1I4ZA

The crystal structure of phascolopsis gouldii l98y methemerythrin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
113
structure length
113
Chain Sequence
GFPIPDPYVWDPSFRTFYSIIDDEHKTLFNGIFHLAIDDNADNLGELRRCTGKHFLNEQVLMQASQYQFYDEHKKEHETFIHALDNWKGDVKWAKSWYVNHIKTIDFKYKGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxygen storage/transport
molecule keywords METHEMERYTHRIN
publication title The crystal structures of Phascolopsis gouldii wild type and L98Y methemerythrins: structural and functional alterations of the O2 binding pocket.
pubmed doi rcsb
source organism Phascolopsis gouldii
total genus 45
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2001-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1i4zA00
2HMZA 1HMOA 2HMQA 3AGUA 4XPXA 1I4YA 2AWYA 2MHRA 4XQ1A 1A7EA 4XPWA 3AGTA 1I4ZA 3WHNA 1A7DA 4XPYA 2AVKA 2AWCA 1HMDA 3WAQA
chains in the Genus database with same CATH superfamily
1JPJA 1VYKA 5DVWA 3ASNC 3G4XA 2I15A 3IQTA 3HTKC 2GA0A 4XPXA 3LUTB 4BJTA 4G7OF 1Z5ZA 4KNWA 4G7ZF 2KC3A 3HNIA 4Z9IA 1PCXA 1V55C 2PNOA 1YDIA 3EGXB 3WODF 4I1MA 4ONSA 3A9CA 2NSFA 3UMHA 2EINC 3ZG1A 5DQTA 1DOWA 4DVZA 3SNHA 4E0HA 4F4BA 3MLGA 4OIQF 1MNDA 4DRIB 1ZU5A 4CJOA 2C04A 2YQYA 3GWNA 1A7DA 2AU5A 1G4US 3Q7GA 3TULA 2IXNA 2KW3C 1JMWA 2NG1A 3GM1A 2WL8A 2J0XA 2ZXOA 3U5SA 1TWAA 2OG2A 2Q3TA 2QLAA 1D1BA 3JRTA 1M6TA 5A6JA 2VC9A 4Z9JA 2HV6A 5K0IA 1PV3A 2UUIA 3JSZA 3M1CB 1NFNA 5CI9A 5GPGB 2OQMA 3WAQA 3GEHA 3JT1A 4U5DE 1EKYA 1HMOA 1YZAA 3H65A 4LDQA 4HFFB 2L6HA 4IARA 4MVUA 5BQIA 4AE4B 1YA9A 1BR4A 4U5CE 1ZW3A 1H9GA 1R5ID 3U9JA 4BJ6C 1YAUO 1TWGA 3ZTMA 5BUOA 4C7OB 4ANJA 2XXAA 3LS0A 3ZDLA 4CDAA 5B1BC 2GAQA 2XS8A 3PCVA 3DMDA 4XQ1A 3S27A 3T9OA 1TKNA 3B0PA 4Z9HA 4J7TA 1OR3A 3FVYA 2EIJC 1OXKA 4N6CA 1E83A 2XL4A 3LNRA 3DI5A 4KC9A 4MVZA 1VYIA 3V7OA 3QW1A 4XPYA 1YZCA 4CS9A 4QDLA 4EBJA 2OJQA 2R7UA 3DAFA 3EG9B 4Q7CA 1YJGA 3RFYA 1SF8A 1ZW2A 2QTVA 1F1MA 2CGEA 1VB5A 2J9VA 2AWCA 3JSEO 4PFPA 4E7ZA 1BR2A 2LD6A 3VAYA 3M79A 1NZEA 3NMJA 4O6YA 4WGYA 4RBNA 2GWWA 1Z23A 2ICWG 3GEEA 3NYJA 4N4WA 2W9YA 1W2WA 5T1DB 3RQGA 3SP1A 1I4YA 1CGOA 2HS5A 3L8IA 1BBHA 3PDMP 3EZIA 1J8YF 3UR3C 3ABMC 3POVA 3GEIA 4JTAB 2A6HF 3X2QC 1VLSA 3UGOA 3ZQVA 1ORYA 4MVMA 4WGZA 2R7OA 3EH2A 1Z3IX 1ZHWA 5COGA 3V5YA 2L81A 4G78A 4EUKB 2R7RA 3AGTA 1OW7A 1YVIA 4D4XA 2ZXRA 4YT2A 3KKBA 2OOCA 5JP7A 3IEEA 2R03A 4NQFA 2M64A 2UUHA 1U89A 3GWLA 4C3DA 1M2VA 3I5QA 1E85A 2WVNA 3CSKA 3K66A 1LPEA 5EK0A 2KSFA 3AQBA 1VTMP 2H7OA 2P61A 4FAPB 1E84A 1T6UA 1Q0FA 4ER9A 2LSEA 2J9BA 3EGDA 2NSGA 4I1OB 3H2UA 4O7GA 4YT5A 4FX5A 1D1CA 5DQZA 1WATA 1WWPA 4MVQA 4YN0B 3OA1A 3VF0A 4CDVA 5JLIA 2YLIA 3NDBB 2AWYA 3HNKA 1YYJA 2LIGA 2VCAA 2D5RB 2KNHA 1V54C 3TJ5A 2A6EF 3GORA 2R7TA 4LDRA 3LAYA 5L0GA 2PP4A 4WABA 1LM3B 1S7ZA 2X51A 1YLMA 5B1AC 3US6A 4EIYA 4IJJA 1H6GA 2GDCA 1K40A 1QLEC 1GM5A 1HE1A 3VYWA 4PACA 1Q0DA 2XLVA 2PBEA 3AQCA 4ULWA 4BG0A 4IWBA 1BR1A 1D0XA 4R32A 1R4TA 4MTOA 1UG7A 4XTKA 4CX9A 3CZ6A 2R7SA 1FTSA 3EZHA 1HY5A 3JCUQ 5DLJA 2GFHA 4X0RA 1MMDA 1PD0A 1WOLA 5L0HA 4A4AA 2NPUA 3W8HA 3EGXA 1A7VA 2Y3BA 5IY5C 2DYSC 1ZHYA 1GQAA 2H7BA 3DE8A 4ULVA 4J32B 1OCCC 2EPKX 2MWQA 2WZLA 4NTAA 3ZQYA 3W2WA 5DS4A 3J06A 2Y3DA 3K33A 1C17M 4Q5SF 3JRMO 3ZVRA 1MNEA 4C3BA 3IQ6A 4U9EA 2XL6A 1JOGA 1C03A 2EILC 2P7VA 4YT4A 3FOOA 4BJ6A 2X0CA 4YWQA 5DS5A 2DYRC 1OW6A 4OD5A 3EHNA 5A69A 2HMQA 4AE4A 2G3VA 1MMGA 1S05A 3U2MA 1GS9A 3V5ZA 4W8PA 4YL1A 4C7OA 1JRAA 4U9DA 3B71A 3JZ0A 2ZD9A 1A41A 2LQGA 4IAQA 1U6HA 4U5FE 5F5HA 5HSWA 1NLXA 4GQHA 3U8VA 2RD9A 3IQ5A 4AL1A 1MMAA 1ZU4A 2Q7RA 1QQ3A 1M57C 1L7CA 3B0UX 4JCZA 4QI0A 3RQEA 4GEHA 1TR2A 3QW0A 1A0BA 4JEAA 1I5NA 2WVQA 5CIVA 3MBGA 3UMIA 3TJ6A 1VK5A 2J0WA 2XLHA 5HV9A 3EG9A 2HV7A 2MYSA 1OR2A 2CDQA 2EIMC 3O39A 2P6VA 3K7DA 1T6IA 3T4RA 4EKWA 4MS2A 3C18A 2EPOA 5F5FA 1T5OA 4XEVA 4MVSA 4JW1A 4AX2A 1H7IA 4ZLDA 1O3UA 3AGUA 3AG2C 4CBEA 3LEVA 3BRJA 1SMYF 2KJGA 2XS1A 1MMNA 3T6JA 2YEVA 1M56C 5E33A 5A6BA 1YARO 2QE9A 2MHRA 3SEOA 5L0IA 3T6GB 2R7XA 4YJWA 4GYTA 4PR9A 2W4MA 1U0BB 3R7CA 3C7JA 3LESA 1M2OA 2I8BA 4YL3A 3RIPA 5BQHA 1JAFA 3CEXA 1J8MF 3JYHA 4FWVA 4IRUA 3NMIA 2HJMA 2XRHA 2EPNA 1G4WR 2ASRA 3FAJA 3FHDA 2OCCC 3CQZA 2LP4A 5L0FA 1Q0MA 3AG1C 2A69F 1RXQA 2KQ9A 1B68A 4I3MA 4J7YA 3A11A 4LACB 1HMDA 2VB6A 3UMKA 3JYYA 1LI5A 4JE9A 2IBFA 4RDAA 3O10A 1NU7D 3RVZA 4LLCA 2VCCA 3GM2A 3M15A 1AVOB 1Y6DA 2WZGA 2ZXWC 2CNWA 2QNLA 1K05A 3QZCA 3TQOA 5JUAA 5JVEA 1FNTc 2YWAA 4P6IC 2IXOA 2P0NA 1OKKA 2Q4FA 2NUTB 2XSEA 4BJ5A 4HFKB 3U2LA 3PHF2 1QVXA 4PJMA 3U0CA 5FCLA 2G3KA 3S28A 2J9UA 4N06A 3ABLC 2D4UA 1DOVA 1ZYRF 4K7BA 1K04A 1LS1A 1CGNA 3DKAA 5KYUB 1OQCA 3AOUA 3HLZA 4LERA 2J8WA 3QVZA 4PJLA 5E3AA 3UNGC 2YLGA 3I4UA 5COFA 5E3CA 2EPLX 4CS8A 3DE9A 4YL0A 5AGFA 4BEJA 2CNWD 2OEVA 4JZAA 4NCQA 3OEOA 1VOMA 3LLKA 4CIPA 4CJGA 2PFDA 1NBBA 4K0DA 1OKKD 2LFDA 1FFHA 4PJNA 1OCZC 3SXYA 4DBQA 1FMWA 3U8PA 2PX0A 4G7HF 4XPWA 1YYXA 1E2XA 4XLNF 2V3CC 3UGPA 4D4NA 3W4YA 2OU6A 2FFHA 2JPUA 1RJ9B 3NKEA 3NKDA 3NMKA 2BC5A 2BL2A 4Q4ZF 3B9QA 1CPQA 3AJMA 5A6BD 3Q7LA 3RQFA 1TFOB 3LLIA 5L0DA 2YRFA 1GGQA 4JJFA 3ZIBA 2XLOA 3W8IA 2R7QA 4OD4A 2R9RB 3G50A 2XL8A 3KL4A 3LJBA 3EFOB 3EJNA 3L1MA 2RSEB 4B6IA 2NUPB 3C63A 3M4BA 2Z15A 3N24A 2Y39A 2W4BA 2L7AA 4P9TA 1RKEB 256BA 1EI7A 4U5HA 4HEAJ 2PF4E 1UFBA 2BE5F 4KNVA 4MNDA 4YK5A 5D91A 1WN0A 5A6KA 1EQ1A 2YVKA 2FGYA 3VM6A 5TJ5E 4E0IA 5L3QA 2HSQA 1WGWA 4JTDB 2AVKA 1LIHA 5FZTA 1HW2A 4JVSA 2VH3A 1OCOC 1ST6A 1XZQA 4BJ1A 5A6AA 2JD3A 4JTCB 3MX3A 4L6RA 4RD9A 4CIHA 3RH3A 2F22A 1EA8A 4OINF 4U5BE 4KI2A 3X1OA 4WJ0A 1VLTA 3DAGA 2VASA 1KU2A 5JS5A 2IXPA 5D92A 4IGGA 3RVYA 5KYNA 5KYWB 1RMVA 2R7VA 1FR0A 2R25A 5KYYB 3HKKA 3WG7C 4LDKA 3K1IC 4AK9A 1WASA 1TFKB 2XM4A 2WZFA 2YL3A 5KYXB 3G4ZA 3ECSA 3NYLA 2PX3A 3V5XA 4DRHB 1ZHXA 5AC5A 4MTFA 1LS4A 3Q6MA 1BDJB 4NC3A 4AL0A 4QI2A 1CPRA 2LCHA 1LKXA 3GANA 3M4CA 3S0XA 2OKUA 2IYLD 2B0JA 4E7SA 4K1OA 1H9TA 2ETSA 3C8GB 3E9VA 4N6HA 3QTHA 1PD1A 1WTYA 2HMZA 4U5GA 2IXMA 3DD7A 1T01A 3DJUB 3HNJA 2WB7A 1Y4CA 4A2NB 3L8JA 3KMIA 2ZXPA 5L0CA 2R7WA 2XLWA 3FXHA 2R05A 3RYLA 4JKVA 4IAOA 3N2ZB 4MTGA 1ZVZA 3ZC4A 4KBLA 1OCRC 3E70C 2C03A 2CYDA 1TWCA 1BZ4A 1V74B 3ASOC 1G8XA 4MQ9F 4CSAC 1KNYA 2Q00A 5DS6A 2NUTA 1QSPA 3LS1A 1ORSC 2H7VC 1VMAA 3NYMA 5CI8A 3PMRA 5BQGA 1D1AA 3H2VA 3KYJA 2XLEA 3SXMA 1O87A 4U5EE 3MYFA 2Q9AA 4CSAA 4UDVA 2TMVP 4H54A 2L6FA 4DOZA 3GM3A 2XLMA 3FDQA 4OIRF 1G5ZA 2YHSA 2M4EA 1Z7Qc 2QUPA 4NTBA 1Q0GA 4O6NA 5KYUA 1RCPA 2OEXA 2YL0A 2CW0F 2J7PA 2O9XA 2L9JA 4JURI 1ZZPA 3TK0A 2YL7A 4PK4A 1V4AA 3FMSA 1AUEA 2H8AA 1XZPA 4EWCA 3U3FA 3AG3C 3U9MA 1N1CA 3MFNA 4DBRA 3FOPA 5L3VA 2Q9CA 1A7EA 4CDYA 4JCHA 1APCA 2OJED 1I4ZA 4G0HA 5E2QA 3L34A 3DXJF 3ITFA 3KPHA 2L6GA 2Y3HA 4JIOA 1FFTC 1RJ9A 5JT4A 3ZTZA 4XLPF 3NRHA 1HE9A 3SZRA 2LFFA 4BPMA 4EHPA 5COMA 3K6BA 4MVRA 4XWJA 3WHNA 2DGJA 2EPMX 4PJJA 2J7PD 4ZLCA 1YA7O 1D0ZA 4XEFA 3TD7A 3LEOA 1L3PA 2ZPAA 2A1DD 3EFOA 3MYIA 4PFOA 3W2VA 2DI3A 3TOMA 5B3IA 2NUPA 1KTMA 3EQLF 3B29A 3K1HA 3GODA 1RKEA 2A0UA 2Y69C 4DXWA 1ZHTA 4E17A 2XXAB 1NFOA 2EIKC 5T3WA 1Q0KA 2KYHA 2R02A 2CCYA 1CGME 2XM0A 1NSGB 1SYQA 2A68F 2HSBA 2YKZA 3I5PA 3O6XA 4P9FA 4C3EA 4CS7A 1QPUA 2WVOA 5JSLA 3EH1A 3N0TA 3R2PA 3ABKC 3OWTA 3SXZA 4OIOF 3DZAA 3NG1A 3TOLA 1OW8A 3VRCA 3ZWIA 2J46A 3F46A 5T3TA 4HE8D 1LVKA 4EBBA 2FAPB 3IQCA 2J45A 1HW1A 4CS9C 3K1IA 2B0HA 1IW7F 4W8KA 3QMKA 3QVYA 1SR2A 2P1AA 2E87A 1XWJA 1LE2A 3LNMB 2HUJA 3IHUA 1Z6AA 3BEHA 3O55A 5KYYA 1T9KA 5AC4A 1QKRA 2HJ3A 4MW8A 2Y3GA 3DJNB 4H4KC 2YL1A 2VCBA 1NG1A 3HNLA 2J9WA 3KYIA 3F47A 5KYXA 3U3BA 2JX0A 5JRAA 3DWWA 1JPNA 4J30B 2V26A 4O79A 1C02A 3JTLO 4I44A 1SZIA 3S84A 1MQVA 5EHHA 5EGYA 4JJGA 2HKVA 4EBKA 1LE4A 1TWHA 2DB4A 4MVOA 4DRJB 3AG4C 2W45A 2QY9A 1LI7A 3C8GA 4FESA 1M2VB 3ATPA 4IB4A 4BJ5C 1ZHZA 3SYNA 3HJCA 3Q6NA 2A0BA 1D0YA 4NTFA 2YLDA 3DM9B 3EHMA 4OIPF 4JEBA 1ORJA 4O6MA 1TQGA 3C8ZA 3EPVA 2IOQA 2KGOA 2KK1A 1QZXA 5B3SC 4LLEA 3EGDB 3ZSUA 4XEKA 4E18A 3RKOF 2XLDA 3DM5A 3B0VC 4MW3A 4DJ9A 4BEMJ 4YT8A 1Z63A 2HZ8A 3S9OA 1FAPB 1RKCA 2Q9BA 1JR8A 4CS8C 5F28E 2YZSA 4DVYP 3CAXA 3T6BA 3IPMO 1IZMA 3FAPB 3L0IA 3SXKA 3RF3A 4JC7A 1O5HA 2IM8A 3C8GD 4NY3A 1NU9C 3S90A 2LK4A 5KYWA 4M63A 2AP3A 5L0JA 3KH2A 2G62A 1T6QA 1OXBA 3C62A 4JRZA 3S29A 2HFIA 1E86A 3RW0A 1AEPA 1FMVA
chains in the Genus database with same CATH topology
2HMZA 1HMOA 2HMQA 3AGUA 4XPXA 1I4YA 2AWYA 2MHRA 4XQ1A 1A7EA 4XPWA 3AGTA 1I4ZA 3WHNA 1A7DA 4XPYA 2AVKA 2AWCA 1HMDA 3WAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMZ A;  1HMO A;  2HMQ A;  3AGU A;  4XPX A;  1I4Y A;  2AWY A;  2MHR A;  4XQ1 A;  1A7E A;  4XPW A;  3AGT A;  1I4Z A;  3WHN A;  1A7D A;  4XPY A;  2AVK A;  2AWC A;  1HMD A;  3WAQ A; 
#chains in the Genus database with same CATH topology
 1JPJ A;  1VYK A;  5DVW A;  3ASN C;  3G4X A;  2I15 A;  3IQT A;  3HTK C;  2GA0 A;  4XPX A;  3LUT B;  4BJT A;  4G7O F;  1Z5Z A;  4KNW A;  4G7Z F;  2KC3 A;  3HNI A;  4Z9I A;  1PCX A;  1V55 C;  2PNO A;  1YDI A;  3EGX B;  3WOD F;  4I1M A;  4ONS A;  3A9C A;  2NSF A;  3UMH A;  2EIN C;  3ZG1 A;  5DQT A;  1DOW A;  4DVZ A;  3SNH A;  4E0H A;  4F4B A;  3MLG A;  4OIQ F;  1MND A;  4DRI B;  1ZU5 A;  4CJO A;  2C04 A;  2YQY A;  3GWN A;  1A7D A;  2AU5 A;  1G4U S;  3Q7G A;  3TUL A;  2IXN A;  2KW3 C;  1JMW A;  2NG1 A;  3GM1 A;  2WL8 A;  2J0X A;  2ZXO A;  3U5S A;  1TWA A;  2OG2 A;  2Q3T A;  2QLA A;  1D1B A;  3JRT A;  1M6T A;  5A6J A;  2VC9 A;  4Z9J A;  2HV6 A;  5K0I A;  1PV3 A;  2UUI A;  3JSZ A;  3M1C B;  1NFN A;  5CI9 A;  5GPG B;  2OQM A;  3WAQ A;  3GEH A;  3JT1 A;  4U5D E;  1EKY A;  1HMO A;  1YZA A;  3H65 A;  4LDQ A;  4HFF B;  2L6H A;  4IAR A;  4MVU A;  5BQI A;  4AE4 B;  1YA9 A;  1BR4 A;  4U5C E;  1ZW3 A;  1H9G A;  1R5I D;  3U9J A;  4BJ6 C;  1YAU O;  1TWG A;  3ZTM A;  5BUO A;  4C7O B;  4ANJ A;  2XXA A;  3LS0 A;  3ZDL A;  4CDA A;  5B1B C;  2GAQ A;  2XS8 A;  3PCV A;  3DMD A;  4XQ1 A;  3S27 A;  3T9O A;  1TKN A;  3B0P A;  4Z9H A;  4J7T A;  1OR3 A;  3FVY A;  2EIJ C;  1OXK A;  4N6C A;  1E83 A;  2XL4 A;  3LNR A;  3DI5 A;  4KC9 A;  4MVZ A;  1VYI A;  3V7O A;  3QW1 A;  4XPY A;  1YZC A;  4CS9 A;  4QDL A;  4EBJ A;  2OJQ A;  2R7U A;  3DAF A;  3EG9 B;  4Q7C A;  1YJG A;  3RFY A;  1SF8 A;  1ZW2 A;  2QTV A;  1F1M A;  2CGE A;  1VB5 A;  2J9V A;  2AWC A;  3JSE O;  4PFP A;  4E7Z A;  1BR2 A;  2LD6 A;  3VAY A;  3M79 A;  1NZE A;  3NMJ A;  4O6Y A;  4WGY A;  4RBN A;  2GWW A;  1Z23 A;  2ICW G;  3GEE A;  3NYJ A;  4N4W A;  2W9Y A;  1W2W A;  5T1D B;  3RQG A;  3SP1 A;  1I4Y A;  1CGO A;  2HS5 A;  3L8I A;  1BBH A;  3PDM P;  3EZI A;  1J8Y F;  3UR3 C;  3ABM C;  3POV A;  3GEI A;  4JTA B;  2A6H F;  3X2Q C;  1VLS A;  3UGO A;  3ZQV A;  1ORY A;  4MVM A;  4WGZ A;  2R7O A;  3EH2 A;  1Z3I X;  1ZHW A;  5COG A;  3V5Y A;  2L81 A;  4G78 A;  4EUK B;  2R7R A;  3AGT A;  1OW7 A;  1YVI A;  4D4X A;  2ZXR A;  4YT2 A;  3KKB A;  2OOC A;  5JP7 A;  3IEE A;  2R03 A;  4NQF A;  2M64 A;  2UUH A;  1U89 A;  3GWL A;  4C3D A;  1M2V A;  3I5Q A;  1E85 A;  2WVN A;  3CSK A;  3K66 A;  1LPE A;  5EK0 A;  2KSF A;  3AQB A;  1VTM P;  2H7O A;  2P61 A;  4FAP B;  1E84 A;  1T6U A;  1Q0F A;  4ER9 A;  2LSE A;  2J9B A;  3EGD A;  2NSG A;  4I1O B;  3H2U A;  4O7G A;  4YT5 A;  4FX5 A;  1D1C A;  5DQZ A;  1WAT A;  1WWP A;  4MVQ A;  4YN0 B;  3OA1 A;  3VF0 A;  4CDV A;  5JLI A;  2YLI A;  3NDB B;  2AWY A;  3HNK A;  1YYJ A;  2LIG A;  2VCA A;  2D5R B;  2KNH A;  1V54 C;  3TJ5 A;  2A6E F;  3GOR A;  2R7T A;  4LDR A;  3LAY A;  5L0G A;  2PP4 A;  4WAB A;  1LM3 B;  1S7Z A;  2X51 A;  1YLM A;  5B1A C;  3US6 A;  4EIY A;  4IJJ A;  1H6G A;  2GDC A;  1K40 A;  1QLE C;  1GM5 A;  1HE1 A;  3VYW A;  4PAC A;  1Q0D A;  2XLV A;  2PBE A;  3AQC A;  4ULW A;  4BG0 A;  4IWB A;  1BR1 A;  1D0X A;  4R32 A;  1R4T A;  4MTO A;  1UG7 A;  4XTK A;  4CX9 A;  3CZ6 A;  2R7S A;  1FTS A;  3EZH A;  1HY5 A;  3JCU Q;  5DLJ A;  2GFH A;  4X0R A;  1MMD A;  1PD0 A;  1WOL A;  5L0H A;  4A4A A;  2NPU A;  3W8H A;  3EGX A;  1A7V A;  2Y3B A;  5IY5 C;  2DYS C;  1ZHY A;  1GQA A;  2H7B A;  3DE8 A;  4ULV A;  4J32 B;  1OCC C;  2EPK X;  2MWQ A;  2WZL A;  4NTA A;  3ZQY A;  3W2W A;  5DS4 A;  3J06 A;  2Y3D A;  3K33 A;  1C17 M;  4Q5S F;  3JRM O;  3ZVR A;  1MNE A;  4C3B A;  3IQ6 A;  4U9E A;  2XL6 A;  1JOG A;  1C03 A;  2EIL C;  2P7V A;  4YT4 A;  3FOO A;  4BJ6 A;  2X0C A;  4YWQ A;  5DS5 A;  2DYR C;  1OW6 A;  4OD5 A;  3EHN A;  5A69 A;  2HMQ A;  4AE4 A;  2G3V A;  1MMG A;  1S05 A;  3U2M A;  1GS9 A;  3V5Z A;  4W8P A;  4YL1 A;  4C7O A;  1JRA A;  4U9D A;  3B71 A;  3JZ0 A;  2ZD9 A;  1A41 A;  2LQG A;  4IAQ A;  1U6H A;  4U5F E;  5F5H A;  5HSW A;  1NLX A;  4GQH A;  3U8V A;  2RD9 A;  3IQ5 A;  4AL1 A;  1MMA A;  1ZU4 A;  2Q7R A;  1QQ3 A;  1M57 C;  1L7C A;  3B0U X;  4JCZ A;  4QI0 A;  3RQE A;  4GEH A;  1TR2 A;  3QW0 A;  1A0B A;  4JEA A;  1I5N A;  2WVQ A;  5CIV A;  3MBG A;  3UMI A;  3TJ6 A;  1VK5 A;  2J0W A;  2XLH A;  5HV9 A;  3EG9 A;  2HV7 A;  2MYS A;  1OR2 A;  2CDQ A;  2EIM C;  3O39 A;  2P6V A;  3K7D A;  1T6I A;  3T4R A;  4EKW A;  4MS2 A;  3C18 A;  2EPO A;  5F5F A;  1T5O A;  4XEV A;  4MVS A;  4JW1 A;  4AX2 A;  1H7I A;  4ZLD A;  1O3U A;  3AGU A;  3AG2 C;  4CBE A;  3LEV A;  3BRJ A;  1SMY F;  2KJG A;  2XS1 A;  1MMN A;  3T6J A;  2YEV A;  1M56 C;  5E33 A;  5A6B A;  1YAR O;  2QE9 A;  2MHR A;  3SEO A;  5L0I A;  3T6G B;  2R7X A;  4YJW A;  4GYT A;  4PR9 A;  2W4M A;  1U0B B;  3R7C A;  3C7J A;  3LES A;  1M2O A;  2I8B A;  4YL3 A;  3RIP A;  5BQH A;  1JAF A;  3CEX A;  1J8M F;  3JYH A;  4FWV A;  4IRU A;  3NMI A;  2HJM A;  2XRH A;  2EPN A;  1G4W R;  2ASR A;  3FAJ A;  3FHD A;  2OCC C;  3CQZ A;  2LP4 A;  5L0F A;  1Q0M A;  3AG1 C;  2A69 F;  1RXQ A;  2KQ9 A;  1B68 A;  4I3M A;  4J7Y A;  3A11 A;  4LAC B;  1HMD A;  2VB6 A;  3UMK A;  3JYY A;  1LI5 A;  4JE9 A;  2IBF A;  4RDA A;  3O10 A;  1NU7 D;  3RVZ A;  4LLC A;  2VCC A;  3GM2 A;  3M15 A;  1AVO B;  1Y6D A;  2WZG A;  2ZXW C;  2CNW A;  2QNL A;  1K05 A;  3QZC A;  3TQO A;  5JUA A;  5JVE A;  1FNT c;  2YWA A;  4P6I C;  2IXO A;  2P0N A;  1OKK A;  2Q4F A;  2NUT B;  2XSE A;  4BJ5 A;  4HFK B;  3U2L A;  3PHF 2;  1QVX A;  4PJM A;  3U0C A;  5FCL A;  2G3K A;  3S28 A;  2J9U A;  4N06 A;  3ABL C;  2D4U A;  1DOV A;  1ZYR F;  4K7B A;  1K04 A;  1LS1 A;  1CGN A;  3DKA A;  5KYU B;  1OQC A;  3AOU A;  3HLZ A;  4LER A;  2J8W A;  3QVZ A;  4PJL A;  5E3A A;  3UNG C;  2YLG A;  3I4U A;  5COF A;  5E3C A;  2EPL X;  4CS8 A;  3DE9 A;  4YL0 A;  5AGF A;  4BEJ A;  2CNW D;  2OEV A;  4JZA A;  4NCQ A;  3OEO A;  1VOM A;  3LLK A;  4CIP A;  4CJG A;  2PFD A;  1NBB A;  4K0D A;  1OKK D;  2LFD A;  1FFH A;  4PJN A;  1OCZ C;  3SXY A;  4DBQ A;  1FMW A;  3U8P A;  2PX0 A;  4G7H F;  4XPW A;  1YYX A;  1E2X A;  4XLN F;  2V3C C;  3UGP A;  4D4N A;  3W4Y A;  2OU6 A;  2FFH A;  2JPU A;  1RJ9 B;  3NKE A;  3NKD A;  3NMK A;  2BC5 A;  2BL2 A;  4Q4Z F;  3B9Q A;  1CPQ A;  3AJM A;  5A6B D;  3Q7L A;  3RQF A;  1TFO B;  3LLI A;  5L0D A;  2YRF A;  1GGQ A;  4JJF A;  3ZIB A;  2XLO A;  3W8I A;  2R7Q A;  4OD4 A;  2R9R B;  3G50 A;  2XL8 A;  3KL4 A;  3LJB A;  3EFO B;  3EJN A;  3L1M A;  2RSE B;  4B6I A;  2NUP B;  3C63 A;  3M4B A;  2Z15 A;  3N24 A;  2Y39 A;  2W4B A;  2L7A A;  4P9T A;  1RKE B;  256B A;  1EI7 A;  4U5H A;  4HEA J;  2PF4 E;  1UFB A;  2BE5 F;  4KNV A;  4MND A;  4YK5 A;  5D91 A;  1WN0 A;  5A6K A;  1EQ1 A;  2YVK A;  2FGY A;  3VM6 A;  5TJ5 E;  4E0I A;  5L3Q A;  2HSQ A;  1WGW A;  4JTD B;  2AVK A;  1LIH A;  5FZT A;  1HW2 A;  4JVS A;  2VH3 A;  1OCO C;  1ST6 A;  1XZQ A;  4BJ1 A;  5A6A A;  2JD3 A;  4JTC B;  3MX3 A;  4L6R A;  4RD9 A;  4CIH A;  3RH3 A;  2F22 A;  1EA8 A;  4OIN F;  4U5B E;  4KI2 A;  3X1O A;  4WJ0 A;  1VLT A;  3DAG A;  2VAS A;  1KU2 A;  5JS5 A;  2IXP A;  5D92 A;  4IGG A;  3RVY A;  5KYN A;  5KYW B;  1RMV A;  2R7V A;  1FR0 A;  2R25 A;  5KYY B;  3HKK A;  3WG7 C;  4LDK A;  3K1I C;  4AK9 A;  1WAS A;  1TFK B;  2XM4 A;  2WZF A;  2YL3 A;  5KYX B;  3G4Z A;  3ECS A;  3NYL A;  2PX3 A;  3V5X A;  4DRH B;  1ZHX A;  5AC5 A;  4MTF A;  1LS4 A;  3Q6M A;  1BDJ B;  4NC3 A;  4AL0 A;  4QI2 A;  1CPR A;  2LCH A;  1LKX A;  3GAN A;  3M4C A;  3S0X A;  2OKU A;  2IYL D;  2B0J A;  4E7S A;  4K1O A;  1H9T A;  2ETS A;  3C8G B;  3E9V A;  4N6H A;  3QTH A;  1PD1 A;  1WTY A;  2HMZ A;  4U5G A;  2IXM A;  3DD7 A;  1T01 A;  3DJU B;  3HNJ A;  2WB7 A;  1Y4C A;  4A2N B;  3L8J A;  3KMI A;  2ZXP A;  5L0C A;  2R7W A;  2XLW A;  3FXH A;  2R05 A;  3RYL A;  4JKV A;  4IAO A;  3N2Z B;  4MTG A;  1ZVZ A;  3ZC4 A;  4KBL A;  1OCR C;  3E70 C;  2C03 A;  2CYD A;  1TWC A;  1BZ4 A;  1V74 B;  3ASO C;  1G8X A;  4MQ9 F;  4CSA C;  1KNY A;  2Q00 A;  5DS6 A;  2NUT A;  1QSP A;  3LS1 A;  1ORS C;  2H7V C;  1VMA A;  3NYM A;  5CI8 A;  3PMR A;  5BQG A;  1D1A A;  3H2V A;  3KYJ A;  2XLE A;  3SXM A;  1O87 A;  4U5E E;  3MYF A;  2Q9A A;  4CSA A;  4UDV A;  2TMV P;  4H54 A;  2L6F A;  4DOZ A;  3GM3 A;  2XLM A;  3FDQ A;  4OIR F;  1G5Z A;  2YHS A;  2M4E A;  1Z7Q c;  2QUP A;  4NTB A;  1Q0G A;  4O6N A;  5KYU A;  1RCP A;  2OEX A;  2YL0 A;  2CW0 F;  2J7P A;  2O9X A;  2L9J A;  4JUR I;  1ZZP A;  3TK0 A;  2YL7 A;  4PK4 A;  1V4A A;  3FMS A;  1AUE A;  2H8A A;  1XZP A;  4EWC A;  3U3F A;  3AG3 C;  3U9M A;  1N1C A;  3MFN A;  4DBR A;  3FOP A;  5L3V A;  2Q9C A;  1A7E A;  4CDY A;  4JCH A;  1APC A;  2OJE D;  1I4Z A;  4G0H A;  5E2Q A;  3L34 A;  3DXJ F;  3ITF A;  3KPH A;  2L6G A;  2Y3H A;  4JIO A;  1FFT C;  1RJ9 A;  5JT4 A;  3ZTZ A;  4XLP F;  3NRH A;  1HE9 A;  3SZR A;  2LFF A;  4BPM A;  4EHP A;  5COM A;  3K6B A;  4MVR A;  4XWJ A;  3WHN A;  2DGJ A;  2EPM X;  4PJJ A;  2J7P D;  4ZLC A;  1YA7 O;  1D0Z A;  4XEF A;  3TD7 A;  3LEO A;  1L3P A;  2ZPA A;  2A1D D;  3EFO A;  3MYI A;  4PFO A;  3W2V A;  2DI3 A;  3TOM A;  5B3I A;  2NUP A;  1KTM A;  3EQL F;  3B29 A;  3K1H A;  3GOD A;  1RKE A;  2A0U A;  2Y69 C;  4DXW A;  1ZHT A;  4E17 A;  2XXA B;  1NFO A;  2EIK C;  5T3W A;  1Q0K A;  2KYH A;  2R02 A;  2CCY A;  1CGM E;  2XM0 A;  1NSG B;  1SYQ A;  2A68 F;  2HSB A;  2YKZ A;  3I5P A;  3O6X A;  4P9F A;  4C3E A;  4CS7 A;  1QPU A;  2WVO A;  5JSL A;  3EH1 A;  3N0T A;  3R2P A;  3ABK C;  3OWT A;  3SXZ A;  4OIO F;  3DZA A;  3NG1 A;  3TOL A;  1OW8 A;  3VRC A;  3ZWI A;  2J46 A;  3F46 A;  5T3T A;  4HE8 D;  1LVK A;  4EBB A;  2FAP B;  3IQC A;  2J45 A;  1HW1 A;  4CS9 C;  3K1I A;  2B0H A;  1IW7 F;  4W8K A;  3QMK A;  3QVY A;  1SR2 A;  2P1A A;  2E87 A;  1XWJ A;  1LE2 A;  3LNM B;  2HUJ A;  3IHU A;  1Z6A A;  3BEH A;  3O55 A;  5KYY A;  1T9K A;  5AC4 A;  1QKR A;  2HJ3 A;  4MW8 A;  2Y3G A;  3DJN B;  4H4K C;  2YL1 A;  2VCB A;  1NG1 A;  3HNL A;  2J9W A;  3KYI A;  3F47 A;  5KYX A;  3U3B A;  2JX0 A;  5JRA A;  3DWW A;  1JPN A;  4J30 B;  2V26 A;  4O79 A;  1C02 A;  3JTL O;  4I44 A;  1SZI A;  3S84 A;  1MQV A;  5EHH A;  5EGY A;  4JJG A;  2HKV A;  4EBK A;  1LE4 A;  1TWH A;  2DB4 A;  4MVO A;  4DRJ B;  3AG4 C;  2W45 A;  2QY9 A;  1LI7 A;  3C8G A;  4FES A;  1M2V B;  3ATP A;  4IB4 A;  4BJ5 C;  1ZHZ A;  3SYN A;  3HJC A;  3Q6N A;  2A0B A;  1D0Y A;  4NTF A;  2YLD A;  3DM9 B;  3EHM A;  4OIP F;  4JEB A;  1ORJ A;  4O6M A;  1TQG A;  3C8Z A;  3EPV A;  2IOQ A;  2KGO A;  2KK1 A;  1QZX A;  5B3S C;  4LLE A;  3EGD B;  3ZSU A;  4XEK A;  4E18 A;  3RKO F;  2XLD A;  3DM5 A;  3B0V C;  4MW3 A;  4DJ9 A;  4BEM J;  4YT8 A;  1Z63 A;  2HZ8 A;  3S9O A;  1FAP B;  1RKC A;  2Q9B A;  1JR8 A;  4CS8 C;  5F28 E;  2YZS A;  4DVY P;  3CAX A;  3T6B A;  3IPM O;  1IZM A;  3FAP B;  3L0I A;  3SXK A;  3RF3 A;  4JC7 A;  1O5H A;  2IM8 A;  3C8G D;  4NY3 A;  1NU9 C;  3S90 A;  2LK4 A;  5KYW A;  4M63 A;  2AP3 A;  5L0J A;  3KH2 A;  2G62 A;  1T6Q A;  1OXB A;  3C62 A;  4JRZ A;  3S29 A;  2HFI A;  1E86 A;  3RW0 A;  1AEP A;  1FMV A; 
#chains in the Genus database with same CATH homology
 2HMZ A;  1HMO A;  2HMQ A;  3AGU A;  4XPX A;  1I4Y A;  2AWY A;  2MHR A;  4XQ1 A;  1A7E A;  4XPW A;  3AGT A;  1I4Z A;  3WHN A;  1A7D A;  4XPY A;  2AVK A;  2AWC A;  1HMD A;  3WAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...