR7A 2WJGA 2BBWA 1KK2A 1YR6A 1UAAA 3WP1B 4TYQA 3M6AA 4NYIQ 1KZ7B 4GRAA 1Z63A 2W0MA 2CHGA 1JQJC 4G5SA 2C5LA 2GZAA 3H1TA 4DC9A 1E0AA 3FFBA 4Q47A 2CVFA 3HPQA 4OI0A 5JHHB 2ZAOA 4DXAA 1FX0A 4HSEA 2GJSA 3J81k 2XOKD 2C9YA 2X2FA 4MRNA 4OHVA 1XWIA 2YKGA 5FBWB 5HKKD 2YHSA 4UXJA 4DDVA 1DAHA 1R2QA 3SBDA 1E6CA 2Q3HA 3IIKA 2J5XA 1G8PA 2ZITA 3I8SA 1H8EA 4MKIA 5JSZB 4U7DA 4AK9A 1KI4A 1QG4A 2W58A 3BFKA 4C7OA 3GFOA 1SVKA 2Q3FA 2GXAA 3RS0A 2NO9A 1RRCA 2QORA 1MOZA 1VCIA 3BH7A 2JAQA 2ORWA 4WIAA 2VO1A 2GA8A 1NJGA 1DO2A 2ZJOA 4PHTA 1GTVA 4UQOA 2IYQA 2H16A 5FFMA 1NG9A 1CS4C 3JZAA 3VR1A 3AVQA 4FMCF 3QVUA 4OK5A 5C46F 821PA 3OEHA 1JI0A 5GJWC 3CF2A 2JA1A 3MUFA 3VHXA 3PIRA 2V7QD 1XTSA 4Q66C 3L8ZA 4DLVA 2VL7A 1U98A 5FBVB 1II8A 4DLRA 1KI6B 3W3ZB 2H17A 4ARZB 1XEXB 2GDJA 2FEOA 1CRPA 5FTNA 1ZC4A 2OLKA 2GJAA 3AVTA 4FI3C 5E7IA 2RGEA 1P9NA 1FX0B 2ZSFA 2WKRA 3CPJB 1R0YA 1W2GA 2CLCX 2A5FA 1KMHB 2R2AA 4P31A 1TPZA 2PJZA 3WNDA 4IFEA 3K8YA 3WRXC 4W9MC 1NBME 2GAAA 2XTMA 2IUUA 4B48A 4NYMQ 4Q5IA 4MGZR 4TL9A 2QE7D 3TKLA 3X2SA 3L0OA 4G3XA 1DELA 3B5JA 3GLHE 1FQJA 2NZ8A 3WY9A 3TQCA 4NU0A 3QG5A 1ZW6A 1R0XA 3BERA 3RSLA 4A6XA 2PBRA 4N1AA 4B3FX 2V6JA 3QKSA 3OFNA 3N70A 4AIIA 3BS4A 1TADA 4LJ7A 2FF7A 1Z07A 1T0JB 2G83A 2QTVB 4OKSA 4PSKA 2WWYA 1NVXQ 4DB4A 2CMKA 1NY5A 3LX5A 3DOFA 2GCNA 2YJTD 4TLCA 4EPTA 3TMKA 4O2LA 1Q44A 3C14C 3LWNA 4RD4A 3ND8A 2QP4A 4HB3A 1T6NA 2ZI9A 1N6RA 4A8JC 3QY0A 3AVUA 2V1UA 3LRPA 2QI9C 2BDTA 2REXB 1L2TA 4RKEA 1IY2A 2WM9B 4OJKA 4C30A 4K46A 3AF1A 4R2IA 2G9NA 3D7MA 2WSSD 1AKYA 1E9AA 2FSGA 3LNCA 1E0JA 2HT6A 2ZJZA 1ZYUA 2ZS8A 4LYAA 5J4HA 3CBQA 4Q1FA 2WPDA 1KO5A 1T5IA 2C98A 3CX6A 1DVRA 1Z0DA 2FEMA 4ACAA 2V55B 4LDJA 2MSDB 2FZ4A 4Q9KA 3SQWA 4B76A 3CX7A 3THXB 1N5IA 1P2UA 2IWHA 1GITA 4LBWA 2YZ2A 4NTZA 4P4TA 5FH9A 2QMHA 2QQEA 4NYJR 2J7PD 1NKSA 1M74A 3B9PA 3H0KA 2GBLC 4Z54A 4MRSA 3KDSE 1Z28A 1N2CE 2L0XA 4HB2A 1IJEA 2J9RA 4JVNA 4D82A 3R9WA 4BFYA 1E2EA 3PITA 1OB2A 3O8BA 1SXJC 4PHFA 4WXPA 4IDPA 3THWB 5KSZA 5KDLA 4EAQA 2JLUA 2A5DA 2ZI6A 4A2PA 1U81A 1UM8A 2XXAB 2AWNA 4GT1A 2XNSA 5SZHB 4MYCA 4W5WA 2ATXA 3AUXA 1F60A 1KY3A 1ZIPA 2FA9A 2NO0A 1EFHA 2WWHA 2JGNA 2EFHB 2C04A 1K6MA 2P5TB 2Y8EA 2CDNA 4LYFA 1JECA 1AS0A 1IY1A 4HUQA 3C5HA 1R0ZA 4P0TA 1IHUA 3SBEA 4YMUA 3HWSA 3K0AA 4FWTA 2QAGA 4I1VA 3GFTA 5BYJA 1GIAA 4KU4A 4O0MA 1ZU4A 5K8UA 5EXSA 3A37A 2XEXA 3SOPA 1VTKA 5TB5A 5J4LA 4EDHA 1CJMA 4GMXA 1KO4A 2C8VA 1CU1A 2OBLA 5A0FA 4XOIA 4MDFA 3W6NA 4LV8B 3EX7C 1B0UA 2HEIA 4OI1A 2ZRBA 4HAXA 1NLFA 5JECA 4FMCB 5EUQB 1G20E 1D9ZA 4YC7A 4PFSA 1TEXA 2AN9A 3ZZUA 2NOAA 2JJ8A 3QE0A 3A4NA 4Q7LA 1X8KA 5KU1A 4LUCA 3GLFE 4JL8A 1LS1A 3IIMA 3REGA 421PA 3U61B 2IK8A 1US8A 1G4AE 4BASA 2C78A 5CDFE 3ZDQA 1ETUA 3AVPA 4Z1MD 5B57C 3QF4A 1ZJ6A 4NCKA 1G7RA 2W2VA 4NKRA 3NDBB 3X1DA 4OI2A 5KHOC 3K0SA 4M21A 4NE2A 1UPTA 4M4SA 4C0AC 1VCOA 2QQ0A 5BYKA 3AH8A 5JWHA 2CLSA 1S96A 1KJWA 4D4LA 1J7KA 3HDTA 3QOFA 2ZRLA 2I1VB 1AK2A 4KFUA 4Q1BA 2QMUA 3FVQA 5DGXA 4X8HA 1Z0AA 2DWPA 1IJFA 1Z0JA 3QKRB 4V0NA 4NMMA 1TQ6A 2CCGA 2X8AA 5H68A 5DI3B 1MABB 1COWA 3B1YA 1W0KA 4C0SA 1G8GA 1II0A 2AKYA 1NMZA 4UJ3A 4C3ZA 4C0LA 5JFGA 4B6EA 4DIDA 1T3SA 4LPKA 3SNHA 2A2ZA 5E7MA 2O8BB 2O8DA 2CE2X 1KSFX 3MFYA 2QAGB 3QPUA 3I61A 2QPOA 1ZVQA 3CNLA 1HH4A 1CJKC 5BXQC 4RCYA 5H70A 2ZE5A 3QKUA 4BLOA 3EZFA 5SZIA 2D2EA 3CF6R 3T35A 4DT1A 3LFUA 3QEOA 4KO8A 1VYVA 1T8UA 4BWYA 1TUEA 1HT2E 1Q21A 1VDZA 2JASA 1N6KA 2ASEA 1Q57A 4OQLA 2WJVA 2VBCA 3U7FB 4D25A 3IBGA 4B32A 2IS4A 1UEIA 3ZQJA 3LAWA 4U02A 3CX8A 3IDQA 2HLDD 3AVOA 2B92A 5JS8A 1E2MA 1MT0A 1BKDR 3KTAA 4GFDA 2IYXA 2PMDA 3NEJA 4F93B 1XMJA 3EXAA 4IDHA 4G5GA 4LJ6A 5JWOA 3R7WA 4AY2A 2WPDD 1XTQA 4JLKA 1SVMA 121PA 3HU2A 1RRPA 521PA 3B1ZA 1G3QA 2YINC 2JCSA 4AURA 1TTTA 1NN5A 1F5NA 2VHTA 2ODBA 4QNRA 1DO0A 3VNVA 1A7JA 2Z4SA 3FTQA 3NH9A 4TZ0A 1UADA 4GNKA 1XB2A 2I1QA 5G53C 1E9CA 2QGNA 2QPAA 4IDOA 5TARA 1CRQA 3N2IA 3X1WA 4Q4LA 3K09A 4JT4A 2OCAA 3Q5EA 4GL2A 3Q8XB 4QXAA 3GLIE 2Z4RA 3REFA 4KYUA 4FCVA 1JAIA 1G9XA 3VR5A 1G3RA 2ZTSA 1AZTA 2AR7A 4PAMA 5TXGA 3K0CC 2WIBA 5IK2A 1IAQA 4P32A 5EE9A 2UZIR 3KUDA 3KB1A 1ESNA 2QUZA 3GLGE 1KO7A 3HU1A 3KL4A 2NPIA 1MO5A 4LX0A 1JR3E 3EARA 3RVBA 3RYTC 2JEOA 3LXXA 3LBHA 1Q22A 1M7HA 1W47A 2MMGA 4IXMA 4LZZA 4TQUS 5FTKA 1GWNA 3SYKA 4TZ6A 5CK5A 2FJUA 1EX7A 1V5WA 1OYYA 2YOFA 3FMOB 4HDQB 4CYMA 4DCVA 1NLZA 4M1WA 4HB0A 3RS7A 2IS1A 2BOVA 5EE5B 2QA5A 2OEPA 2ZRCA 1DAMA 2BMDA 3KFVA 4JBXA 5E4FA 3T15A 4LJ8A 1U90A 1Z6XA 3CPHA 3RS5A 5JBQA 4IDNA 4TTPA 1RIFA 2YNMA 4JIMA 1KYIA 5J5CA 4TYPA 4GDFA 2IXEA 3RC3A 3PUVA 1E2FA 1X6VA 1OKKA 4F38A 2GXQA 4Q1AA 4RZUA 4DLYA 2ZIAA 5CK4A 4MDEA 4HZUA 3CRW1 3PQCA 1NSFA 1Z0IA 4GSYA 1KI7A 2Q9AA 2EWWA 2WJIA 2ZRAA 2DB3A 3VFDA 1NG1A 5C2JB 5CLLA 5F9HA 4TMVA 5CIQA 1GM5A 4KLNA 4I99A 1KI1A 1RVDA 2EQBA 1N6IA 2F9LA 2FPKA 1Z08A 2GK7A 4KVGA 5J47A 2YOHA 4IDQA 2ZI3A 4EUNA 4NCHA 4Q00A 4MITA 1VG1A 2ZU0C 1EESA 1YZTA 1Z0KA 4A6PA 4QHTA 3H84A 3BFXA 5KNCA 2GKSA 4NHOA 5EP1A 1Q1EA 3EA5A 5G3YA 5KUTA 3ADDA 1N5KA 2GZHA 4PC2A 1JXOA 2CBZA 4YXWD 5DH9A 4ZDKA 5JMTA 1W2HA 5LPNA 2IYUA 1GKYA 2AXPA 2ZRKA 4WZBE 1YZGA 3LH5A 2WWXA 2BEJA 2VP9A 1G3UA 1LVGA 2AL7A 4II7A 3LVRE 1IXSB 1XP8A 1X8LA 3NHAA 2ZRDA 4RJLA 4DB2A 2F1JA 1JNYA 1Q3TA 3EZ6A 4IVRA 4JS0A 4M1OA 3TVDA 2CJWA 2GILA 2PX3A 2OAQ1 1KJZA 4Q4JA 4M1KA 2JJ2A 5EE3A 1PLLA 3AP2A 1S3GA 2HYDA 1KNQA 1RJ9A 2NO7A 3CIOA 3OE7A 1UKVY 1W49A 3SJBA 3KQLA 2WAYA 3L82B 1M7GA 4Y0AA 4QL3A 2F43A 1GILA 2GESA 2W6IA 3WYAA 5KOYA 1DE0A 4A15A 2AD5A 1OYWA 2NG1A 4FINA 2GJKA 1G21E 4ERNA 2ATVA 5FI1B 2VEDA 3CZPA 4DUGD 3ZS9A 2QENA 4HZUB 2CE7A 1NVWQ 4Q4HB 2QM8A 2WOOA 5KNDA 5DI9A 4PPFA 2ZSDA 1A4RA 2QN6A 2DYKA 1LY1A 4PQFA 1M34E 2WHXA 5HCNA 1VIYA 5KSPA 3TLXA 2VSOA 4D81A 1NVVQ 2NIPA 2F7SA 2XOKA 5FL7D 1N0VC 3BGWA 5TMPA 4MGYR 4YLGA 1YZKA 3FYHA 3X1XA 4UNNA 1XMIA 5HKKA 1NIJA 1QHNA 1Z8FA 4TMKA 4JVMA 3IHLA 1T9HA 1JBKA 5CITA 4O3MA 2ANBA 4LHXA 1QF9A 2JDID 1LTQA 4L4UA 3DO6A 3U3JA 3Q72A 3PVSA 2OHFA 1L4UA 2WWFA 1XEFA 2ZQ5A 2WICA 1KJYA 1OH5A 3AKDA 1OH6A 2IYSA 1II9A 4OI4A 3GLHA 2IEYA 3K70B 1AJEA 4ZO4A 1XX6A 4NDZA 1D9XA 3RS4A 1W0JD 2AX4A 1DOAA 1JR6A 5AJYA 2P0EA 1RZ3A 2D7CA 4KLZA 3ZQ6A 2GCOB 1Y3AA 2XNDD 2BMFA 4TN1A 3U3KA 2ODEA 4ZCIA 1T91A 1QZXA 1ZM2A 1FOEB 2Z43A 5CYPA 3WMEA 1MO3A 4QM7A 1IM2A 4Q4JB 1HQYE 4P33A 1UKZA 2FSIA 3U44A 1I2DA 3AKYA 3KJEA 2R6CA 2ZAMA 1SVLA 1AGPA 1UBCA 4PSAA 4Z51A 3TUIC 1E9EA 1VECA 4W5JA 1OE0A 4FCWA 4TQAA 4TLDA 2FPLA 2QMOA 4CIDA 4ZKDA 2V7QA 3PUXA 2OILA 2ZJ5A 1FFHA 4NH0A 5CB6A 1P72A 2OE2A 3GJ6A 2HXYA 4HDOB 5EP3A 3T1OA 1P2VA 3UMRA 2ZROA 4B71A 5H1YA 2NO6A 2ZETA 4E07A 2XJ4A 1G8HA 2AFHE 2FG5A 4PZYA 2AWOA 4FWIB 1SHKA 4G5RA 4LOAA 5K8LA 4MRRA 2AD1A 4KITB 1VPLA 3EIEA 5HZKA 2V3CC 3NXSA 3I72A 1E2IA 4V02A 3S1AA 1N6PA 4PO1A 2D62A 2RGGA 1DAEA 4BPBA 3WHLA 4GP6A 3FWYA 1ZM3A 4EFLA 2QE7A 3A36A 4AD8A 5J4KA 2DFTA 2DFNA 4U5XA 2FV8A 4ACBA 2ZS7A 2R6FA 3KKMA 4TT3D 4D6PA 3EA0A 1SXJE 1KI8A 1X3SA 3D3QA 4H9GA 2HF8A 5AR1A 1G7TA 4CEHB 1G41A 2FN4A 4OL0A 2VHQA 1G17A 3EPLA 2CCJA 1AM4D 1YQTA 3UATA 3QG1A 4OQXA 1I2MA 3QJYA 4MUBA 3A4MA 5KYKA 1KZGB 3U7EB 3TVTA 2NMVA 3LQRA 3SFVA 1YZLA 1W4CA 3U44B 1IXRC 1ONBA 3EC2A 1NI3A 1JXMA 4JVLA 2WSSA 3ZS8A 4Y0VA 1UBFA 3VMFA 2QTFA 3PV0A 3UPUA 4DZZA 4DWJA 2R6DA 5JLJA 1ZBDA 4I1UA 5DO9A 3CONA 4NCJA 2JLQA 3LO5A 4UXHA 3MJHA 1S4QA 4CEJA 4JBWA 3PCRB 3Q9LA 2JLWA 3AUYA 1DADA 2J0UA 3C5CA 5D3MB 2OSBA 4BEBA 1FNMA 2F3TA 1YR9A 4DSOA 4JBYA 4IOMA 2J7PA 3WMFA 8OHMA 3IHWA 4DVGA 3P27A 4BLPA 1YU9A 3SHWA 4P4SB 4C9BA 1J70A 4V0ME 3SHFA 1XXHB 2OM2A 3MSXA 2GAOA 1S1CA 3P1JA 3NG1A 2QP9X 3OIWA 5CDFA 5CM9C 5AUPB 1Z6AA 4DHEA 2XZOA 1P5ZB 2BBTA 3CF0A 2VLIA 4IFBA 2RKOA 4KJZA 4JLOA 4B3CA 4IEEA 2RHMA 3A4LA 3ZVLA 3K9GA 4FXPA 3LBIA 4AKHA 4QGHA 3H86A 3I8XA 3OIUA 3Q85A 4BEJA 4EJSA 4EKDA 1N5JA 3QSYA 1GUAA 4BUJA 3ZJYA 1XPOA 1U8YA 4C0KA 4DIEA 4F4IA 2GETA 3RABA 5EQTA 2J0VA 3UXMA 1C9KA 2ZYVX 1WBDA 3B2EA 5C4GB 1NBMD 1NN3A 2RGXA 4DJTA 4O2RA 4TLBA 3AV0B 2O8FB 2ZS9A 5EXPA 1D6JA 2YWHA 2O52A 3WNBA 1JQLB 5FI0B 2KI5A 1XTIA 3I62A 4CDGA 1W4AA 3ASYA 2V6IA 3NBXX 2PT7A 3FGNA 3UIEA 4Q01A 4EFMA 3KUCA 2GVZC 2W2XA 4BFWA 2D2FA 1SKYE 3NBYC 4JYCA 2PT5A 4ZKEA 4XWKA 5DN6D 1G1MA 1XDBA 3CRVA 2DFLA 4DEXA 4EIWA 1RW4A 2ANCA 2J0UB 3HR8A 1DAFA 4I1OA 4HLUC 3AGPA 1KSGA 1QHGA 4L5BA 2ERYA 1AQYA 1G8YA 4DBLC 3R8CA 5A5GA 2QRZA 3B7GA 4LRWA 2IYLD 2ZREA 1N6OA 4Z1MA 1I4TD 1KKLA 1ZMXA 2G1KA 1OT3A 4JJKA 4LSGA 2QAGC 3X1ZA 4KCGA 2D7DA 1W4RA 1G5RA 3ZGXA 1VYTA 1U0HC 2QEQA 3OF5A 1WP9A 3ZZTA 4IVPA 2IWRA 1JPNA 1XEWX 2WIAA 3W6OA 1GAJA 3SC3A 4B75A 3NBZC 2H5EA 2FPMA 4JSTA 1SHZA 2KWIA 3SYLA 2FGJA 4XWOA 4I1SA 4C2UA 1QHXA 1S1MA 3RS3A 1S3SA 4XH9B 1PLJA 4HAUA 4EJSB 1OXSC 2DCUA 4D0LB 4Q18A 4QOSA 2H8KA 4RVCA 1P2TA 1J2JA 1KKMA 1FNNA 3KQUA 1CIPA 3V9PA 2FU5C 4BRWA 4E09A 2PLFA 3V4FA 5EXXA 2BMEA 4AYTA 2YYZA 3MRSA 4AKGA 3ADKA 1CULC 1OH8A 4O25A 2KB0A 4C7OB 3GLGA 5C4MA 3FDIA 3AVVA 2VYFA 1SULA 5JZVA 1KK1A 2OCPA 1A5TA 1AS3A 3TIFA 4KSBA 4ZI2A 4Z8XA 3KQHA 4FCTA 1OHHA 2NGRA 4TYYA 1QDEA 2ZVQX 5AJWA 2ECKA 4CRWB 4PC1A 1WF3A 3EZ2A 4B6FA 3RSOA 3NWJA 4BFZA 5JJLA 2ZYTX 2OXRA 5FOXA 2ZRFA 1HTWA 1HUQA 1N25A 2HLDA 1NSTA 4GZLA 4LY6A 4FN5A 4W7SA 1G5TA 1X1SA 3U6BA 3MGCA 3TJZA 3VTKA 4US1R 3EPKA 4A2WA 3SS8A 2BKEA 2ZJ8A 2JIZD 4MKGA 3AP3A 4UKDA 3W90A 1II8B 1ZAKA 4RFSA 4OQFA 2QMEA 5L3QA 2IF2A 1X86B 4KV9A 1ZM9A 1G16A 4DEYA 1GRNA 3EWAA 5LB2A 4R9UC 4TMZA 1OLOA 2CVHA 1YKSA 3GJ3A 4JL5A 3K0EA 1F48A 2PMKA 2QSZA 1W7AA 1DARA 4PQYA 2XB2A 1I4LD 2ZJYA 3N5CA 3KFXA 2BJVA 3NIBA 4LHZA 4URVR 3C41J 5JEDA 4MH0R 2XZLA 4MKHA 2AXNA 4CF7A 1Q20A 1UBEA 1KDPA 1JJVA 1J90A 2IW3A 3ICQB 3SE0A 3IKJA 1CR2A 2A78A 2IS6A 1E9FA 1CXZA 1JJ7A 4PQRA 4H1UA 5FOTA 2H18A 5HE8A 5L3SA 1GRQA 4RY2A 3OEED 1YJ5A 2NTYC 3QKSB 4S2EA 3G0HA 2G0NA 5CB8A 5C18A 2EYUA 2Q21A 4HAVA 1XZPA 2QGZA 4R98A 5CJ2A 3SN6A 5J4YA 2YOGA 1XJ0A 3AF4A 2HV8A 5F3WB 2GZDA 3KJHA 1G3MA 1RRFA 4IRUB 2FSHA 2HDNB 4LK2A 4QGGA 4EQ6A 1DTSA 3U60B 3Q7QA 4KHZA 4QM6A 5KDOA 1MKYA 3HYRA 3T1TA 4QJ3A 4IEIA 2Z6VA 3UMFA 5E3HA 1Q1BA 2O5VA 4JLDA 1IONA 4A2QA 1R5BA 2OAP1 3BWDD 2W00A 5ELXA 2ZRNA 3CNNA 5EXTA 1XMSA 3U3MA 2ZYUX 1E79D 3GPLA 5JWRA 4NCNA 3LQQA 2JATA 3LVQE 1R8SA 2B8WA 2OFOA 4BFVA 1AA9A 2JLSA 2XZPA 1CLUA 1W36B 1KK0A 3F0TA 3A1SA 4A0RA 2XJ9A 3F3YA 4PSVA 2A7QA 2FSFA 2W2TA 2YC2C 4RZXA 4JLVA 4OHXA 4EPVA 2GJ8A 2EFEB 5DHAA 3RHFA 3P4XA 1XTKA 1QHIA 1BO6A 2KBEA 1EGAA 2QAJA 4JYBA 3ZVRA 3AB3A 5LDDC 1E2HA 4IJMA 2W83A 1E1QD 4A0HA 1N0UA 3D31A 5EP4A 1ZIOA 3IQWA 2GEVA 3IUYA 1TL7C 3KKQA 4YXWA 5P21A 1G291 4RCZA 2ZYWX 4F4JA 2GTPA 3LLMA 1Z3IX 3QKTA 5BN4A 1C1YA 1TX4B 4A1FA 2X77A 3T06B 2FFQA 4DCSA 1G18A 3QXSA 3QXXA 5JRZA 1SQ5A 2BC9A 3SJZA 1J99A 4D0NA 1PLKA 1KGDA 2P6RA 1ZM7A 1R10A 5FPSA 2A3RA 1KAOA 2J59A 1JALA 4B43A 5KPJA 1UFQA 1FP7A 4BLRA 5L3VA 2W6JD 1M6NA 3FPAA 5TDHA 1LW7A 4DLZA 2BBSA 2QT0A 4QRHA 3CLVA 4V0LA 3B60A 4HUQB 3GEIA 2OV2A 3QXHA 3R9IA 1P61B 3K0AB 3X1YA 2C9OA 3ZLJA 2GEDA 1ZINA 3SJCA 2ERXA 1JR3D 1FMJA 3K70C 2X2EA 2IUTA 3IPYA 4V03A 4DUGA 3I5YA 2EFGA 3KB2A 1KDTA 2YWFA 3NVAA 3N2EA 4R71A 1OHHD 3BIFA 4AKIA 4QBHA 5B2ZA 4GOKA 4M2LA 4PPNA 5FUYA 4KI0A 2IYYA 3SU8A 4NYIR 1SVOA 5AK0A 1FL9A 3DMDA 1D2NA 3K53A 2R65A 1BH2A 1RKBA 2EFDB 2WJJA 5FL7A 1KI3A 5CM8B 4ZDWA 4NONA 2VTKA 3MMPA 1Q1ZA 1G4UR 1US8B 3SI7A 1P62B 3I3SR 2GCPA 1OXTA 4KXFB 2AFIE 2Q3MA 3QF4B 4LBYA 2O0JA 2ZRMA 3U7GA 4AC9A 4C4PA 4DCNA 3MG9A 4F7WA 2JDIA 2C03A 3FHCB 4ITRC 2ZR0A 3FOZA 3NTUA 4B74A 2DY1A 3FMIA 2GBLA 4YQFA 1RRGA 1G7SA 1GDDA 1EK0A 3U7HB 4RD3A 3RS2A 3MWJA 1W0JA 4M9SA 1KO1A 2CHQA 2Q0HA 2VSFA 4DLUA 1BMFD 5AWFC 5IHPA 5JRJA 1FQKA 2VSXA 4A0GA 2XNDA 1OIWA 2RMKA 2IF0A 2QTHA 3BC1A 4ZIRA 3ETLA 4G5OA 4M0LA 1E9RA 3EG5A 2V54A 5FTMA 3FKSD 1E1RD 4BFUA 3W5IA 1FP6A 3AM1A 1KY2A 1X8JA 2Z83A 4PHGA 1K5GA 2HUPA 3PUZA 4DKXA 3BAFA 3KXLA 1GNQA 2PEYA 1ZNZA 2ZSEA 2LKCA 3KJGA 3RRNA 4ZV4A 2NZJA 1U94A 3OHMA 4MYUA 4MYHA 4E5UA 1ZU5A 3M4YA 4DT1B 4KODA 3B13B 5IF9A 3EPJA 3PG5A 4B3DA 1P6XA 2D3WA 2AK2A 3C8UA 3PJRA 1NY6A 4OHWA 1TF7A 4B35A 1T8TA 2IYRA 4G5QA 2Q9CA 2BKUA 4FD2A 4B33A 3KTAB 4JJZA 4PAQA 3KJIA 4WBSA 3WNCA 3P32A 4R2HA 2FDCA 1MRNA 2E87A 3IIJA 2QU8A 2C2HA 3R7WB 4F92B 3ZD7A 5LBIA 1RC8A 1OFIA 4V0MA 1SVSA 3H4MA 4B2PA 2VP6A 1VMAA 1GL6A 3BB4A 721PA 3RC8A 2WMOB 1ZD1A 3UK6A 4C0HA 2CK3D 2F1HA 4IW3B 2BM0A 4TT3A 4R7ZA 1SZPA 4A36A 4IOKA 5DIFA 4NYMR 2RGBA 1NJFA 4KFSA 4XTCS 2ZJBA 3QI2A 4FMBB 2FWRA 2BVNA 3B85A 2IHYA 4KVAA 1RPZA 2IYTA 3I5XA 2C99A 4N3NA 2HXSA 4ZIRB 5EE0A 1OW3B 2FOLA 3IEUA 3FB4A 3I73A 5JJIA 4CW7A 2MMCA 1P73A 2ORIA 4DLXA 4HLCA 4KFRA 2WKPA 3P20A 5AJXA 1WBBA 2F1IA 1XTJA 1WGWA 4M8NE 5KDDA 4KAXA 5GJCA 1E94E 1GNPA 1P60A 4DCUA 621PA 1Z2AA 1ZD8A 2WOJA 1IN4A 3T61A 4OBEA 2MSCB 3C4JA 2D4HA 1GRRA 3KXIA 3IILA 4MGKR 5G41A 5TY0A 4BFTA 1WA5A 3AQ4A 4B3BA 3QENA 2O8DB 1WB9A 3SJAA 4ESHA 4RFVA 1TUIA 1CR4A 1XD9A 1ZUNB 1ANKA 4QHYA 3A8TA 3QXCA 4WVFA 3ZIAD 1Z83A 5F9FA 1G19A 3IBYA 3QIAA 5AJZA 1ZUIA 3LDAA 1C4OA 3Q3JB 2ZRIA 2J87A 2RGDA 2FE4A 4I81A 4OJQA 3UMSA 2ZUBA 5EJEA 3GEEA 4HLDA 4FIDA 4US0R 4NZYA 1TQ4A 3WYFA 5L8VA 2QPTA 1QHHA 4UNSA 1U99A 3I1FA 1KSHA 5H8WA 2J41A 4G1UC 1HQCA 1P3JA 2OO7A 5KNBA 5GJBA 4AI6A 2OBNA 1N6HA 1WMSA 1QVRA 1JB1A 5K8TA 3ZVMA 1VCNA 2MSEB 3VR4A 4S35A 5HR5A 1OF1A 1E2GA 2J46A 1GG2A 3MD0A 2FH5B 2P5SA 3BFVA 1NBMA 3SDZA 4FW9A 5FR2A 3ADCA 1HURA 1R5OA 1LFDB 5A4JA 4BECA 5FL3A 1IN6A 4BGDA 1P7CA 3R9XA 5BQ5A 4JLNA 3PEVA 3RNLA 1G3IA 4BZPA 3T12A 1G5PA 3GCGA 3O8DA 5E95A 4C0QC 3T5DA 1ZNWA 3K0CA 1SXJD 2IXFA 2A5YB 2KBFA 4AWXA 4ESVA 4WZ6A 3VKHA 3JVUA 1W5TA 1I4DD 2CJWB 3UWKA 1LS6A 3U2QA 1IBRA 2W0SA 3DKPA 1SGWA 2QNRA 1W46A 2R62A 4DSNA 4NYJQ 5DN6A 4EJSC 1CJUC 1KO8A 1GOTA 2EYQA 3KKPA 1RJ9B 3P26A 3UKDA 4URXR 2FFHA 2H92A 2F43B 5KO2A 4TYWA 4Q1CA 3SFZA 3SYNA 1UKYA 4Q02A 1KOFA 4AYWA 1MH1A 4C0BA 3W8NA 1W44A 3BD9A 4C0JA 1IY0A 4AG5A 4QBFA 1Z6YA 1CKEA 1QG2A 4PXAA 1XFAA 4TLAA 1PUJA 2VQSA 2P2LA 1P9WA 1BIFA 4D0GA 2QBYA 3FMFA 2C95A 4OHZA 2XTZA 2BIFA 1W48A 2ZJAA 1WRBA 4TL6A 3RRZA 1AIPA 4RZ2A 4PPGA 3OAAD 3ADBA 3D6TB 1YE8A 3OIYA 2RGNA 3T34A 4HAWA 4TSFD 4B3GA 1Z22A 1Z6TA 5CLQA 1ESMA 3B1XA 3WBKA 4D4MA 1K5DA 1R0WA 4Q7JB 2OUKA 1XCGB 3MWLA 3A1UA 4Q9HA 1H8HD 1T5LA 1TAGA 5FTLA 3HJNA 1HE1C 1G64A 1E2DA 1OV4A 2ZI5A 3F8TA 4I4LA 2HCBA 4PPQA 3JVVA 3GLHB 1XPUA 2BM1A 4H1VA 3VR2A 3AEZA 2XAUA 4HB4A 2UKDA 4NPHA 1N0WA 1OIXA 1M1YE 5DYGA 3B1WA 2B8TA 4Q19A 1EXMA 4TL7A 3IGFA 3SZRA 2VHCA 3M0EA 3GJ7A 1KMQA 2G6BA 3PUYA 1E2NA 4EPRA 3DL0A 3SEAA 1DS6A 3B1VA 4F91B 2CXXA 3WP0A 2Q6TA 2F6RA 1W4BA 2XX3A 1ZC3A 2H57A 2G77B 1GFIA 4FMDF 1A2BA 4M1SA 5HCIA 2JIZA 2FMXA 2PH1A 3KQNA 1GKUB 5FPYA 1UBGA 2HJVA 4HATA 4BLSA 1NN0A 3OZXA 4OYHA 4M9XA 4GMDA 2R6AA 4JMPA 5JSZA 2JLVA 4LJ4A 5D3QA 2CL7X 1P2SA 1Q1QA 2QBYB 3Q5DA 2R8RA 1AQUA 4RSGA 3AF3A 3TGPA 1B23P 2AK3A 3RDPA 4UJ5A 5DISB 3PR1A 3U4QA 1FPMA 2ZE8A 1X1RA 2BEKA 1E9SA 1T3LA 4PR0A 3S1AB 3GLFA 4B34A 5FOSA 5E7JA 2PEZA 1XBTA 4EPWA 5LD2B 2H1LA 3L43A 3BORA 4V0KA 1XTRA 5FOUA 1UKEA 2ZE6A 3PEWA 3A1TA 1ELOA 1XRJA 1HA3A 3C16C 4D26A 1W5SA 4RD6A 4LV5B 2EVWX 3W3AA 3LX8A 3EC1A 2VP2A 3OEEA 2Z0MA 4CT5A 1W36C 1FTSA 3ND9A 3NC1C 4JKYA 2E1RA 1Z6GA 2YWGA 3HYTA 1HT1E 3GFPA 2OZEA 4LPSA 4YMVA 2D06A 1XCMA 3LLUA 1MO4A 4A9AA 2X1VA 2SHKA 4TLEA 2DWQA 3TRFA 3UWOA 2ZRJA 3CZQA 4CGZA 1PJRA 2J0SA 3SQXA 4E22A 1KI6A 2F3RA 5KTYA 4ARZA 1XEXA 3LV8A 4HZIA 3WYGA 1G7CA 1EG7A 1GKIA 1JEEA 1MO6A 2PCLA 3DZDA 4QJ4A 4OQMA 1FMLA 4B73A 3GEHA 4LJAA 5EZ5A 1E0SA 1YHNA 4UNRA 2QSYA 3NBFA 1R7RA 5M04A 4BLQA 4HLQB 2E9SA 2I3BA 2REOA 2Q9BA 5C1BA 1IQPA 1DAGA 1AKEA 1E69A 1E79A 2J45A 1KMHA 2NO1A 4RD0A 2XSZD 4IOJA 4EPYA 4MRPA 3TE6A 2GF0A 4BZQA 1BS1A 1D2MA 4Q7KA 4QNMA 4CEJB 1JPJA 4L16A 4PAOA 4JVSB 1OH7A 1EFUA 2J0QA 1E9BA 2LWIA 1NNEA 2WV9A 2BWJA 4YMWA 2LCFA 4QKQA 1VG0B 2PJRA 5KSOA 1D5CA 4NCIA 3U4QB 1P75A 1TNDA 1E1QA 1U9IA 4Q21A 3GLFB 1KNXA 1EFRD 2R9VA 4M22A 2O0HA 5K8IA 2BCJQ 3RLFA 1OIVA 4QJ5A 4QHSA 5BN5A 1A2KC 3V4RA 5GVRA 1S0UA 3BXZA 2GNOA 4NBSA 3PENA 4QBIA 3U5ZB 5IDVA 1HE8B 2BV3A 3I92A 1SKQA 2JJ1D 1YRAA 4DLTA 4BZXA 4KFTA 4YMTA 1E2JA 5DLQC 4PC6A 1VG8A 1QHYA 5FBQB 1Q0UA 1QVAA 4A82A 5BW8A 5G3ZA 2IA5A 2P67A 1WE2A 4X8LA 2KJQA 4ASUD 2V8OA 1CP2A 3VHLB 2BMJA 3GLIA 2W6JA 3AGQA 2ORVA 4HI0E 3BOSA 5TV2A 2ONKA 2Z5FA 2IUSA 3KKOA 3THXA 2UZ3A 3CUEF 3AVYA 1DPFA 1PV4A 3NEYA 5DYIA 1HV8A 4BFSA 3EWSA 3RRYA 3SR0A 3O8RA 3IEVA 1F6BA 1JR3A 4P3YA 1O3YA 3KZ1E 1M7BA 2OBMA 2PX0A 2WKQA 2HYIC 3HPRA 4Q9IA 4XVQA 1H65A 1ODFA 2O8CA 3P4YA 4PO9A 4LBVA 2OFWA 3ZZ0A 3AVWA 1YZNA 4A0FA 1T0HB 4HYYA 4XVUA 1YVDA 2A9KA 5F98A 3IQXA 1E4VA 3K9NA 1OXVA 3THWA 4JL6A 4FMDB 2REBA 2P6NA 1FUKA 1VCMA 3W34A 2BBOA 4UNQA 2XXAA 4Z8YA 5FPTA 2H7VA 2AHOA 2ZXUA 1PVOA 4TTRA 4HAYA 4XD7D 2B7CA 1PZNA 1N5LA 1G6HA 1NVVR 1RFLA 3A1VA 3H2YA 4RKFA 5G40A 5LB4A 2GHIA 1WXQA 3L0PA 2VF8A 2ZM5A 2IXGA 5F2EA 2J3EA 3VR3A 3DPUA 3PFIA 5AUNB 4GP7A 5AJVB 4RZ3A 3T5GA 4M53A 4Q1EA 4HEJA 2EW1A 2GRJA 1V43A 2RB4A 3CO5A 4JZKA 4OK6A 2CNWD 3EIQA 4TMWA 2N1BA 1E2LA 1RYFA 5FUXA 2OESA 1XF9A 2FGKA 4TQ9A 4G0NA 1BMFA 3DVLA 1N6NA 4N0EA 2QT1A 1LF5A 4TTQA 4BFXA 1CEEA 3WXMA 5IT5A 3HR7A 3I32A 1LNZA 3B78A 4D2IA 4L8GA 3M1IA 4Q9JA 4POAA 4ZPXA 3FKSA 1E1RA 2BJWA 2QRNA 3GLIB 2PZGA 3MWYW 1IN5A 2RGCA 4BLTA 3THYA 2BCGY 4DDTA 4RD2A 1J8YF 2ZEJA 4YDHB 1E0KA 3RWOA 3T1VA 4G01B 2O8EA 4PHHA 5GADl 3GLGB 4M9QA 5HE9A 1XXHE 2PZFA 2WVJA 1XJQA 4LHVA 2KSQA 4DRZA 3TUZC 4TMTA 1TF5A 5B58C 3DM9B 5FTJA 1TF2A 4PZLA 5AUOB 3L2OB 1G8FA 2WZQA 4PZZA 2B21A 5JCZA 2O8CB 1Z29A 2DBYA 1NN1A 3B82A 3K09C 5HZHA 5FUWA 4LJ5A 4JLAA 3QEJA 1F3OA 4LGMA 3ZD6A 6Q21A 5CIWA 3RWMB 4XSHA 3KXKA 1ZCAA 3L0SA 2B6HA 3CR7A 1L7VC 2P65A 3FKQA 3O47A 3TNFA 1J8MF 5EUMA 2VP5A 1QBKC 2RHDA 5IRCD 2WMNB 3Q7PA 3QKRA 1E3MA 4HLUA 4MUAA 3DM5A 1MABA 1NMXA 2EWVA 2QL6A 3IPXA 1R5NA 4RFSB 5DI3A 3BK7A 1AS2A 4D80A 5L3QB 1H8ED 4URZR 2DR3A 2ZSAA 2CK3A 1S9DA 3CH4B 4CVNA 3NDPA 1CF4A 2CL0X 3NHBA 4ZDJA 1DEKA 1E98A 2QZ4A 4QC2A 5KPDA 3R8FA 2O8BA 1DG3A 4URYR 4DSUA 2XTNA 1U8AA 4KBFA 2G1JA 1GVNB 3KKNA 3QPVA 1KAGA 4JLJA 2ODWA 4LJYA 1FUUA 2A5GA 1M2OB 2GWHA 1FTNA 1Y63A 2A5JA 4B44A 4OQNA 3THYB 3BB3A 1OJLA 2GF9A 2IEZA 1QRAA 2VP0A 4LV6A 1XD2A 3TR0A 3FHTA 1YZQA 3QF7A 4XJXA 3GP8A 5L3SB 2O8EB 1E32A 4IVQA 1DAKA 1EWRA 1TU3A 2C77A 3TBKA 3CW2A 4EPXA 3OEHD 4DLSA 2EFCB 1JEDA 4N0DA 3B8HA 3C15C 1A82A 3IO3A 3LXRA 2GVDC 5DHFA 3I4LA 2FZLA 1XPRA 4TYNA 4WA7A 5FUVA 1OB5A 4EQ6B 2VA8A 5L3RA 1CTQA 4B2IA 4PX9A
chains in the Genus database with same CATH superfamily
4JX9A 1E7QA 3ZIAA 2JAPA 1EG2A 1B1CA 4LF4B 3IPAA 2ADOA 2COEA 3LA6A 2HQ1A 3HI6A 1CVRA 3FPKA 5KTSA 4YL0A 3M9LA 4LC1A 4CIVA 1ZOOA 1M34B 5I7RA 1Z5WA 2Z95A 4GC5A 3OFND 2FEWB 2V3VA 2HIMA 4E2FA 3A10A 1K6IA 2YY7A 4N01A 3UT5A 5J40A 4BQQA 3ESBA 3M15A 3G2QA 2R00A 4Y18A 5EVCA 1EFCA 3FFAA 1N3IA 3H13A 2Q6LA 1HL3A 1ZNXA 2PPVA 1QGOA 2DT5A 1RJFA 4C43A 1W36D 3PHBE 1KQPA 3LBYA 3SQNA 2Q6KA 1GN9A 1MNEA 2VYNA 4N7RA 3VKGA 1Y1KE 2Z30A 4CQLA 4JFAA 4MA4A 4MULA 4FM9A 1NIPA 4WKGA 1VKJA 1C41A 3NYIA 2Q1YA 3BH6A 3ASNC 3DE1X 4D4JA 3AHCA 3E5MA 3LY5A 3UT5B 1YYJA 5AFSA 2HSBA 4PLFA 5FHRA 3UJCA 4M37A 5EP2A 3TAHA 3P0EA 3ZNNA 2PH7A 3DMFA 4LWZA 4TN5A 1UDXA 2I2XB 3R5KA 5LD2C 4GOMD 4PYLA 4CZ2A 4PZPA 4LMAA 4YMSA 3K2BA 1UDWA 4MZXA 1QH1A 4DA6A 3KBBA 3K6RA 3WKDA 4NBTA 2ZI7A 2YZ7A 1IN1A 3EIHA 3HCAA 3ZVNA 5TMBA 1BC5A 2IU3A 3IO5A 1JHXA 4BGIA 4M1TA 2BI4A 2IGBA 1I01A 4GC9A 3B9QA 3ZGVA 4JJ4A 1Q95A 4MWBA 3K1IA 3R3SA 3MAAC 2Y2UA 3D3EA 1JHDA 3RK4A 3O8CA 4NWIA 4RKYA 5CYOA 3NDRA 4CDNA 1L7PA 1Z17A 3EBOA 4CCYB 5AW8A 5AVZA 3GUHA 3FTCA 1HYBA 2WLTA 4NEHB 1DZ3A 1DV2A 1QH1B 3O9VA 3NS7A 3RKUA 1PT6A 3QPAA 1ZA2A 4N06A 4R81A 1VOTA 4JEMA 2EG9A 5CUQA 2DPXA 1H3EA 3HA7A 3HSSA 2RAPA 4M76B 1W1WA 1GJRA 1BJRE 3VPFA 4EJMA 3U48A 1AGNA 5FCDA 3GPIA 3L7MA 1YMUA 1S7CA 3U3FA 1TA0A 1H69A 1D6MA 3ZYCA 2YNMD 3CEAA 4F9FA 1YV9A 1ESDA 5A7HA 5CFQA 4JYPA 1Y37A 4FE4A 5CCDA 2FZEA 1IHYA 2XL6A 3LT5A 3F5FA 3ZJ4A 5KYXA 3ENVA 2DLNA 2VYCA 2ZSUA 1SC1A 4D8WA 3C7KA 4JT2A 1R8XA 4MUEA 2HGZA 5CVCA 3PB3A 1QANA 2PS0A 4MVQA 1JPVA 3NWEA 4G4SO 3BJMA 3CVJA 5FPHA 3PXGA 2VSQA 3DBHA 4NBKA 5B3JA 3RADC 4URUR 3J7AC 1YZUA 4BVJA 3O7MA 2JAHA 5E9QA 4DV3B 1RKQA 4JJAA 3JAKA 2F3UA 4Y2UA 1D0IA 4IQ0A 4H1TA 5K3FA 1VYKA 5KNDD 3B51X 1G4WR 1MB0A 2HK7A 5JHHB 3QVSA 2XA2A 3KL2A 4OHVA 2KQ9A 4RIFA 2R7OA 5T3TA 2XUIA 3IIKA 1N36B 1TC1A 4G0WA 3GFOA 2GXAA 1VCIA 2IPNA 2VO1A 3GK3A 1Y6QA 5IWAB 4CBEA 1XRSB 3AM5A 1XTSA 3DLAA 2X0KA 3USCS 4GRDA 3WGLA 4ARZB 4PGMA 2R7MA 4RVSA 1ZC4A 1NMEA 1L0BA 3K8YA 1NBME 4EW6A 4B48A 2EL9A 5IT4A 5DBEX 5B1HA 2H5LA 1L5YA 3OPNA 3N70A 5ITZA 1CZKA 1T0JB 1UJCA 2HF2A 3PHJA 3CKKA 4A0SA 3L6RA 4J43A 2IBSA 3HB9A 4R8LA 4MV9A 1O95A 4B6GA 1AUOA 1TVEA 4M0EA 3L0ZA 1ZHTA 2V55B 1DQYA 1O9GA 4LJSA 4EHIA 3SYMA 1OW6A 5AXAA 5BRNA 1QIJA 1J2TA 3AERA 3OZ7A 3BGDA 4GF5A 4PTZA 3NNSA 1DIOB 1F1JA 1YAUO 2DHCA 2M6LA 5ENVA 1LZKA 4BV2A 4A2PA 1NUAA 1UP4A 4DQVA 1RZVA 4JB3A 2BSAA 4B4VA 3A4VA 1N34B 1LUAA 1K0FA 4PPYA 3W1WA 4I2NA 1DMRA 1QNFA 4R6XA 1DIRA 2GFHA 1A2OA 4GH5A 3U4GA 2WTNA 2XDQA 1ZUD1 2H4JA 2ZTHA 2O57A 1YA8A 2O8NA 4PFSA 1Z33A 3K94A 3IIMA 4B4UA 2PS9A 3AERB 3NNNA 5B57C 5B1YA 2IOHA 5KHOC 1IZZA 4NE2A 4B8WA 3DDSA 3AFGA 4KFUA 3STVA 1A27A 2X9QA 4H3KB 4C0SA 2Q9UA 1XDSA 4F3NA 4B6EA 9LDBA 4JC4A 4RANA 1ZCJA 3UJPA 1J1UA 3QPUA 2WYWA 2HK6A 2O0MA 3CF6R 4KO8A 4JB8A 4E08A 1N6KA 5ECWA 2WJVA 4B32A 1NHWA 2YWCA 3KLNA 1CJCA 3LUDA 3NUZA 2WPDD 5A7FA 4OJYA 4QYWA 5CTAA 3KJQA 3BGSA 1N1DA 3WE7A 1NN5A 4TYMA 1P0CA 1ESEA 3M8KA 3CLRD 4Q4LA 3F7MA 2IW1A 4KYUA 3HWRA 1JAIA 3TQRA 3KUDA 4A8PA 1N2SA 1YDEA 2BFPA 5FTKA 4J7UA 5BSTA 4HDQB 1VDMA 2ACEA 3R76A 1CDZA 1VL6A 3VXKA 3U4DA 2EJTA 1M0WA 5DK6A 1I51A 4HWPA 4BCCA 2EWWA 4Y2XA 4BNJA 1T5BA 4I99A 2XHZA 4JI1B 2QVYX 2KYHA 3NAQA 3AHHA 1U7DA 1YIAA 2XKKA 1KORA 5BWLA 2GZHA 2J07A 4L5CA 4AWBA 3PLAE 1TRHA 1X8XA 3T95A 4AJNA 5DFAA 4H3VA 4OINF 4M1OA 4J16C 4FFMA 4M1KA 2JJ2A 4D0RA 3CWCA 5CR9A 4YEDA 1B14A 4EG1A 1GILA 2Y3BA 2XLBA 2WJZB 4PYIA 5EINA 1GQFA 3GT7A 1XF1A 2NG1A 4Q4HB 2PE5A 4HHEA 1M34E 3FSRA 4BMOB 3AILA 4AUKA 1NVVQ 2W9YA 1NBAA 2WU0A 2WB2A 1S2DA 5TMPA 3FYHA 2OB2A 3H1BA 1KY5A 1WAMA 5DLPA 2Q3JA 4L4UA 5HKBA 1QK4A 3O6VA 3BGOS 2IEYA 1YSCA 4KLAA 4P36A 2A0BA 2VWQA 2Z43A 4MQFA 4F0JA 4KB5A 1E5VA 1DDIA 1WF6A 2YRWA 2R6CA 3NYQA 5CDGA 3FPCA 3AG1C 1S3IA 3PUXA 3IR6A 1ZH2A 3R2JA 3KYIB 2FEAA 1Z12A 4C6TA 1DX6A 4PZYA 2EP5A 3DAPA 1A8IA 3MN1A 5A3QA 5KHAA 1KXJA 2HRRA 4AMYA 3QVYA 3VRCA 1KI8A 2V6MA 4OTZA 4EVSA 3UATA 1FB5A 5HQ3A 8ATCA 5DMXA 1A96A 4IJKA 2YXBA 3AIIA 4BKMA 4B3SB 2R6DA 4I1UA 4EECA 3AUYA 3RGGA 4U6SA 3OZAA 8OHMA 1WKCA 3NVMB 1YU9A 1C3JA 1DTWA 4JLSA 4PYNA 4JC0A 1LBIA 3PICA 4FYWA 3DAHA 4FDAA 4WLOA 4FXPA 2CJXA 3OIUA 4H7HA 4KNWA 2CF5A 2Y76A 3ZDRA 1SURA 1XK7A 4AZVA 1WZIA 5HIKA 1T1GA 3N2YA 2JF0A 4Z9AA 4LLCA 1H6GA 2ZVJA 3H3FA 3U5SA 4M99A 1KDYA 2UZAA 5A6SA 3AGPA 1AQYA 2OWDA 3S5JA 2W4IA 1QAOA 3AUAA 2DEUA 1GYPA 1DTWB 2GYWA 2J0WA 4QBTA 1VIMA 3A3PA 1A5SB 1GAJA 3RIPA 4O8CA 1BBHA 1P2TA 2ENUA 2F3QA 3V9PA 3AFNA 4YFVA 1UDCA 4WH0A 2BMEA 3ADKA 5FFFA 2I7XA 3PUJA 1KJJA 4DVYP 1U0TA 2ODQA 1B2RA 1Z4PX 4OL9A 1BE0A 3CINA 5FNVF 1P45A 5AJWA 5A6SB 2XMRA 3NWJA 2ZYTX 2ZRFA 1OXBA 3FTDA 2HLDA 3DZBA 3C4VA 1AF4A 1G5TA 4M7WA 3SS8A 4OQFA 4O02B 4NXMB 3JQEA 4R9UC 4KX5A 2J9YB 2PLAA 3I6QA 1A7KA 2VDNB 2ZJYA 2ZYSA 2BJVA 3D0QA 1ORVA 3ZEIA 1D0VA 4MKHA 1Z6QA 3F6YA 3ICQB 3TE7A 3DEZA 3RSCA 1IOLA 4LWPA 1XTTA 1K7CA 5I3CA 4F5WA 5CB8A 2IDJA 3N6VA 4ZXPA 1OW8A 4HX2A 1RRFA 3K6KA 2O2XA 4L3OA 2EKQA 4MTLA 3BKWA 1Z7GA 2X4GA 4X3CA 4JW1A 4E30A 1OFGA 2RHBA 2YQYA 3FPLA 4BNTA 2VFAA 3PX3A 3DOOA 3RYLA 1W36B 4ME6A 4DABA 1KS2A 2YC2C 2G72A 4WLNA 3GMDA 1T4DA 4IJMA 3H5LA 1VJ0A 2IQ5A 4AULA 1XHEA 2GTPA 3HFJA 2WIDA 3L1VA 1TX4B 4C7BA 3QXXA 3YASA 3CE9A 1XROA 2DRIA 3Q2KA 1VGVA 1QFXA 5FWYA 3SVTA 3C8MA 3T9BA 3B60A 2CKDA 3SX4A 5JJBA 5F4ZA 1WWPA 2HMZA 4ZRNA 5FNVB 5CD1A 2P3QA 1KIFA 3SG0A 4LDZA 3I5YA 3VSEA 2EFGA 4ZA2A 1CWUA 5B2ZA 4NYIR 3Q4GA 1ZD3A 3V1MA 1V8BA 4LXXA 1PS0A 2H52A 1XHLA 3M4NA 5ES3A 2QX8A 1SA0B 1OXTA 2O0JA 1AQIA 4B74A 1GAEO 2GYYA 1Y3FE 2GRAA 5JUAA 5LBUA 1Q7RA 1A9XA 2UDPA 3F6CA 4IWXA 4GXRA 4ZIRA 4IHKA 1N2BA 5B5SA 1ZR4A 4UE6A 5FWYB 1X8JA 2JARA 2HUPA 4FX2A 3I6MA 4BMYA 2EX4A 2ZSEA 1OILA 4RKRA 3PNQA 2C7BA 2UZ0A 3COWA 2Q9CA 1Z5PA 1PFYA 5AKIA 1MRNA 4MVJP 2C2HA 3FOBA 1NNSA 2FN8A 2FSPA 4QTZA 1VSVA 1XIVA 3QU4A 4JBHA 3VZRA 3LXMA 4R7ZA 1SZPA 4OBXA 1A9XB 3H65A 2ZJBA 1T2EA 1P81A 4ZIRB 5U1PA 2OHXA 3TINA 1QYCA 5LA6A 5JJIA 3PEEA 2II6A 3HGTA 2I78A 4JP3A 2YLGA 3IPLA 1WGWA 1J20A 5KDDA 2WHEA 3MD9A 4U2FA 2PAAA 1ZXLA 3LMKA 3L18A 2VDRB 1Y6FA 3DNFA 4OBEA 1UWCA 4BFTA 1DWQA 3PPYA 4EUSA 3HC7A 5A5FA 1EUCA 3V4PB 3LDAA 1A4XA 4JBLA 1J49A 1NU8A 3UGQA 5EXDA 2DYSC 2Z6UA 4YRQA 3S2ZA 1QHHA 5DGHA 3Q2OA 2O1WA 2XLHA 5A03A 2CNOA 2ODAA 7MDHA 1G6KA 3R0VA 4YWQA 1PG5A 4R69A 4BGDA 1RYDA 1SUBA 1QE0A 6AT1A 2P79A 3FGPA 3T5DA 4FSDA 1ZNWA 2FPRA 1SXJD 1E6UA 2H7XA 1RI5A 1CJUC 3AEUA 3KYDB 3D3JA 1DOHA 1WJGA 4QI0A 3UICA 4YAOA 5C7OO 1BIFA 4R7GA 2ZJAA 3QH4A 4TL6A 1RKCA 2JI7A 5AI4A 5CX4A 2VK8A 4Q7JB 4Q9HA 1A7DA 1T5LA 1JHZA 1KP2A 2J9XB 3LUTB 2RC5A 2UXCB 3CMCO 4AKTA 4AS1A 5K8JB 1G42A 2GASA 4BBZA 2VHCA 1R37A 3AZOA 1KMQA 2J3LA 1E2NA 2P6MA 1GQQA 1PFWA 3C7CB 4IXWA 3G3EA 5G0TA 3BZUA 3PD0A 2XBUA 2VUTA 1JTVA 3OZXA 1RRKA 3IOCA 5D3QA 4OHOA 5I4BA 1JDSA 5EJAA 2ZB4A 3RDPA 3ZIBA 3K0BA 4GPZA 3AEKA 3KETA 5IKXA 1RQNA 3G5MA 3PEWA 3BRCA 1T2AA 5JH7F 1ZGAA 5EHXA 2A4MA 2XOEA 4EHAA 2P41A 4CM3A 3M6WA 4F21A 4ETNA 3V5YA 2DB4A 1YHNA 1LRKA 5C1PA 5M04A 3EQ7A 2I3BA 5H3CA 4YV2A 4FOTA 4E17A 1QG0A 3B0UX 5FJJA 4DXHA 4IIXA 1VG0B 5KSOA 4NCIA 4ZK6A 2R9VA 3I45A 2O0HA 1MAVA 3TZHA 2BCJQ 4L4YA 3VVMA 2QSJA 4F3CA 4BUZA 3LI2A 1SC3A 3AY3A 3NR2A 2EJBA 2Q41A 2HRQA 3O3CA 2C00A 5J2UF 2W93A 2Q99A 3AEQA 4CMBA 2PANA 2W6JA 1DDGA 2PU7A 5JUWA 3M6XA 2CL5A 3RRYA 1O3YA 5IBCA 4MLZA 2HYIC 2BF4A 4YRLA 3ZZ0A 2GN2A 3CVUA 5NLLA 1SD1A 4ECEA 2QU7A 4UNQA 2XXAA 2Y6VA 4JJIA 2AHOA 2GKOA 3HTXA 3R1IA 1G6HA 5FJIA 4TVOA 4GP7A 2G7ZA 5B6IA 1UKAA 2OESA 1XF9A 3PF8A 2VSNA 3NRHA 3WFIA 1U7OA 3F7OA 4YJGB 3B78A 4L8GA 2POCA 3ZE2B 4NU8X 2ZEJA 1M6TA 4FDUA 4YIHA 3FYTA 5JH7B 2O8EA 5J2UA 1I1QB 1ZHYA 2WVJA 4BBAA 2P1AA 2BFFA 2FN7A 3O5AA 3FNIA 3KB8A 3WVNA 1O0SA 2BZGA 3DFUA 3ZD6A 1PYDA 3LT1A 5LC1A 3KXKA 4R4JA 3O47A 2WMNB 4BNKA 2M1XA 5JCOA 3IPXA 1DXHA 1U31A 5H4GA 1GTG1 4N6OA 1KZ4A 1K5HA 3E1KA 5T6MA 4IX9A 1CT9A 1GTZA 3WO0A 3BB3A 3DMTA 2X5NA 3GLUA 3TR0A 5DOZA 2O8EB 5J2UB 4IVQA 1FUIA 1ORYA 4WRRA 4IIEA 4MB0A 2BFFB 1KERA 2BYTA 2Q28A 3KR1A 2IOFK 2JZCA 4EQ6B 2GO1A 1F7VA 1ZK1A 4BKRA 2ZBGA 1BX3A 5BQ3A 4Q5SF 2JFYA 1KEVA 4Y2RA 3H17A 1K0UA 4AY4A 2O19A 2AYYA 1VE6A 5KYGA 5HHTA 2CXOA 4EBJA 1HFEL 1SZCA 5JS2A 2RCNA 3TQFA 1AGRA 1ILWA 2BGGA 3R3VA 2VPIA 3H8WA 1AKVA 1JDNA 3Q6NA 4IV0A 3OQMA 4B3HA 4YRMA 4IB4A 1KI2A 4MYTA 2BTEA 1F4VA 3NHWA 4F71A 3MLEA 3S29A 3KSDO 4UTNA 4JP5A 4MWTA 1TVKA 3CRMA 4ZRDA 5K0SA 3P4UA 1Q3HA 3RRMA 1MUUA 3L8JA 5AC5A 4Z9FA 4LW8A 4ZAZA 3KQSA 2JGDB 2VS1A 4QTTB 1W1IA 2LXNA 4QG7A 3VOSA 5I4CA 1W59A 2ZT8A 1SCAA 5IANA 4YI3A 3LGAA 4TS9A 3DL7A 1QRUA 4BX9A 1E7MA 4DQXA 2Q3TA 1S7GA 4X8OA 3IQ6A 4A92A 2K7FA 1N3BA 4C3UA 3VVCA 3M1CB 2C4MA 1COWD 4UPVA 3FG9A 4ZDIA 2XWBF 4U00A 3K72B 1XZQA 5IHXA 2WJPA 2CHVA 1MOSA 4LI0A 3TRDA 3ICWA 1NVGA 4XDYA 3VKWA 1KSJA 1ZH0A 1K7XB 2QTLA 4D3DA 3GVPA 4G24A 5DTMA 5IW8A 1Q50A 5DT9A 3N0TA 2PL5A 5YASA 4YONB 3JQ9A 4Q7MB 4F7DA 3LLIA 1GDTA 2YC4C 3CNQS 3MLGA 1PDWA 4JBNA 4IHQA 4QRIA 1KK3A 4C6SA 2Z15A 2XCSB 5AK4A 1N0HA 3UKOA 4TWZA 4OK3A 5E8RA 4FGSA 5EJ4A 1LVUA 1FIUA 3OLQA 1EJBA 3AEXA 1AKWA 3TTYA 4L3VA 4QLBA 1THZA 2WWWA 3DXFA 4PXSA 5HQJA 4LQCA 5COBA 3T5CA 3JWIA 1XXHA 3MJRA 3HEMA 1CNEA 4F4UA 4DMCA 4V2IA 4UTVA 1E2QA 1H5NA 1BX0A 1A5ZA 2K2QB 4I5FA 3IQGX 1V3UA 3EMVA 4CQMD 3IBFA 1AK9A 1JJAA 3TCKA 2H1OA 3C18A 3K70D 3GJ5A 2WZBA 1EXDA 1OYOA 1Z38A 4GVLA 2CB9A 3KHUA 2E49A 2QM7A 5DM60 1E2KA 5ETJA 3ZQYA 1DIGA 2GRUA 3K9WA 3ZG6A 4FDMA 4HQOA 2WJGA 1HEYA 2C5LA 2ACWA 1HDOA 5HZGA 1HORA 3UOWA 2PL9A 1QYDA 1FX0A 2GJSA 4K3VA 1CJBA 1T1EA 1DFGA 1RAGA 4UXJA 3LPMA 5IAGA 5JSZB 4EY4A 4GVXA 5A4AA 1XOIA 4GM4A 2TSYB 2VJKA 3NBKA 2H16A 3DTVA 4G84A 3T3MB 4X63A 3Q7EA 3OEHA 1Z5OA 3AL0C 2V7QD 3K8ZA 4PZDA 2J32A 3LY9A 4HMOA 4YYZA 3AVTA 3A4YA 2I2BA 1FX0B 2CC2A 3UR3C 3MJEA 3Q8KA 3GU3A 3QNWA 4KR6A 3TKLA 2QE7D 4BLWA 3RH3A 5LUAA 3B5JA 2ETXA 5JCJA 1R0XA 1WOLA 1TFRA 4WJZA 2YJTD 5BUOA 5HJ7A 1FVXA 4KGZA 3DTVB 5G4LA 4RULA 2C84A 3QY0A 3SM3A 4IS2A 1EFKA 4DJFC 3FJOA 2YN4A 2HGSA 2FPGA 4ZQGA 1NW3A 4IUYA 4WY2A 1YACA 2VQ3A 4Q3NA 2IWHA 1Z9BA 3IAEA 4CDRA 5AC4A 5JARA 4XQCA 3EQZA 2VC9A 4C4XA 4D82A 3GLVA 2M6SA 3RI3A 3LVBA 3EHDA 4MYRA 4IDPA 2YXPX 4BNXA 4GT1A 1JIIA 4GI3A 1AGXA 2ATXA 2JIRA 2FA9A 3LECA 2GO7A 2O6LA 3IAHA 3B5IA 4LYFA 5AM4A 4HUQA 3C5HA 1P4GA 5H7XA 2FZKA 2QAGA 4KXYA 4K6MA 3VZQA 3OO0A 2JIBA 5J4LA 3RT9A 5K0LA 4GQIA 1WSAA 2EILC 1BFKA 2CD9A 5BQIA 4OUDB 4X1IA 2WE7A 2V0NA 1QO0A 4FFDA 1ETUA 4S1NA 3STUA 3NDBB 4GXTA 5JWHA 2F48A 2RE8A 1F51E 5IBRA 1SC6A 4YCLA 1J25A 2QMUA 3S1LA 5H68A 2SBTA 1ULUA 3WBFA 4EJ6A 3E2PA 2QAGB 1OQCA 1B6TA 4MIEA 3CW8X 1RWOA 4GECA 3U7FB 4DUZB 2HBZA 3CX8A 4OD4A 4PLGA 4F93B 1UPXA 5IEJA 1BVUA 3OF2A 3HUUA 2JJYA 6REQB 521PA 4UUMA 1PSWA 4QNRA 4TTJA 3V7OA 4IDOA 3N2IA 1OGJA 3ZY4A 2H3EA 3SQLA 1G3RA 1A69A 5K3EA 2AEFA 1IAQA 3V1KA 3ZGNA 3PSAA 1T3TA 4R8MA 4F2DA 5SY6A 4J0JA 4S12A 4XFJA 5HF8A 2QD2A 3EFBA 3RS7A 1WMDA 2W6OA 3VJMA 1YJGA 4ANJA 2VDUE 1HR0B 2P9FA 3JQAD 4C7KA 4ZT6A 4KNYA 4DAOA 1X6VA 5CK4A 4MDEA 4ZVLA 1FDWA 3PQCA 5GAJA 3UJDA 2PYDA 4E3ZA 3DJFA 4D46A 4AJHA 1WUIS 4ZHQA 2FPKA 3IULA 4X6UA 1E0DA 3H84A 5KNCA 3EA5A 1YS2X 1EHCA 3CRZA 4U3JA 1HDZA 1C5KA 1YA7O 4KWIA 5ILOA 1THMA 2WWXA 5A9SA 2B3DA 5B37A 3INNA 3PDJA 5IFLA 1CY2A 2CXNA 1RPNA 2GESA 4R1TA 3UENA 1N2XA 3IHTA 2GPWA 1EH5A 3ICOA 3VHRA 5JZMA 3SZLA 2DLDA 1A4RA 5JS1A 3BT7A 2NIPA 2NPOA 3E0QA 4BPMA 3W3AH 3DQZA 4G4SP 3VDMA 2WU4A 3HRHA 2P2DA 1M0SA 5A02A 1T9HA 3P19A 4YPVA 1LTQA 2WJWA 2VKQA 2DJIA 1AJEA 5A9SB 1W0JD 3C63A 2EBWA 3KYCA 2ZGVA 3P9ZA 2QN8A 2O7QA 2BH9A 1X7WA 1FOEB 2I8LA 1PUXA 4P33A 1UKZA 2YVQA 1SVLA 1PF7E 3TUIC 3G17A 4PCLA 3OX4A 1P4HA 3GQVA 1VYIA 4F2GA 3T1OA 1SYQA 3AJ8A 2FG5A 2AC7A 4QT0A 4I3GA 4O2AA 1R3UA 4MRRA 3RT1A 2HADA 3AUSA 2LCIA 4BPBA 1BS9A 1ZZEA 1EGVB 1OUMA 4EFLA 5HBGA 1TM5E 3MBGA 1LBEA 4LNAA 4WNAB 3D3QA 5AR1A 1XDDA 3TX2A 1GPKA 3H5VA 1R6TA 3ZQ4A 4XLZA 4DZZA 1JWBB 2CUZA 1K3UB 3H2JA 2E5WA 1VXRA 3HP4A 5C53B 2P62A 3VYUB 4I36A 5F73A 4IOMA 2G9ZA 3LESA 3O8QB 1QZUA 5DYYA 2QVCA 1I10A 5T67A 1C4KA 3OIWA 2E18A 3CBGA 3I5PA 2BBTA 1UBRS 4B6JA 4JLOA 2VPWA 5KWEA 2NQ8A 2RHMA 3H86A 4DZTA 1E5QA 2OMKA 3QMVA 2P2SA 5K3BA 4JA2A 3WODF 5EYPB 5FD8A 2VJPA 4IBOA 4GR4A 4TLBA 1DOVA 1IL0A 2F8MA 1EJ6A 4OFWA 1XTPA 4OLJA 3QRWA 3L7IA 4OSPA 3RIYA 4G4IA 5CAEB 2Z3ZA 2I2DA 4P9FA 1YCGA 3ZY6A 4IAOA 2C3UA 1VMDA 3PQFA 3UMJA 3VTAA 4ARSA 3DT8A 1XWFA 1JPNA 2UYGA 3W6OA 5LU8A 4RHFA 2JK1A 2KWIA 2FGJA 5GOTA 4QBKA 3JD2A 1U5BA 1QMPA 4HAUA 5C81A 1ZJZA 2IHNA 3GDOA 4BRWA 3TQQA 1OH8A 2KB0A 1YRWA 1UMCA 5HSGA 2TS1A 2VYFA 3ZDCA 2W71A 5KKAA 4FHDA 3QHQA 4O4LF 5LQCA 4X65B 4UEQA 1MOQA 1IB0A 2ECQA 1AXEA 4W7SA 1LTKA 1DXOA 3ER6A 3AY7A 4LQDA 2IF2A 2VT2A 3E22A 4LIPD 2D2IA 4TMZA 2FW6A 1W7AA 3JARB 1U5BB 1U3VA 4FE3A 1YE5A 2CDRA 1KDPA 4DLLA 1FNDA 1JJ7A 4B4KA 2ISSD 4U5DE 2CHUA 1OR3A 2V5AA 4YALA 3AF4A 1YBHA 2HDNB 1DIHA 1FFXA 1M67A 2UVPB 5LMNB 5EXTA 1E79D 3SR4A 2QNBA 5AVTA 1CLUA 4XWWA 4DXWA 1I3KA 1GPH1 3S9OA 5JD4A 1M34A 2RI6A 5HW0A 1VLQA 4NFLA 2W8BA 1RT9A 4FR2A 3KKQA 4M9RA 5TJHA 3GUYA 1MAUA 4MP3A 3T06B 4XYMA 3RYFA 1M57C 4OAPA 1TI7A 3ITFA 4B43A 3Q98A 4JV5B 4B3RB 4EA8A 2VJAA 4J7YA 2QTCA 2Y3HA 3HKDA 4C1NA 3GEIA 1FFXB 4O4LB 2ORED 3K71B 3DV9A 4NSNA 3AOGA 2HLHA 1FDSA 3ABSB 4P6VF 3CVWA 5H82A 5BQGA 1DQZA 5IAJA 3OUZA 4GE3A 3R6LA 3U7GA 1KF0A 2JHFA 2W8BB 1CV2A 1RWNA 3IB3A 1QIFA 2CHQA 3RYFB 4E4TA 2VSXA 2HSWA 2R87A 2IF0A 2PTHA 3I01M 9LDTA 3HKDB 4ZVSA 3GUZA 1XYYA 2PX2A 4EL0A 2PEYA 3PFGA 4HNAA 3NIFB 1ZONA 5FNZA 4K28A 3S99A 4OBBA 3B13B 4CIPA 3PPIA 4MUGA 3IQ5A 3U0BA 4FD2A 2EWMA 3UJ6A 2VDQB 3GAFA 1B93A 2VRCA 2VNIA 3BFPA 3QFSA 3U1VA 2VJYA 1GSOA 3P0JA 3R7FA 1ZKDA 2RGBA 1YVRA 4ZOBA 3VPBA 4LHSA 4FMBB 5T5QA 2IYTA 4NDNE 2C99A 1QRRA 5EE0A 3DR5A 2EGUA 4MIOA 2PO5A 2YJ5A 4HNAB 4OVKA 4CCYA 2NYAA 4FK8A 1ECFA 3IILA 3CZRA 1A77A 3SJAA 3GODA 1ZGCA 2A6HF 2AN1A 2RDMA 2QPTA 4L9AA 1KSHA 3KQTA 3ITEA 3EGWA 5HRCA 3DLBA 4CQMB 3OCJA 1GCIA 4RK1A 5HR5A 1M1XB 5FR2A 3WJ2A 1U4OA 4NAVA 4E46A 5MFZA 1LFDB 3GMIA 3PEVA 1G3IA 2WRZA 3IKTA 3HCRA 2AQ8A 3GN1A 4ESVA 5DN6A 1NP7A 4PFJA 3ZDYB 3SFZA 4AB1A 1KOFA 2WHPA 4B87A 2YJZA 3JCZA 3N0VA 4GPAA 5EWJA 1P80A 5AW2A 5TRTA 1W48A 4P22A 2Q5HA 2C1ZA 1JWLA 3OTGA 1XCGB 4B40A 1OV4A 1MOPA 3JVVA 3FZYA 1YYXA 1YFLA 3SZRA 1YI8A 3ZWYA 2PBLA 5TC4A 5HYVA 2B0JA 1SFRA 4OU4A 2OGZA 1AUXA 1ABEA 3WAGA 2XVMA 2WHPB 4M1SA 1KE2A 2YHIB 3DR3A 4HATA 4DFDA 2R6AA 1U0BB 5EWJB 1P3Y1 4R05A 3AF3A 4A03A 1MF7A 5DISB 1S2IA 1N2GA 1E9SA 5E7JA 4B6QA 5K7SA 4NBVA 3EDRA 4DC1A 4OHUA 4LFCB 1K4MA 5FP0A 5JDIC 1Z7YA 2MWMA 5KQPA 1YOBA 1ICIA 3E8SA 3ZCRA 2F3RA 3T6GB 1Y7PA 4ARZA 2XD4A 4QJ4A 4OQMA 1Z0SA 2QSYA 3NBFA 3FD8A 4BLQA 3KJZA 4ZMRA 3HXPA 3NHKA 2OEXA 2B2XA 5TPZA 4WOBA 2LCQA 3UV7A 5HFAA 4FDVA 2WA2A 4PXYA 4OLBA 1ZWLA 3AEYA 3ORHA 1EFRD 1MX3A 3OF3A 4KK3A 4QJ5A 1S0UA 2FSVA 4NBSA 2I5PO 1W52X 3ZE7A 4C3OB 1HDIA 3I92A 5DLQC 1WXEA 5BW8A 4A82A 4ROTA 4FYMA 1CP2A 5ICGA 2VQEB 5JISA 5CDYA 5A2QA 2FW7A 3GFGA 2OBMA 5DHPA 3HPRA 1V2HE 2DE0X 5EZSA 1R8YA 4ARIA 3AVWA 4XVUA 4HQNA 3WK5A 1GNVA 3AR8A 1KTIA 3FCUB 3PKIA 4PNPA 4TTRA 2KPOA 1PZNA 5G1OA 3H4VA 2L17A 3OA0A 1FQOA 2PRJA 3ISTA 2E55A 1E2LA 4JASB 4TTAA 4S2UA 3PHF2 3NORA 1E2XA 5DOVA 3WXMA 3HR7A 1U2PA 3V8VA 1J8YF 2X22A 1F0PA 2OWEA 5EJ5A 3G6KA 5KI6A 4EBBA 2OKGA 3B48A 3K0HA 1MC1A 4MGHA 3T4PA 2Z2ZA 1RM4A 1ZCAA 4DR1B 1KC3A 3TBHA 1VKOA 4FGJA 4F6RA 3JYYA 2CK3A 3R8FA 3HNJA 2NXEA 2I7TA 2NUPA 3RWBA 3RAJA 1FUUA 3L7DA 3CTPA 1FTNA 5D6NA 3NJ4A 1NURA 3GBSA 2R751 4FWVA 1TU3A 2IP2A 1JEDA 3C15C 3LXRA 1F4LA 1H2WA 4JCZA 4TYNA 1OB5A 2ZBPA 4LZLA 4IQ4A 1NXXA 4N12A 3WMRA 2I29A 3OZSA 1JA0A 3G0OA 3LKVA 4L74A 4F6RB 3R3JA 4ZCPA 2HLPA 5DNDA 3AV3A 2A84A 4WUVA 3EASA 2NUPB 3DDOA 3UC9A 3V1NA 2VCEA 2C2ZA 4Q48A 4UXIA 4YAEA 3CU5A 3U3OA 3U37A 2DERA 5T1DB 1MMFB 3PYLA 5B3LA 4REMA 2XLCA 5T6BA 5KNBH 5A3JA 3RQFA 4NOMA 2D6FA 1TQ2A 2AWYA 4R3NA 4IKOA 1RACA 2FN3A 3QW4B 4QGBA 4NP6A 5DGDA 2NPUA 3EHMA 3BRJA 4S0ZA 4YDSA 3RAGA 2X1HA 4WOPA 4MTGA 5EQFA 3FKJA 2JFFA 4I9NA 1EK6A 4J9VA 5DGCA 4Q4ZF 1U2ZA 3WXBA 2CNBA 1MV8A 4S3MA 4OIOF 2PKWA 2H4WA 5GZ1A 4HYEA 4UHKA 1JAHA 3UJ9A 4FYPA 2I4TA 4Q4HA 3VC2A 5HMMA 4I6JA 1EIWA 5TJ9A 2MT9A 3P9KA 2DQZA 4BMNA 1RMQA 2HKVA 4W82A 4NH4A 1J9GA 3AHIA 3EJWA 2BFWA 5G0UA 4DTCA 2AA3A 1YFJA 4M9ZA 1DX4A 4BQEA 3EIWA 2ZR9A 2D1RA 1KVSA 1SNYA 4UATA 5HPYB 3IDAA 4XPIA 1QFJA 3WQBA 1MPTA 4YRAA 2KSFA 4YAWA 3N53A 4WAUA 3KYIA 5SZKB 2QP3A 3SXZA 2OV3A 3G8BA 3IV6A 1YVUA 2F8LA 2O0KA 3DTYA 1DB3A 2XSZA 2CBXA 3EW9A 2YYSA 1IWPB 1XD8A 4NNPA 2HA2A 3L4JA 1X39A 2G88A 4WK2B 4KXQA 1ZITA 3AF0A 2EF0A 1H2XA 2FEKA 4HDNB 1NYRA 1K04A 1VLSA 4G1BA 2RB5A 1E99A 1RXUA 2JJ1A 3CM0A 4XPIB 3HUTA 3HE3A 1T6BY 3RAPR 2DCMA 3S7ZA 5LQSA 4RV9A 5JD5A 4NG4A 1QRDA 5D86A 1PGJA 4KRYA 3QYAA 3HV2A 1ISHA 3N1UA 1DG1G 3SY8A 4CG3A 5ALPA 3RIEA 3CRQA 3GT0A 4LBZA 5IKMA 1X15A 2I9KA 3RKSA 2HC9A 2HF9A 3PXCX 3GOQA 2YEVA 5K20A 2XT0A 4A6DA 5HA5A 4FUTA 1IEVA 5CH5A 1W87A 4MP8A 5TQVA 3HO1A 3TZEA 4HVTA 2P0NA 4DPKA 2VDMB 1YL6A 4Z2AA 1N5OX 4X84A 1MJGA 3UGKA 3NC0C 1E5TA 2W6ZA 4B3XA 5JJKA 1RE0A 6GPBA 3OJOA 4NYIQ 2CFOA 1SR2A 3WBBA 2WC1A 2OORA 2FUCA 3H1TA 3A6ZA 1LLFA 2WG2A 1IULA 3W1EA 2O05A 4MRNA 1XWIA 4F11A 4DDVA 3R24A 2JGKA 5GGXA 3S8MA 4W8KA 4X54A 1HW1A 2DOKA 5KVQA 4PGGA 1RM5A 2QTVA 3TOVA 2A7XA 2QUAA 4WIAA 2VCHA 3WGGA 3ZEAA 3V2IA 5FFMA 1NG9A 1KVUA 1PKEA 3AVQA 2PKYX 4OK5A 1U7ZA 1JI0A 1R0CA 2NU9B 4Z0PA 4R8RA 3KZKA 5EHHA 1H6DA 4MICA 5BW5A 3W3ZB 2P4EA 1XEXB 3I12A 1Z2NX 3CUUA 3LSYA 2G5GX 3DEHA 4HX9A 3I9JA 4QEKA 2ZSFA 2D1SA 2Z6QA 4NZMA 1OQAA 1GZ3A 2PVCA 2CVZA 4EOGA 3QVKA 5HF5A 4EHKA 4B9AA 1NF2A 3BJEA 3IA2A 4TPKA 3OFNA 3GY0A 2FF7A 2QTVB 4D6XA 3T7RA 2FXIA 5BN5B 1T6NA 2ZI9A 2QI9C 1HYEA 3A9RA 1QF7A 2YYAA 2WSSD 3O1HB 3WL3A 2ZS8A 3L8DA 3RT7A 2NW6A 3K16A 4JXXA 3CX6A 1B16A 4DIMA 5LBTA 2MSDB 1U1FA 3QTHA 1T6QA 2CWWA 2WNIA 4W5TA 2J7PD 3M4JA 4F6LA 1Y42X 4PHFA 2QRJA 1SCDA 2X5JO 2ZI6A 4CIYA 4MVUA 2Q3EA 4DM4A 2HA7A 3ZBTA 3PQ8A 1WPRA 2ZUWA 3FOWA 1OZHA 4G1CA 3HWSA 1E6EA 4CR8A 5FNVA 1SXHA 2X6QA 2EPKX