1I4ZA

The crystal structure of phascolopsis gouldii l98y methemerythrin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
113
structure length
113
Chain Sequence
b'GFPIPDPYVWDPSFRTFYSIIDDEHKTLFNGIFHLAIDDNADNLGELRRCTGKHFLNEQVLMQASQYQFYDEHKKEHETFIHALDNWKGDVKWAKSWYVNHIKTIDFKYKGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHEMERYTHRIN
publication title The crystal structures of Phascolopsis gouldii wild type and L98Y methemerythrins: structural and functional alterations of the O2 binding pocket.
pubmed doi rcsb
source organism Phascolopsis gouldii
molecule tags Oxygen storage/transport
total genus 45
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2001-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1i4zA00
1I4YA 4XQ1A 4XPXA 2AWCA 1A7EA 2HMZA 2AWYA 3WHNA 3WAQA 1HMDA 3AGTA 1A7DA 2AVKA 4XPYA 2MHRA 3AGUA 1HMOA 4XPWA 2HMQA 1I4ZA
chains in the Genus database with same CATH superfamily
5KYXA 3BEHA 5A6BD 2QY9A 1ORJA 3UGOA 3H65A 2QNLA 1Q0KA 2NUPA 2XLMA 2XRHA 3FMSA 3ZWIA 4IAQA 4Q4ZF 3J06A 2QTVA 3U3FA 2XM0A 4DVZA 3C62A 3GEEA 3C63A 2OJQA 2CNWA 2W45A 1YA7O 2OEVA 1BBHA 2ZPAA 2J9UA 3OA1A 3E70C 3ECSA 1ORYA 3RH3A 4JJFA 2H7BA 1GM5A 3W8HA 2YWAA 1YYJA 1AEPA 2Y3GA 3RQGA 4CDAA 1S05A 3LS0A 2L6GA 2YKZA 4YT5A 3L1MA 4WGZA 4AE4B 4F4BA 2VCBA 4DJ9A 5JUAA 3MFNA 2OEXA 4QI0A 1K05A 1LE4A 1T5OA 3B0PA 3RVYA 4BJTA 4FAPB 3SP1A 5D92A 3T6JA 1OCCC 5BQGA 5L0FA 4E0HA 1HY5A 1NG1A 2Y39A 2Y3DA 4BPMA 1ZYRF 3T6GB 3ASNC 5HSWA 2Q9CA 1IW7F 1Y4CA 1YZCA 4N06A 3C8GB 3TK0A 3K1IC 4BJ6A 5B3IA 4CIHA 4JEBA 1V74B 4YT2A 3JCUQ 2R25A 3JSEO 4EBBA 4DBRA 4G78A 3LEVA 1YVIA 5KYUA 2NSFA 2VASA 4PK4A 1T01A 4LACB 1G4US 2EINC 1DOVA 1S7ZA 2IM8A 2HJ3A 3DE9A 3O55A 4OD4A 2XLOA 1CPRA 4XPYA 3UMIA 3JSZA 3NYMA 3EHMA 4YL0A 3V5YA 1YLMA 3DMDA 2OJED 3PCVA 3U2MA 4CS8C 2ZD9A 1U0BB 2KK1A 2WZFA 3FOOA 4DBQA 4XPWA 5L0HA 3S9OA 3AQCA 3L8IA 1M57C 4HFFB 5A6KA 2DI3A 1OW6A 4PJMA 4YL3A 3NKEA 3NYJA 3U2LA 5DS4A 1SF8A 3TJ5A 3QTHA 3IQCA 3T9OA 3AG4C 3W8IA 1XZPA 1M2VA 1LI7A 4J7TA 4K7BA 2FAPB 2XS8A 2YL0A 3DM5A 1VB5A 3ZQVA 1YARO 1O3UA 2L6FA 3TQOA 1G4WR 2A69F 2BC5A 2EPNA 3LLIA 1DOWA 1QVXA 3FOPA 3U9MA 4BJ5C 1E86A 2VCAA 4KC9A 2NUTB 3DZAA 1ZHXA 3MX3A 1YA9A 2Y69C 4U5BE 2R7RA 3AG3C 2W4BA 4JTCB 5E3AA 4R32A 3PHF2 4EIYA 5JT4A 3EPVA 3M4CA 1OQCA 3GEHA 1VYIA 4CJGA 1JPJA 4YT8A 2Y3HA 2Z15A 5L3QA 1ORSC 5EK0A 2Q3TA 3C8GA 2A6HF 3SZRA 3U3BA 1WN0A 3CSKA 2M64A 1ZHYA 1A7VA 1VK5A 3JT1A 3O39A 1N1CA 4IAOA 4PACA 1H9GA 1O87A 1IZMA 1LIHA 3IHUA 3O10A 1EQ1A 3WHNA 1E84A 4CBEA 2OQMA 4J7YA 1H7IA 3EQLF 3UR3C 4ULVA 1A7DA 2PX0A 3DI5A 4MS2A 1U6HA 4G7HF 5COFA 5TJ5E 2J0WA 2P6VA 4U5HA 5A69A 3GORA 4CSAA 4EUKB 2HUJA 5E3CA 2I8BA 1XWJA 2XLHA 1NSGB 2GWWA 3RIPA 2X51A 2J7PA 5KYYB 2NPUA 1MMGA 1YJGA 3KYJA 1V55C 4IARA 4JC7A 4CS7A 1WATA 2R7OA 4LDRA 4D4XA 4O7GA 2HMQA 4FX5A 4L6RA 4OD5A 2IBFA 2D4UA 3NYLA 4E17A 2VH3A 2WZGA 3ZQYA 4CJOA 2J9BA 3H2VA 4BJ1A 3B0UX 1H6GA 3C7JA 3M15A 3EGXB 4UDVA 3C8ZA 2HSQA 4MVQA 4DXWA 2IYLD 2JPUA 4XEFA 2M4EA 2CYDA 2P7VA 3LNRA 4E18A 4JZAA 1D1CA 4YJWA 1VLSA 4X0RA 2OG2A 3I5PA 4MNDA 2CDQA 2L6HA 1HE9A 2LQGA 2MHRA 3IPMO 2IXNA 3U0CA 4NC3A 4I1MA 4D4NA 1D1BA 3POVA 1LI5A 4U5FE 5A6JA 2OOCA 2YVKA 2ZXWC 1E85A 5CIVA 4JIOA 1BDJB 1VMAA 4MW8A 3TOLA 2XL6A 4CS8A 3NMIA 1FFTC 3LS1A 5E2QA 5DLJA 3AG1C 2DGJA 3RW0A 1OKKD 5L0GA 2FGYA 3MLGA 4NY3A 1BR1A 3U8VA 3EFOB 1NU9C 3RQEA 2R7SA 3JYHA 4P9FA 2XL8A 2WZLA 2IXPA 3CQZA 3KH2A 4MVZA 4W8KA 2VC9A 2A6EF 2HJMA 2V26A 3KPHA 3N2ZB 3OWTA 4PJJA 4PFOA 5BQIA 3ZG1A 2L81A 4Z9IA 1ZW2A 2L9JA 5K0IA 2A1DD 2XM4A 3EGDA 2KC3A 2PF4E 3M79A 1ZVZA 3L8JA 2X0CA 3QMKA 2EPKX 2JD3A 3B29A 3GM3A 5KYYA 2HFIA 4U9DA 1ST6A 3UMKA 3N0TA 2CCYA 3EZHA 2EPOA 3ZVRA 4CDVA 1OCZC 3OEOA 1RKEA 3GANA 1WTYA 5B1BC 4XLPF 3ZTMA 5BQHA 2XXAB 4GQHA 3VM6A 3Q7LA 5DQZA 2LSEA 3JTLO 3ITFA 1U89A 2VCCA 5DS5A 4MVRA 4MVOA 2R9RB 2OKUA 3S29A 4C7OB 1G5ZA 2DB4A 4MTGA 1L7CA 4CDYA 4DOZA 1JMWA 1VLTA 1MMDA 2YLIA 3AGTA 4LDQA 2R02A 5DVWA 4QDLA 5JSLA 3GODA 3HKKA 2NG1A 5DQTA 3TJ6A 2LIGA 3QW0A 4CS9C 1MMAA 4LLEA 5AC4A 2MWQA 3A11A 1QKRA 4JURI 1V54C 1C17M 2C03A 2LD6A 2XLEA 4RBNA 3ZC4A 4B6IA 4C3BA 1Z63A 3RKOF 3V5XA 5HV9A 1K40A 4P9TA 1RXQA 2YHSA 2YZSA 5T3TA 1MQVA 2GFHA 1E83A 3CEXA 2CNWD 4JJGA 3ABMC 3NMJA 4MVUA 3EFOA 4DRJB 2EIKC 3TD7A 3DAGA 1NBBA 1ZHTA 2QE9A 3HLZA 2LFFA 1T6IA 2P61A 3QW1A 1WWPA 4YL1A 1FTSA 1TWGA 4JEAA 1JRAA 2WVOA 3DD7A 1SMYF 2W4MA 3ATPA 4LERA 1XZQA 1J8YF 5EHHA 3QVZA 2HSBA 2KQ9A 2KGOA 3DE8A 3KL4A 5A6AA 1GQAA 3MBGA 5F5FA 1KU2A 2B0HA 5AGFA 1Q0DA 4G0HA 2WVQA 2XL4A 2J9WA 4Z9JA 1TWHA 2XLWA 1T6UA 4AE4A 3EG9B 3R2PA 2BL2A 2QLAA 2XS1A 1C02A 2XXAA 1LE2A 4PR9A 4ER9A 2TMVP 4H54A 3HNIA 4IB4A 4ULWA 4WJ0A 5FZTA 2MYSA 3Q6MA 4E7ZA 4QI2A 1QPUA 1G8XA 2WB7A 1TR2A 1Q0GA 1YDIA 2A0BA 4U5DE 4BEMJ 4U5EE 1CGNA 2AWCA 2C04A 1Z3IX 2J0XA 4PFPA 1TWAA 4DRIB 2AU5A 4CX9A 1CGOA 2EIMC 2XLVA 1EI7A 1ZZPA 3M4BA 4JCZA 3DKAA 3S28A 1RKCA 4KBLA 3U8PA 4EBJA 1RMVA 4J30B 1LM3B 1T9KA 3B9QA 4NQFA 1RCPA 4JRZA 5T3WA 3RQFA 3W2VA 1SR2A 1V4AA 4Z9HA 1H9TA 2J45A 1FAPB 1EKYA 2PBEA 3HJCA 1LS1A 1TKNA 3WODF 5L0CA 1NU7D 4U5CE 4MTOA 4G7ZF 1T6QA 3IEEA 1GGQA 3EZIA 1QZXA 1ZU5A 3JRMO 5IY5C 1OXKA 2Q9AA 4U9EA 4BJ6C 1D0YA 2O9XA 3FHDA 5KYXB 3I5QA 4O6YA 1FMVA 2OCCC 3JRTA 4W8PA 1K04A 2NUPB 2EILC 3EHNA 5L0JA 1OKKA 1VOMA 3B71A 4GEHA 5A6BA 5COGA 3EH2A 4AL1A 3U5SA 3ZDLA 1MNEA 4HE8D 3LEOA 3GWNA 1VYKA 3KYIA 2CW0F 3K1IA 1FR0A 2R7UA 1WASA 4BEJA 3SEOA 3EG9A 2Q9BA 2R7XA 4XEKA 1JR8A 3AQBA 1J8MF 3CZ6A 3IQ6A 2R05A 3LJBA 3MYFA 4KNVA 2NUTA 2YLDA 1MMNA 2PP4A 1NFOA 4XWJA 5F28E 3M1CB 256BA 3C8GD 4CS9A 1TFOB 1SYQA 1NFNA 2RSEB 3QVYA 3FAJA 3RFYA 1HW2A 2A0UA 5BUOA 3B0VC 2G3KA 4AK9A 2W9YA 2E87A 4KNWA 2DYSC 1MNDA 2B0JA 3T4RA 2EPLX 3NRHA 3Q7GA 2G62A 5JLIA 3FDQA 3F47A 5E33A 3NDBB 5D91A 3E9VA 4O6MA 1ZU4A 2YRFA 3SNHA 1PD0A 3V5ZA 1A41A 3LESA 3C18A 3HNJA 3K1HA 1SZIA 2J7PD 2UUIA 3PDMP 3LAYA 2HS5A 2HV7A 2LK4A 4M63A 4N6CA 2AVKA 3RF3A 4N6HA 4PJLA 5KYUB 2R7TA 1HE1A 2YL1A 3N24A 2IXMA 3ASOC 4MVSA 4HEAJ 1YYXA 1AUEA 5L0DA 1LKXA 1HMOA 3DJNB 1D0ZA 1AVOB 1QLEC 4E7SA 3EH1A 4H4KC 1OR3A 1WOLA 4BJ5A 1VTMP 4O79A 4OIPF 4EBKA 4RDAA 2LP4A 3ABLC 3DXJF 4AX2A 5FCLA 4OIRF 1FMWA 2ICWG 4MTFA 4YN0B 4JCHA 1D1AA 3KMIA 1OCRC 4IWBA 4I3MA 3EGXA 2KNHA 5B3SC 1A7EA 3DJUB 4MW3A 1JPNA 2DYRC 2UUHA 4KI2A 1BR4A 1ZW3A 1ZHZA 5GPGB 3X1OA 3WAQA 1APCA 4CSAC 1OW7A 3SXZA 1YZAA 3L0IA 1M2VB 1NZEA 3V7OA 3X2QC 2G3VA 4YT4A 3I4UA 3UMHA 5JVEA 2QUPA 2A68F 3G50A 3VF0A 1BR2A 3AGUA 4C3DA 3AJMA 4EWCA 5AC5A 4OINF 3AG2C 1NLXA 3JYYA 3W2WA 3ZTZA 4ONSA 4DRHB 2OU6A 3DWWA 1BZ4A 2Q4FA 4NCQA 4ANJA 2ZXRA 2YL3A 3GM2A 4CIPA 4O6NA 4XQ1A 4ZLCA 1LS4A 1OXBA 3VRCA 2JX0A 4I1OB 2ASRA 3AOUA 1LVKA 2LCHA 2H7VC 2VB6A 3FVYA 4MVMA 3SYNA 4PJNA 3MYIA 4JKVA 1Z7Qc 5KYWB 4A4AA 1EA8A 3S84A 1HMDA 2GAQA 2KW3C 4MQ9F 4ZLDA 2WVNA 3NMKA 4J32B 3GEIA 3HNLA 1WGWA 4G7OF 2YLGA 4E0IA 3KKBA 5EGYA 2HV6A 2R03A 4OIQF 2PFDA 1JAFA 4NTFA 5B1AC 3R7CA 3DM9B 3W4YA 1HW1A 2XLDA 4OIOF 3TOMA 3LLKA 4EKWA 3K6BA 1QQ3A 4XLNF 2BE5F 2CGEA 3K7DA 1I4ZA 5JRAA 1I5NA 1Z23A 3JZ0A 3CAXA 4XPXA 3ZSUA 3F46A 1L3PA 1KTMA 1OR2A 4C7OA 3S0XA 4GYTA 2IOQA 4JVSA 1YAUO 1LPEA 1RJ9B 1R5ID 2YQYA 1TWCA 2LFDA 2R7VA 3U9JA 2EPMX 2R7QA 3LUTB 4JTAB 3US6A 3K33A 1GS9A 2GA0A 2V3CC 2AP3A 1D0XA 4BG0A 1PV3A 2KYHA 2ZXOA 1B68A 1OW8A 2Q7RA 5KYNA 1TFKB 2GDCA 2KSFA 3ZIBA 3VAYA 3FAPB 1FNTc 3UGPA 3H2UA 2H7OA 4P6IC 2HKVA 5COMA 1Q0FA 1OCOC 1TQGA 3SXKA 1M56C 1PD1A 3GM1A 2P1AA 4FESA 3S27A 1I4YA 4C3EA 4IJJA 3LNMB 1JOGA 3G4XA 1E2XA 3T6BA 3IQTA 2HMZA 1R4TA 4EHPA 5KYWA 4JE9A 3S90A 1UFBA 4A2NB 2IXOA 3HTKC 4FWVA 4K1OA 4NTBA 4XEVA 3IQ5A 2H8AA 4K0DA 5L0IA 3TULA 4WGYA 2KJGA 3RVZA 1C03A 1A0BA 2XSEA 3EGDB 4U5GA 3VYWA 4WABA 4IGGA 3K66A 1F1MA 4Q5SF 3G4ZA 2J8WA 5CI9A 2FFHA 5JP7A 2ZXPA 3PMRA 3L34A 2F22A 2Y3BA 5F5HA 1Z6AA 4I44A 3UNGC 2ETSA 1RKEB 2I15A 4RD9A 4YK5A 3NG1A 1Y6DA 3SXMA 5JS5A 4Q7CA 2Q00A 3DAFA 3Q6NA 3SXYA 1KNYA 1Z5ZA 2YL7A 1CPQA 2L7AA 2PX3A 3A9CA 1PCXA 3O6XA 2PNOA 1CGME 2HZ8A 2EIJC 4LLCA 2RD9A 1RJ9A 2AWYA 3ABKC 4HFKB 3WG7C 2NSGA 2D5RB 1Q0MA 4JW1A 2J46A 1M2OA 4N4WA 5CI8A 1UG7A 1ZHWA 4IRUA 4XTKA 1W2WA 1O5HA 3BRJA 2YEVA 4JTDB 3GWLA 3HNKA 4NTAA 2WL8A 4LDKA 3EJNA 4AL0A 3FXHA 2P0NA 1FFHA 2J9VA 1M6TA 3RYLA 5DS6A 1QSPA 5L3VA 2R7WA 4DVYP 3NKDA 5T1DB 3QZCA 4YWQA
chains in the Genus database with same CATH topology
1I4YA 4XQ1A 4XPXA 2AWCA 1A7EA 2HMZA 2AWYA 3WHNA 3WAQA 1HMDA 3AGTA 1A7DA 2AVKA 4XPYA 2MHRA 3AGUA 1HMOA 4XPWA 2HMQA 1I4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I4Y A;  4XQ1 A;  4XPX A;  2AWC A;  1A7E A;  2HMZ A;  2AWY A;  3WHN A;  3WAQ A;  1HMD A;  3AGT A;  1A7D A;  2AVK A;  4XPY A;  2MHR A;  3AGU A;  1HMO A;  4XPW A;  2HMQ A;  1I4Z A; 
#chains in the Genus database with same CATH topology
 5KYX A;  3BEH A;  5A6B D;  2QY9 A;  1ORJ A;  3UGO A;  3H65 A;  2QNL A;  1Q0K A;  2NUP A;  2XLM A;  2XRH A;  3FMS A;  3ZWI A;  4IAQ A;  4Q4Z F;  3J06 A;  2QTV A;  3U3F A;  2XM0 A;  4DVZ A;  3C62 A;  3GEE A;  3C63 A;  2OJQ A;  2CNW A;  2W45 A;  1YA7 O;  2OEV A;  1BBH A;  2ZPA A;  2J9U A;  3OA1 A;  3E70 C;  3ECS A;  1ORY A;  3RH3 A;  4JJF A;  2H7B A;  1GM5 A;  3W8H A;  2YWA A;  1YYJ A;  1AEP A;  2Y3G A;  3RQG A;  4CDA A;  1S05 A;  3LS0 A;  2L6G A;  2YKZ A;  4YT5 A;  3L1M A;  4WGZ A;  4AE4 B;  4F4B A;  2VCB A;  4DJ9 A;  5JUA A;  3MFN A;  2OEX A;  4QI0 A;  1K05 A;  1LE4 A;  1T5O A;  3B0P A;  3RVY A;  4BJT A;  4FAP B;  3SP1 A;  5D92 A;  3T6J A;  1OCC C;  5BQG A;  5L0F A;  4E0H A;  1HY5 A;  1NG1 A;  2Y39 A;  2Y3D A;  4BPM A;  1ZYR F;  3T6G B;  3ASN C;  5HSW A;  2Q9C A;  1IW7 F;  1Y4C A;  1YZC A;  4N06 A;  3C8G B;  3TK0 A;  3K1I C;  4BJ6 A;  5B3I A;  4CIH A;  4JEB A;  1V74 B;  4YT2 A;  3JCU Q;  2R25 A;  3JSE O;  4EBB A;  4DBR A;  4G78 A;  3LEV A;  1YVI A;  5KYU A;  2NSF A;  2VAS A;  4PK4 A;  1T01 A;  4LAC B;  1G4U S;  2EIN C;  1DOV A;  1S7Z A;  2IM8 A;  2HJ3 A;  3DE9 A;  3O55 A;  4OD4 A;  2XLO A;  1CPR A;  4XPY A;  3UMI A;  3JSZ A;  3NYM A;  3EHM A;  4YL0 A;  3V5Y A;  1YLM A;  3DMD A;  2OJE D;  3PCV A;  3U2M A;  4CS8 C;  2ZD9 A;  1U0B B;  2KK1 A;  2WZF A;  3FOO A;  4DBQ A;  4XPW A;  5L0H A;  3S9O A;  3AQC A;  3L8I A;  1M57 C;  4HFF B;  5A6K A;  2DI3 A;  1OW6 A;  4PJM A;  4YL3 A;  3NKE A;  3NYJ A;  3U2L A;  5DS4 A;  1SF8 A;  3TJ5 A;  3QTH A;  3IQC A;  3T9O A;  3AG4 C;  3W8I A;  1XZP A;  1M2V A;  1LI7 A;  4J7T A;  4K7B A;  2FAP B;  2XS8 A;  2YL0 A;  3DM5 A;  1VB5 A;  3ZQV A;  1YAR O;  1O3U A;  2L6F A;  3TQO A;  1G4W R;  2A69 F;  2BC5 A;  2EPN A;  3LLI A;  1DOW A;  1QVX A;  3FOP A;  3U9M A;  4BJ5 C;  1E86 A;  2VCA A;  4KC9 A;  2NUT B;  3DZA A;  1ZHX A;  3MX3 A;  1YA9 A;  2Y69 C;  4U5B E;  2R7R A;  3AG3 C;  2W4B A;  4JTC B;  5E3A A;  4R32 A;  3PHF 2;  4EIY A;  5JT4 A;  3EPV A;  3M4C A;  1OQC A;  3GEH A;  1VYI A;  4CJG A;  1JPJ A;  4YT8 A;  2Y3H A;  2Z15 A;  5L3Q A;  1ORS C;  5EK0 A;  2Q3T A;  3C8G A;  2A6H F;  3SZR A;  3U3B A;  1WN0 A;  3CSK A;  2M64 A;  1ZHY A;  1A7V A;  1VK5 A;  3JT1 A;  3O39 A;  1N1C A;  4IAO A;  4PAC A;  1H9G A;  1O87 A;  1IZM A;  1LIH A;  3IHU A;  3O10 A;  1EQ1 A;  3WHN A;  1E84 A;  4CBE A;  2OQM A;  4J7Y A;  1H7I A;  3EQL F;  3UR3 C;  4ULV A;  1A7D A;  2PX0 A;  3DI5 A;  4MS2 A;  1U6H A;  4G7H F;  5COF A;  5TJ5 E;  2J0W A;  2P6V A;  4U5H A;  5A69 A;  3GOR A;  4CSA A;  4EUK B;  2HUJ A;  5E3C A;  2I8B A;  1XWJ A;  2XLH A;  1NSG B;  2GWW A;  3RIP A;  2X51 A;  2J7P A;  5KYY B;  2NPU A;  1MMG A;  1YJG A;  3KYJ A;  1V55 C;  4IAR A;  4JC7 A;  4CS7 A;  1WAT A;  2R7O A;  4LDR A;  4D4X A;  4O7G A;  2HMQ A;  4FX5 A;  4L6R A;  4OD5 A;  2IBF A;  2D4U A;  3NYL A;  4E17 A;  2VH3 A;  2WZG A;  3ZQY A;  4CJO A;  2J9B A;  3H2V A;  4BJ1 A;  3B0U X;  1H6G A;  3C7J A;  3M15 A;  3EGX B;  4UDV A;  3C8Z A;  2HSQ A;  4MVQ A;  4DXW A;  2IYL D;  2JPU A;  4XEF A;  2M4E A;  2CYD A;  2P7V A;  3LNR A;  4E18 A;  4JZA A;  1D1C A;  4YJW A;  1VLS A;  4X0R A;  2OG2 A;  3I5P A;  4MND A;  2CDQ A;  2L6H A;  1HE9 A;  2LQG A;  2MHR A;  3IPM O;  2IXN A;  3U0C A;  4NC3 A;  4I1M A;  4D4N A;  1D1B A;  3POV A;  1LI5 A;  4U5F E;  5A6J A;  2OOC A;  2YVK A;  2ZXW C;  1E85 A;  5CIV A;  4JIO A;  1BDJ B;  1VMA A;  4MW8 A;  3TOL A;  2XL6 A;  4CS8 A;  3NMI A;  1FFT C;  3LS1 A;  5E2Q A;  5DLJ A;  3AG1 C;  2DGJ A;  3RW0 A;  1OKK D;  5L0G A;  2FGY A;  3MLG A;  4NY3 A;  1BR1 A;  3U8V A;  3EFO B;  1NU9 C;  3RQE A;  2R7S A;  3JYH A;  4P9F A;  2XL8 A;  2WZL A;  2IXP A;  3CQZ A;  3KH2 A;  4MVZ A;  4W8K A;  2VC9 A;  2A6E F;  2HJM A;  2V26 A;  3KPH A;  3N2Z B;  3OWT A;  4PJJ A;  4PFO A;  5BQI A;  3ZG1 A;  2L81 A;  4Z9I A;  1ZW2 A;  2L9J A;  5K0I A;  2A1D D;  2XM4 A;  3EGD A;  2KC3 A;  2PF4 E;  3M79 A;  1ZVZ A;  3L8J A;  2X0C A;  3QMK A;  2EPK X;  2JD3 A;  3B29 A;  3GM3 A;  5KYY A;  2HFI A;  4U9D A;  1ST6 A;  3UMK A;  3N0T A;  2CCY A;  3EZH A;  2EPO A;  3ZVR A;  4CDV A;  1OCZ C;  3OEO A;  1RKE A;  3GAN A;  1WTY A;  5B1B C;  4XLP F;  3ZTM A;  5BQH A;  2XXA B;  4GQH A;  3VM6 A;  3Q7L A;  5DQZ A;  2LSE A;  3JTL O;  3ITF A;  1U89 A;  2VCC A;  5DS5 A;  4MVR A;  4MVO A;  2R9R B;  2OKU A;  3S29 A;  4C7O B;  1G5Z A;  2DB4 A;  4MTG A;  1L7C A;  4CDY A;  4DOZ A;  1JMW A;  1VLT A;  1MMD A;  2YLI A;  3AGT A;  4LDQ A;  2R02 A;  5DVW A;  4QDL A;  5JSL A;  3GOD A;  3HKK A;  2NG1 A;  5DQT A;  3TJ6 A;  2LIG A;  3QW0 A;  4CS9 C;  1MMA A;  4LLE A;  5AC4 A;  2MWQ A;  3A11 A;  1QKR A;  4JUR I;  1V54 C;  1C17 M;  2C03 A;  2LD6 A;  2XLE A;  4RBN A;  3ZC4 A;  4B6I A;  4C3B A;  1Z63 A;  3RKO F;  3V5X A;  5HV9 A;  1K40 A;  4P9T A;  1RXQ A;  2YHS A;  2YZS A;  5T3T A;  1MQV A;  2GFH A;  1E83 A;  3CEX A;  2CNW D;  4JJG A;  3ABM C;  3NMJ A;  4MVU A;  3EFO A;  4DRJ B;  2EIK C;  3TD7 A;  3DAG A;  1NBB A;  1ZHT A;  2QE9 A;  3HLZ A;  2LFF A;  1T6I A;  2P61 A;  3QW1 A;  1WWP A;  4YL1 A;  1FTS A;  1TWG A;  4JEA A;  1JRA A;  2WVO A;  3DD7 A;  1SMY F;  2W4M A;  3ATP A;  4LER A;  1XZQ A;  1J8Y F;  5EHH A;  3QVZ A;  2HSB A;  2KQ9 A;  2KGO A;  3DE8 A;  3KL4 A;  5A6A A;  1GQA A;  3MBG A;  5F5F A;  1KU2 A;  2B0H A;  5AGF A;  1Q0D A;  4G0H A;  2WVQ A;  2XL4 A;  2J9W A;  4Z9J A;  1TWH A;  2XLW A;  1T6U A;  4AE4 A;  3EG9 B;  3R2P A;  2BL2 A;  2QLA A;  2XS1 A;  1C02 A;  2XXA A;  1LE2 A;  4PR9 A;  4ER9 A;  2TMV P;  4H54 A;  3HNI A;  4IB4 A;  4ULW A;  4WJ0 A;  5FZT A;  2MYS A;  3Q6M A;  4E7Z A;  4QI2 A;  1QPU A;  1G8X A;  2WB7 A;  1TR2 A;  1Q0G A;  1YDI A;  2A0B A;  4U5D E;  4BEM J;  4U5E E;  1CGN A;  2AWC A;  2C04 A;  1Z3I X;  2J0X A;  4PFP A;  1TWA A;  4DRI B;  2AU5 A;  4CX9 A;  1CGO A;  2EIM C;  2XLV A;  1EI7 A;  1ZZP A;  3M4B A;  4JCZ A;  3DKA A;  3S28 A;  1RKC A;  4KBL A;  3U8P A;  4EBJ A;  1RMV A;  4J30 B;  1LM3 B;  1T9K A;  3B9Q A;  4NQF A;  1RCP A;  4JRZ A;  5T3W A;  3RQF A;  3W2V A;  1SR2 A;  1V4A A;  4Z9H A;  1H9T A;  2J45 A;  1FAP B;  1EKY A;  2PBE A;  3HJC A;  1LS1 A;  1TKN A;  3WOD F;  5L0C A;  1NU7 D;  4U5C E;  4MTO A;  4G7Z F;  1T6Q A;  3IEE A;  1GGQ A;  3EZI A;  1QZX A;  1ZU5 A;  3JRM O;  5IY5 C;  1OXK A;  2Q9A A;  4U9E A;  4BJ6 C;  1D0Y A;  2O9X A;  3FHD A;  5KYX B;  3I5Q A;  4O6Y A;  1FMV A;  2OCC C;  3JRT A;  4W8P A;  1K04 A;  2NUP B;  2EIL C;  3EHN A;  5L0J A;  1OKK A;  1VOM A;  3B71 A;  4GEH A;  5A6B A;  5COG A;  3EH2 A;  4AL1 A;  3U5S A;  3ZDL A;  1MNE A;  4HE8 D;  3LEO A;  3GWN A;  1VYK A;  3KYI A;  2CW0 F;  3K1I A;  1FR0 A;  2R7U A;  1WAS A;  4BEJ A;  3SEO A;  3EG9 A;  2Q9B A;  2R7X A;  4XEK A;  1JR8 A;  3AQB A;  1J8M F;  3CZ6 A;  3IQ6 A;  2R05 A;  3LJB A;  3MYF A;  4KNV A;  2NUT A;  2YLD A;  1MMN A;  2PP4 A;  1NFO A;  4XWJ A;  5F28 E;  3M1C B;  256B A;  3C8G D;  4CS9 A;  1TFO B;  1SYQ A;  1NFN A;  2RSE B;  3QVY A;  3FAJ A;  3RFY A;  1HW2 A;  2A0U A;  5BUO A;  3B0V C;  2G3K A;  4AK9 A;  2W9Y A;  2E87 A;  4KNW A;  2DYS C;  1MND A;  2B0J A;  3T4R A;  2EPL X;  3NRH A;  3Q7G A;  2G62 A;  5JLI A;  3FDQ A;  3F47 A;  5E33 A;  3NDB B;  5D91 A;  3E9V A;  4O6M A;  1ZU4 A;  2YRF A;  3SNH A;  1PD0 A;  3V5Z A;  1A41 A;  3LES A;  3C18 A;  3HNJ A;  3K1H A;  1SZI A;  2J7P D;  2UUI A;  3PDM P;  3LAY A;  2HS5 A;  2HV7 A;  2LK4 A;  4M63 A;  4N6C A;  2AVK A;  3RF3 A;  4N6H A;  4PJL A;  5KYU B;  2R7T A;  1HE1 A;  2YL1 A;  3N24 A;  2IXM A;  3ASO C;  4MVS A;  4HEA J;  1YYX A;  1AUE A;  5L0D A;  1LKX A;  1HMO A;  3DJN B;  1D0Z A;  1AVO B;  1QLE C;  4E7S A;  3EH1 A;  4H4K C;  1OR3 A;  1WOL A;  4BJ5 A;  1VTM P;  4O79 A;  4OIP F;  4EBK A;  4RDA A;  2LP4 A;  3ABL C;  3DXJ F;  4AX2 A;  5FCL A;  4OIR F;  1FMW A;  2ICW G;  4MTF A;  4YN0 B;  4JCH A;  1D1A A;  3KMI A;  1OCR C;  4IWB A;  4I3M A;  3EGX A;  2KNH A;  5B3S C;  1A7E A;  3DJU B;  4MW3 A;  1JPN A;  2DYR C;  2UUH A;  4KI2 A;  1BR4 A;  1ZW3 A;  1ZHZ A;  5GPG B;  3X1O A;  3WAQ A;  1APC A;  4CSA C;  1OW7 A;  3SXZ A;  1YZA A;  3L0I A;  1M2V B;  1NZE A;  3V7O A;  3X2Q C;  2G3V A;  4YT4 A;  3I4U A;  3UMH A;  5JVE A;  2QUP A;  2A68 F;  3G50 A;  3VF0 A;  1BR2 A;  3AGU A;  4C3D A;  3AJM A;  4EWC A;  5AC5 A;  4OIN F;  3AG2 C;  1NLX A;  3JYY A;  3W2W A;  3ZTZ A;  4ONS A;  4DRH B;  2OU6 A;  3DWW A;  1BZ4 A;  2Q4F A;  4NCQ A;  4ANJ A;  2ZXR A;  2YL3 A;  3GM2 A;  4CIP A;  4O6N A;  4XQ1 A;  4ZLC A;  1LS4 A;  1OXB A;  3VRC A;  2JX0 A;  4I1O B;  2ASR A;  3AOU A;  1LVK A;  2LCH A;  2H7V C;  2VB6 A;  3FVY A;  4MVM A;  3SYN A;  4PJN A;  3MYI A;  4JKV A;  1Z7Q c;  5KYW B;  4A4A A;  1EA8 A;  3S84 A;  1HMD A;  2GAQ A;  2KW3 C;  4MQ9 F;  4ZLD A;  2WVN A;  3NMK A;  4J32 B;  3GEI A;  3HNL A;  1WGW A;  4G7O F;  2YLG A;  4E0I A;  3KKB A;  5EGY A;  2HV6 A;  2R03 A;  4OIQ F;  2PFD A;  1JAF A;  4NTF A;  5B1A C;  3R7C A;  3DM9 B;  3W4Y A;  1HW1 A;  2XLD A;  4OIO F;  3TOM A;  3LLK A;  4EKW A;  3K6B A;  1QQ3 A;  4XLN F;  2BE5 F;  2CGE A;  3K7D A;  1I4Z A;  5JRA A;  1I5N A;  1Z23 A;  3JZ0 A;  3CAX A;  4XPX A;  3ZSU A;  3F46 A;  1L3P A;  1KTM A;  1OR2 A;  4C7O A;  3S0X A;  4GYT A;  2IOQ A;  4JVS A;  1YAU O;  1LPE A;  1RJ9 B;  1R5I D;  2YQY A;  1TWC A;  2LFD A;  2R7V A;  3U9J A;  2EPM X;  2R7Q A;  3LUT B;  4JTA B;  3US6 A;  3K33 A;  1GS9 A;  2GA0 A;  2V3C C;  2AP3 A;  1D0X A;  4BG0 A;  1PV3 A;  2KYH A;  2ZXO A;  1B68 A;  1OW8 A;  2Q7R A;  5KYN A;  1TFK B;  2GDC A;  2KSF A;  3ZIB A;  3VAY A;  3FAP B;  1FNT c;  3UGP A;  3H2U A;  2H7O A;  4P6I C;  2HKV A;  5COM A;  1Q0F A;  1OCO C;  1TQG A;  3SXK A;  1M56 C;  1PD1 A;  3GM1 A;  2P1A A;  4FES A;  3S27 A;  1I4Y A;  4C3E A;  4IJJ A;  3LNM B;  1JOG A;  3G4X A;  1E2X A;  3T6B A;  3IQT A;  2HMZ A;  1R4T A;  4EHP A;  5KYW A;  4JE9 A;  3S90 A;  1UFB A;  4A2N B;  2IXO A;  3HTK C;  4FWV A;  4K1O A;  4NTB A;  4XEV A;  3IQ5 A;  2H8A A;  4K0D A;  5L0I A;  3TUL A;  4WGY A;  2KJG A;  3RVZ A;  1C03 A;  1A0B A;  2XSE A;  3EGD B;  4U5G A;  3VYW A;  4WAB A;  4IGG A;  3K66 A;  1F1M A;  4Q5S F;  3G4Z A;  2J8W A;  5CI9 A;  2FFH A;  5JP7 A;  2ZXP A;  3PMR A;  3L34 A;  2F22 A;  2Y3B A;  5F5H A;  1Z6A A;  4I44 A;  3UNG C;  2ETS A;  1RKE B;  2I15 A;  4RD9 A;  4YK5 A;  3NG1 A;  1Y6D A;  3SXM A;  5JS5 A;  4Q7C A;  2Q00 A;  3DAF A;  3Q6N A;  3SXY A;  1KNY A;  1Z5Z A;  2YL7 A;  1CPQ A;  2L7A A;  2PX3 A;  3A9C A;  1PCX A;  3O6X A;  2PNO A;  1CGM E;  2HZ8 A;  2EIJ C;  4LLC A;  2RD9 A;  1RJ9 A;  2AWY A;  3ABK C;  4HFK B;  3WG7 C;  2NSG A;  2D5R B;  1Q0M A;  4JW1 A;  2J46 A;  1M2O A;  4N4W A;  5CI8 A;  1UG7 A;  1ZHW A;  4IRU A;  4XTK A;  1W2W A;  1O5H A;  3BRJ A;  2YEV A;  4JTD B;  3GWL A;  3HNK A;  4NTA A;  2WL8 A;  4LDK A;  3EJN A;  4AL0 A;  3FXH A;  2P0N A;  1FFH A;  2J9V A;  1M6T A;  3RYL A;  5DS6 A;  1QSP A;  5L3V A;  2R7W A;  4DVY P;  3NKD A;  5T1D B;  3QZC A;  4YWQ A; 
#chains in the Genus database with same CATH homology
 1I4Y A;  4XQ1 A;  4XPX A;  2AWC A;  1A7E A;  2HMZ A;  2AWY A;  3WHN A;  3WAQ A;  1HMD A;  3AGT A;  1A7D A;  2AVK A;  4XPY A;  2MHR A;  3AGU A;  1HMO A;  4XPW A;  2HMQ A;  1I4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...