1I4ZA

The crystal structure of phascolopsis gouldii l98y methemerythrin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
113
structure length
113
Chain Sequence
GFPIPDPYVWDPSFRTFYSIIDDEHKTLFNGIFHLAIDDNADNLGELRRCTGKHFLNEQVLMQASQYQFYDEHKKEHETFIHALDNWKGDVKWAKSWYVNHIKTIDFKYKGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHEMERYTHRIN
publication title The crystal structures of Phascolopsis gouldii wild type and L98Y methemerythrins: structural and functional alterations of the O2 binding pocket.
pubmed doi rcsb
source organism Phascolopsis gouldii
molecule tags Oxygen storage/transport
total genus 45
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2001-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1i4zA00
1I4ZA 1HMDA 1A7DA 3AGTA 3AGUA 2AVKA 4XQ1A 4XPWA 3WAQA 2HMQA 2HMZA 4XPXA 1A7EA 2AWYA 3WHNA 2AWCA 2MHRA 1HMOA 4XPYA 1I4YA
chains in the Genus database with same CATH superfamily
1I4ZA 1U89A 1OCOC 3ABKC 3U3FA 1MMNA 3JYHA 4G78A 4AK9A 1ZYRF 2R7WA 3AJMA 1VLSA 3CSKA 1CGME 1ZHYA 3BRJA 3PMRA 1WASA 3CEXA 1MMAA 1O5HA 4CIPA 2KSFA 1JOGA 1YYXA 3B0PA 2XLWA 1JPNA 1S05A 3DWWA 3SXKA 1TWAA 1H7IA 4J30B 4R32A 4ER9A 1AEPA 1HY5A 2EIKC 3FAJA 2XL8A 5EHHA 3EHNA 2R7SA 1NSGB 3Q6MA 2NUPB 4GEHA 2AU5A 2Y3HA 4MVZA 2QTVA 4PFPA 3C7JA 4CS9C 3X2QC 3L1MA 2J9UA 4JW1A 1HE9A 4E17A 1RKCA 3NYMA 1TWHA 3SP1A 1JMWA 1Y6DA 4JRZA 4BJ5A 1UFBA 3QMKA 2QUPA 1Z7Qc 4PJMA 3LS0A 2GWWA 3JZ0A 1BZ4A 1FFHA 1HE1A 1T9KA 2WZFA 3T4RA 4WABA 2XS8A 1RJ9B 2IM8A 2NSGA 3M15A 3S27A 4YT8A 5KYWB 4EWCA 3C8GA 3O55A 3SXZA 4DVYP 1QZXA 4O7GA 2YL0A 1JR8A 2Y69C 4Q7CA 2QY9A 4BJ1A 2I15A 3EZIA 3I4UA 3O39A 5BUOA 1QVXA 4A4AA 1TKNA 2OEVA 5BQHA 2HV6A 2XLDA 1M2VA 2PX0A 1YYJA 1ZHWA 4O6NA 4LDRA 2WB7A 1VTMP 3GWNA 3EGXA 3TULA 5AC5A 3GEHA 4XLNF 4HFKB 4IB4A 4C7OB 3DZAA 3HNJA 3M4CA 1QLEC 1LIHA 3DAFA 4LACB 5A6AA 1BDJB 2PBEA 2BC5A 3O10A 4IRUA 4OIPF 3UGOA 2OG2A 2L7AA 3S84A 1WATA 1VLTA 1KNYA 2YWAA 3HLZA 1A0BA 1LI7A 2A0UA 3LAYA 1FFTC 1A7EA 2AP3A 3HNIA 2QNLA 2JD3A 2ICWG 3HNKA 4JCZA 2ASRA 4JEBA 5HSWA 4NTAA 2Q9CA 1ZZPA 3S0XA 2P1AA 3T6BA 1SYQA 3K7DA 4LDQA 4XEVA 5KYYB 2RSEB 4EKWA 1OR3A 4YL1A 3X1OA 1ZU4A 3AG3C 3L8JA 4W8KA 5COMA 3G50A 2J9BA 3EJNA 2J0WA 1A7VA 4OIOF 4IARA 4OIRF 3EHMA 3ZSUA 2A6EF 3F46A 1A7DA 4HE8D 1Z63A 3ITFA 3C63A 1RKEB 1K04A 4P9FA 5T1DB 1K05A 2LFFA 3NG1A 3TQOA 4YL0A 5JUAA 2AVKA 3RVZA 1ST6A 3FMSA 4Q4ZF 1G4WR 2KW3C 3L0IA 3RYLA 4AE4B 5FZTA 1T5OA 1Z6AA 3EG9A 4MVRA 3GEEA 5L0CA 4JZAA 3QVZA 1MMDA 1BR1A 3U3BA 1HMOA 4I44A 3DJNB 2HJMA 1NU7D 1FR0A 2J7PA 3S9OA 1E83A 1YJGA 3IQ5A 3JSEO 3GORA 3ZTZA 1J8YF 1F1MA 1G5ZA 3HTKC 1PV3A 1WOLA 2GDCA 3IQTA 1XZQA 5AGFA 2WZLA 5DLJA 2E87A 3ZG1A 1VYKA 3GEIA 3QZCA 3SNHA 2P7VA 3AGUA 1DOWA 2OJQA 3U2MA 5FCLA 2XL4A 2OOCA 3B0UX 3GM3A 1BR2A 3FAPB 1PD1A 1Q0MA 4DXWA 1V74B 2J9WA 2OJED 2L81A 2HS5A 3IQ6A 4EIYA 1Q0KA 1Y4CA 4BPMA 4E18A 3V5XA 5A6BA 2QLAA 2VC9A 3ZQVA 2R7VA 2OCCC 4IAQA 2NUTB 5BQGA 1B68A 4DOZA 2LQGA 3LEOA 3JCUQ 2DB4A 1YARO 5B1AC 4CSAA 4PJNA 2MWQA 3JT1A 2CW0F 3DKAA 5DS5A 2A0BA 4CX9A 4G7OF 5TJ5E 3U8PA 2YQYA 1YDIA 2UUHA 1V55C 3W2WA 1FNTc 3KYJA 3PDMP 4MVQA 4A2NB 1H6GA 2J8WA 3U9JA 2OQMA 2LD6A 3WODF 5KYUA 1OCCC 3CAXA 4MW8A 4EBBA 2EPMX 4D4NA 1ZVZA 3LUTB 4E7SA 1OKKA 1RMVA 3C8GD 1MNEA 4U9EA 4XQ1A 3M1CB 1MNDA 4QI0A 1TFKB 3UNGC 1EKYA 5COGA 3AQBA 2KC3A 3SXMA 5L0FA 3ABLC 1JPJA 3GM2A 4PR9A 2HV7A 1SMYF 3AG1C 5BQIA 4XPXA 3LEVA 2LK4A 1J8MF 2LSEA 4RD9A 1ORJA 3QW0A 2P6VA 4WJ0A 1YZAA 3ASNC 1FMVA 2QE9A 5E33A 3U8VA 1TWCA 2R7TA 2IYLD 2DYRC 2HKVA 5D92A 2OKUA 2VASA 3VM6A 1XWJA 5B1BC 3TK0A 3TD7A 5IY5C 2FAPB 4CSAC 1QSPA 2A6HF 3DMDA 3LNRA 4NTFA 3RFYA 1YAUO 3FOOA 3ZQYA 5L0GA 3UGPA 2NSFA 3VRCA 3JRTA 2XSEA 4WGZA 2EPLX 3ECSA 1SR2A 3B71A 4MS2A 3WAQA 1LI5A 3SYNA 2R7RA 2XLVA 4FAPB 1HW2A 3EH2A 4X0RA 3B9QA 4BEMJ 2VB6A 2KGOA 2KNHA 4G0HA 3NYLA 2DYSC 2J46A 3QVYA 5F28E 5T3TA 5DQTA 1APCA 2H7VC 2MHRA 2X51A 3K6BA 1LKXA 1C03A 4FX5A 4JEAA 2IXPA 4PFOA 1KU2A 3SEOA 2IXNA 1K40A 2O9XA 5JP7A 3EFOA 2HUJA 4Q5SF 2GAQA 2VH3A 1XZPA 3Q7LA 3EGDA 3EG9B 4JIOA 5B3SC 2C04A 2W4MA 4YK5A 3QTHA 2P0NA 4H54A 4GYTA 3TJ6A 2EPOA 2XM0A 4YT2A 5KYNA 2TMVP 2YKZA 4I1MA 1PD0A 2EPKX 2G3VA 4N6HA 3SXYA 5F5HA 4AL1A 5JS5A 2C03A 4JKVA 2R7OA 4Z9HA 3ZDLA 1GS9A 3EH1A 1R4TA 5KYXA 3LNMB 2XLOA 2YEVA 4MVUA 5L0IA 4C3EA 4BG0A 2YLGA 3DAGA 2J7PD 3POVA 4U5HA 4KI2A 5JT4A 5L3QA 1QKRA 5JSLA 2D4UA 2L6FA 1G4US 3B29A 3HKKA 2CNWA 2MYSA 3UMKA 3DE8A 4BJ5C 4ZLCA 3G4ZA 4RDAA 4F4BA 2GFHA 3K66A 2X0CA 3IQCA 1NFNA 4CIHA 4ULVA 2FFHA 1I4YA 3RQFA 2R7UA 3US6A 4JTCB 2V26A 4CS8A 4RBNA 4CDAA 2R25A 1EA8A 3RQGA 3W2VA 4EUKB 1HMDA 4MVSA 3S90A 3MBGA 1V54C 3E70C 1VOMA 4ANJA 5A69A 4IJJA 2EIMC 3EQLF 1RXQA 1M2OA 1WTYA 2L6GA 3I5QA 5A6BD 1ZW2A 3NDBB 1GQAA 4MQ9F 4XPWA 1ZHXA 3SZRA 2NUPA 4NC3A 4XWJA 1EI7A 2CCYA 3UR3C 1TQGA 4YT4A 3NKEA 4KNWA 5GPGB 3ZVRA 1Q0FA 3EPVA 3UMIA 4G7ZF 2PP4A 5E2QA 1QPUA 3E9VA 1G8XA 1Q0GA 1OKKD 2Y3DA 3EZHA 1V4AA 4KC9A 4OD4A 4EBJA 3FDQA 3MYFA 3K1HA 4DRHB 4IGGA 4OIQF 2J45A 3K1IA 2P61A 4H4KC 3ATPA 3NKDA 4AL0A 1AUEA 2YHSA 1OQCA 1W2WA 3V5YA 3IEEA 2Q9BA 2R02A 1RJ9A 2YZSA 3PCVA 4N6CA 3TOMA 4CS8C 1MMGA 4B6IA 4JJFA 3NMJA 5KYWA 5JVEA 1KTMA 3MFNA 1QQ3A 3Q7GA 2ETSA 1WWPA 5DVWA 5JRAA 3TJ5A 4CJOA 1D0ZA 3AG2C 3KKBA 3RKOF 2VCAA 3DD7A 2YLIA 2B0JA 5L0DA 1JAFA 1YZCA 3A11A 3WHNA 2BE5F 2CDQA 2XLMA 1YLMA 3RVYA 4OD5A 1WGWA 5E3CA 2CGEA 1OW8A 4YN0B 3L8IA 1ZW3A 1D1BA 4E0HA 4C7OA 2Q7RA 2LFDA 3A9CA 3AG4C 3CZ6A 3K33A 2R03A 3KL4A 1NU9C 4LDKA 1D0XA 1M56C 3Q6NA 2EPNA 3RW0A 3R2PA 2YL7A 1OW6A 2L9JA 2Y3BA 2D5RB 2YL1A 2R7QA 3TOLA 3C8GB 4LLEA 1E85A 1OR2A 3U9MA 3H65A 2Q9AA 3KPHA 3L34A 2F22A 2BL2A 4U5DE 3W8HA 4PJJA 3K1IC 3WG7C 3ZIBA 1C02A 1VMAA 4MW3A 5KYYA 5DQZA 1M2VB 2GA0A 2ZXPA 1OXBA 4I1OB 3EGXB 1D0YA 3PHF2 1D1CA 4FWVA 1L3PA 4L6RA 4HEAJ 2H7OA 1ZHTA 2AWCA 2R9RB 3DI5A 2NPUA 3CQZA 3KYIA 4MVOA 4Z9JA 4P9TA 2H8AA 4U5CE 1O3UA 5T3WA 1BBHA 2M4EA 3AQCA 1E84A 4U5GA 2KK1A 1RKEA 3ASOC 3GODA 5D91A 4XPYA 4G7HF 4BJTA 1OXKA 2VCCA 1GGQA 4HFFB 2XXAA 1UG7A 3C18A 1NFOA 2WZGA 4MTFA 2LIGA 2EIJC 2RD9A 4O6YA 3T6JA 3LLKA 4AE4A 1C17M 4U5BE 4YWQA 4JE9A 2CNWD 3FOPA 1CGOA 1FAPB 4M63A 5K0IA 2J0XA 4CBEA 4GQHA 4BEJA 4NCQA 3LS1A 4U5FE 5A6KA 1IZMA 4XTKA 3OEOA 1I5NA 3MX3A 2HSBA 1AVOB 2AWYA 2WVOA 3MLGA 1N1CA 1T6UA 2WVQA 4I3MA 2A68F 2PNOA 4J7YA 1Q0DA 2XL6A 2YRFA 4DBRA 2KQ9A 4K7BA 3M79A 1U6HA 4YL3A 2HSQA 2KYHA 3FVYA 4JVSA 3W8IA 2OU6A 4MTGA 4E7ZA 3KH2A 3N2ZB 5A6JA 3LESA 3C62A 1GM5A 2R05A 3ZC4A 1ORSC 1Z23A 3GANA 3S28A 3N0TA 3DM5A 1H9TA 1SF8A 3I5PA 4LLCA 1OW7A 2PF4E 2NUTA 4N4WA 1NG1A 1TR2A 1LS4A 2J9VA 4DJ9A 5DS6A 2JX0A 2W4BA 4WGYA 1MQVA 2HMZA 2PFDA 2ZPAA 4PJLA 4K1OA 2DGJA 2VCBA 2XS1A 2YLDA 3DXJF 2EINC 3JRMO 3RH3A 2Y39A 3DM9B 4DVZA 2HZ8A 4KBLA 1ZU5A 4NTBA 1WN0A 1YA7O 2W45A 4FESA 1FMWA 3KMIA 1D1AA 4JTDB 1LPEA 3H2VA 2G3KA 5CI9A 3DJUB 4ONSA 2NG1A 4N06A 5EK0A 4W8PA 4D4XA 4JC7A 2Z15A 1RCPA 3LLIA 4CDVA 3JTLO 1VYIA 2HFIA 3J06A 1M6TA 3FXHA 4IWBA 4K0DA 4XEKA 2L6HA 4J32B 1HW1A 1R5ID 2UUIA 2HJ3A 3AGTA 4CS7A 4YJWA 2PX3A 1T6IA 1S7ZA 4QDLA 1T01A 3R7CA 1CGNA 4PK4A 1M57C 2Q00A 256BA 2Q4FA 4JTAB 4U9DA 4EHPA 4QI2A 2HMQA 1ORYA 5EGYA 2IXMA 4BJ6A 3JYYA 2IXOA 3ZWIA 2V3CC 1JRAA 1LE4A 3U2LA 2OEXA 4C3BA 4CDYA 4DRIB 3B0VC 5KYUB 3JSZA 2YL3A 1YA9A 4JURI 3IPMO 1LVKA 3RIPA 4LERA 2IOQA 5L3VA 3NRHA 4MVMA 3H2UA 3MYIA 5CIVA 1H9GA 5E3AA 1LS1A 2ZD9A 5B3IA 2G62A 1U0BB 4UDVA 2WVNA 1T6QA 3T6GB 3VYWA 4IAOA 3C8ZA 1IW7F 1CPQA 1EQ1A 2Y3GA 1A41A 1LM3B 3FHDA 2ZXWC 3HNLA 3V5ZA 5JLIA 4O6MA 1PCXA 4JJGA 3AOUA 2B0HA 3U5SA 4PACA 4ZLDA 2W9YA 2XXAB 1Z5ZA 2FGYA 5L0JA 4CJGA 3F47A 4JCHA 1ZHZA 3U0CA 2EILC 1NZEA 3NMIA 1O87A 1Z3IX 3RF3A 3OA1A 5COFA 1FTSA 3GWLA 2Q3TA 3RQEA 3DE9A 4MTOA 3ZTMA 4BJ6C 2WL8A 4Z9IA 5HV9A 3NYJA 3UMHA 2IBFA 2M64A 1NLXA 5F5FA 1OCZC 3S29A 4E0IA 2ZXOA 4U5EE 1E2XA 4EBKA 1E86A 4NQFA 1TWGA 2DI3A 2CYDA 1OCRC 2I8BA 3V7OA 3N24A 2A1DD 1NBBA 2A69F 3EFOB 1YVIA 3GM1A 4OINF 2JPUA 5L0HA 3EGDB 1DOVA 2XM4A 3QW1A 3VAYA 1LE2A 3BEHA 2KJGA 3G4XA 2XRHA 3ABMC 1TFOB 3LJBA 5AC4A 5DS4A 2XLEA 2XLHA 3T9OA 4XEFA 3VF0A 4MNDA 3NMKA 1SZIA 4O79A 4YT5A 4XLPF 1CPRA 4KNVA 4AX2A 2R7XA 4DRJB 5CI8A 4P6IC 4NY3A 2ZXRA 4CS9A 1VK5A 2LCHA 5KYXB 3W4YA 2YVKA 4J7TA 4DBQA 3IHUA 1BR4A 3HJCA 2H7BA 1VB5A 4ULWA 2LP4A 3M4BA 1L7CA 4C3DA 3OWTA 3O6XA
chains in the Genus database with same CATH topology
1I4ZA 1HMDA 1A7DA 3AGTA 3AGUA 2AVKA 4XQ1A 4XPWA 3WAQA 2HMQA 2HMZA 4XPXA 1A7EA 2AWYA 3WHNA 2AWCA 2MHRA 1HMOA 4XPYA 1I4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I4Z A;  1HMD A;  1A7D A;  3AGT A;  3AGU A;  2AVK A;  4XQ1 A;  4XPW A;  3WAQ A;  2HMQ A;  2HMZ A;  4XPX A;  1A7E A;  2AWY A;  3WHN A;  2AWC A;  2MHR A;  1HMO A;  4XPY A;  1I4Y A; 
#chains in the Genus database with same CATH topology
 1I4Z A;  1U89 A;  1OCO C;  3ABK C;  3U3F A;  1MMN A;  3JYH A;  4G78 A;  4AK9 A;  1ZYR F;  2R7W A;  3AJM A;  1VLS A;  3CSK A;  1CGM E;  1ZHY A;  3BRJ A;  3PMR A;  1WAS A;  3CEX A;  1MMA A;  1O5H A;  4CIP A;  2KSF A;  1JOG A;  1YYX A;  3B0P A;  2XLW A;  1JPN A;  1S05 A;  3DWW A;  3SXK A;  1TWA A;  1H7I A;  4J30 B;  4R32 A;  4ER9 A;  1AEP A;  1HY5 A;  2EIK C;  3FAJ A;  2XL8 A;  5EHH A;  3EHN A;  2R7S A;  1NSG B;  3Q6M A;  2NUP B;  4GEH A;  2AU5 A;  2Y3H A;  4MVZ A;  2QTV A;  4PFP A;  3C7J A;  4CS9 C;  3X2Q C;  3L1M A;  2J9U A;  4JW1 A;  1HE9 A;  4E17 A;  1RKC A;  3NYM A;  1TWH A;  3SP1 A;  1JMW A;  1Y6D A;  4JRZ A;  4BJ5 A;  1UFB A;  3QMK A;  2QUP A;  1Z7Q c;  4PJM A;  3LS0 A;  2GWW A;  3JZ0 A;  1BZ4 A;  1FFH A;  1HE1 A;  1T9K A;  2WZF A;  3T4R A;  4WAB A;  2XS8 A;  1RJ9 B;  2IM8 A;  2NSG A;  3M15 A;  3S27 A;  4YT8 A;  5KYW B;  4EWC A;  3C8G A;  3O55 A;  3SXZ A;  4DVY P;  1QZX A;  4O7G A;  2YL0 A;  1JR8 A;  2Y69 C;  4Q7C A;  2QY9 A;  4BJ1 A;  2I15 A;  3EZI A;  3I4U A;  3O39 A;  5BUO A;  1QVX A;  4A4A A;  1TKN A;  2OEV A;  5BQH A;  2HV6 A;  2XLD A;  1M2V A;  2PX0 A;  1YYJ A;  1ZHW A;  4O6N A;  4LDR A;  2WB7 A;  1VTM P;  3GWN A;  3EGX A;  3TUL A;  5AC5 A;  3GEH A;  4XLN F;  4HFK B;  4IB4 A;  4C7O B;  3DZA A;  3HNJ A;  3M4C A;  1QLE C;  1LIH A;  3DAF A;  4LAC B;  5A6A A;  1BDJ B;  2PBE A;  2BC5 A;  3O10 A;  4IRU A;  4OIP F;  3UGO A;  2OG2 A;  2L7A A;  3S84 A;  1WAT A;  1VLT A;  1KNY A;  2YWA A;  3HLZ A;  1A0B A;  1LI7 A;  2A0U A;  3LAY A;  1FFT C;  1A7E A;  2AP3 A;  3HNI A;  2QNL A;  2JD3 A;  2ICW G;  3HNK A;  4JCZ A;  2ASR A;  4JEB A;  5HSW A;  4NTA A;  2Q9C A;  1ZZP A;  3S0X A;  2P1A A;  3T6B A;  1SYQ A;  3K7D A;  4LDQ A;  4XEV A;  5KYY B;  2RSE B;  4EKW A;  1OR3 A;  4YL1 A;  3X1O A;  1ZU4 A;  3AG3 C;  3L8J A;  4W8K A;  5COM A;  3G50 A;  2J9B A;  3EJN A;  2J0W A;  1A7V A;  4OIO F;  4IAR A;  4OIR F;  3EHM A;  3ZSU A;  2A6E F;  3F46 A;  1A7D A;  4HE8 D;  1Z63 A;  3ITF A;  3C63 A;  1RKE B;  1K04 A;  4P9F A;  5T1D B;  1K05 A;  2LFF A;  3NG1 A;  3TQO A;  4YL0 A;  5JUA A;  2AVK A;  3RVZ A;  1ST6 A;  3FMS A;  4Q4Z F;  1G4W R;  2KW3 C;  3L0I A;  3RYL A;  4AE4 B;  5FZT A;  1T5O A;  1Z6A A;  3EG9 A;  4MVR A;  3GEE A;  5L0C A;  4JZA A;  3QVZ A;  1MMD A;  1BR1 A;  3U3B A;  1HMO A;  4I44 A;  3DJN B;  2HJM A;  1NU7 D;  1FR0 A;  2J7P A;  3S9O A;  1E83 A;  1YJG A;  3IQ5 A;  3JSE O;  3GOR A;  3ZTZ A;  1J8Y F;  1F1M A;  1G5Z A;  3HTK C;  1PV3 A;  1WOL A;  2GDC A;  3IQT A;  1XZQ A;  5AGF A;  2WZL A;  5DLJ A;  2E87 A;  3ZG1 A;  1VYK A;  3GEI A;  3QZC A;  3SNH A;  2P7V A;  3AGU A;  1DOW A;  2OJQ A;  3U2M A;  5FCL A;  2XL4 A;  2OOC A;  3B0U X;  3GM3 A;  1BR2 A;  3FAP B;  1PD1 A;  1Q0M A;  4DXW A;  1V74 B;  2J9W A;  2OJE D;  2L81 A;  2HS5 A;  3IQ6 A;  4EIY A;  1Q0K A;  1Y4C A;  4BPM A;  4E18 A;  3V5X A;  5A6B A;  2QLA A;  2VC9 A;  3ZQV A;  2R7V A;  2OCC C;  4IAQ A;  2NUT B;  5BQG A;  1B68 A;  4DOZ A;  2LQG A;  3LEO A;  3JCU Q;  2DB4 A;  1YAR O;  5B1A C;  4CSA A;  4PJN A;  2MWQ A;  3JT1 A;  2CW0 F;  3DKA A;  5DS5 A;  2A0B A;  4CX9 A;  4G7O F;  5TJ5 E;  3U8P A;  2YQY A;  1YDI A;  2UUH A;  1V55 C;  3W2W A;  1FNT c;  3KYJ A;  3PDM P;  4MVQ A;  4A2N B;  1H6G A;  2J8W A;  3U9J A;  2OQM A;  2LD6 A;  3WOD F;  5KYU A;  1OCC C;  3CAX A;  4MW8 A;  4EBB A;  2EPM X;  4D4N A;  1ZVZ A;  3LUT B;  4E7S A;  1OKK A;  1RMV A;  3C8G D;  1MNE A;  4U9E A;  4XQ1 A;  3M1C B;  1MND A;  4QI0 A;  1TFK B;  3UNG C;  1EKY A;  5COG A;  3AQB A;  2KC3 A;  3SXM A;  5L0F A;  3ABL C;  1JPJ A;  3GM2 A;  4PR9 A;  2HV7 A;  1SMY F;  3AG1 C;  5BQI A;  4XPX A;  3LEV A;  2LK4 A;  1J8M F;  2LSE A;  4RD9 A;  1ORJ A;  3QW0 A;  2P6V A;  4WJ0 A;  1YZA A;  3ASN C;  1FMV A;  2QE9 A;  5E33 A;  3U8V A;  1TWC A;  2R7T A;  2IYL D;  2DYR C;  2HKV A;  5D92 A;  2OKU A;  2VAS A;  3VM6 A;  1XWJ A;  5B1B C;  3TK0 A;  3TD7 A;  5IY5 C;  2FAP B;  4CSA C;  1QSP A;  2A6H F;  3DMD A;  3LNR A;  4NTF A;  3RFY A;  1YAU O;  3FOO A;  3ZQY A;  5L0G A;  3UGP A;  2NSF A;  3VRC A;  3JRT A;  2XSE A;  4WGZ A;  2EPL X;  3ECS A;  1SR2 A;  3B71 A;  4MS2 A;  3WAQ A;  1LI5 A;  3SYN A;  2R7R A;  2XLV A;  4FAP B;  1HW2 A;  3EH2 A;  4X0R A;  3B9Q A;  4BEM J;  2VB6 A;  2KGO A;  2KNH A;  4G0H A;  3NYL A;  2DYS C;  2J46 A;  3QVY A;  5F28 E;  5T3T A;  5DQT A;  1APC A;  2H7V C;  2MHR A;  2X51 A;  3K6B A;  1LKX A;  1C03 A;  4FX5 A;  4JEA A;  2IXP A;  4PFO A;  1KU2 A;  3SEO A;  2IXN A;  1K40 A;  2O9X A;  5JP7 A;  3EFO A;  2HUJ A;  4Q5S F;  2GAQ A;  2VH3 A;  1XZP A;  3Q7L A;  3EGD A;  3EG9 B;  4JIO A;  5B3S C;  2C04 A;  2W4M A;  4YK5 A;  3QTH A;  2P0N A;  4H54 A;  4GYT A;  3TJ6 A;  2EPO A;  2XM0 A;  4YT2 A;  5KYN A;  2TMV P;  2YKZ A;  4I1M A;  1PD0 A;  2EPK X;  2G3V A;  4N6H A;  3SXY A;  5F5H A;  4AL1 A;  5JS5 A;  2C03 A;  4JKV A;  2R7O A;  4Z9H A;  3ZDL A;  1GS9 A;  3EH1 A;  1R4T A;  5KYX A;  3LNM B;  2XLO A;  2YEV A;  4MVU A;  5L0I A;  4C3E A;  4BG0 A;  2YLG A;  3DAG A;  2J7P D;  3POV A;  4U5H A;  4KI2 A;  5JT4 A;  5L3Q A;  1QKR A;  5JSL A;  2D4U A;  2L6F A;  1G4U S;  3B29 A;  3HKK A;  2CNW A;  2MYS A;  3UMK A;  3DE8 A;  4BJ5 C;  4ZLC A;  3G4Z A;  4RDA A;  4F4B A;  2GFH A;  3K66 A;  2X0C A;  3IQC A;  1NFN A;  4CIH A;  4ULV A;  2FFH A;  1I4Y A;  3RQF A;  2R7U A;  3US6 A;  4JTC B;  2V26 A;  4CS8 A;  4RBN A;  4CDA A;  2R25 A;  1EA8 A;  3RQG A;  3W2V A;  4EUK B;  1HMD A;  4MVS A;  3S90 A;  3MBG A;  1V54 C;  3E70 C;  1VOM A;  4ANJ A;  5A69 A;  4IJJ A;  2EIM C;  3EQL F;  1RXQ A;  1M2O A;  1WTY A;  2L6G A;  3I5Q A;  5A6B D;  1ZW2 A;  3NDB B;  1GQA A;  4MQ9 F;  4XPW A;  1ZHX A;  3SZR A;  2NUP A;  4NC3 A;  4XWJ A;  1EI7 A;  2CCY A;  3UR3 C;  1TQG A;  4YT4 A;  3NKE A;  4KNW A;  5GPG B;  3ZVR A;  1Q0F A;  3EPV A;  3UMI A;  4G7Z F;  2PP4 A;  5E2Q A;  1QPU A;  3E9V A;  1G8X A;  1Q0G A;  1OKK D;  2Y3D A;  3EZH A;  1V4A A;  4KC9 A;  4OD4 A;  4EBJ A;  3FDQ A;  3MYF A;  3K1H A;  4DRH B;  4IGG A;  4OIQ F;  2J45 A;  3K1I A;  2P61 A;  4H4K C;  3ATP A;  3NKD A;  4AL0 A;  1AUE A;  2YHS A;  1OQC A;  1W2W A;  3V5Y A;  3IEE A;  2Q9B A;  2R02 A;  1RJ9 A;  2YZS A;  3PCV A;  4N6C A;  3TOM A;  4CS8 C;  1MMG A;  4B6I A;  4JJF A;  3NMJ A;  5KYW A;  5JVE A;  1KTM A;  3MFN A;  1QQ3 A;  3Q7G A;  2ETS A;  1WWP A;  5DVW A;  5JRA A;  3TJ5 A;  4CJO A;  1D0Z A;  3AG2 C;  3KKB A;  3RKO F;  2VCA A;  3DD7 A;  2YLI A;  2B0J A;  5L0D A;  1JAF A;  1YZC A;  3A11 A;  3WHN A;  2BE5 F;  2CDQ A;  2XLM A;  1YLM A;  3RVY A;  4OD5 A;  1WGW A;  5E3C A;  2CGE A;  1OW8 A;  4YN0 B;  3L8I A;  1ZW3 A;  1D1B A;  4E0H A;  4C7O A;  2Q7R A;  2LFD A;  3A9C A;  3AG4 C;  3CZ6 A;  3K33 A;  2R03 A;  3KL4 A;  1NU9 C;  4LDK A;  1D0X A;  1M56 C;  3Q6N A;  2EPN A;  3RW0 A;  3R2P A;  2YL7 A;  1OW6 A;  2L9J A;  2Y3B A;  2D5R B;  2YL1 A;  2R7Q A;  3TOL A;  3C8G B;  4LLE A;  1E85 A;  1OR2 A;  3U9M A;  3H65 A;  2Q9A A;  3KPH A;  3L34 A;  2F22 A;  2BL2 A;  4U5D E;  3W8H A;  4PJJ A;  3K1I C;  3WG7 C;  3ZIB A;  1C02 A;  1VMA A;  4MW3 A;  5KYY A;  5DQZ A;  1M2V B;  2GA0 A;  2ZXP A;  1OXB A;  4I1O B;  3EGX B;  1D0Y A;  3PHF 2;  1D1C A;  4FWV A;  1L3P A;  4L6R A;  4HEA J;  2H7O A;  1ZHT A;  2AWC A;  2R9R B;  3DI5 A;  2NPU A;  3CQZ A;  3KYI A;  4MVO A;  4Z9J A;  4P9T A;  2H8A A;  4U5C E;  1O3U A;  5T3W A;  1BBH A;  2M4E A;  3AQC A;  1E84 A;  4U5G A;  2KK1 A;  1RKE A;  3ASO C;  3GOD A;  5D91 A;  4XPY A;  4G7H F;  4BJT A;  1OXK A;  2VCC A;  1GGQ A;  4HFF B;  2XXA A;  1UG7 A;  3C18 A;  1NFO A;  2WZG A;  4MTF A;  2LIG A;  2EIJ C;  2RD9 A;  4O6Y A;  3T6J A;  3LLK A;  4AE4 A;  1C17 M;  4U5B E;  4YWQ A;  4JE9 A;  2CNW D;  3FOP A;  1CGO A;  1FAP B;  4M63 A;  5K0I A;  2J0X A;  4CBE A;  4GQH A;  4BEJ A;  4NCQ A;  3LS1 A;  4U5F E;  5A6K A;  1IZM A;  4XTK A;  3OEO A;  1I5N A;  3MX3 A;  2HSB A;  1AVO B;  2AWY A;  2WVO A;  3MLG A;  1N1C A;  1T6U A;  2WVQ A;  4I3M A;  2A68 F;  2PNO A;  4J7Y A;  1Q0D A;  2XL6 A;  2YRF A;  4DBR A;  2KQ9 A;  4K7B A;  3M79 A;  1U6H A;  4YL3 A;  2HSQ A;  2KYH A;  3FVY A;  4JVS A;  3W8I A;  2OU6 A;  4MTG A;  4E7Z A;  3KH2 A;  3N2Z B;  5A6J A;  3LES A;  3C62 A;  1GM5 A;  2R05 A;  3ZC4 A;  1ORS C;  1Z23 A;  3GAN A;  3S28 A;  3N0T A;  3DM5 A;  1H9T A;  1SF8 A;  3I5P A;  4LLC A;  1OW7 A;  2PF4 E;  2NUT A;  4N4W A;  1NG1 A;  1TR2 A;  1LS4 A;  2J9V A;  4DJ9 A;  5DS6 A;  2JX0 A;  2W4B A;  4WGY A;  1MQV A;  2HMZ A;  2PFD A;  2ZPA A;  4PJL A;  4K1O A;  2DGJ A;  2VCB A;  2XS1 A;  2YLD A;  3DXJ F;  2EIN C;  3JRM O;  3RH3 A;  2Y39 A;  3DM9 B;  4DVZ A;  2HZ8 A;  4KBL A;  1ZU5 A;  4NTB A;  1WN0 A;  1YA7 O;  2W45 A;  4FES A;  1FMW A;  3KMI A;  1D1A A;  4JTD B;  1LPE A;  3H2V A;  2G3K A;  5CI9 A;  3DJU B;  4ONS A;  2NG1 A;  4N06 A;  5EK0 A;  4W8P A;  4D4X A;  4JC7 A;  2Z15 A;  1RCP A;  3LLI A;  4CDV A;  3JTL O;  1VYI A;  2HFI A;  3J06 A;  1M6T A;  3FXH A;  4IWB A;  4K0D A;  4XEK A;  2L6H A;  4J32 B;  1HW1 A;  1R5I D;  2UUI A;  2HJ3 A;  3AGT A;  4CS7 A;  4YJW A;  2PX3 A;  1T6I A;  1S7Z A;  4QDL A;  1T01 A;  3R7C A;  1CGN A;  4PK4 A;  1M57 C;  2Q00 A;  256B A;  2Q4F A;  4JTA B;  4U9D A;  4EHP A;  4QI2 A;  2HMQ A;  1ORY A;  5EGY A;  2IXM A;  4BJ6 A;  3JYY A;  2IXO A;  3ZWI A;  2V3C C;  1JRA A;  1LE4 A;  3U2L A;  2OEX A;  4C3B A;  4CDY A;  4DRI B;  3B0V C;  5KYU B;  3JSZ A;  2YL3 A;  1YA9 A;  4JUR I;  3IPM O;  1LVK A;  3RIP A;  4LER A;  2IOQ A;  5L3V A;  3NRH A;  4MVM A;  3H2U A;  3MYI A;  5CIV A;  1H9G A;  5E3A A;  1LS1 A;  2ZD9 A;  5B3I A;  2G62 A;  1U0B B;  4UDV A;  2WVN A;  1T6Q A;  3T6G B;  3VYW A;  4IAO A;  3C8Z A;  1IW7 F;  1CPQ A;  1EQ1 A;  2Y3G A;  1A41 A;  1LM3 B;  3FHD A;  2ZXW C;  3HNL A;  3V5Z A;  5JLI A;  4O6M A;  1PCX A;  4JJG A;  3AOU A;  2B0H A;  3U5S A;  4PAC A;  4ZLD A;  2W9Y A;  2XXA B;  1Z5Z A;  2FGY A;  5L0J A;  4CJG A;  3F47 A;  4JCH A;  1ZHZ A;  3U0C A;  2EIL C;  1NZE A;  3NMI A;  1O87 A;  1Z3I X;  3RF3 A;  3OA1 A;  5COF A;  1FTS A;  3GWL A;  2Q3T A;  3RQE A;  3DE9 A;  4MTO A;  3ZTM A;  4BJ6 C;  2WL8 A;  4Z9I A;  5HV9 A;  3NYJ A;  3UMH A;  2IBF A;  2M64 A;  1NLX A;  5F5F A;  1OCZ C;  3S29 A;  4E0I A;  2ZXO A;  4U5E E;  1E2X A;  4EBK A;  1E86 A;  4NQF A;  1TWG A;  2DI3 A;  2CYD A;  1OCR C;  2I8B A;  3V7O A;  3N24 A;  2A1D D;  1NBB A;  2A69 F;  3EFO B;  1YVI A;  3GM1 A;  4OIN F;  2JPU A;  5L0H A;  3EGD B;  1DOV A;  2XM4 A;  3QW1 A;  3VAY A;  1LE2 A;  3BEH A;  2KJG A;  3G4X A;  2XRH A;  3ABM C;  1TFO B;  3LJB A;  5AC4 A;  5DS4 A;  2XLE A;  2XLH A;  3T9O A;  4XEF A;  3VF0 A;  4MND A;  3NMK A;  1SZI A;  4O79 A;  4YT5 A;  4XLP F;  1CPR A;  4KNV A;  4AX2 A;  2R7X A;  4DRJ B;  5CI8 A;  4P6I C;  4NY3 A;  2ZXR A;  4CS9 A;  1VK5 A;  2LCH A;  5KYX B;  3W4Y A;  2YVK A;  4J7T A;  4DBQ A;  3IHU A;  1BR4 A;  3HJC A;  2H7B A;  1VB5 A;  4ULW A;  2LP4 A;  3M4B A;  1L7C A;  4C3D A;  3OWT A;  3O6X A; 
#chains in the Genus database with same CATH homology
 1I4Z A;  1HMD A;  1A7D A;  3AGT A;  3AGU A;  2AVK A;  4XQ1 A;  4XPW A;  3WAQ A;  2HMQ A;  2HMZ A;  4XPX A;  1A7E A;  2AWY A;  3WHN A;  2AWC A;  2MHR A;  1HMO A;  4XPY A;  1I4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...