1I4ZA

The crystal structure of phascolopsis gouldii l98y methemerythrin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
113
structure length
113
Chain Sequence
GFPIPDPYVWDPSFRTFYSIIDDEHKTLFNGIFHLAIDDNADNLGELRRCTGKHFLNEQVLMQASQYQFYDEHKKEHETFIHALDNWKGDVKWAKSWYVNHIKTIDFKYKGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of Phascolopsis gouldii wild type and L98Y methemerythrins: structural and functional alterations of the O2 binding pocket.
pubmed doi rcsb
source organism Phascolopsis gouldii
molecule tags Oxygen storage/transport
molecule keywords METHEMERYTHRIN
total genus 45
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2001-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1i4zA00
3WAQA 3AGUA 1HMOA 1A7DA 2AWCA 4XPYA 1I4YA 2HMQA 4XQ1A 1I4ZA 1HMDA 4XPXA 2AWYA 2MHRA 3AGTA 3WHNA 4XPWA 2AVKA 1A7EA 2HMZA
chains in the Genus database with same CATH superfamily
5T3WA 2XS1A 4CIPA 1ZVZA 1JOGA 1S05A 2Y69C 3SXYA 3ZDLA 5KYWA 3UR3C 1FAPB 3SNHA 4WABA 2YL7A 4DXWA 3J06A 1PD0A 4G7ZF 2NUPA 2H7BA 4O6NA 3R2PA 1C03A 5JRAA 4A4AA 2IM8A 3RYLA 1Q0GA 2Q00A 1UFBA 4NTAA 3TJ5A 1WGWA 1TWGA 5L0HA 3ZG1A 1BDJB 1J8MF 1A0BA 5JP7A 3AQBA 4PJNA 2JD3A 1M56C 3T6GB 2PX0A 2HJ3A 1H6GA 2YEVA 4IGGA 4CS8C 4YT4A 1UG7A 2KSFA 2Q9BA 4YL3A 1L3PA 1RMVA 2A0UA 1IZMA 1U6HA 2Q4FA 1WN0A 1VLSA 4K1OA 1G4WR 4OIQF 1IW7F 3LUTB 4N06A 3LAYA 2HKVA 1GQAA 2YRFA 4MW3A 4N6HA 3JRMO 3RF3A 4C3BA 4G7OF 1PD1A 3CSKA 1VTMP 3DI5A 1Z6AA 3IQTA 5B1BC 4Q7CA 2Y39A 4JKVA 2MYSA 4U9EA 2P6VA 3TOMA 4DBRA 2R7OA 3M4CA 2LD6A 2YQYA 2Z15A 5KYYB 1YAUO 2IXMA 1BR1A 3C8GB 4MS2A 2W45A 4WGZA 4JCZA 5B1AC 3FVYA 2ETSA 1D1CA 2ZD9A 2FAPB 1O3UA 2GAQA 5IY5C 4JTCB 3HLZA 5HV9A 1YDIA 4FWVA 2XLWA 3H2UA 4W8PA 3C8GD 1FR0A 2GA0A 2I15A 3B0VC 2YZSA 5JT4A 2LK4A 1WOLA 3NYMA 2V26A 1EQ1A 2PBEA 4XPWA 1RKEB 2WVQA 4PJMA 2R25A 4EBJA 4ZLDA 2F22A 4M63A 1K04A 2CCYA 1ZW2A 3EZIA 4W8KA 2YHSA 4FX5A 1CPRA 3VAYA 5EHHA 3GEEA 5L0DA 3NKDA 2R7WA 1T6UA 3LEVA 3AG2C 2IBFA 2XS8A 4YWQA 5F5HA 3VF0A 4MVRA 3S90A 1G4US 2DYSC 1YYJA 4BJ6A 1D0YA 2ZXRA 3EH1A 2D5RB 1Z5ZA 3A9CA 1D1AA 3U3FA 4ZLCA 3QZCA 2NG1A 3IQ5A 3ZTMA 4AE4A 4KNVA 2HMZA 2Y3DA 1YLMA 4A2NB 5BQHA 1A7VA 2I8BA 5CI9A 2UUHA 4J7YA 3ZSUA 2EPMX 5K0IA 1O87A 2OCCC 4ER9A 2YVKA 2A68F 4BJ6C 2HUJA 2WL8A 2YLGA 1TFOB 1LKXA 4U5GA 5E33A 256BA 1OXBA 1M2VB 4GEHA 2V3CC 3K1IC 4OIOF 2C03A 4IWBA 3I5QA 1HW2A 3EHNA 2X51A 2WVOA 1H9TA 3NG1A 3VYWA 3B0UX 3DM9B 3AG3C 3HJCA 5JS5A 1FFTC 1Z3IX 1E85A 3BEHA 1LM3B 2KNHA 3FOOA 3O55A 4QI0A 4BEJA 1T6QA 1BR4A 3B71A 2R7SA 2W4MA 3MLGA 2EINC 1SMYF 3QMKA 1GS9A 3EFOB 3ZQYA 3JYHA 4MVZA 4E7ZA 4MW8A 2ZXWC 2L9JA 3EPVA 3F46A 3US6A 1M2VA 1LPEA 1VB5A 2R9RB 2FGYA 3DAGA 4NC3A 3K7DA 1TFKB 1LE2A 2XL6A 3JZ0A 3L1MA 2WVNA 3ZC4A 3HKKA 2J7PD 5E2QA 3DAFA 4GYTA 1T01A 2OJED 1YARO 3A11A 3B9QA 3DJNB 4U5BE 3Q7LA 4QDLA 3TD7A 2YL1A 2P61A 1TWAA 1OXKA 4NCQA 2CNWA 1WWPA 1PV3A 3EJNA 3U8VA 4L6RA 4MTFA 2NPUA 2GFHA 3WODF 2E87A 1RXQA 2WZGA 1MMGA 2IOQA 1FTSA 3T6JA 1VYIA 1KTMA 1T9KA 3W8HA 4G7HF 2DYRC 3L8JA 2EIJC 2KGOA 3EGDB 1Q0MA 2EPNA 3U9JA 3LLKA 3N0TA 4BPMA 2QE9A 3NYJA 1JR8A 4IJJA 3KYJA 4XTKA 5JUAA 1NU7D 1OCOC 3LESA 1ZU5A 2J45A 2VCBA 2AWCA 3AG4C 3EQLF 3RQEA 3DD7A 3RVYA 1YZCA 5BUOA 2R05A 3ASNC 2XM4A 3SXKA 2P0NA 2QNLA 1M2OA 1W2WA 4PR9A 3EFOA 3V7OA 3S27A 1VMAA 1KU2A 3FMSA 3M1CB 2WZFA 2YLIA 4Q4ZF 1RJ9A 1GGQA 5JLIA 3EZHA 2CDQA 3NRHA 5COFA 1AVOB 3RKOF 5KYUB 3POVA 3BRJA 1CGME 4KC9A 4PK4A 5KYXB 1A41A 4XEVA 2W4BA 3UMHA 3H65A 5GPGB 4BJ5A 3AG1C 4DRJB 2HZ8A 2CGEA 4F4BA 4JJGA 1LI5A 1O5HA 4EBKA 2J9UA 2XLHA 3EG9A 4JEAA 3W2VA 3LS1A 4I1MA 3ZWIA 3FXHA 1L7CA 1YJGA 4JZAA 3MYFA 2HFIA 2LFDA 4JC7A 2DI3A 4O6MA 3U2LA 4PFOA 2OEVA 1ZHXA 4YK5A 4ANJA 1OCCC 4MVSA 1OKKA 1GM5A 1YVIA 4XPYA 1XZQA 1ZHYA 3KKBA 4H54A 4MVUA 1ORYA 2EPLX 2QTVA 1ST6A 3O6XA 4O6YA 1D0XA 5F28E 4C3DA 4CIHA 2AU5A 1NLXA 3F47A 1ZYRF 2OOCA 4IAQA 5D91A 3ATPA 1EKYA 2HS5A 5B3SC 3OWTA 3O10A 3C18A 3RIPA 4IB4A 3T6BA 2NSGA 3G4XA 3NKEA 3S0XA 2Y3GA 3NMJA 4G78A 3MFNA 5A6KA 4CBEA 4XLNF 4B6IA 1QVXA 1SF8A 5L0FA 2HSBA 3LEOA 4RD9A 3O39A 3QW1A 5DLJA 3HNLA 3HNJA 3W2WA 3MYIA 3ZVRA 4DBQA 2RD9A 3DE8A 1BBHA 1DOVA 5AGFA 4I44A 3DXJF 4OINF 2Q9CA 5L0GA 3ZQVA 3RVZA 5DVWA 5TJ5E 4DJ9A 1HE9A 3K1HA 1D1BA 4OD4A 3DZAA 3ZIBA 1C17M 3KL4A 3PDMP 2G3VA 1APCA 2R7QA 1K40A 4J30B 5BQIA 4YT2A 1ZHZA 5DQTA 2LP4A 3TJ6A 4XEKA 4BJ1A 4CJGA 1CGOA 2J9WA 2Q7RA 3QTHA 4IAOA 4PJLA 1TQGA 2H8AA 3HNIA 4WJ0A 1BZ4A 2A6EF 5COGA 4CS9A 4BJ5C 3S84A 2VH3A 4YN0B 4I3MA 1JRAA 3QVYA 3JRTA 3PMRA 2NUPB 1FNTc 4LERA 4EHPA 3B29A 1TWHA 5KYYA 1JPNA 4CSAA 1YA7O 4FESA 4C7OB 1VK5A 2A6HF 4JW1A 4JRZA 3FAJA 4U9DA 5E3CA 4EUKB 1EI7A 2RSEB 3JT1A 4ONSA 3KYIA 3I5PA 3HTKC 3RW0A 3FOPA 1OW8A 2M64A 4Z9IA 5L3VA 2EIMC 2X0CA 1YA9A 3X1OA 1OW6A 2YL0A 1FMVA 4OIRF 1H9GA 2VC9A 1HW1A 2KW3C 1V4AA 3L34A 3U3BA 1FFHA 3KMIA 2P1AA 4JURI 3M79A 2C04A 3C8ZA 3NDBB 2CW0F 3U9MA 1LE4A 2XL8A 2XLMA 2P7VA 3MBGA 1Z63A 1YYXA 1J8YF 2LFFA 4J7TA 1JMWA 5L3QA 2VASA 3R7CA 4FAPB 2KK1A 1YZAA 4U5FE 2KYHA 2OJQA 1AUEA 2ZXPA 3AGUA 4YJWA 3W8IA 5DS5A 2OKUA 3RQFA 3CAXA 3WHNA 3OEOA 4CDVA 3UMKA 1OR2A 4AL0A 1G5ZA 4CDAA 4IARA 2R02A 4D4NA 3U0CA 2PNOA 5L0CA 3FDQA 3Q6MA 4PFPA 5KYWB 3SZRA 4XLPF 1I5NA 1TR2A 4C3EA 1MNEA 4C7OA 5F5FA 3EG9B 3TK0A 4Q5SF 1OKKD 4DRHB 3DJUB 4XWJA 3T9OA 1OCZC 4OIPF 3AOUA 1V55C 2KQ9A 2Y3HA 2QY9A 3DKAA 2GWWA 3JSZA 3FHDA 5T3TA 3X2QC 1F1MA 3EH2A 4P9TA 3GEHA 3GWNA 3SXMA 3V5ZA 4JJFA 4JCHA 4MVQA 3GORA 3TOLA 2XSEA 3GM2A 4BG0A 2WZLA 4YL1A 2JX0A 2XLDA 2L6FA 4LDQA 3WG7C 1ORJA 2JPUA 3TULA 5BQGA 2FFHA 5B3IA 4AL1A 2PF4E 3DE9A 5A6BD 2G62A 3V5XA 3ABKC 4NY3A 3LNRA 1RCPA 1BR2A 1HY5A 3IHUA 3IQ6A 3JCUQ 2HMQA 3K6BA 3SEOA 4I1OB 2AWYA 2ZPAA 2GDCA 1H7IA 1OQCA 4E0HA 4P6IC 1ZW3A 1LS4A 1MMNA 2WB7A 2O9XA 3DMDA 1A7DA 2NUTB 1T5OA 2R03A 2ASRA 4U5CE 4YL0A 1E84A 4J32B 1S7ZA 1QLEC 1ZHWA 4LACB 2BL2A 4ULWA 4H4KC 3S29A 2A69F 5A6JA 4ULVA 3U5SA 3JTLO 4KI2A 4GQHA 2TMVP 2XLOA 1ORSC 2LQGA 1XZPA 4E7SA 2OG2A 3W4YA 5JVEA 4UDVA 4DOZA 3K33A 1ZHTA 4QI2A 1Q0KA 2IYLD 2OEXA 3H2VA 2M4EA 2J9BA 1ZZPA 2PX3A 2NSFA 2CNWD 4RBNA 1MQVA 2LCHA 1OCRC 2KJGA 3DWWA 4XEFA 3IEEA 4K0DA 1LVKA 3JYYA 4PACA 3AJMA 5D92A 3EGDA 3WAQA 1M6TA 3KPHA 2QUPA 4CJOA 5A6BA 3NMIA 2BE5F 3C63A 1XWJA 2LSEA 3LNMB 5E3AA 2J0XA 2PP4A 1JPJA 1OR3A 4CX9A 1MMDA 3Q7GA 4BJTA 4NQFA 2A1DD 1E2XA 1WATA 4HEAJ 4R32A 1WTYA 1WASA 4P9FA 3ITFA 4NTFA 3TQOA 4G0HA 3VM6A 4EBBA 1RKCA 2HV7A 1LIHA 2W9YA 2HSQA 4CS9C 4JTAB 2YWAA 1Y6DA 3UGOA 1HE1A 1V54C 1TWCA 1Q0DA 4JTDB 3ECSA 4XQ1A 2J8WA 3E70C 4BEMJ 2MHRA 3JSEO 4LLCA 1SZIA 5COMA 1KNYA 1DOWA 4E18A 1JAFA 2UUIA 3B0PA 3U8PA 2Y3BA 4EWCA 2VB6A 2D4UA 4IRUA 4PJJA 4CS7A 1AEPA 1Z7Qc 1D0ZA 2YKZA 3M4BA 4AX2A 4DVZA 5L0IA 4CS8A 3ASOC 2OQMA 3G50A 2H7VC 3L8IA 3GEIA 1Y4CA 2Q9AA 2BC5A 3ABMC 3E9VA 1CPQA 1LI7A 2R7VA 2KC3A 4KBLA 1QSPA 4HE8D 4JIOA 1C02A 3U2MA 4AK9A 5CIVA 2R7RA 3NMKA 4Z9JA 4LDKA 5HSWA 4MVOA 1NZEA 4JVSA 4N6CA 2NUTA 1NSGB 3KH2A 1VLTA 2J0WA 1NU9C 2L6HA 2OU6A 2B0JA 4MNDA 4DVYP 3PHF2 2R7UA 2R7XA 1MNDA 3CEXA 2J9VA 4KNWA 1ZU4A 3LLIA 5FZTA 1E86A 1N1CA 1I4YA 3V5YA 3UNGC 2ICWG 3QVZA 4OD5A 1QZXA 4HFKB 4N4WA 1R5ID 3GODA 2EPKX 2QLAA 3EGXA 1NFOA 4LDRA 3AQCA 2L7AA 1OW7A 3L0IA 2L6GA 1EA8A 4NTBA 1R4TA 2ZXOA 4U5HA 4Z9HA 5AC4A 2H7OA 3C7JA 2EIKC 2XXAB 1A7EA 1Q0FA 3K1IA 4E0IA 1HMOA 2MWQA 2CYDA 2HV6A 3PCVA 3IQCA 1G8XA 2B0HA 5CI8A 5EK0A 1RJ9B 2XRHA 3UGPA 3C8GA 2VCAA 4MVMA 4YT5A 3RQGA 4U5DE 2XLEA 4EIYA 2XXAA 1QKRA 4RDAA 3N2ZB 3GWLA 3Q6NA 5EGYA 3N24A 1M57C 3RFYA 4MTOA 5DQZA 1NFNA 2HJMA 3MX3A 1NG1A 1SYQA 3EGXB 3SP1A 3IPMO 1U0BB 5L0JA 2IXOA 3GM1A 2J46A 1QPUA 3GM3A 5DS6A 3OA1A 4JEBA 1QQ3A 5KYUA 1RKEA 1TKNA 2XM0A 4WGYA 5AC5A 4D4XA 4MQ9F 1NBBA 1CGNA 3S9OA 1T6IA 1U89A 4XPXA 1LS1A 2DB4A 1SR2A 3CQZA 1VYKA 5A6AA 2L81A 4YT8A 3DM5A 5FCLA 3HNKA 2EILC 2J7PA 3I4UA 2EPOA 4U5EE 4AE4B 2IXPA 2VCCA 1HMDA 4O79A 5KYXA 3GANA 4LLEA 2G3KA 2AVKA 3C62A 3FAPB 3UMIA 3ABLC 3T4RA 3M15A 2XLVA 3LS0A 3G4ZA 2LIGA 1B68A 2XL4A 3NYLA 3SXZA 2AP3A 3AGTA 4K7BA 5JSLA 2IXNA 1K05A 3S28A 2YLDA 1Z23A 3SYNA 4DRIB 4JE9A 4E17A 3CZ6A 1E83A 4EKWA 4MTGA 3VRCA 2Q3TA 3K66A 2DGJA 5DS4A 1PCXA 2YL3A 3EHMA 3LJBA 4HFFB 4CSAC 4O7GA 1VOMA 2A0BA 1V74B 2R7TA 3RH3A 4CDYA 2PFDA 5T1DB 1MMAA 4X0RA 5A69A 3ZTZA 1I4ZA 1FMWA 3QW0A 5KYNA
chains in the Genus database with same CATH topology
3WAQA 3AGUA 1HMOA 1A7DA 2AWCA 4XPYA 1I4YA 2HMQA 4XQ1A 1I4ZA 1HMDA 4XPXA 2AWYA 2MHRA 3AGTA 3WHNA 4XPWA 2AVKA 1A7EA 2HMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAQ A;  3AGU A;  1HMO A;  1A7D A;  2AWC A;  4XPY A;  1I4Y A;  2HMQ A;  4XQ1 A;  1I4Z A;  1HMD A;  4XPX A;  2AWY A;  2MHR A;  3AGT A;  3WHN A;  4XPW A;  2AVK A;  1A7E A;  2HMZ A; 
#chains in the Genus database with same CATH topology
 5T3W A;  2XS1 A;  4CIP A;  1ZVZ A;  1JOG A;  1S05 A;  2Y69 C;  3SXY A;  3ZDL A;  5KYW A;  3UR3 C;  1FAP B;  3SNH A;  4WAB A;  2YL7 A;  4DXW A;  3J06 A;  1PD0 A;  4G7Z F;  2NUP A;  2H7B A;  4O6N A;  3R2P A;  1C03 A;  5JRA A;  4A4A A;  2IM8 A;  3RYL A;  1Q0G A;  2Q00 A;  1UFB A;  4NTA A;  3TJ5 A;  1WGW A;  1TWG A;  5L0H A;  3ZG1 A;  1BDJ B;  1J8M F;  1A0B A;  5JP7 A;  3AQB A;  4PJN A;  2JD3 A;  1M56 C;  3T6G B;  2PX0 A;  2HJ3 A;  1H6G A;  2YEV A;  4IGG A;  4CS8 C;  4YT4 A;  1UG7 A;  2KSF A;  2Q9B A;  4YL3 A;  1L3P A;  1RMV A;  2A0U A;  1IZM A;  1U6H A;  2Q4F A;  1WN0 A;  1VLS A;  4K1O A;  1G4W R;  4OIQ F;  1IW7 F;  3LUT B;  4N06 A;  3LAY A;  2HKV A;  1GQA A;  2YRF A;  4MW3 A;  4N6H A;  3JRM O;  3RF3 A;  4C3B A;  4G7O F;  1PD1 A;  3CSK A;  1VTM P;  3DI5 A;  1Z6A A;  3IQT A;  5B1B C;  4Q7C A;  2Y39 A;  4JKV A;  2MYS A;  4U9E A;  2P6V A;  3TOM A;  4DBR A;  2R7O A;  3M4C A;  2LD6 A;  2YQY A;  2Z15 A;  5KYY B;  1YAU O;  2IXM A;  1BR1 A;  3C8G B;  4MS2 A;  2W45 A;  4WGZ A;  4JCZ A;  5B1A C;  3FVY A;  2ETS A;  1D1C A;  2ZD9 A;  2FAP B;  1O3U A;  2GAQ A;  5IY5 C;  4JTC B;  3HLZ A;  5HV9 A;  1YDI A;  4FWV A;  2XLW A;  3H2U A;  4W8P A;  3C8G D;  1FR0 A;  2GA0 A;  2I15 A;  3B0V C;  2YZS A;  5JT4 A;  2LK4 A;  1WOL A;  3NYM A;  2V26 A;  1EQ1 A;  2PBE A;  4XPW A;  1RKE B;  2WVQ A;  4PJM A;  2R25 A;  4EBJ A;  4ZLD A;  2F22 A;  4M63 A;  1K04 A;  2CCY A;  1ZW2 A;  3EZI A;  4W8K A;  2YHS A;  4FX5 A;  1CPR A;  3VAY A;  5EHH A;  3GEE A;  5L0D A;  3NKD A;  2R7W A;  1T6U A;  3LEV A;  3AG2 C;  2IBF A;  2XS8 A;  4YWQ A;  5F5H A;  3VF0 A;  4MVR A;  3S90 A;  1G4U S;  2DYS C;  1YYJ A;  4BJ6 A;  1D0Y A;  2ZXR A;  3EH1 A;  2D5R B;  1Z5Z A;  3A9C A;  1D1A A;  3U3F A;  4ZLC A;  3QZC A;  2NG1 A;  3IQ5 A;  3ZTM A;  4AE4 A;  4KNV A;  2HMZ A;  2Y3D A;  1YLM A;  4A2N B;  5BQH A;  1A7V A;  2I8B A;  5CI9 A;  2UUH A;  4J7Y A;  3ZSU A;  2EPM X;  5K0I A;  1O87 A;  2OCC C;  4ER9 A;  2YVK A;  2A68 F;  4BJ6 C;  2HUJ A;  2WL8 A;  2YLG A;  1TFO B;  1LKX A;  4U5G A;  5E33 A;  256B A;  1OXB A;  1M2V B;  4GEH A;  2V3C C;  3K1I C;  4OIO F;  2C03 A;  4IWB A;  3I5Q A;  1HW2 A;  3EHN A;  2X51 A;  2WVO A;  1H9T A;  3NG1 A;  3VYW A;  3B0U X;  3DM9 B;  3AG3 C;  3HJC A;  5JS5 A;  1FFT C;  1Z3I X;  1E85 A;  3BEH A;  1LM3 B;  2KNH A;  3FOO A;  3O55 A;  4QI0 A;  4BEJ A;  1T6Q A;  1BR4 A;  3B71 A;  2R7S A;  2W4M A;  3MLG A;  2EIN C;  1SMY F;  3QMK A;  1GS9 A;  3EFO B;  3ZQY A;  3JYH A;  4MVZ A;  4E7Z A;  4MW8 A;  2ZXW C;  2L9J A;  3EPV A;  3F46 A;  3US6 A;  1M2V A;  1LPE A;  1VB5 A;  2R9R B;  2FGY A;  3DAG A;  4NC3 A;  3K7D A;  1TFK B;  1LE2 A;  2XL6 A;  3JZ0 A;  3L1M A;  2WVN A;  3ZC4 A;  3HKK A;  2J7P D;  5E2Q A;  3DAF A;  4GYT A;  1T01 A;  2OJE D;  1YAR O;  3A11 A;  3B9Q A;  3DJN B;  4U5B E;  3Q7L A;  4QDL A;  3TD7 A;  2YL1 A;  2P61 A;  1TWA A;  1OXK A;  4NCQ A;  2CNW A;  1WWP A;  1PV3 A;  3EJN A;  3U8V A;  4L6R A;  4MTF A;  2NPU A;  2GFH A;  3WOD F;  2E87 A;  1RXQ A;  2WZG A;  1MMG A;  2IOQ A;  1FTS A;  3T6J A;  1VYI A;  1KTM A;  1T9K A;  3W8H A;  4G7H F;  2DYR C;  3L8J A;  2EIJ C;  2KGO A;  3EGD B;  1Q0M A;  2EPN A;  3U9J A;  3LLK A;  3N0T A;  4BPM A;  2QE9 A;  3NYJ A;  1JR8 A;  4IJJ A;  3KYJ A;  4XTK A;  5JUA A;  1NU7 D;  1OCO C;  3LES A;  1ZU5 A;  2J45 A;  2VCB A;  2AWC A;  3AG4 C;  3EQL F;  3RQE A;  3DD7 A;  3RVY A;  1YZC A;  5BUO A;  2R05 A;  3ASN C;  2XM4 A;  3SXK A;  2P0N A;  2QNL A;  1M2O A;  1W2W A;  4PR9 A;  3EFO A;  3V7O A;  3S27 A;  1VMA A;  1KU2 A;  3FMS A;  3M1C B;  2WZF A;  2YLI A;  4Q4Z F;  1RJ9 A;  1GGQ A;  5JLI A;  3EZH A;  2CDQ A;  3NRH A;  5COF A;  1AVO B;  3RKO F;  5KYU B;  3POV A;  3BRJ A;  1CGM E;  4KC9 A;  4PK4 A;  5KYX B;  1A41 A;  4XEV A;  2W4B A;  3UMH A;  3H65 A;  5GPG B;  4BJ5 A;  3AG1 C;  4DRJ B;  2HZ8 A;  2CGE A;  4F4B A;  4JJG A;  1LI5 A;  1O5H A;  4EBK A;  2J9U A;  2XLH A;  3EG9 A;  4JEA A;  3W2V A;  3LS1 A;  4I1M A;  3ZWI A;  3FXH A;  1L7C A;  1YJG A;  4JZA A;  3MYF A;  2HFI A;  2LFD A;  4JC7 A;  2DI3 A;  4O6M A;  3U2L A;  4PFO A;  2OEV A;  1ZHX A;  4YK5 A;  4ANJ A;  1OCC C;  4MVS A;  1OKK A;  1GM5 A;  1YVI A;  4XPY A;  1XZQ A;  1ZHY A;  3KKB A;  4H54 A;  4MVU A;  1ORY A;  2EPL X;  2QTV A;  1ST6 A;  3O6X A;  4O6Y A;  1D0X A;  5F28 E;  4C3D A;  4CIH A;  2AU5 A;  1NLX A;  3F47 A;  1ZYR F;  2OOC A;  4IAQ A;  5D91 A;  3ATP A;  1EKY A;  2HS5 A;  5B3S C;  3OWT A;  3O10 A;  3C18 A;  3RIP A;  4IB4 A;  3T6B A;  2NSG A;  3G4X A;  3NKE A;  3S0X A;  2Y3G A;  3NMJ A;  4G78 A;  3MFN A;  5A6K A;  4CBE A;  4XLN F;  4B6I A;  1QVX A;  1SF8 A;  5L0F A;  2HSB A;  3LEO A;  4RD9 A;  3O39 A;  3QW1 A;  5DLJ A;  3HNL A;  3HNJ A;  3W2W A;  3MYI A;  3ZVR A;  4DBQ A;  2RD9 A;  3DE8 A;  1BBH A;  1DOV A;  5AGF A;  4I44 A;  3DXJ F;  4OIN F;  2Q9C A;  5L0G A;  3ZQV A;  3RVZ A;  5DVW A;  5TJ5 E;  4DJ9 A;  1HE9 A;  3K1H A;  1D1B A;  4OD4 A;  3DZA A;  3ZIB A;  1C17 M;  3KL4 A;  3PDM P;  2G3V A;  1APC A;  2R7Q A;  1K40 A;  4J30 B;  5BQI A;  4YT2 A;  1ZHZ A;  5DQT A;  2LP4 A;  3TJ6 A;  4XEK A;  4BJ1 A;  4CJG A;  1CGO A;  2J9W A;  2Q7R A;  3QTH A;  4IAO A;  4PJL A;  1TQG A;  2H8A A;  3HNI A;  4WJ0 A;  1BZ4 A;  2A6E F;  5COG A;  4CS9 A;  4BJ5 C;  3S84 A;  2VH3 A;  4YN0 B;  4I3M A;  1JRA A;  3QVY A;  3JRT A;  3PMR A;  2NUP B;  1FNT c;  4LER A;  4EHP A;  3B29 A;  1TWH A;  5KYY A;  1JPN A;  4CSA A;  1YA7 O;  4FES A;  4C7O B;  1VK5 A;  2A6H F;  4JW1 A;  4JRZ A;  3FAJ A;  4U9D A;  5E3C A;  4EUK B;  1EI7 A;  2RSE B;  3JT1 A;  4ONS A;  3KYI A;  3I5P A;  3HTK C;  3RW0 A;  3FOP A;  1OW8 A;  2M64 A;  4Z9I A;  5L3V A;  2EIM C;  2X0C A;  1YA9 A;  3X1O A;  1OW6 A;  2YL0 A;  1FMV A;  4OIR F;  1H9G A;  2VC9 A;  1HW1 A;  2KW3 C;  1V4A A;  3L34 A;  3U3B A;  1FFH A;  3KMI A;  2P1A A;  4JUR I;  3M79 A;  2C04 A;  3C8Z A;  3NDB B;  2CW0 F;  3U9M A;  1LE4 A;  2XL8 A;  2XLM A;  2P7V A;  3MBG A;  1Z63 A;  1YYX A;  1J8Y F;  2LFF A;  4J7T A;  1JMW A;  5L3Q A;  2VAS A;  3R7C A;  4FAP B;  2KK1 A;  1YZA A;  4U5F E;  2KYH A;  2OJQ A;  1AUE A;  2ZXP A;  3AGU A;  4YJW A;  3W8I A;  5DS5 A;  2OKU A;  3RQF A;  3CAX A;  3WHN A;  3OEO A;  4CDV A;  3UMK A;  1OR2 A;  4AL0 A;  1G5Z A;  4CDA A;  4IAR A;  2R02 A;  4D4N A;  3U0C A;  2PNO A;  5L0C A;  3FDQ A;  3Q6M A;  4PFP A;  5KYW B;  3SZR A;  4XLP F;  1I5N A;  1TR2 A;  4C3E A;  1MNE A;  4C7O A;  5F5F A;  3EG9 B;  3TK0 A;  4Q5S F;  1OKK D;  4DRH B;  3DJU B;  4XWJ A;  3T9O A;  1OCZ C;  4OIP F;  3AOU A;  1V55 C;  2KQ9 A;  2Y3H A;  2QY9 A;  3DKA A;  2GWW A;  3JSZ A;  3FHD A;  5T3T A;  3X2Q C;  1F1M A;  3EH2 A;  4P9T A;  3GEH A;  3GWN A;  3SXM A;  3V5Z A;  4JJF A;  4JCH A;  4MVQ A;  3GOR A;  3TOL A;  2XSE A;  3GM2 A;  4BG0 A;  2WZL A;  4YL1 A;  2JX0 A;  2XLD A;  2L6F A;  4LDQ A;  3WG7 C;  1ORJ A;  2JPU A;  3TUL A;  5BQG A;  2FFH A;  5B3I A;  4AL1 A;  2PF4 E;  3DE9 A;  5A6B D;  2G62 A;  3V5X A;  3ABK C;  4NY3 A;  3LNR A;  1RCP A;  1BR2 A;  1HY5 A;  3IHU A;  3IQ6 A;  3JCU Q;  2HMQ A;  3K6B A;  3SEO A;  4I1O B;  2AWY A;  2ZPA A;  2GDC A;  1H7I A;  1OQC A;  4E0H A;  4P6I C;  1ZW3 A;  1LS4 A;  1MMN A;  2WB7 A;  2O9X A;  3DMD A;  1A7D A;  2NUT B;  1T5O A;  2R03 A;  2ASR A;  4U5C E;  4YL0 A;  1E84 A;  4J32 B;  1S7Z A;  1QLE C;  1ZHW A;  4LAC B;  2BL2 A;  4ULW A;  4H4K C;  3S29 A;  2A69 F;  5A6J A;  4ULV A;  3U5S A;  3JTL O;  4KI2 A;  4GQH A;  2TMV P;  2XLO A;  1ORS C;  2LQG A;  1XZP A;  4E7S A;  2OG2 A;  3W4Y A;  5JVE A;  4UDV A;  4DOZ A;  3K33 A;  1ZHT A;  4QI2 A;  1Q0K A;  2IYL D;  2OEX A;  3H2V A;  2M4E A;  2J9B A;  1ZZP A;  2PX3 A;  2NSF A;  2CNW D;  4RBN A;  1MQV A;  2LCH A;  1OCR C;  2KJG A;  3DWW A;  4XEF A;  3IEE A;  4K0D A;  1LVK A;  3JYY A;  4PAC A;  3AJM A;  5D92 A;  3EGD A;  3WAQ A;  1M6T A;  3KPH A;  2QUP A;  4CJO A;  5A6B A;  3NMI A;  2BE5 F;  3C63 A;  1XWJ A;  2LSE A;  3LNM B;  5E3A A;  2J0X A;  2PP4 A;  1JPJ A;  1OR3 A;  4CX9 A;  1MMD A;  3Q7G A;  4BJT A;  4NQF A;  2A1D D;  1E2X A;  1WAT A;  4HEA J;  4R32 A;  1WTY A;  1WAS A;  4P9F A;  3ITF A;  4NTF A;  3TQO A;  4G0H A;  3VM6 A;  4EBB A;  1RKC A;  2HV7 A;  1LIH A;  2W9Y A;  2HSQ A;  4CS9 C;  4JTA B;  2YWA A;  1Y6D A;  3UGO A;  1HE1 A;  1V54 C;  1TWC A;  1Q0D A;  4JTD B;  3ECS A;  4XQ1 A;  2J8W A;  3E70 C;  4BEM J;  2MHR A;  3JSE O;  4LLC A;  1SZI A;  5COM A;  1KNY A;  1DOW A;  4E18 A;  1JAF A;  2UUI A;  3B0P A;  3U8P A;  2Y3B A;  4EWC A;  2VB6 A;  2D4U A;  4IRU A;  4PJJ A;  4CS7 A;  1AEP A;  1Z7Q c;  1D0Z A;  2YKZ A;  3M4B A;  4AX2 A;  4DVZ A;  5L0I A;  4CS8 A;  3ASO C;  2OQM A;  3G50 A;  2H7V C;  3L8I A;  3GEI A;  1Y4C A;  2Q9A A;  2BC5 A;  3ABM C;  3E9V A;  1CPQ A;  1LI7 A;  2R7V A;  2KC3 A;  4KBL A;  1QSP A;  4HE8 D;  4JIO A;  1C02 A;  3U2M A;  4AK9 A;  5CIV A;  2R7R A;  3NMK A;  4Z9J A;  4LDK A;  5HSW A;  4MVO A;  1NZE A;  4JVS A;  4N6C A;  2NUT A;  1NSG B;  3KH2 A;  1VLT A;  2J0W A;  1NU9 C;  2L6H A;  2OU6 A;  2B0J A;  4MND A;  4DVY P;  3PHF 2;  2R7U A;  2R7X A;  1MND A;  3CEX A;  2J9V A;  4KNW A;  1ZU4 A;  3LLI A;  5FZT A;  1E86 A;  1N1C A;  1I4Y A;  3V5Y A;  3UNG C;  2ICW G;  3QVZ A;  4OD5 A;  1QZX A;  4HFK B;  4N4W A;  1R5I D;  3GOD A;  2EPK X;  2QLA A;  3EGX A;  1NFO A;  4LDR A;  3AQC A;  2L7A A;  1OW7 A;  3L0I A;  2L6G A;  1EA8 A;  4NTB A;  1R4T A;  2ZXO A;  4U5H A;  4Z9H A;  5AC4 A;  2H7O A;  3C7J A;  2EIK C;  2XXA B;  1A7E A;  1Q0F A;  3K1I A;  4E0I A;  1HMO A;  2MWQ A;  2CYD A;  2HV6 A;  3PCV A;  3IQC A;  1G8X A;  2B0H A;  5CI8 A;  5EK0 A;  1RJ9 B;  2XRH A;  3UGP A;  3C8G A;  2VCA A;  4MVM A;  4YT5 A;  3RQG A;  4U5D E;  2XLE A;  4EIY A;  2XXA A;  1QKR A;  4RDA A;  3N2Z B;  3GWL A;  3Q6N A;  5EGY A;  3N24 A;  1M57 C;  3RFY A;  4MTO A;  5DQZ A;  1NFN A;  2HJM A;  3MX3 A;  1NG1 A;  1SYQ A;  3EGX B;  3SP1 A;  3IPM O;  1U0B B;  5L0J A;  2IXO A;  3GM1 A;  2J46 A;  1QPU A;  3GM3 A;  5DS6 A;  3OA1 A;  4JEB A;  1QQ3 A;  5KYU A;  1RKE A;  1TKN A;  2XM0 A;  4WGY A;  5AC5 A;  4D4X A;  4MQ9 F;  1NBB A;  1CGN A;  3S9O A;  1T6I A;  1U89 A;  4XPX A;  1LS1 A;  2DB4 A;  1SR2 A;  3CQZ A;  1VYK A;  5A6A A;  2L81 A;  4YT8 A;  3DM5 A;  5FCL A;  3HNK A;  2EIL C;  2J7P A;  3I4U A;  2EPO A;  4U5E E;  4AE4 B;  2IXP A;  2VCC A;  1HMD A;  4O79 A;  5KYX A;  3GAN A;  4LLE A;  2G3K A;  2AVK A;  3C62 A;  3FAP B;  3UMI A;  3ABL C;  3T4R A;  3M15 A;  2XLV A;  3LS0 A;  3G4Z A;  2LIG A;  1B68 A;  2XL4 A;  3NYL A;  3SXZ A;  2AP3 A;  3AGT A;  4K7B A;  5JSL A;  2IXN A;  1K05 A;  3S28 A;  2YLD A;  1Z23 A;  3SYN A;  4DRI B;  4JE9 A;  4E17 A;  3CZ6 A;  1E83 A;  4EKW A;  4MTG A;  3VRC A;  2Q3T A;  3K66 A;  2DGJ A;  5DS4 A;  1PCX A;  2YL3 A;  3EHM A;  3LJB A;  4HFF B;  4CSA C;  4O7G A;  1VOM A;  2A0B A;  1V74 B;  2R7T A;  3RH3 A;  4CDY A;  2PFD A;  5T1D B;  1MMA A;  4X0R A;  5A69 A;  3ZTZ A;  1I4Z A;  1FMW A;  3QW0 A;  5KYN A; 
#chains in the Genus database with same CATH homology
 3WAQ A;  3AGU A;  1HMO A;  1A7D A;  2AWC A;  4XPY A;  1I4Y A;  2HMQ A;  4XQ1 A;  1I4Z A;  1HMD A;  4XPX A;  2AWY A;  2MHR A;  3AGT A;  3WHN A;  4XPW A;  2AVK A;  1A7E A;  2HMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...