2YHSA

Structure of the e. coli srp receptor ftsy
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
308
structure length
308
Chain Sequence
b'EKPTKEGFFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN FTSY
publication title Lipids Trigger a Conformational Switch that Regulates Signal Recognition Particle (Srp)-Mediated Protein Targeting.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
total genus 125
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2yhsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yhsA02
1GSIA 1EGAA 2RHDA 1N5IA 4M9XA 5H70A 3DVLA 1VCNA 2VBCA 2LCFA 5SZHB 1PLJA 4N0EA 3W5JA 4PAQA 3GLGE 1TNDA 2D4HA 5JEEA 1OXSC 2C77A 4URXR 2AD1A 2C5LA 4OQMA 2RGAA 2XZOA 4ASUA 2HCJB 4NONA 1E9EA 3TAHA 3HU2A 2PT5A 3U3OA 1P2UA 5FL7D 3E70C 1HQCA 3B9QA 2WAYA 1J8MF 2VHQA 3LV8A 1G8HA 2OXRA 2IL1A 2RGEA 2WJGA 2WHXA 3C16C 4IFBA 2Q9CA 3ADCA 4NCNA 1TAGA 1X86B 1MABA 3LO5A 3U61B 3QXXA 1SHKA 3VX4A 4DB4A 3RC8A 3EZ6A 3SS8A 3HU3A 3P4XA 1R0WA 1ZM9A 4LHWA 2NG1A 2RGCA 4Q66C 4D2IA 4ZIRA 3BC1A 1E9AA 1T8TA 1PJRA 4I1UA 3BH6A 1NJFA 2LWIA 5IT5A 3RS3A 5L3QB 3NWJA 5D3MA 2QY9A 2RGNC 3IO3A 1OLOA 2QQEA 3QXCA 4CF7A 4H1UA 3THYB 2ZUCA 2D7CA 3NVAA 3ONWA 4W5HA 1AA9A 2ZR9A 4JLKA 2WWHA 4ZDKA 2PCLA 2QSYA 4MYTA 5CYPA 1TTTA 4B44A 3B60A 1E2IA 4N3NA 3DZDA 1OH8A 1IY1A 1ESNA 3AKCA 4CT4B 2H5EA 2D7DA 2ZI6A 3UG6A 3OEEA 2QPAA 5BYJA 1FMLA 2FZ4A 2E9SA 4M22A 5GADl 2D62A 4BLQA 5HR5A 4W5JA 3EXAA 1ZM3A 3PEVA 4IOJA 1N6RA 2ZRMA 1Z0IA 3O8DA 2WM9B 5GJWC 3FGNA 3A8TA 2IYSA 3ADDA 5FTLA 1C4OA 4NKRA 1G7SA 1W48A 3GD7A 2JLZA 2OCYC 4M2LA 1W7AA 4LY6A 2MMGA 6Q21A 3DM9B 1EX6A 5L3SA 3GPLA 5JLJA 1CXZA 1HQYE 4LWZA 3Q72A 2JLYA 1WRBA 3BH7A 1XWIA 2O8EA 4RZXA 2P6NA 4XSGA 4Q5IA 4YLGA 2W0MA 3S1AB 2NOAA 1DVRA 4Q4JB 3TVTA 1WA5A 4BLRA 1VCMA 1QHXA 4YDHB 4XTRA 1GNQA 1MH1A 1GDDA 1SXJA 5LB2A 2ZJAA 3A37A 5JZVA 3QXJA 3EIQA 2HJVA 1QHSA 3M4YA 2YOGA 8OHMA 2OAP1 4CEJA 4HLQB 1H8HA 1DTSA 2CLCX 2WWGA 4Q1CA 1XPOA 2Q0HA 4PFSA 2G0NA 4M1TA 1YZGA 3ZVRA 5EUMA 3TW8B 1GRQA 3UG7A 1B23P 3I1FA 3IHWA 1QVAA 4NPHA 5AK0A 2FPMA 2HF8A 4DLUA 1V5WA 1TF5A 1T91A 5G3YA 2F43A 4BEBA 1DAHA 2IEYA 4C0JA 2HLDD 2XX3A 1KY3A 4FCWA 2XNDD 3L8YA 1YZQA 4JJZA 4LRWA 4URZR 4CVNA 1F60A 5HCIA 3IQWA 4U7DA 5E95A 1T4GA 2GF0A 4YONB 2P6RA 3MAAC 3ZIAA 3GJ4A 4E07A 3C7KA 3IO5A 4PO1A 5EUQB 1CJUC 1HTWA 3ASZA 4G0NA 2BCJQ 1NLYA 3WNBA 3TGPA 2AXPA 1N2CE 1Z6GA 1P2VA 3IPXA 3UATA 2P6UA 4PX9A 4I1SA 4HI0E 2FFHA 2QZ4A 4HAUA 2P5SA 5FOWA 4PHHA 4UNRA 3CB4A 2JASA 3AF0A 1P9WA 5SZIA 1IXSB 2OLJA 1WMSA 4GP6A 4M4SA 1XMSA 4Q48A 5EXPA 1M2OB 2C95A 4UXIA 1ZCAA 5L8VA 1WB9A 4PAMA 1KO7A 4A0RA 1FQJA 2J0VA 3ETLA 2DWOA 4AWXA 1RYHA 4O2RA 1BMFA 2V55B 3NBYC 2RAPA 3FHTA 1Q0UA 3QKTA 3WMEA 3U6BA 3VR1A 2ZRFA 2CEAA 2ZSDA 4GRAA 1R5OA 2BMFA 1H8EA 2A9KA 4QGAA 1IJEA 1IAQA 3EZ2A 3QQ5A 4IW3B 2WWWA 1XF9A 5JI3E 2GCPA 1G1MA 5G40A 3OIYA 1VG9B 2ZETA 2CL0X 2ZPTX 2IF0A 1HYQA 5LBIA 1M74A 4LHYA 1EFHA 4IDPA 5CDFE 1OKKA 1E9CA 1KMHB 4P4UA 4HUTA 1CEEA 2IYYA 5HKKA 3EASA 5DN6A 3N5CA 5E4FA 1G3MA 1XPRA 1XXHA 3PCRB 4AK9A 4DUGD 4OQXA 4HAVA 4A8JB 3TK1A 1PZNA 2GJ9A 3QOFA 4QFMA 2B7CA 2IXEA 4PSKA 3W3AA 4KFRA 1DADA 4EPWA 4JYBA 1TQ6A 3CH5A 4RD3A 2VEDA 1E1QD 2R6CA 3DKPA 4YXWA 2ZIAA 4DLYA 3MWJA 4FWIB 4KO8A 1D9XA 2FEOA 4QM7A 1G8YA 3FMIA 3QY0A 4LPKA 5DIFA 2FZLA 3L82B 3FKQA 2VHUA 5K8UA 1KOFA 5ELXA 4CYMA 2NO0A 1J2JA 3TAUA 4DDTA 4PQRA 4DDVA 4V03A 4QGFA 1R8SA 5IDVA 4QGGA 3PUZA 1E2MA 4Q7LA 5HCNA 1VYUA 1Q22A 1ELOA 2D3WA 2IYTA 3QKRB 1XTKA 2H57A 3Q7QA 1A2KC 1E0SA 4HB4A 4TMTA 1NVXQ 3RYTC 2CJWB 4BQSA 1OB2A 2XZLA 1Q3TA 3L0PA 5FBRB 4AIIA 1QF9A 1P75A 2BHRA 1C1YA 2V3CC 3V4FA 1SVOA 2G83A 4KYIB 1MO4A 4UNNA 2Q9BA 5EE5B 3OESA 4MGYR 4V0KA 2OM2A 2JJ1A 5G41A 1DS6A 1ZW6A 1W49A 4OI1A 4DXAA 2J3EA 4NDZA 5K8IA 2FA9A 1XEWY 5FR1A 4DT1B 1W0KD 1X3SA 3IIJA 1WE2A 1JI0A 3Q3JB 1KSGA 4OK6A 1JR6A 3F3YA 1CR0A 3NHAA 2MSEB 3SR0A 2JLWA 1FX0B 1NN1A 2C04A 5FOXA 1TADA 2JIZD 1JPNA 3RDPA 1Z47A 5JI2E 4Q18A 3FHCB 1GP2A 2HDNB 4Q7MB 3T34A 1TF7A 1GAJA 4CEJB 3ICQB 1TEVA 2VF7A 1FNNA 2IYWA 1ZJ6A 4MYHA 4TLEA 3W6NA 2ANCA 1EFTA 1R7RA 3I5XA 2WSSA 3QVUA 3VX3A 2WJVA 1GOTA 2O52A 4L9WA 1G7RA 4EIWA 4AI6A 2R62A 4Y0VA 2WOJA 3QBTA 3RAPR 1GITA 1Z06A 1KI6A 2BOVA 1W44A 1HURA 2DYKA 4LJ6A 3OZXA 3MUFA 4O0MA 2G9NA 3W90A 2BEJA 5BN5A 5FPTA 3PENA 2GEDA 2QM7A 2ONJA 3EZ7A 3O8RA 1K5GA 3OIWA 1XCGB 1YZKA 4B2IA 4OQNA 4A0HA 4P4TA 4JS0A 1CTQA 2LKCA 3L0OA 2B21A 5GJVC 1LW7A 3N2EA 1J70A 3FVQA 1YR6A 2ZRHA 4DZZA 2XSZD 3X1WA 4KBFA 2QAGB 2AL7A 4DHEA 1FOEB 2IT1A 5GVSA 2FWRA 2WJIA 2GK6A 1UAAA 3TRFA 4XWKA 4BRUA 5KUTA 4GP7A 2RHMA 2GAAA 4PO8A 3BERA 1YRAA 1U8ZA 1XFAA 3QXHA 4A9AA 4DLSA 3OEHD 4Z1MD 2ZEJA 3K0AA 1ZNYA 5A0FA 3X1ZA 5KSPA 2VLIA 3U3MA 2OV2A 3KXIA 4HZUA 2JLVA 4GL2A 4P31A 1ZNXA 1M7GA 3F5FA 1W0JD 3WYFA 3MG9A 4PR0A 5AJWA 2VHTA 3EZ9A 3LA6A 2C8VA 3HDTA 4GOJA 4KFSA 4Q1EA 4D0LB 4FI3C 2E1RA 3WY9A 4HAZA 4R98A 3NG1A 2O5VA 3PEUA 3SBDA 1CJTC 3T5DA 5BXQC 3R9XA 3I4LA 5DI3A 3AVXA 2J45A 2YJTD 5J4YA 4ABYA 2IS2A 5KYKA 1R0XA 3K09C 1ZM4A 2I1QA 5CIQA 1OB5A 3AVOA 4D0NA 4ZKDA 1ZINA 2HYIC 2OLKA 1JB1A 3UPUA 2RCNA 3C15C 3QE0A 1HT1E 2ZJ5A 3W8RA 4ITRC 2WAXA 2VH5R 3B13B 4FCVA 3RLFA 3M1IA 1NSTA 5FTKA 1KAOA 1YRBA 2D06A 2KJQA 1D9ZA 2QPTA 1RPZA 2V4ZA 1KYIA 4YMSA 2IYLD 3K0FA 1KO4A 4UQOA 1F48A 3RSOA 3NEJA 1BH2A 2IUSA 4IHQA 1AGRA 2ZR7A 4DCSA 2NMVA 5DYGA 3PXGA 5FFMA 3OIVA 5KNCA 1NN5A 2GRJA 2ZAOA 4D80A 4IJMA 3AP2A 1ZM2A 2EYQA 1Z22A 3AQ4A 3CBQA 5G53C 2IEZA 3AVPA 2VA8A 4LBVA 3LWNA 2WWXA 3BFVA 5FI0B 1ZU5A 3DKVA 4D4MA 3HJNA 1UF9A 4H9GA 4K46A 4C3ZA 2Z4SA 5JRJA 1UBEA 4JSYA 4Q1AA 4RJLA 4YMWA 1AQUA 1CULC 4DKXA 3EA5A 4JKIA 4M0LA 4MUAA 3TNFA 3AV0B 1NBME 1IQPA 2FSHA 1KSJA 3CM0A 4KXFB 4HB3A 3ZS8A 1KI7A 3EPLA 1YZLA 2BBOA 2JGNA 3WRYC 3EIHA 4M21A 3OE7D 2FPLA 2AKAB 4JL5A 2KBFA 5TXGA 1NJGA 3CWZA 2PT7A 1FFHA 2DBYA 2ZJOA 1Z28A 2GHIA 3A1TA 2FH5B 4EFNA 1HEIA 1NBMD 1P6XA 4LJ5A 4LV5B 4MDFA 5H8WA 5CB6A 1OIWA 2J0QA 4ESHA 2J9RA 1Z2CA 1AKEA 2IYUA 3OIUA 3ICEA 4PPNA 1W5SA 4M1MA 3TE6A 1N6IA 1EFCA 4C7OA 3VR4A 5C4MA 3U4QB 3QEJA 2D2EA 3D6TB 2PMDA 2ZJ2A 4POAA 1FPMA 2F1IA 5DI9A 2OT3B 4ARZB 2ZI9A 3DEFA 4NHOA 2H8KA 5GVRA 4PZYA 3R20A 5TY0A 4UKDA 2VSOA 1W36B 2MSDB 1EFRA 2YWFA 4MQBA 1IXRC 4BFVA 421PA 2C78A 1NSFA 3L8ZA 1OH6A 1KKLA 1E0AA 4KFTA 1G16A 2H16A 3KQLA 3KL4A 3EG5A 1IY0A 1QHHB 3TQFA 1Q1ZA 1L8QA 4Q7JB 5FUXA 4DCNA 1GKYA 4HB0A 1MO6A 4DC9A 4G5GA 4PHTA 2BDTA 2GJKA 2YYZA 4XJXA 3AP3A 2CXXA 3B8HA 4A15A 1XB2A 3VU9B 4B3BA 1E0KA 1WDTA 2Q21A 4AURA 1E2DA 3HPRA 4NYMR 4TYPA 1CR2A 3C41J 1QDEA 4WOPA 3K0SA 3CPHA 3K70B 5C4GB 2F3TA 2EFCB 2IYQA 3KXLA 2KI5A 3B7GA 1JAIA 4TMKA 3QENA 1WBDA 4QRHA 1G20E 1HT2E 1QHGA 1XMJA 5EXXA 4RD4A 5JMTA 1QRAA 2NO7A 2GJAA 3CPJB 1VCIA 3QG5A 4CEIA 1F2TA 1R4AA 3VHXA 4US2R 1RZ3A 1N3BA 5J4KA 4LBYA 5P21A 4B75A 2HLDA 4KVGA 3LX5A 4ZPXA 2AD5A 1CRPA 1G3UA 4NCIA 1G18A 3WRXC 5KPJA 3B1ZA 4DIDA 2HT1A 1SVIA 2AXNA 1OHHA 2GTPA 3MMPA 4FMDB 2EQBA 2GVDC 3P4YA 4C0KA 4RZ2A 2PEZA 1XJQA 5L3VA 3AKYA 3P1JA 3SYLA 1RIFA 2CVHA 5IF9A 1YHNA 2R8RA 1MT0A 1ZAKA 2J0UA 3WXMA 2WIAA 2ZS9A 4B73A 2FF7A 2CDNA 2DB3A 3ADBA 1KI8A 3RRYA 4TL6A 1KMQA 3B2EA 2XTMA 1T3HA 1TMKA 2IHYA 1IM2A 3W6PA 4D6PA 4FMCB 3VR3A 1KO5A 1Z0KA 1W36D 3GLIE 4LV6A 4F7WA 4M53A 1AQYA 3NBFA 3THWA 1X1RA 1NNEA 1FZQA 1G3RA 4LYJA 1S3SA 4Q19A 4XD7D 4TYQA 3PUVA 4ZO4A 1CLUA 3JVVA 5F2EA 1E3MA 1IN7A 2BM0A 2B8TA 3PV0A 1R8QA 2IF2A 4GOXA 4PHGA 4RVCA 4AY2A 2IS6A 1JXOA 4NZYA 2WV9A 1YR8A 2EFGA 3BWDD 4MH0R 1N6KA 2GA8A 3Q9LA 1WGWA 1G21E 1FNMA 3AH8A 1GUAA 3D7MA 3KKNA 4ZV4A 2ZI7A 5KDLA 3GQBA 4A8JC 1KNQA 1XX6A 2L0XA 1MOZA 4B35A 1S8FA 2RGDA 4CEHB 3MSXA 5AUQA 3CF6R 5CLQA 3AVWA 1DG1G 4LHVA 4EPYA 4A2PA 2A5JA 5AJZA 3I61A 2VPPA 4OI0A 3AB3A 4RFVA 4F91B 1JXMA 1LF5A 1KZGB 3MCAA 3BB4A 4TMWA 2QTHA 3RRZA 3BE4A 2FV8A 3KTAA 4DUGA 1Z6XA 4WW0A 3VQTA 4AYXA 2QSZA 1KK3A 1G17A 4JLJA 5FPKA 1S96A 2HXYA 3C8UA 2ECKA 5CDFA 2V6IA 2QGNA 2ZSAA 3QI2A 1G19A 3BJIC 1BS1A 1SHZA 2GVZC 4OBEA 1AK2A 4BZQA 4M1SA 1LTQA 1E98A 4LUCA 3I72A 4IEIA 2QBYB 3QKUA 2BVNA 1KO1A 1KNXA 2A30A 5C18A 2ZE8A 1L4UA 1UKYA 1OFIA 3GJ7A 3LW7A 4PPQA 1EESA 2ORWA 1W1WA 4P33A 2KE5A 4G3XA 5G3ZA 2ZRBA 1IXZA 1IONA 2VL7A 4TSFD 3K9HA 3AKDA 3HR7A 4LZZA 1BYIA 1I4LD 1N5JA 3T61A 2ZJYA 3EX7C 3UMRA 2X8AA 3B9PA 3QUSA 2P65A 2GZAA 4LGMA 2AN9A 2PCJA 1OT3A 2XAUA 4GT1A 1E2EA 1E9BA 1LY1A 3K8YA 4EFMA 1G7CA 4ZKEA 2IS4A 3IBYA 221PA 4PC2A 1PLLA 2RMKA 1AS0A 4LJ8A 4HYYA 4D4JA 2ZYTX 2SHKA 1Z3IX 3A4MA 4YMUA 5BN4A 3EC1A 4EDHA 1T3LA 1H65A 3CRQA 1SKYE 1L7VC 1OF1A 4IXNA 4C4PA 2NPIA 1KI2A 1XPUA 1E2GA 1NF3A 2RGGA 3QF4B 2HF9A 4XVRA 3C5CA 4MUBA 2ZE7A 2ZROA 4FCTA 2DWQA 4LHXA 4UNSA 3OAAA 1YZUA 3K9GA 1US8A 2JIZA 4UNQA 2WSMA 1Q20A 3A58B 3K9LA 2X1VA 1U94A 4KYUA 4IDQA 1IN4A 1XMIA 4B47A 4EUNA 2AX4A 2W6ID 3GLFA 5AJYA 1DG3A 1BO6A 1E4YA 3GP8A 3CH4B 3LXRA 4MRNA 4Q21A 3B85A 1COWD 1T9HA 3Q5DA 3QBVA 2OFWA 4HZIA 4D4LA 2QAGC 4A82A 3GEEA 1A2BA 1Z8FA 4LCBA 4DWJA 1FUUA 2GKSA 3FOZA 3IEUA 3MLEA 5BWMA 2F9LA 2QE7A 3ZVLA 4LX0A 1D8TA 3TUZC 2JLRA 4GI7A 4M9ZA 4ERNA 4CT5A 3UMSA 4TMXA 5IRCD 1XRJA 1FTNA 2KSQA 1U9IA 3CRMA 2V6JA 1Q1BA 3A1WA 2W2TA 1ZMXA 2XSZA 5BYKA 1R5NA 3THXB 5KTYA 4UJ3A 2GBLC 5KHOC 2J41A 2F1RA 1M6NA 1Z6YA 4KI0A 1QHYA 3TUIC 4XVUA 3U7HB 4NMMA 1U8AA 4O2LA 1G5RA 3CZPA 4DSTA 2N42A 3BXZA 4JYCA 2BIFA 1YJ5A 4HAXA 4BUJA 2OFXA 5JWOA 3LLMA 1JEEA 2ZRIA 3B1VA 1KI4A 3OFND 3V00A 4DLRA 3VNUA 2PLRA 4JVMA 4MYCA 4TL8A 3I32A 3H86A 3PIRA 3LVQE 2OEPA 2ZRGA 1W4CA 3P27A 1LS1A 1UEIA 3BOSA 4I4LA 2F6RA 2GNOA 5DHFA 4TTPA 4AYTA 3EC2A 5SZKB 4A4DA 2ZVQX 4MGZR 2I3BA 5B2ZA 1HH4A 4KITB 2GEVA 4EPTA 3HR8A 2TMKA 3DPUA 1GFIA 1NLZA 3A36A 3ZLJA 2DPXA 1V43A 4A1FA 4AKGA 1OJLA 4L15A 3KQKA 2C9CA 3N70A 4G01B 1ODFA 3FPAA 3R7WB 5BN3A 1TEXA 2WPDA 5AJXA 4S35A 3LDAA 3SQXA 2IUTA 3MFYA 2XOKA 4DLWA 3BRWD 2V54A 3KTAB 1AIPA 1FQKA 1GILA 1NIPA 4JLMA 2HJGA 4F4JA 2YWGA 2F9MA 4PQFA 3ZVMA 4EJSC 4KFUA 1HV8A 1AJEA 1QHNA 1IJFA 1UBFA 5JJLA 2ZYUX 3P20A 5J5CA 4DB2A 1EX7A 1G7TA 2GF9A 1K8RA 4DBLC 2GESA 3V4RA 4JT2A 2XB2A 2ZRDA 4BZXA 1JEDA 1XU4A 4GZLA 1G5TA 4P3YA 1CU1A 2JLQA 2AWOA 2WWIA 3QNUA 1OIXA 1Z6AA 2B92A 3OE7A 1I2DA 2X2EA 3EPHA 5BQ5A 1Y3AA 2F1HA 1II8A 3NH9A 5CJ2A 1B0UA 1OXXK 3TQCA 2PZGA 3QPWA 2FNAA 3AKEA 2FSGA 5AUPB 5K8LA 3ND9A 1W36C 3IGFA 3GEIA 2CCGA 3I8XA 4K81B 5HZHA 2P0EA 2GCOA 1R2QA 5J4LA 4NH0A 2JJ2A 4B71A 1MABB 3REFA 3KJGA 4IOMA 4QHTA 2OCPA 2WOOA 1JALA 3FMOB 1NL3A 4M1WA 4NYMQ 4OJQA 2IYRA 5DH9A 1W5TA 1NKTA 1P62B 1KI3A 2VRWA 4ZIRB 1OXVA 5CK5A 4DSUA 4DLZA 2OAQ1 2XXAA 3CX6A 4GBMA 5FL3A 5D3MB 3ZVNA 2OFOA 1IBRA 2ODWA 1SKQA 4HAYA 1NVVR 3QXSA 4B3GA 3CIOA 4EAQA 1G5PA 4OYHA 2AK2A 5AJVB 4A6PA 5E7MA 4A0FA 1KIMA 4BPBA 2VSFA 3SC3A 3WBJA 3GLFB 3K70C 2RGXA 1KY2A 4U5XA 4Q9IA 5CJPA 3ZZ0A 5JHHB 4KLNA 4KBGA 1XTSA 2B8WA 2NO6A 2AR7A 4C2TA 3A4LA 4I99A 2UKDA 2BKEA 5EXTA 5DNYB 1VG1A 4C2UA 2ZE5A 1CIPA 2Q6TA 4UXJA 1VG0B 5FBWB 1JPJA 4Q9JA 2QGZA 2VP9A 3U6KA 4RD6A 5LD2B 4XWAA 2WTUA 1P9NA 1YQTA 1A7JA 1EWRA 3R8CA 1P60A 1N6OA 2FN4A 4V0ME 2G1KA 3TH5A 1HA3A 4R9UC 4YMTA 1SZPA 4KVAA 4IRUB 1J7KA 1KI9A 2CLSA 1DARA 3NHBA 5FOSA 4B32A 1KDTA 4Y0AA 2CL7X 5AR1A 4L9SA 4TQAA 4FINA 4TLBA 3K9NA 4N1AA 1Z0DA 4JBWA 4AG5A 4FD2A 1OFTA 2IXGA 2HUPA 3C5HA 2O8CA 3NC1C 1F3OA 3IIMA 4X8OA 2NIPA 2JEOA 3I73A 1JR3A 3VMFA 3H0KA 3Q5EA 3ZGXA 5JCZA 3CRVA 3KQUA 1M7HA 1Z0JA 2CK3A 2QP9X 4RCYA 5L3SB 3KB1A 2HT6A 2QMHA 2VHCA 2ORIA 4ASUD 2O8EB 3G5UA 3T35A 4GZMA 1ZD1A 2VSXA 2Z43A 3LBIA 4E5UA 3TSZA 2ZU0C 4XSHA 4JBXA 2Z4RA 4TT3A 3G0HA 2CHVA 3SFZA 1SXJB 1ZC4A 4RCZA 3FKSA 2C03A 2W2XA 5EP4A 1UBCA 1GZSA 1SVMA 3ASYA 3NXSA 2REBA 2ERYA 1G6OA 2WKPA 2PLFA 2J7KA 1S3GA 2KBEA 3GLHA 3SBEA 2W2VA 3AF3A 1NRJB 4LYHA 1UPTA 2J7PA 2VP0A 2ZVPX 3QIAA 1X1SA 2AKYA 1CJKC 1UKVY 2FMXA 2FU5C 4GNKA 2YC4C 3OF5A 4R2HA 3T1QA 3TBKA 2YWEA 2A5GA 4KSCA 1XZPA 3LNCA 4E03A 2Y8EA 3NDPA 1XBTA 4A36A 1NY5A 3LRPA 2F43B 2XJ9A 4JKYA 2YOHA 4MRSA 4B34A 1GL6A 3FHOA 4RD1A 1O3YA 1F2UA 1M34E 4PANA 2QNRA 1E9RA 2ZJ8A 1J99A 1CRQA 3A1SA 3FFBA 1RJ9A 3VHLB 4EPVA 5UKDA 1SVKA 2PX3A 5JJKA 1Z07A 3LVRE 2J1LA 4BLTA 2YHSA 1QBKC 4HDCA 3QJYA 4HLUA 5JCPA 1WQ1R 1YZNA 2YC2C 4I81A 3U60B 2WICA 3PEYA 4Q7KA 3QKSA 4JBYA 4RFSA 1GTVA 2FEMA 4OK5A 3NDBB 2OUKA 3EWAA 3OEED 3VKWA 2OBMA 3CUEF 1KHTA 1XTQA 4X8LA 2C99A 1JQJC 1W46A 4WXPA 4Q4AA 4C30A 1XEWX 2PBRA 3KXKA 3RS7A 3CKLA 2CCKA 4TQ9A 4BFTA 4PHFA 4BFWA 3SJCA 4G5OA 3PG5A 4M9QA 5HE9A 4HUQA 1FW6A 4QBHA 2IW3A 3QVVA 2NO1A 4Q4HA 1Z29A 3O47A 4TWZA 2A5DA 2Z83A 2ZS8A 3HP1A 1TX4B 3WP0A 2GCOB 4IFEA 2QPOA 4DDWA 1LVGA 2ASEA 1SVLA 1YKSA 4ZDIA 4F38A 1XDBA 4TMVA 3ECCA 4JVNA 1G291 3RS0A 2YZ2A 1DAIA 1VPLA 4V0LA 3SYNA 1E2KA 3TIFA 1H8HD 4HSEA 4PC1A 1UADA 3R9IA 3TKLA 3DL0A 3MJHA 2CMKA 4P4SA 2A3RA 1XXHB 1DAGA 4XTCS 5FL7A 2WIBA 3GLGA 1RYFA 3O8BA 2W00A 2ZRAA 4RKEA 5FBQB 4JLDA 4Q47A 3BBPA 4LJAA 3WNDA 4A2QA 5E3HA 4AKIA 4MKFA 1YR9A 4MKIA 5FTMA 2VF8A 4NCHA 2ZRCA 3K0CA 4X8HA 3DDCA 1OYWA 1RRGA 1G4UR 1AZSC 3KJHA 1S9DA 2WJJA 1E6CA 3CW2A 3BGWA 5KU1A 5FBLB 4O25A 1A1VA 1PUJA 3F0TA 4OI2A 2QI9C 2ZSFA 4M1KA 4TMZA 4URYR 721PA 3ZIAD 3U5ZB 4Q1FA 3SFVA 2ZRJA 4M1YA 2QN6A 4YQFA 1K5DA 2F3RA 4I1VA 4Q00A 1UDXA 2H1LA 4WBSA 1L4YA 2J59A 3CWQA 4B3CA 1OSNA 621PA 3AVYA 5ANRB 2BCGY 3T5GA 5FUVA 5TARA 4Q9HA 2W6IA 1GIAA 4WIAA 4DJTA 2EFEB 2CNWD 1CJMA 3L43A 4A6XA 1BYUA 2FFAA 2IBMA 2WJHA 4B3DA 1DPFA 1R0ZA 1KZ7B 4W7SA 4CGZA 1JAHA 3IHLA 1N5LA 4FMDF 5EP2A 4D4KA 5JFGA 1GKUB 3WHLA 5FTJA 1KSHA 3QF7A 1KK2A 5FTNA 3ZS9A 4F93B 2O0KA 1W2GA 3K0EA 4OL0A 5DGXA 4AKHA 1KDRA 1TUIA 2XITA 4IVPA 3DHWC 1E4VA 1E79D 5EZ6B 1H8ED 3QPUA 2JAQA 4C0BA 4B6FA 1P2SA 1OYYA 3K1JA 3LY5A 4FMCF 1U0LA 3HYRA 3B1WA 4QJ4A 2A78A 5AUOB 1W2HA 3ZYCA 3BD9A 1X8LA 3SE0A 1XD2A 1VG8A 2FE4A 1Z63A 1NP6A 4PZLA 5D3QA 1KKMA 3NH6A 4ESVA 2J46A 3GLHB 4YMVA 1GWNA 5FPSA 1N6PA 3PFIA 5HKKD 1T6NA 3H2YA 3N2IA 1T3SA 5H68A 2GXSA 1LNZA 4NP6A 5DN6D 2ORVA 4NYJR 5AUNB 1KSFX 4QJ5A 4FN5A 5JWHA 3GJ0A 2QRNA 3UMFA 1PVOA 1KI6B 4LYAA 1G8FA 1E2FA 2GAOA 4GFDA 3ZZUA 5EJEA 1IY2A 2G0TA 4PO9A 1F2UB 3UXMA 3CR8A 3MRSA 3TR0A 4R71A 4YXWD 4GDFA 2OCBA 3WP1B 1XZQA 3C14C 2R44A 3CPEA 1X6VA 3RWOA 1D2MA 3M0EA 1RE0A 3RABA 2OO7A 1BOFA 5L3QA 4XVQA 2P5TB 1E0JA 1VDZA 2IK8A 2RH5A 4V0NA 3RWMB 1MRNA 1XNJA 3NC0C 4HDOB 2DR3A 2XNDA 3THYA 5FPYA 3A1VA 3V9PA 1R6BX 1AGPA 3X1XA 1QHIA 2ZUBA 2A2ZA 2BBTA 2G6BA 5DO9A 1Q44A 2GXUA 2WVJA 4TTRA 4JIMA 5CM9C 4E09A 2P3SA 4Z54A 2O0HA 3K0AB 2G1JA 1QVRA 4B6EA 3BFXA 4PC3A 1AKYA 5JS8A 1OPXA 4HZUB 5HE8A 2AWNA 2WWYA 2N46A 4NYIR 3A6PC 3DM5A 4IXMA 5CITA 2QTVB 2H18A 2PZEA 3TR5A 2G77B 3TW4A 2PL3A 4C0HA 2AK3A 1NIJA 1VYTA 3M6AA 5DI3B 4D26A 1S9HA 2JJ1D 2VP4A 5JHGB 2XNSA 4GMXA 1VCOA 4Q9KA 3KFVA 1XJ0A 4KV9A 3NKVA 1GL7A 3CRRA 1DEKA 2PEYA 4PQYA 5FUYA 3X1DA 2BKUA 4D81A 3AGPA 1Q57A 2PZFA 3U3JA 4EFLA 1ZP6A 3GCGA 4IOLA 1XD8A 4NCKA 5C2JB 1TU4A 3UWKA 2IYVA 1NVVQ 3A4NA 1AS3A 1E2LA 4PC7A 3K0FB 4XIGS 1VMAA 1ZD8A 4BFSA 4TYYA 4Q02A 4KU4A 1XP8A 3AP1A 4MITA 3GLGB 1M1YE 2XTZA 4OJKA 4QGHA 2QMUA 1D2EA 4C9BA 2IC5A 4D25A 3S1AA 3CNNA 4D82A 4Q4JA 1E9FA 5DSZA 1VYVA 4B2PA 4LC0A 5HZKA 5FUWA 1S2MA 4TQUS 2F55A 1Z2AA 3Q85A 4QXAA 1N5KA 2DFNA 4WXRA 3REGA 2IUUA 4BWYA 4OI4A 3DMDA 3RSLA 4LJ9A 3T15A 3UIEA 1N6LA 3K70D 3LBNA 3HPQA 2VP6A 3FDIA 4KCGA 3FMPB 5TDHA 4ZDJA 2W6JD 3EA0A 3PVSA 3VKGA 4QBGB 1UM8A 1A82A 3KB2A 4QG7A 1P7CA 3HWSA 2FGJA 3FWYA 1DELA 4NE2A 3QSYA 1RFLA 1W4AA 4AYWA 4BRWA 1CR1A 2BEKA 5LD2C 5IHPA 1E1QA 2J87A 2V7QD 1E9DA 4GMDA 2AFHE 3T1OA 3TSWA 2FJUA 1LS6A 2QRZA 1JECA 1YVDA 2WJYA 1NMXA 4DEXA 3AUXA 3H4MA 4LJ7A 2GJSA 1L2TA 4B3XA 5B58C 2PJZA 3U7FB 2DWPA 1XJCA 3KKMA 5J4VA 2QU8A 1P61B 2VQSA 1PUIA 2XZPA 3C4JA 4IDHA 4QOSA 3NEYA 1KJWA 4C7OB 5F98A 1G8GA 4JVSB 2QROA 4IOKA 4TN1A 2RB4A 3HYTA 2CE7A 3MD0A 4ZCMA 2ZR0A 3X2SA 5JBQA 2V9PA 4LC1A 4QHSA 3CO5A 4G1UC 1GM5A 3FYHA 1U90A 2GJ8A 2PMKA 3VFDA 4DSOA 1QG2A 4URVR 1E2PA 1SXJC 4TZ0A 1XD2B 4BFXA 4ZI3A 5CYOA 2DFTA 4V0MA 4PSAA 4YC7A 3UANA 1RRFA 4DCUA 2OG2A 4W5WA 4IVQA 4Z8XA 2PJRA 2Q9AA 4NU0A 3TUJC 2ZM5A 2XB4A 1GL9B 1CKEA 2R6AA 1W0KA 3SNHA 3H84A 3BORA 2DFKB 2ZANA 4WZAE 2IYZA 1RC8A 1VKJA 4IEEA 1EG7A 2EW1A 2R65A 2CLDX 4JSTA 4RD2A 4WA7A 3CX8A 3P26A 4MGIR 2MSCB 3DMNA 1N0UA 4LSGA 2BM1A 1ZNZA 3AVVA 2UVQA 3RRMA 2IA5A 1WBBA 3I62A 3ZZTA 1KMHA 1GVNB 1K6MA 1X8JA 5IK2D 2BBWA 1ZBDA 2UZIR 2J5XA 1Z0AA 1QG4A 1RW4A 2GZDA 4A8JA 2OE2A 4LBWA 4LOAA 5EP1A 3RS4A 4CEIB 1E2JA 2OHFA 1F2TB 1S1CA 3THOA 1ZCBA 5DYIA 2JCSA 4UXHA 5JS7A 4BFZA 2ZSEA 2ZE6A 5JSZA 1G3QA 3ADKA 1SULA 3I5YA 2EVWX 3KZ1E 4CW7A 1G4AE 2GETA 2I1VB 5JJIA 4TL9A 4ZI2A 3U3RA 4HLDA 2JLXA 1OE0A 2YV5A 1PLKA 4DIEA 1P5ZB 3WYGA 3FMFA 3PUWA 3KQNA 2J0UB 1NI3A 2DHRA 1T0HB 3SHFA 1S0UA 3B5JA 1E2QA 1T5LA 4B2LA 2YINC 2QP3A 4TZ6A 4HLCA 4W9MC 1EXMA 3OEHA 1LFDB 3LW8A 3QKRA 4Z1MA 1HE8B 2X2FA 1E32A 2FG5A 4LHZA 5DISB 3TVDA 5KO2A 2R6DA 2WMOB 1EFRD 2CJWA 2I4IA 4LYFA 4OHXA 2IWRA 1RRPA 1W0JA 1ZU4A 1XCMA 2BC9A 3LLUA 3THWB 3IBGA 3BH0A 2YOFA 3CONA 3LX8A 2ZXUA 4JLAA 1P2TA 3AF2A 1KTVA 5GJCA 2F1JA 1WP9A 3IDQA 3VR5A 2ANBA 2GXAA 1MO5A 3EARA 4ACBA 1N6HA 3LFUA 5F9HA 1ETUA 2OZEA 4U00A 4DT1A 4RY2A 5FOVA 4A0GA 1KJYA 1AZTA 4C0QC 4JLVA 1U0HC 2R6FA 4R7ZA 3KKQA 3PITA 1FX0A 2FGKA 1J90A 5TMPA 2NTYC 2HEIA 4BASA 3U44A 1E96A 5FI1B 1CS4C 2IX3A 4MYUA 2EWVA 2ZITA 4BLOA 3QPVA 1E1RD 1RRCA 2GK7A 5FOTA 5KSYA 2HCBA 5EP3A 2ZYWX 5TB5A 4OHVA 1UKZA 3IILA 4UNPA 3AVQA 1W4RA 2WKRA 2BMEA 4QBFA 2RGNA 4NCJA 1DE0A 3KJEA 3E1SA 3PUXA 1E9SA 3W8NA 5FOUA 2NZJA 4WZ6A 1ANKA 1SVSA 1D6JA 1EWQA 5GJBA 1DBSA 2OESA 5L3RA 1MR3F 3T06B 2C9OA 2QL6A 4PSVA 4HB2A 3B1XA 5J40A 3KDSE 3PUYA 5DHAA 3SZRA 4TTQA 1A4RA 4EQ6A 2ZRNA 4LPSA 4S2EA 3BB3A 1UJ2A 3CLVA 5HTKA 1OHHD 1VTKA 3W3ZB 1EK0A 1Q1QA 4CZ2A 1GNRA 2QAGA 4JZKA 2ODEA 4QBIA 4GPTA 4P32A 2BV3A 4BLPA 4CRWB 4L5BA 5KOYA 3I92A 4K8OA 5JRZA 4A92A 1NBMA 2VTKA 2CNWA 1OIVA 3EIEA 1VHLA 1MKYA 3PR1A 3R9WA 1CBUA 3RNLA 3WHKA 4EPXA 5KDDA 1G41A 1NLFA 1NMZA 4H1VA 4JT4A 3QEOA 4NYJQ 3O8CA 1GNPA 1OH7A 4B74A 4KLZA 2X77A 4ZCLA 1UKEA 4IDNA 2GBLA 3W9YA 1FL9A 1GRNA 2Z5FA 2ZRKA 4DCVA 3AF1A 4Q01A 3ZDQA 1E79A 3D8BA 2GILA 2NPFA 1W4BA 1A5TA 3SJZA 1EFUA 5C46F 2ZAMA 2O8FA 3SYKA 1CJVC 2VO1A 1OXTA 1ZVQA 2IXFA 1US8B 4CDGA 2QTFA 2ATXA 1KAGA 1NG9A 4YDSA 5FBVB 3QG1A 4L4UA 2CCJA 2NGRA 1VHTA 3W34A 4BZPA 4LK2A 4KHZA 2F7SA 1N6NA 1TQDA 4L8GA 1OV4A 1ZC3A 3FB4A 4GSYA 4LJYA 5EE3A 3RS5A 3TJZA 1JQLB 2QORA 4WZBE 2ZRPA 3W6OA 1TQ2A 4JL6A 2JDID 4HLUC 4MRPA 3NIBA 1G9XA 2WBLC 4NYIQ 3U7GA 1HUQA 5M04A 4F4CA 1KK1A 2REOA 4KSBA 1NN3A 4JLOA 3ZH9B 5JSZB 3IQXA 1T8UA 1II9A 3LXXA 1G8PA 1ZRHA 2CL6X 3A1UA 5EQTA 1XCPA 4MDEA 4MKGA 3CNLA 4M8NE 4RZ3A 1GRRA 2NZ8A 4QKQA 2QT0A 2XGJA 4US1R 2O0JA 2JJ8A 4C0SA 4Q4LA 4DCTA 4OHZA 821PA 4L16A 4EKDA 2ZQ5A 4KJZA 1AN0A 4EJSA 2ZUDA 4I1OA 4PPFA 3W5IA 1NVUQ 2VIIA 4Z8YA 5KSOA 2ZI5A 2GCNA 2AFIE 1P4SA 3PEWA 1XD9A 4FMBB 4ON9A 4FWTA 1FMJA 2PH1A 1Q3HA 3ZD7A 3BAFA 3GFTA 1XTIA 1Q1EA 2FX3A 3AUYA 1MO3A 4FXPA 3VR2A 2HXSA 1TUEA 4HDQB 1Z83A 1TPZA 4UJ5A 2R9VA 4HAWA 1M8PA 1WF3A 1U81A 3DZ8A 1YZTA 4MRRA 1P3JA 2AHOA 3GJ8A 1ZIOA 3U4QA 2PX0A 1IN5A 1OFUX 3I8SA 3L0SA 1P9RA 4V02A 4Q03A 3ZQ6A 4DSNA 3PJRA 2ZREA 3ZJYA 3KX2A 4OQLA 3KKPA 4ARZA 3BB1A 2FSIA 1DO2A 3VAAA 1G64A 3GFOA 4V0OA 3GLFE 5J4HA 5B57C 4F4IA 1M7BA 4C0AC 4ACAA 3Q7PA 4BEJA 3RRNA 3ZD6A 1N0WA 4G5QA 4Q1DA 3EPJA 2ERXA 2R2AA 3LAWA 3LBHA 2QMEA 2ZYVX 3K0CC 1IOZA 2A5FA 3OAAD 4XD7A 3CNOA 3U44B 4Q1BA 1AS2A 2BWJA 3SOPA 1QHHA 2ZSBA 3I3SR 4IDOA 2NQ2C 5FH9A 2OILA 2W0SA 4D0GA 3Q8XB 5DLQC 3NBZC 2C9YA 4OKSA 3GLIA 2VP2A 4BFYA 2NO9A 4M9SA 3TMKA 3WNCA 2HV8A 5E7JA 2C98A 3TSOA 2FSFA 3WMFA 3SDZA 4BECA 4JLBA 3VU9A 2JLUA 3AF4A 3H1TA 1WXQA 1SGWA 1F6BA 3SU8A 3WYAA 2G3YA 1ZD9A 2QE7D 1XEXA 2C96A 3KFXA 1F5NA 2EFHB 4HATA 1KGDA 4ILEA 3VR6A 1UFQA 5FR2A 2W6JA 2H7VA 2P67A 4EQ6B 5A4JA 2IWHA 2H17A 1NN0A 3EWSA 4CIDA 3VNVA 2IS1A 3MJRA 1KDOA 1PV4A 1TQ4A 2IYXA 3G82C 3RC3A 1II8B 1N0VC 5CIWA 2BBSA 1SXJE 3WMGA 2V7QA 1SQ5A 3BS4A 3DOFA 4N0DA 1E2HA 3CF0A 2LKDA 4NL4H 3R8FA 2YKGA 2XJ4A 3EZFA 4TYNA 2ZU6A 2V1UA 4MKHA 1LV7A 4GOKA 4BFUA 1S4QA 3GJ5A 5EE9A 3SN6A 3TLXA 3EAQA 4RSGA 2G88A 2OBLA 4QJ3A 3J81k 2ZJBA 3KUCA 1SXJD 5DE3A 1Q12A 2ZJZA 521PA 3U3KA 4O3MA 2EYUA 2EWWA 2CHGA 3LH5A 3RANA 3KUDA 3JZMA 4TSFA 1U2RA 2QA5A 3LQRA 4TLAA 5SZJA 4KODA 1QZXA 2FDCA 2XXAB 2Q3MA 2QG6A 3SI7A 4J0QA 4B3FX 5JEDA 3CZQA 5AWFC 1XTJA 1NMYA 2O8FB 3CRW1 4DLVA 2REXB 2ZI3A 3RS2A 1FP7A 4NBSA 1IN6A 4RD0A 1JNYA 2BMDA 2O8BA 2FFBA 2WMNB 4TLDA 5JWRA 4R2IA 2OXCA 4PC6A 1GKIA 1JBKA 5EZ5A 2WZQA 1ZUHA 3AM1A 3UK6A 2WPDD 1OW3B 4WVFA 1TF2A 4DDUA 1VIYA 5KDOA 2XOKD 1Z6TA 5K8TA 4Z51A 5LPNA 1HE1C 3L2OB 1UEJA 3KJIA 1N25A 4PTLA 3B78A 1OFHA 1X8KA 1KK0A 3CX7A 3IKJA 4CEHA 2O8DA 2QM8A 2QT1A 5CM8B 2EFDB 5CB8A 5HPYB 5F3WB 1CF4A 1Z08A 4TL7A 2W58A 3MWKA 5JECA 1CR4A 4AD8A 5IK2A 4JLNA 1NG1A 4HEJA 1COWA 5B64A 2O8CB 4OQFA 2B6HA 4RKFA 4MA4A 3AVUA 1G6HA 3E5HA 4EJSB 5KNBA 4URWR 4F92B 4C0LA 1GG2A 3IIKA 1YU9A 1I2MA 3KKOA 3BK7A 1R10A 1R0YA 2Q3FA 1BMFD 3X1YA 4LDJA 5J47A 1U98A 3GMTA 4NTZA 1O87A 4KAXA 1ZNWA 3GJ3A 4FW9A 1AM4D 3RHFA 4JL8A 2GEUA 2CVFA 4MGKR 1D5CA 3MGCA 2B7BA 3BIFA 1ZIPA 1XXHE 2QBYA 3K53A 4Q9LA 3AEZA 4P0TA 2JJ2D 1KJZA 5LDDC 2VYFA 3SHWA 1IHUA 1YE8A 1T0JB 3GJXC 4AG6A 1BKDR 4XH9B 3BFKA 4PPGA 2K5UA 2V8OA 4TLCA 1OKKD 2BMJA 4QL3A 2Q3HA 3U7EB 2QP4A 1G3IA 3P32A 5B30A 2IHBA 3JVUA 5EE1A 3K09A 3GFPA 4JLPA 4DLTA 2KWIA 4QM6A 3ND8A 1Y63A 2GWHA 1XMVA 5FPHA 1MV5A 3DO6A 3OFNA 2GXQA 3SJBA 4PAOA 1VIAA 4M1OA 2V1XA 3AGQA 2ZRLA 1FUKA 2A5YB 2OBNA 2QUZA 1UBGA 2QENA 2YNMA 3VKHA 4FIDA 1WCV1 2QMOA 4XOIA 1RJ9B 1U8YA 2QEQA 4JVLA 3MWYW 4LI0A 5CLLA 4LBZA 3GLIB 1II0A 2GDJA 2DCUA 3VTKA 4AC9A 2ZTSA 1ESMA 3QF4A 1DAMA 3FE2A 2D2FA 3D3QA 1JR3E 3DOEA 1XTRA 3QKSB 4PZZA 4RFSB 5EE0A 1ZUIA 1LB1B 1OH5A 1R5BA 3HU1A 1KO8A 1XEXB 1IN8A 2P2LA 4AKEA 1XEFA 1E1RA 1KI1A 4U02A 2FPKA 2ZS7A 1FTSA 2R6GA 4Q4AB 4B33A 1ZUNB 4G5SA 4B48A 4DLXA 1TL7C 3NTUA 4URUR 1I4TD 1I4DD 3SJAA 3NBXX 1JR3D 1HY3A 2XEXA 3EW9A 2BJWA 2DY1A 5KPDA 4HUQB 1DAKA 3IEVA 3B6EA 1D2NA 3SQWA 1JJ7A 1U0JA 2CK3D 2MMCA 1Q21A 4Q4HB 3UWOA 4EPRA 1E69A 2RGBA 5BW8A 1BIFA 4DVGA 4QNMA 2X19A 4G5RA 1W47A 3IUYA 3B1YA 2JATA 3GJ6A 3GLHE 3B82A 4ZDWA 2ONKA 4LJ4A 4II7A 1MRSA 4ZCIA 1RVDA 5F9FA 1J8YF 4B43A 4TT3D 1RKBA 3JZAA 5EXSA 3THXA 1Z0FA 2ODNA 5CK4A 3E2IA 3FKSD 2VP5A 2Z0MA 2XTNA 4X8MA 4DRZA 4TYWA 3AVTA 2E87A 2GZHA 1C9KA 1E2NA 5H1YA 5KSZA 2N1BA 4P4SB 3T1VA 1JJVA 2J7PD 2CHQA 2QQ0A 2WSSD 3LD9A 4E22A 2YVUA 2OSBA 2ZI4A 4MRVA 1T5IA 4OHWA 1CP2A 3F8TA 2C2HA 4QC2A 4IVRA 1TU3A 3L0IB 1E94E 2WKQA 2O8BB 1ONBA 1YR7A 1E99A 2J0SA 2JLSA 2D74A 1NKSA 1P72A 1KDPA 5LB4A 2OCAA 4BGDA 3OHMA 2CBZA 4BLSA 3PQCA 2KB0A 2HYDA 3GEHA 1SVWA 2RKOA 1DAFA 3RVBA 3SEAA 4OHYA 2ODBA 5C1BA 2QAJA 4LV8B 2O8DB 1ZM7A 3U2QA 3KQHA 4OK3A 1NY6A 3LQQA 2A7QA 2FOLA 5A5GA 4JMPA 3R7WA 1VECA 1P73A 5TV2A 2JA1A 1SKYB 2BJVA 4QHYA 1U9IC 3FTQA 4QNRA 5TVKA 4IKEA 1S1MA 2EU8A 2ATVA 1DAEA 2FFQA 2VHJA 4DEYA 1Z5ZA 2JDIA 3CF2A 3WBKA 4XWOA 4BE7B 3D31A 1UDWA 3T1TA 3ZQJA 3CR7A 4RZUA 1DOAA 2CE2X 2Z6VA 4PXAA 3T12A 1NVWQ 2UZ3A 4A2WA 1OXUA 5KNDA 1LF0A 3FFAA 3UKDA 3IPYA 3EPKA 2YWHA 2WWFA 2H92A 4JJKA 4WAUA 4B76A 2DFLA 4US0R 121PA 1FP6A 2W83A 3MWLA 5E7IA 1DO0A 1U99A 1ZYUA
chains in the Genus database with same CATH superfamily
3L02A 4XDYA 2AIRA 1PLJA 3WL8A 2J85A 1JYFA 4GR5A 2AD1A 1UT6A 4Y1RA 1CG6A 1RQ7A 9ATCA 3RFUA 1Y7TA 1A72A 1IUOA 2IPXA 4EF6A 2RGEA 3FZEA 1K6XA 4EYGA 4YNBA 1KMIY 4FYPA 2OVBA 4YASA 4ADSG 5IULC 4R1MA 4MUYA 3D4BA 2FPIA 5L3QB 1XCOA 5HTOA 2FUKA 2RGNC 3GM3A 1FS5A 2HN9A 1QV6A 4DIFA 2ILVA 1L4KA 5CYPA 1TTTA 1XRMA 3BT7A 1E2IA 3OZWA 1PW7A 1ESNA 3VU1A 4GKBA 4D9CA 5K05A 1E92A 4ZVVA 3PEVA 5ALFA 2HK7A 3VO8A 5FTLA 5LBTA 3LHIA 1CZOA 2AC2A 4G0MA 4BEWA 1G0NA 4Y6SA 4WN9B 1DVRA 3TVTA 2P6PA 2NACA 3LHSA 4FBGA 4R6XA 3JQ7B 4U9UA 1JKIA 1NKVA 4CEJA 4CFSA 3BF7A 1L8XA 1KEVA 1QC5A 4P5DA 4IS3A 5C8XA 2ORED 2HF8A 1TJYA 2QNLA 2P77A 3N07A 3JU3A 1N0IA 2FFRA 5K2MA 1QTRA 1XKLA 4PO1A 1EFVB 4JJEA 1O94D 3UHAA 1FU4A 3U0CA 3JWJA 2YMQA 5FOWA 2JASA 4LWPA 4IDEA 3DAFA 1MJFA 2ADMA 2C82A 4F11A 3O1HB 1M6TA 3QVZA 1IWBB 4J0GA 4Y1RB 2FJ0A 5H80A 4L3WA 1HE9A 1GTZA 2BZ1A 1VG9B 2JVKA 2D5RB 1XTPA 2P9CA 5CT6A 4YJGA 4XYEA 4KWTA 1CEEA 1FDTA 4PYKA 1QLEC 1ZZEA 1VB5A 3K4PA 4AN4A 5BVGA 1O6BA 3RU2A 2IXEA 3P8ZA 4HD8A 3OSZA 3W3AA 4KFRA 1U4SA 2BN4A 5LJIA 2VEDA 3UOWA 4ITVA 3DLTA 3V8VA 1RPAA 3R74A 4A73A 1D9XA 5IN5A 1D0IA 1IK6A 1T15A 3MINA 1FJ2A 2CEKA 3LUFA 4OQYA 5ELMA 5F3DA 4YGYA 3IT1A 4O29A 2OVFA 5HRAA 1VRWA 4BQSA 2DZDA 3I0MA 4A6EA 4B31A 1OI2A 5B4TA 2JAWA 3TPZA 3IP3A 2VXBA 4H0FA 3TE7A 2JLWA 4UZSA 3AR6A 2C04A 5HOQA 1N34B 4WOJA 3R3VA 1Z47A 4CEJB 1X42A 3AUTA 3P2YA 1ZJ6A 4FGLA 4GLOA 3AR4A 5JY6A 3SXPA 4BNYA 2G9NA 3MUFA 3OA0A 4OD5A 4C7MA 1EGQA 2EJUA 1XCGB 4K28A 4MEAA 4RL6A 5C1OA 3W2HA 2OL4A 1YBFA 2FWRA 1P45A 3FUWA 4DDKA 3Q5GA 3H3XA 4QAQA 4PO8A 1JMYA 3X1ZA 5JCJA 3UKOA 3T3MB 1W0JD 2AI1A 2J5RA 2VJDA 4RJIA 2PD6A 3LPNA 1J42A 4GUAA 5BXQC 4IICA 3VC1A 2J45A 5J4YA 1R0XA 3AVOA 4ZXPA 4D0NA 5AHOA 2WAXA 3GV0A 1RPZA 4JROA 1D4FA 3G8BA 3FXAA 4YJGB 5IXSA 2QV7A 2GRJA 4D80A 1GG8A 3AQ4A 3DNMA 1GPBA 1C03A 2Q07A 3UCEA 4H9GA 5HK8A 2R6ZA 1UBEA 3H1AA 1RAAA 3AG5A 5L51A 4HK4A 2WJAA 1ZLYA 1FFEA 2BELA 5KBYA 1BJTA 3RG2A 1JJFA 2JGNA 4EGJA 2Y39A 4OGKA 2Y1LA 2D2VA 4MR9A 2R7RA 2KBFA 3HDYA 4V3BA 1R66A 2FH5B 2G25A 4EZBA 4I5FA 4F3TA 1X1AA 4X54A 1IOWA 1UANA 1DC3A 3HJGA 4HJXA 4L9RA 1O58A 1VHWA 4CLRB 3E2PA 2DC1A 4Y2SA 5DI9A 1T9GS 1E1YA 1A5BB 2A9FA 2IXBA 1NUHA 4O02B 1E0AA 2ID7A 1IEQA 1FVHA 2XD9A 1G2PA 4J0FA 2Y1OA 5L0FA 1W29A 1YB1A 1E2DA 5ENDA 1QDEA 1GUDA 3UTDA 4M89A 2IYQA 2I2AA 4TWAA 3A05A 3KHUA 2R3SA 3CS3A 2BEUA 3FLEA 1K4YA 1BS9A 1A5SB 4JR0A 3F9RA 4ZPXA 2YTZA 3D02A 1ZOPA 1I6WA 2FQXA 5DT9A 1UJCA 4TSKA 1NJ5A 5ECWA 4PZEA 1UBRS 3U4MA 5L3VA 3ADBA 1BTOA 4FMCB 2HRCA 2EXXA 3GLIE 4F7WA 3K1HA 5T3UA 3T3EA 4ES6A 2IS6A 3DZGA 4CLOA 1QX4A 5B37A 4KSYA 3MA0A 5KDLA 3GQBA 1HY5A 1B6SA 3V7WA 1QNLA 3DWGA 4Z4EA 1S8FA 3IKLA 1QRSA 5AUQA 3AQIA 3AVWA 1DG1G 5GZ1A 3RSGA 2VPPA 2A92A 2TMDA 2FV8A 5BSRA 3W8IA 1XA3A 3G8DA 4BRZA 1QSPA 2GN9A 4I6GA 3MJTA 3CG0A 3DLIA 3OVMA 3G59A 2I2WA 1T9GR 4UFOA 4LVNA 4P33A 2IPAB 3NHRA 1W4LA 2PBLA 2P9FA 2V7VA 1YGYA 4JOQA 1ORSC 3OQ6A 4UTPA 1OT3A 4ZKEA 3X1MA 3PZRA 4I1PA 3MILA 4JC8A 2HJWA 2WD8A 4UTNA 1K66A 1Y3HA 3CRQA 1KI2A 2HF9A 4A5OA 4P3PA 2X1VA 4UFPA 3CH4B 3N05A 5KJCA 2G9ZA 4MX8A 1A8PA 2H3HA 2E7ZA 5C81A 1GCIA 3TFQA 4ERNA 5IP5A 2J8ZA 5B3AA 2FZKA 3GUUA 1ZUWA 3G49A 1FTNA 3CRMA 3REOA 3G0IA 2XSZA 3THXB 5D3KA 1TC1A 1V2GA 1M6NA 2O20A 4NJEA 5DHQA 3UJHA 2FI1A 4BUJA 1YAJA 2R7WA 2JHCA 5J43A 3OFND 4G24A 3WBFA 4WOCA 2RKBA 4CLOB 4YUVA 1T8WA 4TTPA 4AYTA 1CEQA 4WFKA 2D00A 1B3BA 1V71A 3TNLA 3HR8A 4KN6A 4DABA 1JHMA 2GEFA 2C9CA 4DSAA 3BF8A 3FTEA 3SQXA 3K1AA 3WO0A 1P77A 3TD9A 4Z2YA 3ZW8A 3KOXA 2JFFA 3GRZA 4EL5A 1Y33E 2VF2A 3TDKA 4IAQA 1ZGHA 1K8RA 4JI8B 2ZRDA 3FOOA 4IIBA 5AKHA 4RH3A 1CU1A 3QNUA 4BB9A 5LP6F 2RCYA 2DQ4A 3L1JA 2ZSIA 1QBGA 3QPWA 1BFUA 1P4RA 5AUPB 3GEIA 4O5AA 4NEGA 2QTZA 5LZ5A 4HNSA 4B71A 1WKCA 1P9OA 3ZKWB 2PIDA 3HLKA 4WOKA 4Z9FA 4I8IA 4TKMA 4NYMQ 3NV9A 1TJ5A 4ZIRB 2ZCUA 1WW3A 2BEVA 5JZOA 2X0DA 5E7MA 4KR2A 3K70C 2DETA 4IPTA 4KBGA 1MHTA 1XTSA 4DTCA 2UZ1A 4MIEA 5TPWB 3MB8A 5ERXA 3CZ5A 3NP9A 4FHEA 3ER8A 2C2KA 1OGYA 3QEKA 2P5YA 1SZPA 1HI9A 2Y71A 5AR1A 4UPEA 5C34B 2HUPA 4BQPA 5BNZA 3VMFA 1JR3A 1VPEA 2CWWA 3KB1A 5IZ4A 5CHYA 4HXEB 5KWIA 1SCUA 4R83A 4JBXA 2OHIA 1DQYA 1XQWA 2CWDA 2PX2A 3EE6A 3GLHA 3LUJA 1P0QA 1KAHA 4XQ0A 3KSMA 1UKVY 3DAPA 2Y0DA 1WASA 4IJKA 2II6A 2XJ9A 3A1SA 3L7NA 5HIAA 1THGA 2XQVA 3NR2A 5I5EA 2YVAA 3VTFA 2WICA 4HDKB 2YR0A 4YLYA 1KJIA 1W76A 4TV8F 3AR8A 1YSCA 3DL2A 1ZUNA 1SXQA 4BAUA 2QRKA 2IW3A 1WXHA 2E18A 1SOAA 1SKMA 4IWXA 4YCBA 5GINE 3OWTA 1JTEA 1W8IA 3UMGA 4BV8A 2VAMA 1G291 2FRXA 1VPLA 1NBWB 4HSEA 4LVUA 4D97A 3UUEA 1H5NA 4B82A 2BEVB 3BBPA 3NOOA 2I0FA 4MKFA 3P97A 1AZSC 4MEBA 3DOCA 2UXBB 4MVCA 4N3CA 1S8OA 2ZSFA 1JB9A 3M6MD 2C1ZA 5E6SA 2NSGA 2GZRA 1FK8A 2F3RA 2XKKA 4UDVA 1Y6GA 4Q9HA 4HQRA 2J9ZB 3VBEA 4KR0A 4CGZA 1JAHA 2FK7A 3FH0A 4FOOA 3H97A 1Z4JA 2XCOA 1IJKA 1FDUA 5FTJA 1KK2A 2V7XA 3KOZA 4YCJA 3JQAA 4D42A 2YDXA 2R25B 1TGYA 1V9SA 2A78A 1LD3A 1W2HA 2VPWA 1VG8A 3QFTA 5D3QA 3GLHB 4WGZA 2E21A 4CX9A 3H2YA 1IC6A 4ENUA 2O4CA 5DS5A 1PK7A 1PL8A 3ISVA 2QL9A 1AX9A 5ALHA 8MHTA 1SAYA 1BOFA 2P5TB 3UCXA 1MZVA 2IK8A 3DXZA 3PFBA 4PG6A 2YYSA 4C3UA 3THYA 1Z18A 1R6BX 3K0AB 1AKYA 2XS8A 4I9GA 5CITA 3QTHA 1MB0A 1NIJA 5CPBA 4Q9KA 5GOZA 3X1DA 4QD3A 2BLNA 2R1VB 4YP6A 4CG1A 4QTZA 2IQIA 1EIZA 2OB2A 3C62A 2B4QA 1D2EA 4P9FA 2SICE 3UEOA 1YAHA 2AGVA 4OXYA 1SEPA 3K70D 4E2XA 2DLCX 4N6CA 4ICIA 4EG0A 3VC3A 2AV6A 4C3BA 3UAXA 4KE8A 4NE2A 1WP4A 1ZPDA 4JHLA 2ZCJA 1UKCA 4RDAA 1SCNE 4DEXA 4HNAB 3N59A 2PJZA 4AJOA 3DFFA 2EGGA 2NYAA 1Q14A 4JQZA 2VCAA 3FOPA 1DBPA 4CIVA 4GE0A 1R0CA 1LX7A 1VQ1A 1LVKA 4URVR 3PDHA 4PLHA 1ZY2A 3UTCA 1DAOA 4TM8A 3BORA 2AZTA 2DLNA 3OMLA 3AINA 2FSVA 5DCWA 2OWEA 4Z3OA 4LTNA 2OUIA 2OV6A 4Y9UA 1DIBA 3R5JA 2M6KA 3AY6A 1F2TB 4HGRA 4AF6A 1T26A 3UJBA 1TFKB 1JDSA 2I1VB 5JJIA 2JLXA 3WLNA 4P83A 3VH4A 1P5ZB 4UD2A 2Y3GA 1JS1X 3L5OA 1U9ZA 4LHZA 2A86A 3MSCA 4GI1A 4CUZA 3PDIB 1XCMA 4TKVB 2XLDA 4DG8A 4OM8A 2EJTA 1RE1A 1BDBA 1ZSNA 3RJZA 5CDUA 4RY2A 1F8FA 2DX7A 2F3QA 2SECE 1BCRB 3CRZA 1OLSB 2FGKA 1J90A 1GZUA 5FI1B 1PTJC 2XF2A 2ZYWX 1SUPA 2WT8A 3PUXA 2CXSA 2Y99A 5AOVA 2O5EA 1EWQA 3B20A 1U04A 4EA7A 4FYJA 5ITSA 4S2EA 1EK0A 2YY7A 4KTTE 4BLPA 1E3WA 5A6VA 1RIIA 4KC9A 4O6VA 2J5BA 3D43A 4BNNA 2PPLA 3VR3D 1OH7A 1REQA 2J0XA 4X60A 2B99A 5DCUA 4RVOA 4DDHA 3HBJA 5DM0A 2W2LA 5CCEA 2ZAMA 2V8BA 4BP9A 4ZV7A 2B4RO 4CDGA 4UHHA 2XZDA 3HKBB 3WLOA 2R97A 3F6SA 4DREA 4LK2A 1SYQA 3DAGA 4MAMA 3A6EA 3TK0A 2HPZA 1USWA 3I9OA 3F6PA 2NVUA 4JLOA 4YT2A 4NNJA 3HMKA 4DMUB 4QKQA 3ABLC 3TPCA 3OZCA 4OHZA 3OUZA 1YIOA 3W5IA 2ONCA 5E4YA 3R0QA 1EVZA 1PSZA 4HN2A 2FX5A 3FPGA 2HXSA 1TUEA 2R1ZA 2Z98A 2MYSA 2FMKA 3EDCA 3OTQA 4OQLA 1A27A 4OQPA 5JC8A 2FSIA 3RRNA 5LZ4A 2HRRA 2XLHA 2R2AA 3O90A 2ZYVX 1TD1A 3GGOA 2I03A 1QHHA 3GVCA 2W0SA 2R7NA 1Y1TA 3C1AA 2C98A 4KWEA 4JLBA 4NU5A 1AUEA 1WXQA 3QFHA 3TL3A 2C96A 3NZEA 2YL0A 4GR9A 4QT4A 2IWHA 1NN0A 1JU4A 4WE3A 5IEBA 1YOBA 2WQ6A 3QLEA 2F4VB 1VL2A 2Y27A 1Q6YA 5LLDA 2XTAA 3GUCA 3EZFA 3ZK9A 1EE2A 3U3DA 5KYWB 4H1WA 2EWWA 2WUVA 3DKKA 3MWEB 1TXGA 5DKFA 1K40A 4LK3A 1MAUA 3BAZA 1R8YA 3BRCA 4X90A 2I2XB 5IJ9A 1UBNA 3DWIA 5EZ5A 4O4HF 4C5AA 3MC1A 4ZFNA 3P96A 2CNNA 1O6CA 4B6OA 3B78A 4LRSB 2G8NA 2NVUB 4LQLA 3SMQA 2DVMA 3BIXA 3OLQA 1HETA 4CKBA 4V1CB 4F9GA 5CNIA 4YYZA 1NLUA 5ENVA 2JH9A 3E5HA 4LZAA 5CUQA 3HACA 4C0LA 1R10A 4CIYA 4G7HF 2P78A 5J47A 5BMVA 3V4OA 1DZ3A 1RWBA 2IYAA 3RREA 2PAFA 2GEUA 1Z5OA 3IOYA 3RIMA 1ULSA 2O8NA 1OYVA 5DBOA 3U7EB 2ATIA 1UQRA 2YBEA 5JMPA 2IKQA 1VKNA 2P0AA 2AP3A 1JVSA 3GQVA 4EUKA 1ISSA 1M1NB 2YNMA 1XI2A 8GPBA 3JARB 5I7VA 4JFAA 4FBMA 4YBZA 1DAMA 2HV6A 3AKZA 2D2FA 2AG5A 2YJNA 4R5MA 2B8JA 3EDYA 4G5SA 5F7ZA 1XTBA 3Q2IA 4Q3DA 2PSJA 3US6A 1J0EA 5JQGA 2X19A 2K87A 3I37X 2YZKA 2XVYA 1ZR2A 3T3OA 1NAIA 4CL2A 2E87A 5KSZA 3EIWA 2W2KA 2J7PD 1CF2O 4OHWA 4U7TB 3U16A 4BLUA 3RVQA 1PHRA 4RHFA 4DBVO 1U2DC 3DFUA 1XRQA 4N18A 1KDPA 1NFQA 2JGIA 3GDWA 4CQJA 5C1BA 1SBNE 4ZZ3A 4DEYA 1OUMA 2O3SA 2YIVX 2UZ3A 1H7IA 4URFA 5BMVB 4WAUA 5AHRA 4RIGA 1U99A 3ONWA 4M9XA 1C9MA 4HFKB 5SZHB 4RZHA 1VYKA 3DD1A 4OB7A 4URXR 2X0FA 1J49A 2RBKA 2YUIA 4J8PA 3VO9A 3VJLA 5KTSA 4X0RA 5GP1A 4P80A 3NTQA 2WJGA 3ATPA 4LSZA 3H1GA 4EUKB 3D7NA 3VX4A 1CLEA 3SS8A 3GT4A 4LHWA 1E9AA 5D3MA 2PX5A 2WYVA 3CMCO 3QZCA 4W5HA 1AA9A 2VHYA 4LF4B 2VHVA 2BKAA 4I2NA 2X7XA 4EKEA 3V4PB 1A9XA 1KEEA 4GOMD 3IULA 4RMNA 5JQGB 2QPAA 4MV4A 1UT5A 3AY0A 5EJGA 4XSVA 2FKNA 4XWWA 5AVZA 3DLBA 5K3BA 3M6UA 4JGIA 2ZIWB 4COKA 4R05A 1J56A 3GLSA 3KHTA 3Q72A 4L5AA 2W2KB 1QPZA 5I47A 2QZJA 2W0MA 4WCFC 4G36A 4BRSA 3QFRA 1DXHA 1QORA 1G6Q1 1ZIXA 3FOWA 2NU7A 3M4YA 3R5XA 4ZHQF 4TX1A 1W52X 5BQOA 1BEEA 4AE4B 3JAKA 2LW7A 3I1FA 2FPMA 3U40A 4I9NA 4I8XA 4NMXB 4CKWB 1F60A 3U9LA 1T4GA 5EERA 2GF0A 4JP8A 3ZIAA 3LDGA 3V46A 1MOQA 1HTWA 2AXPA 5E4JA 5KJ6A 3PTLA 4P0PB 5LA6B 2C95A 3DG9A 4IV8A 1SBYA 2CYDA 1BRMA 4LFAB 4UUAA 5JD4A 4GRAA 3ZTTA 1TFUA 3EZ2A 2IOFK 4AKSA 4Z4FA 4D8UA 2CL0X 2H1FA 4TWRA 5CDFE 3G1TA 3FYDA 3KQWA 2GYWA 1R6AA 3LP5A 2GAFA 1TQ6A 1IDOA 3R6WA 4R8RA 4JYZA 4M37A 2FUCA 2XBMA 3FPFA 2ZWVA 3S8YA 1W96A 3LKZA 2NO0A 4DDTA 1KEEB 1OCEA 2HB6A 3C8GA 3QKRB 1LU9A 2FUG6 4XPIA 3ZCXA 3TKAA 4G8CA 1Z17A 3HA7A 3H42B 3L0PA 2H59A 1RYBA 1T35A 1VYIA 3LCVB 2Q9BA 5B7PA 1DS6A 2GO7A 1ZW6A 4IP0A 5D84A 1RTKA 2X0IA 3IB6A 3E9CA 4R51A 1C4XA 3G2OA 4FLFA 1I7SB 2ANCA 1XZFA 2XPCA 5HWSA 3H5LA 1TQHA 3WSVA 1PDVA 1GITA 2OFFA 3X2EA 3L05A 1NUAA 1YB5A 2QM7A 4P4TA 3AZOA 1NV8A 4RO0A 5H4HA 3CQZA 3JD3A 1J5XA 2DFVA 4AZWA 3TRFA 5KUTA 3QXHA 4A9AA 3RK0A 3OEHD 4Z1MD 1LNQA 4D96A 3ZW9A 4P2BA 4RK6A 1FFYA 3K94A 1TLLA 5FZTA 1FMTA 2HADA 3IERA 1ADJA 2IXDA 4JX8A 5KYKA 2C1XA 4DL9A 3T7AA 3UPUA 2RCNA 2QPTA 1A0OA 1D9ZA 3CZ9A 1AHHA 3NEJA 1TJ3A 5BR8B 1BHSA 2GZSA 4S1PA 5JDIA 4MEJA 3JQBC 1FB5A 1ZU5A 4DQUA 4TTTS 4XGKA 1Y6QA 3OPYI 1R4TA 3EA5A 4FKMA 4MUAA 3RSCA 4IDGA 4KR3A 2CMDA 1VMDA 3ZS8A 1RI2A 4JKOA 2VK8A 4GR4A 1T10A 2X0RA 1GV1A 4PN3A 2FPLA 4E11A 4JL5A 2C61A 2GHIA 1L5KA 1I2ZA 1GUYA 2W7TA 1Z12A 2J9RA 4GNRA 4X63A 3ABOB 2ZB7A 3PNLA 1G4WR 3OZAA 1L5VA 3JWHA 1KQNA 3DEFA 3V7YA 4BFVA 3L1IA 4JEBA 4RA6B 2QLTA 1OYOA 2F8LA 3WLQA 1Z5GA 4J0EA 4R31A 4FZVA 4A15A 1R64A 4OUDA 5HIJA 4QXPA 4OGGA 3P9QA 5ILGA 1KOGA 4TMKA 3QENA 1QHGA 4RD4A 5AH0A 4ZOEA 4ED9A 1K2VN 3QG5A 3F78A 3LYLA 5KIAA 2OQIA 1N3BA 2H06A 4LBYA 1LE4A 2RHCA 1G3UA 2JIOA 5KPJA 1OGIA 2IOFA 2AXNA 1Y9ZA 2GVDC 1N7JA 2K4MA 3SYLA 1OZ0A 2R8RA 4RJ2A 3FBTA 3IAAA 2W98A 5HV9A 2GB4A 3R8XA 3N0TA 1IU9A 1XCBA 4TYQA 1C02A 1IN7A 5FEMA 4RVCA 1B41A 1WZCA 1WB6A 3T0IA 1SH7A 4WPGA 4IH4A 4YLEA 1AUQA 1M2EA 2Q6VA 4JWKA 2KK1A 3GNSA 2A5JA 4F91B 1KZGB 1M2NA 3MCVA 2O06A 4GI5A 1Z6XA 1M0EA 2G62A 3B0VC 2VRCA 4OV6B 4RTLA 4HDAA 4PU0A 4N5NA 3OP1A 3QI2A 1DKRA 3IUSA 2Z6QA 4BZQA 3UHJA 2VJKA 4LUCA 3QWAA 5HX7A 1OFIA 1EP2B 2PRZA 1IXZA 3CXUA 3HR7A 3LUKA 4PRKA 2X8AA 3QUSA 9LDBA 3MHTA 1BA3A 3B71A 2A57A 2IVZA 1CD5A 3K8YA 4PTYA 3V1MA 1N3YA 2ZYTX 1CZUA 1T3LA 3FAZA 4HFNA 4OUDB 3T5AA 2IHJA 1YZUA 3ZHVA 1W30A 4IJWA 1X70A 3F3MA 4CIAA 3GJSA 1E4YA 4XQEA 3B85A 3N86A 2VK2A 1Y1SA 2ADFA 5HIKA 3MLEA 3MCUA 5BWMA 3TUZC 4WECA 1YFZA 5ALQA 3H2UA 3DO8A 1DEHA 1R5NA 5L0HA 4BKMA 3KPVA 2WHQA 4XVUA 4RXTA 2R7QA 2C84A 1AKMA 5T57A 4U5QA 5MDHA 3AV3A 4PR3A 3IDAA 3B1VA 2QW0X 4XR4A 1PT5A 4YP5A 1MCZA 1YH3A 3T1YB 3PX7A 1WXWA 2CZGA 3N70A 4OXKA 1JT9A 2GF2A 3EUWA 3W7BA 5K0LA 2V54A 1AIPA 3V1KA 4F3NA 4KFUA 3S90A 3C43A 1IG3A 1U1CA 3CUKA 2W6MA 4JYPA 4ZPJA 2JLQA 4I2VA 1Q0ZA 5IT4A 2WTNA 2GQ0A 4L72A 5JASA 5BQ5A 1U8UA 1II8A 1B0UA 2BFBB 3B9BA 3W5SA 4BL5A 4N0MA 4QODA 3JZFA 3KJGA 4CCYB 4KXWA 2VNSA 1IUPA 2VRWA 5CD1A 2XXAA 1MJGA 4KH1A 2YHIB 1SKQA 3OX1A 1WG8A 5BUOA 1MH9A 3PGXA 2L2QA 2R8XA 1RYDA 3D6UA 4RZIA 2AR7A 2I80A 4TRNA 4OF4A 2PBFA 5I7OA 3SOZA 4V0ME 2G1KA 1DARA 4OJMX 4ARBA 1P0PA 4B40A 4QOEA 3ZDXB 3FM9A 2NIPA 4E12A 5JCZA 2GZ1A 4RCYA 2G09A 2HT6A 4ASUD 2ORIA 3UWDA 3RVKA 1CETA 1Y7PA 3T35A 2Z43A 3LBIA 4M1ZA 1ARZA 5DFAA 4LXHA 2P2ZA 2Z4RA 1TFOB 5AKGA 1IHYA 1KYWA 2J6HA 3NB0A 4CG2A 1L5LA 1XTUA 2QIPA 2K2QB 3OFSA 2XL8A 2I4OA 2F43B 4URHA 2YOHA 2A9QA 1JDZA 3EVGA 1M2KA 1CRQA 1Z7YA 2VZ8A 2C5HA 3GH1A 5BQXA 4ZQGA 2XDAA 3H6KA 4F9TA 3FWHA 2DPMA 3EOAI 3PEYA 4RFSA 2GBPA 4RULA 4OJTA 2AJTA 4HQLA 4X8LA 1QONA 2WVOA 2EWMA 4QDOA 3L0BA 3JQ6A 2CCKA 4FE7A 4PHFA 4G5OA 4M9QA 2A1TS 1Z29A 3CX4A 2Z83A 1WMDA 1P3DA 1WULS 2ZB8A 4E0IA 3A14A 4CG0A 5IX8A 2G5PA 2GUWA 5AVSA 5E8JA 1HZZC 2XLCA 2W71A 1TKRA 2DI3A 1UADA 3R9IA 1JLSA 1HLGA 2CMKA 3HCCA 4DF3A 1XDUA 2PANA 4TVSA 3O8OA 1OXKA 4CM1A 3K0CA 4NZPA 1OYWA 1E6CA 4UE6A 1PUJA 4B0OA 5DM60 3L8HA 3KNZA 4M1KA 5BORA 1V4NA 4GZ5A 3KZOA 3HNIA 3VNBA 2ZDQA 1BXGB 3ZCPA 4WA8A 2PH5A 3BUSA 5BUCA 1FQOA 2VATA 5JYDA 2K7FA 4LDKA 5EKTA 2W6IA 3GWLA 3L43A 4L2IA 1DTEA 4ARIA 4W7SA 4CN8A 2VKTA 3PX2A 1J2RA 3TZQA 4C1BA 4MQ4A 4FHCA 1NW4A 4P98A 3T1NA 5EZ6B 4FVTA 3HYRA 4YA6A 4BN4A 2IIQA 1X8LA 1CQJB 4ESVA 2PUDA 3QXGA 1LNZA 2WD9A 3TIXB 3BILA 3LP8A 5CVDA 2C4UA 4H3KB 2BH2A 4C87A 3JAWB 2XDWA 2OCBA 3WP1B 4BVBA 1DDIA 2CXRA 4YQEA 3R7LA 4NNPA 5L3QA 3EF0A 2VK4A 4E6PA 1GQYA 3L4BA 4AX2A 5FPYA 2OZPA 2QRVB 1C9DB 4EEZA 1H9AA 4MI6A 2GHQA 2A1TR 2WWYA 2WF5A 3DFMA 1PHPA 3CNBA 2WDPA 1RCUA 2AK3A 4CS7A 1VYTA 3L49A 5DRTA 4RORA 1K5HA 1JQDA 1RAHA 3AB7A 4KN8A 1ESCA 2VDVE 4MKRA 2R7KA 1MC4A 5DGIA 3TN7A 4K7BA 4NR0A 1GU0A 3FRJA 1M1YE 4LGCA 4OH7A 1T0PA 2W6NA 1OXKB 2X8JA 4EITA 1KBOA 1ABBA 3JQ7A 3RSLA 3FUCA 4JI4B 4O59O 1Q0MA 3HZRA 3IRUA 3ESCA 1LS6A 3H4MA 4B3XA 4BX2A 1RAIA 1HE3A 3GBSA 1PUIA 2XZPA 4HEA6 4IDHA 1EFVA 3QH4A 4GQBA 1L7XA 4E15A 3THRA 3ETNA 3ZXYA 4D3ZA 3GP5A 3KJQA 5EPEA 1I2BA 4ZI3A 1ZFNA 1KNYA 1R88A 2VCCA 2EV9A 4BQEA 2Q9AA 3QW4B 3TUJC 2ZM5A 2I34A 5EVJA 3VZBA 4LZLA 3QV1A 5M2QA 1VKJA 1VMEA 4RD2A 3L4KA 1ZS9A 4JCZA 4MGIR 3NJRA 2DQYA 1P19A 4YJHB 1FSSA 1V54C 3M79A 5DP1A 1UC4B 3MXOA 3E35A 3OPMA 2I6QA 3M4ZA 2V3WA 3U3RA 3M6LA 3INTA 3G9XA 4HUJA 3ZLUA 1PR9A 2J0UB 1HE4A 4WGYA 2E2WA 3BFJA 4HLCA 1R9GA 1ADGA 1GYQA 2H2IA 1A8HA 1DUSA 3IJRA 1RRPA 1ZU4A 3I2IA 1DKQA 2CHFA 2JBAB 3AF2A 2C2BA 4ZANA 4FD3A 5C31A 3KUXA 2JNWA 3G2MA 1AZTA 2X8JB 2ICWG 4D4XA 1CS4C 2PGJA 4X66B 2Q2OA 5DOVA 4E51A 2EF1A 1CQZA 2P9QA 1PFWA 1K68A 1O54A 2G5TA 3OTOB 3SLRA 3T06B 4AWAA 2J3MA 4B83A 4LZNA 4NCXA 4KMSA 4MW4A 1Q1QA 1GV0A 4P32A 1RWPA 1NTOA 3I92A 3P7MA 4A92A 5HGXA 1VHLA 1GZHB 4IIFA 1BJKA 1FFWA 3SZUA 1ND6A 3PCTA 1RWQA 3DJNB 1CUSA 4Q01A 3VPHA 5LYJF 1EFUA 1ZVQA 3VI4B 1IUNA 2KM1A 4DNQA 2WL8A 2Y68A 1N6NA 3R76A 1OV4A 1JX6A 3UNGC 4IJ6A 4WZBE 1BH6A 3AJEA 3WV5A 2JDID 3O5AA 4HLUC 5IJWA 3OPVA 1U6KA 5BQFA 1G8PA 3ITDA 1ZVKA 4RH0A 3FVVA 4L16A 1AN0A 2ZBFA 1L4HA 3DBIA 4X1OA 3RC2A 4C76A 2G80A 2WF6A 3SJ7A 4CMHA 4L73A 4HDQB 1R9MA 4CLRA 2AHOA 4V02A 3ZJYA 1EJBA 3VAAA 1G64A 5LYJB 4F4IA 4R41A 3M5CA 2PXAA 1TQ8A 1WOLA 3SOPA 1U6IA 3LP6A 3WMXA 2ZYDA 3ASVA 2DOKA 2C0QA 4O4JF 4QYXA 1KYZA 3W2IA 4G6ZA 2R96A 3MJVA 4ILEA 1LLDA 1MVNA 5A4JA 1T01A 1Z35A 2JHFA 3VNVA 4F5YA 3TD2A 2IYXA 1N0VC 3IE0A 5HRUA 4U7HA 1R4ZA 5T8KC 4ZVKA 4YK7A 5C0OE 3P45A 4NULA 1Y0BA 1YWGO 3ZLBA 4UTVA 4ZRDA 4HVCA 5AM3A 5TJHA 4CMCA 1X8XA 3COSA 5C8DA 3V5YA 4I3MA 5KOHB 5HMLA 4R1NA 1QVXA 1JNYA 5LU8A 2E4UA 4MUJA 1DQSA 1ZUHA 5CGZA 1LCIA 1AU9A 3FYUC 1RXWA 1E5TA 2NUTB 5HPYB 1EG2A 1JE1A 1C0IA 2PX6A 4H7EA 1VSTA 3NTOA 2GKOA 1T3TA 2VT7A 4F92B 1ZA1A 3BPSA 1O87A 4KAXA 1UPUA 1GPH1 4A16A 1XPJA 4P0TA 2RFLA 5EXDA 5HKOA 5BV8A 2VBFA 4ZQBA 1UXHA 3B2NA 4QL3A 3P32A 4HQNA 4QYTA 1V5GA 2VH3A 2F22A 3BIWA 3ND8A 3I2FA 4KAAA 1GAXA 1I2CA 1E5DA 2C9DA 4PAOA 3BQMB 2MIIA 4FILA 3E05A 4AKTA 4H0CA 2REQB 1JR8A 4G0HA 4LBZA 1XYGA 2E4XA 2P5UA 2JCYA 1DBIA 1J1IA 1OH5A 1Z7EA 2DRIA 4Q16A 5B4VA 1XELA 1DJQA 1UMBB 1TUGA 5T3YA 3CV3A 4FYXA 3IR6A 4KQJA 2ZUWA 2JFZA 1E69A 1T3ZA 4UATA 1W47A 3JWPA 3GPIA 1XZHA 2I78A 3OZEA 3THXA 4DPLA 3BEOA 4NBRA 4Q24A 3UK7A 2A6HF 1H9TA 1C9KA 4P4SB 1BHQ1 2B78A 2ZI4A 4J0IA 3M49A 3F8TA 5CXXA 2C2HA 4QC2A 4FNMA 1K86A 1K63A 1WABA 3D5QA 1NKSA 4N3GA 1FRQA 2XF8A 3OHMA 2UUBB 1V8DA 3ZGNA 2NYUA 1IBMB 1DAFA 1DFIA 4L5IA 3NUGA 4AJPA 4IRMA 2JA1A 1U9IC 2XCLA 3FX2A 3BXOA 1UDWA 1VLLA 5IJZA 4Z0NA 1N32B 2P6MA 3EQ9A 3DVLA 3ZV3A 4GRDA 4PAQA 4INJA 3OF3A 1PV1A 3HKDA 1G1AA 3S40A 2EATA 3VU0A 1DJPA 1PD0A 5KNCD 4RHUA 3KT6A 2PBZA 4NCNA 3ZKWA 3QYFA 1SHKA 3QMVA 4TM7A 4ZIRA 1Z8NA 1JA9A 3WZ2A 4EG4A 1MP0A 2PTGA 2GZ2A 1PQUA 5HKBA 2F90A 2PQMA 4ZDKA 4Y7DA 1CIJA 4HYEA 3SX0A 1FSGA 2Y4NA 5TPWA 2BM9A 4PINA 1RPJA 2VC2B 1NT2A 1G9SA 4UCFA 4RSMA 2FETA 4WMLA 4XJSA 1ZM3A 2HFKA 1YRHA 1WOMA 1ST6A 4YS6A 5GJWC 3QMKA 6Q21A 4BU1A 1L5RA 4QQKA 1K8XB 5MFPA 1Q2XA 3FGZA 1QHXA 3QUTA 1GNQA 1Y6DA 1GDDA 2B4YA 1DWPA 2ZJAA 3EIQA 1VPVA 2Z2JA 8OHMA 3G6WA 1CFZA 3NMUF 1EK1A 1ZOIA 2BONA 1XCLA 1W34A 4KL8S 2HUJA 1GYPA 2A94A 1RXSA 4ZEWA 4BEBA 2PD4A 2HLDD 3T7TA 2XNDD 4YAOA 1YZQA 4LRWA 4G4JA 3IQWA 2OM6A 2IDJA 1V5EA 3K0BA 3MAAC 2A4KA 2QQ5A 4KZKA 3WNBA 5JNTA 3IPXA 4HDKA 4AY4A 2E5LB 3QLVC 1P9WA 1QGDA 4I8DA 3LVFO 1XMSA 5EXPA 3Q2KA 1G5ZA 2EX4A 2JAUA 2OBFA 3HKDB 3ELDA 3ETLA 1MZPA 1H1DA 3GNQA 3OQOA 4WKBA 4B09A 1UCFA 1XF9A 2BFAA 5JI3E 1YJCA 3EGVA 4Q3KA 1U8FO 5AM4A 2AEMA 4RJKA 3LPAA 2HKVA 3QOFA 4QFMA 4OPMA 4YQZA 4PACA 3O03A 1Y5MA 3AILA 1T24A 4WX2B 3TIVA 5K8UA 1BMDA 1ZDMA 4C01A 2FQQA 1PZMA 1XALA 3O8NA 1P75A 1O3UA 5LP6B 2RGWA 1JSRA 5EMNA 2P9HA 4CSAA 4KQFA 5TR9A 4DT1B 5EUCA 1JI0A 3Q3JB 2R25A 4OK6A 2O9XA 4P81A 3MCTA 3ZNOA 1I3MA 4Q7MB 2DPHA 4UARA 3VKFA 3T38A 3W6NA 1R7RA 5AW4A 1C2TA 3IQHX 2R62A 3OZGA 3ZV5A 1HURA 2N1MA 3M6VA 2CUNA 4RHXA 4QOJA 3UGJA 3HCNA 1K5GA 3A6JA 2QG9A 2G6TA 1Z6ZA 2VPYA 4OIRF 2VJYA 2VPTA 1UFBA 1MB3A 3WLMA 1R0SA 3EDRA 2NV6A 2GAAA 4FOPA 5D5PA 3U3XA 3K0AA 1GRCA 5KSPA 3VR4H 4MYSA 3MG9A 3EMKA 4PR0A 1W581 4KGXA 1EIWA 5AXAA 2XRYA 4NECA 4EY5A 2D06A 2JS7A 2R1VA 1BGVA 3FZNA 1KMCA 3T52A 3ESDA 1HFKA 3FUTA 3AUAA 5ALUA 2IHNA 3AVPA 4WLVA 1BXKA 2XWPA 3H2HA 3VC7A 1NLXA 1GG9A 3MJSA 2ZBDA 5HKLA 4HB3A 1TMYA 2AMVA 1KI7A 1FDRA 2FYTA 4GICA 1MRZA 2BLLA 1ZJ4A 3O95A 5TXGA 4AO8A 4TV8B 2DBYA 1P6XA 4GYJA 3D2AA 4HNAA 3VVCA 3KOUA 3OIUA 4WGGA 3HY3A 4BVGA 3RVSA