2Q3TA

Ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at3g22680
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
121
structure length
121
Chain Sequence
GSLLRRAEMYQDYMKQVPIPTNRGSLIPFTSWVGLSISMKQLYGQPLHYLTNVLLQRWDQSRFGTDSEEQRLDSIIHPTKAEATIWLVEEIHRLTPSHLHMALLWRSDPMYHSFIDPIFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Protein At3g22680
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 41
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09187 RdDM_RDM1 RNA-directed DNA methylation 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.690 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2q3tA00
1VK5A 2Q3TA 3GANA
chains in the Genus database with same CATH superfamily
2Y3BA 3C7JA 3DZAA 4NTFA 4E18A 3N2ZB 4XPWA 1EA8A 4DRHB 3KYIA 2Y39A 2YQYA 2J8WA 3DI5A 3EJNA 1ORJA 3OEOA 3X1OA 2KJGA 2XLEA 3GWNA 3HNLA 3L8IA 3UNGC 5A6JA 2PX0A 1VOMA 4JE9A 1A41A 256BA 4YK5A 1CPQA 3RVYA 4DXWA 4MTGA 1C03A 5EHHA 3DKAA 1MMDA 3W2WA 2XSEA 3DWWA 4FESA 3K7DA 4ZLCA 3MLGA 3K6BA 1CGOA 1SYQA 5E2QA 3TOLA 4BEJA 3S84A 3Q7LA 4N06A 4E7SA 1EKYA 3MYFA 3QW1A 1LVKA 3SNHA 2LP4A 2WZGA 3WODF 3O6XA 3B71A 4NCQA 3JRTA 4YL3A 2QNLA 3T9OA 1XZPA 1CGME 2J45A 1G4WR 2ETSA 3RVZA 2HMZA 3I5PA 2Q7RA 1TFOB 4HEAJ 2R7OA 2R02A 3W4YA 1HW2A 5F5HA 5CI8A 4JTDB 1L3PA 1T5OA 1U89A 1TWAA 2PFDA 1A7EA 1T6QA 3L8JA 3U8PA 5JUAA 5K0IA 2OEXA 2TMVP 2R7QA 3NKEA 2ZXPA 2OOCA 1YYXA 2VCAA 4H4KC 1Z63A 2W45A 1UFBA 3KL4A 4DBRA 1G4US 1HMDA 1LIHA 1ZU5A 2Q9CA 4L6RA 5AC5A 1SZIA 2YZSA 2P61A 1JRAA 1Q0GA 4GEHA 4JJFA 1D0ZA 3RYLA 3C62A 3JTLO 4MTOA 3S9OA 5KYYA 2V3CC 5BUOA 2VASA 3NRHA 2NSFA 1BBHA 3CZ6A 2XL6A 4YT5A 2B0HA 1ZYRF 3GM3A 1LM3B 3WAQA 3EGXB 2GFHA 2CGEA 2YEVA 1G5ZA 1ZZPA 5COMA 2R7SA 3RFYA 4MVOA 4HFKB 4N4WA 4U5HA 2VCCA 3FHDA 1PV3A 3ATPA 3IQCA 3S28A 1Z7Qc 1QKRA 1OKKD 4IB4A 1H6GA 4DVYP 4R32A 1ZW2A 2Y3GA 1FAPB 3PHF2 5B1AC 3H2VA 4CDYA 3FDQA 1OCOC 1M57C 4XLNF 4MW3A 4CDVA 2NUPB 3POVA 2HFIA 1K40A 1E2XA 1YAUO 2YL0A 1NU7D 2Q9BA 2A0BA 1CPRA 1XZQA 2LFFA 2YHSA 4IAOA 3LUTB 1AEPA 4MNDA 3U3FA 2CW0F 3V5YA 1WATA 5BQHA 3DJNB 4XPXA 1VYKA 1A0BA 1LE2A 5B1BC 2QLAA 3ZG1A 2YLIA 3JSEO 1E83A 5L3VA 1ORSC 3T6JA 4U5FE 3U9MA 2WZLA 2R03A 4XPYA 4JC7A 3ASNC 2NUTA 2J7PA 2J9WA 4YL0A 5DQTA 3Q6NA 3UR3C 3ZTZA 2DYRC 2XS8A 1VLSA 1VYIA 4I1MA 1T9KA 1TWCA 1D1BA 3R2PA 4MTFA 4BJ1A 1QLEC 2XRHA 3V5ZA 1LS4A 1QQ3A 1QSPA 2UUIA 1BZ4A 2XS1A 4ULVA 5L3QA 3DM5A 4U9EA 5F5FA 2WZFA 4G0HA 2H7BA 1N1CA 1WN0A 3MX3A 1TWHA 4U5DE 1NZEA 4YN0B 2MYSA 4IRUA 3RQFA 4NTAA 3UGPA 3VAYA 2PP4A 5KYXB 1Y6DA 3EFOA 3C18A 3JT1A 3K66A 5T3TA 3U5SA 1R4TA 4AE4B 2ZPAA 3NYJA 2ASRA 5HV9A 2HV7A 1KNYA 2ZD9A 3IQ6A 4ONSA 4QI0A 4E0IA 3U2MA 1ZHWA 1M6TA 3FMSA 2HMQA 2JX0A 2LCHA 4AL0A 3AQCA 2OKUA 3AG1C 4BJ5A 1FFHA 1Z3IX 5DS5A 1F1MA 1VK5A 3C8ZA 2I15A 3FAPB 3G50A 2XM0A 2PX3A 2YRFA 4O7GA 4WGZA 3OWTA 3RIPA 2H8AA 3JCUQ 4G7HF 3KKBA 2Y69C 3EGDA 1Q0FA 1RJ9B 1FFTC 2GWWA 2X51A 3GORA 2XL4A 3K33A 4P6IC 4Z9HA 1I5NA 3SXMA 3EZIA 5EK0A 4YWQA 3S0XA 5AGFA 3T4RA 4G7OF 3ABMC 1OXBA 2L6GA 3LS0A 1A7DA 4CJGA 1V55C 4YT4A 1XWJA 1ZW3A 3EH1A 4PFPA 1WGWA 1E85A 3PCVA 2QE9A 1YYJA 3ZSUA 3NDBB 4AL1A 3M4CA 2D4UA 2MHRA 2EIMC 3H2UA 3BRJA 2XLVA 4O6NA 4NQFA 2L6HA 2NG1A 2A68F 1ZHTA 1VMAA 4EKWA 2GAQA 2HSQA 3HTKC 2YWAA 4U9DA 1WASA 3A9CA 1MMGA 4K7BA 3E70C 2OCCC 4BJTA 4BEMJ 2CYDA 4BJ6C 5DS6A 1M2VA 1Q0KA 2CDQA 2VC9A 2ZXWC 2HS5A 1ZHZA 1NBBA 1MMAA 3ASOC 1JMWA 4U5BE 4Q5SF 3GWLA 4I44A 4JTCB 2YL1A 1PD0A 3G4XA 3V7OA 2XXAB 3ABLC 1U0BB 4E0HA 2NSGA 2W4MA 5FZTA 4D4XA 1NFNA 2J46A 2BL2A 5GPGB 4C3DA 4W8KA 1GM5A 4AK9A 1OW7A 1TFKB 1ORYA 1V4AA 3NG1A 4KNWA 4LACB 1LE4A 2A69F 3C8GA 1OR2A 3ITFA 2C04A 1TWGA 2CNWA 4EBJA 4XEFA 2DB4A 1AVOB 3UMHA 4C7OB 5KYWA 3DAFA 1CGNA 3CEXA 4H54A 2LSEA 4XTKA 2HJ3A 1VLTA 3ZDLA 2W4BA 3M1CB 3NYLA 1M2OA 5L0HA 3EPVA 3ZTMA 3AGUA 4MVSA 2A6EF 1PCXA 4EBBA 1OW6A 1ZHYA 2G62A 5E33A 5KYNA 5KYYB 3O39A 2ZXRA 3FOPA 2FGYA 2M64A 1MMNA 2CCYA 4LERA 4QI2A 1H7IA 3SZRA 2Q9AA 3L1MA 3G4ZA 2KYHA 3OA1A 2QTVA 1YDIA 3HLZA 4LDRA 1S05A 4X0RA 5IY5C 4XLPF 1LPEA 1HY5A 3KYJA 3ZIBA 1C02A 4JCHA 4MVMA 4PK4A 2ICWG 4CS8C 4YL1A 3NYMA 4J7YA 3UMIA 4JVSA 5E3CA 3NKDA 4Z9IA 3B29A 1BR1A 1MNDA 3MFNA 5A6BA 1JPNA 1ZU4A 2WVOA 2KK1A 2C03A 1NSGB 3EHMA 4OIQF 1MNEA 1MQVA 3S27A 4DOZA 2HUJA 2AP3A 4CX9A 1JPJA 1U6HA 4OINF 1B68A 1YA9A 5L0DA 4P9FA 5L0FA 5TJ5E 3IQTA 2Y3HA 2B0JA 2EPOA 1NU9C 1JAFA 2LQGA 3RQGA 4EWCA 1IW7F 2P1AA 4LDQA 3FXHA 1L7CA 2LIGA 1K04A 2XLWA 2RSEB 1T6IA 1ZVZA 3A11A 3DMDA 4JRZA 5L0GA 4G78A 4W8PA 3AGTA 3CAXA 2H7VC 1QZXA 2KW3C 4PJNA 1APCA 3H65A 4CS8A 3VF0A 2R05A 1RXQA 5E3AA 4Q4ZF 2R7TA 3B0VC 2R7XA 3U8VA 1H9TA 1YZAA 5D91A 4YT2A 3AJMA 3EZHA 2EILC 5B3IA 2J9BA 4YJWA 3U2LA 4CIPA 3LEVA 5A6KA 3DE9A 4PJJA 4CS7A 4CSAC 2XLHA 1RKEB 4FAPB 4M63A 2Z15A 3QZCA 4O79A 1JR8A 4IGGA 2R7WA 1OCCC 5HSWA 2PF4E 3LEOA 2R7UA 3HKKA 1O5HA 4JIOA 1LS1A 3KPHA 2WL8A 1LI7A 3JSZA 3UMKA 3VM6A 5DLJA 2YVKA 3AG3C 5F28E 5AC4A 3JZ0A 4C3BA 1E84A 4J7TA 5L0JA 2XLDA 2IM8A 4CDAA 4IAQA 4MVZA 4PFOA 3SP1A 3X2QC 3TULA 3LJBA 4E17A 3U3BA 3HNIA 1T01A 4C3EA 2HJMA 2R9RB 2KQ9A 1SF8A 3EG9B 3LESA 3UGOA 1EI7A 5JVEA 1E86A 1NLXA 1W2WA 1V54C 2XLOA 3CQZA 5JP7A 2OQMA 2VH3A 3QVYA 3ZQYA 4PR9A 2FFHA 5DS4A 3SXZA 2D5RB 4D4NA 4JW1A 5KYXA 1DOVA 1JOGA 3GEHA 3RQEA 3QMKA 1IZMA 4IJJA 4G7ZF 2A1DD 5JT4A 3TK0A 1D1CA 5KYUA 5CI9A 3T6BA 5A69A 4ZLDA 1YLMA 2RD9A 4LLCA 3HJCA 1HE9A 3TOMA 3C63A 5DQZA 1YJGA 5B3SC 1T6UA 4U5EE 2GDCA 2EPLX 4LLEA 3SXKA 5A6AA 2VCBA 3LAYA 3DJUB 3R7CA 3E9VA 4UDVA 2OEVA 1NFOA 2WB7A 4XWJA 3M79A 2FAPB 1O3UA 1S7ZA 1YVIA 3M15A 2IXOA 3TD7A 2EIKC 2EPMX 3I5QA 3KH2A 1TKNA 3SYNA 3MBGA 2M4EA 4O6MA 3J06A 4Q7CA 2LK4A 3W2VA 4PJMA 1WTYA 3VYWA 1EQ1A 3ABKC 3NMKA 4NY3A 4PACA 2MWQA 1OXKA 2R25A 2J7PD 2L7AA 1SR2A 4OIRF 3GEEA 1NG1A 3GEIA 2JD3A 1Y4CA 1WWPA 4A2NB 4MQ9F 5EGYA 3C8GB 1Q0DA 3QW0A 2JPUA 2DYSC 4FX5A 3S29A 4DBQA 3ZC4A 2OG2A 4LDKA 1D0YA 1M56C 4XQ1A 3F46A 4WJ0A 5D92A 3RF3A 5KYWB 4OIPF 3NMIA 3S90A 1V74B 4HE8D 1RMVA 3AQBA 3W8HA 1BDJB 1FMVA 1YZCA 3ZWIA 2HV6A 4KC9A 3JRMO 2Q4FA 3US6A 2L9JA 4F4BA 2YKZA 4I1OB 2IBFA 2P0NA 1Q0MA 4KNVA 4AX2A 2LD6A 3QVZA 2XXAA 3GM2A 3M4BA 4BJ6A 4JJGA 2H7OA 2YL3A 4NC3A 3HNKA 4P9TA 4EUKB 3MYIA 3TJ5A 4J32B 2QUPA 3WHNA 1YARO 3GM1A 2EPNA 1KTMA 2PNOA 4N6CA 2DI3A 5L0CA 3IPMO 2PBEA 3NMJA 2IYLD 3B0PA 3HNJA 4ULWA 2F22A 5T3WA 3WG7C 2A6HF 1FTSA 3DAGA 4RDAA 2YLGA 1BR2A 1OQCA 4JEAA 2IXPA 2P7VA 2L81A 5L0IA 1RKCA 2QY9A 4JZAA 1FNTc 4JKVA 2O9XA 2Y3DA 3L34A 1KU2A 3B9QA 1QVXA 4QDLA 2OU6A 4WABA 4ANJA 4CIHA 2BE5F 3K1HA 2Q3TA 2EIJC 5COGA 3O55A 4JCZA 3F47A 4IWBA 1J8YF 4WGYA 3IHUA 1WOLA 2YL7A 3EGXA 1D0XA 3KMIA 3LNMB 4DRIB 3B0UX 3JYHA 2GA0A 1FMWA 4HFFB 3LS1A 4JTAB 4B6IA 1Z23A 1I4ZA 4KBLA 2I8BA 1GGQA 1C17M 1BR4A 1YA7O 3U9JA 3DE8A 4GYTA 4OIOF 2BC5A 4EIYA 2KC3A 1VTMP 2KGOA 4IARA 1FR0A 3QTHA 2XLMA 2R7RA 2NUTB 4K0DA 3ZVRA 1TQGA 5JS5A 1DOWA 3IQ5A 4U5GA 1HMOA 2NUPA 3SEOA 3L0IA 3GANA 2XL8A 2J0XA 3EH2A 5T1DB 4MVQA 1OCZC 2XM4A 1ST6A 2AU5A 3AG2C 4FWVA 2HSBA 2IXNA 2J9UA 2WVNA 3LLIA 4J30B 4Z9JA 2OJQA 3AOUA 4JURI 1GQAA 3O10A 2LFDA 4CS9C 3C8GD 3BEHA 3T6GB 1VB5A 1HW1A 4E7ZA 2CNWD 5COFA 4K1OA 1GS9A 2J0WA 2L6FA 3LLKA 2AVKA 2HKVA 1TR2A 2Q00A 3EFOB 3K1IC 2X0CA 2HZ8A 4OD4A 3ECSA 3IEEA 4BJ5C 2NPUA 2AWCA 3RH3A 1I4YA 2YLDA 1Z5ZA 3EQLF 3I4UA 4MS2A 4YT8A 3RW0A 3N0TA 1QPUA 1A7VA 1RCPA 4BPMA 1H9GA 4MW8A 2KSFA 3FOOA 4A4AA 2A0UA 1PD1A 2G3KA 4GQHA 2R7VA 1OR3A 3RKOF 5BQGA 2P6VA 1LKXA 1RKEA 5JSLA 2J9VA 4XEKA 2DGJA 4CJOA 4EBKA 3EHNA 3EGDB 3N24A 4NTBA 4DJ9A 5JLIA 4KI2A 3W8IA 4C7OA 4I3MA 3SXYA 1R5ID 2VB6A 2ZXOA 2UUHA 4XEVA 4CSAA 4CS9A 1K05A 4AE4A 3PDMP 3TQOA 1AUEA 3DM9B 5DVWA 3VRCA 4MVRA 5A6BD 3TJ6A 5KYUB 1LI5A 3Q7GA 2IXMA 2G3VA 1O87A 1ZHXA 1D1AA 4EHPA 2EPKX 3K1IA 3EG9A 2IOQA 4OD5A 3CSKA 3FVYA 2EINC 3DXJF 3Q6MA 5JRAA 4RBNA 4ER9A 3U0CA 4U5CE 1OCRC 2KNHA 2W9YA 4DRJB 1SMYF 4PJLA 1HE1A 1RJ9A 2OJED 4BG0A 4CBEA 1Z6AA 3V5XA 1UG7A 2AWYA 3JYYA 3PMRA 2E87A 3DD7A 4JEBA 4DVZA 4O6YA 1J8MF 1M2VB 3GODA 1OKKA 5CIVA 5BQIA 3ZQVA 3LNRA 5FCLA 4N6HA 4MVUA 1OW8A 2WVQA 4RD9A 3AG4C 1G8XA 2V26A 3FAJA
chains in the Genus database with same CATH topology
2Y3BA 3DZAA 3N2ZB 2Y39A 3EJNA 3OEOA 3X1OA 2KJGA 3UNGC 2PX0A 1VOMA 5EHHA 1MMDA 3W2WA 2XSEA 4FESA 3K7DA 4ZLCA 3MLGA 3K6BA 4BEJA 5E2QA 3Q7LA 4N06A 4E7SA 3WODF 1LVKA 3SNHA 2WZGA 3O6XA 3JRTA 2J45A 3I5PA 4HEAJ 2R7OA 5F5HA 5CI8A 1TWAA 2PFDA 4C7OA 2R7QA 3NKEA 2ZXPA 4H4KC 2W45A 3KL4A 4DBRA 2Q9CA 1ZU5A 1SZIA 2YZSA 4GEHA 4JJFA 1D0ZA 3RYLA 2V3CC 5KYYA 5BUOA 2VASA 3NRHA 3CZ6A 4YT5A 1ZYRF 3EGXB 2GFHA 2CGEA 2YEVA 2R7SA 3RFYA 4HFKB 4U5HA 3FHDA 3S28A 4DVYP 1OKKD 2Y3GA 3PHF2 5B1AC 3FDQA 1OCOC 1M57C 4XLNF 2NUPB 3POVA 1NU7D 2Q9BA 4BJTA 2YHSA 4IAOA 4MNDA 2CW0F 3DJNB 5B1BC 1VYKA 3ZG1A 5L3VA 3T6JA 4U5FE 2WZLA 3ASNC 2NUTA 2J7PA 2J9WA 5DQTA 3Q6NA 3UR3C 2DYRC 1VYIA 4I1MA 1TWCA 1D1BA 4BJ1A 1QLEC 2XRHA 5L3QA 3DM5A 5F5FA 2WZFA 4G0HA 2H7BA 1N1CA 3MX3A 1TWHA 4U5DE 1NZEA 4YN0B 2MYSA 4IRUA 3UGPA 3VAYA 2PP4A 5KYXB 3EFOA 3JT1A 5T3TA 3K66A 4AE4B 2ZPAA 3NYJA 2HV7A 4QI0A 1ZHWA 3AQCA 3AG1C 4BJ5A 5DS5A 1FFHA 1Z3IX 1VK5A 2PX3A 4O7GA 3OWTA 3RIPA 3JCUQ 4G7HF 3KKBA 2Y69C 3EGDA 1RJ9B 1FFTC 2X51A 3K33A 4P6IC 2XL4A 1Z63A 3EZIA 4YWQA 3S0XA 3T4RA 4G7OF 3ABMC 3LS0A 1V55C 4YT4A 3EH1A 4PFPA 1WGWA 3ZSUA 3NDBB 2EIMC 4O6NA 2NG1A 2A68F 1ZHTA 1VMAA 3HTKC 4K7BA 4XLPF 1MMGA 3E70C 2OCCC 4KI2A 4BJ6C 5DS6A 1M2VA 2CDQA 2ZXWC 1ZHZA 1MMAA 3ASOC 4U5BE 4Q5SF 4I44A 1PD0A 3V7OA 2XXAB 3ABLC 2W4MA 2J46A 4C3DA 4W8KA 4AK9A 3NG1A 4KNWA 4LACB 2A69F 3ITFA 2C04A 1TWGA 2CNWA 4C7OB 3UMHA 5KYWA 3DAFA 2LSEA 4XTKA 2W4BA 3M1CB 3NYLA 1M2OA 3EPVA 2A6EF 1PCXA 4EBBA 2G62A 1ZHYA 5KYNA 5E33A 5KYYB 3O39A 2ZXRA 4LERA 2FGYA 1MMNA 4QI2A 3SZRA 2Q9AA 3OA1A 2QTVA 3HLZA 5IY5C 4X0RA 3ZIBA 4JCHA 4PK4A 4CS8C 3NYMA 3UMIA 4JVSA 5E3CA 3NKDA 1BR1A 1MNDA 1JPNA 1ZU4A 2WVOA 2C03A 3EHMA 4OIQF 1MNEA 3S27A 4DOZA 1JPJA 4OINF 2Y3HA 2B0JA 1NU9C 4EWCA 1IW7F 3DMDA 2H7VC 1QZXA 2KW3C 4PJNA 3H65A 4CS8A 2R7XA 5E3AA 4Q4ZF 2R7TA 3B0VC 4YT2A 5D91A 3EZHA 2EILC 4YJWA 3LEVA 4PJJA 4CS7A 4CSAC 4M63A 2Z15A 3QZCA 4O79A 2R7WA 2R7UA 1OCCC 5HSWA 2PF4E 1O5HA 1LS1A 3UMKA 2WL8A 3JSZA 5DLJA 3AG3C 4C3BA 4PFOA 3SP1A 3X2QC 3LJBA 4C3EA 2KQ9A 1SF8A 3EG9B 3LESA 3UGOA 1W2WA 1V54C 3CQZA 2VH3A 2FFHA 5DS4A 2D5RB 4JW1A 5KYXA 4G7ZF 3QMKA 1IZMA 4IJJA 2A1DD 4ZLDA 1D1CA 5KYUA 5CI9A 3T6BA 4LLCA 3HJCA 5DQZA 5B3SC 4U5EE 4LLEA 3LAYA 3DJUB 3E9VA 2WB7A 4XWJA 1S7ZA 2IXOA 3TD7A 2EIKC 3KH2A 3I5QA 1TKNA 3SYNA 2M4EA 4O6MA 4Q7CA 3W2VA 4PJMA 3VYWA 3ABKC 4NY3A 2MWQA 2J7PD 4OIRF 1NG1A 2JD3A 4A2NB 4MQ9F 5EGYA 2DYSC 4FX5A 3S29A 4DBQA 3ZC4A 2OG2A 1D0YA 1M56C 5D92A 3F46A 4WJ0A 5KYWB 4OIPF 4HE8D 3AQBA 3W8HA 1FMVA 2HV6A 4KC9A 2L9JA 4F4BA 4I1OB 4KNVA 4AX2A 2XXAA 4BJ6A 4JJGA 2H7OA 4J32B 2IYLD 3B0PA 4ULWA 5T3WA 3WG7C 2A6HF 1FTSA 3DAGA 4RDAA 1BR2A 2IXPA 2P7VA 2L81A 2QY9A 4JZAA 2O9XA 2Y3DA 3L34A 1KU2A 3B9QA 4QDLA 4ANJA 4CIHA 2BE5F 3K1HA 2Q3TA 2EIJC 3F47A 4IWBA 1J8YF 3EGXA 1D0XA 3KMIA 3B0UX 3JYHA 1FMWA 4HFFB 3LS1A 4B6IA 1Z23A 4KBLA 2I8BA 1BR4A 4GYTA 4OIOF 2KGOA 2R7RA 2NUTB 4K0DA 3ZVRA 4U5GA 2NUPA 3SEOA 3L0IA 3GANA 2J0XA 3EH2A 5T1DB 1OCZC 1ST6A 3AG2C 4FWVA 2IXNA 2J9UA 3LLIA 2WVNA 4J30B 4CS9C 4JURI 4E7ZA 2CNWD 2J0WA 3LLKA 3EFOB 1TR2A 3K1IC 4OD4A 3ECSA 3IEEA 4BJ5C 3RH3A 3I4UA 1Z5ZA 3EQLF 4YT8A 3N0TA 1PD1A 2G3KA 2R7VA 3RKOF 2P6VA 1LKXA 2J9VA 2DGJA 3EHNA 3N24A 3EGDB 3W8IA 4I3MA 2VB6A 2ZXOA 4CSAA 4CS9A 4AE4A 3DM9B 5DVWA 5KYUB 3Q7GA 2IXMA 2G3VA 1O87A 1ZHXA 1D1AA 3EG9A 2IOQA 4OD5A 3CSKA 3FVYA 2EINC 3DXJF 3Q6MA 4RBNA 4U5CE 1OCRC 2KNHA 2W9YA 1SMYF 4PJLA 1RJ9A 4BG0A 4CBEA 1Z6AA 3PMRA 2E87A 3DD7A 4DVZA 4O6YA 1J8MF 1M2VB 3GODA 1OKKA 3LNRA 5FCLA 2WVQA 4RD9A 3AG4C 1G8XA 2V26A 3FAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VK5 A;  2Q3T A;  3GAN A; 
#chains in the Genus database with same CATH topology
 2Y3B A;  3C7J A;  3DZA A;  4NTF A;  4E18 A;  3N2Z B;  4XPW A;  1EA8 A;  4DRH B;  3KYI A;  2Y39 A;  2YQY A;  2J8W A;  3DI5 A;  3EJN A;  1ORJ A;  3OEO A;  3X1O A;  2KJG A;  2XLE A;  3GWN A;  3HNL A;  3L8I A;  3UNG C;  5A6J A;  2PX0 A;  1VOM A;  4JE9 A;  1A41 A;  256B A;  4YK5 A;  1CPQ A;  3RVY A;  4DXW A;  4MTG A;  1C03 A;  5EHH A;  3DKA A;  1MMD A;  3W2W A;  2XSE A;  3DWW A;  4FES A;  3K7D A;  4ZLC A;  3MLG A;  3K6B A;  1CGO A;  1SYQ A;  5E2Q A;  3TOL A;  4BEJ A;  3S84 A;  3Q7L A;  4N06 A;  4E7S A;  1EKY A;  3MYF A;  3QW1 A;  1LVK A;  3SNH A;  2LP4 A;  2WZG A;  3WOD F;  3O6X A;  3B71 A;  4NCQ A;  3JRT A;  4YL3 A;  2QNL A;  3T9O A;  1XZP A;  1CGM E;  2J45 A;  1G4W R;  2ETS A;  3RVZ A;  2HMZ A;  3I5P A;  2Q7R A;  1TFO B;  4HEA J;  2R7O A;  2R02 A;  3W4Y A;  1HW2 A;  5F5H A;  5CI8 A;  4JTD B;  1L3P A;  1T5O A;  1U89 A;  1TWA A;  2PFD A;  1A7E A;  1T6Q A;  3L8J A;  3U8P A;  5JUA A;  5K0I A;  2OEX A;  2TMV P;  2R7Q A;  3NKE A;  2ZXP A;  2OOC A;  1YYX A;  2VCA A;  4H4K C;  1Z63 A;  2W45 A;  1UFB A;  3KL4 A;  4DBR A;  1G4U S;  1HMD A;  1LIH A;  1ZU5 A;  2Q9C A;  4L6R A;  5AC5 A;  1SZI A;  2YZS A;  2P61 A;  1JRA A;  1Q0G A;  4GEH A;  4JJF A;  1D0Z A;  3RYL A;  3C62 A;  3JTL O;  4MTO A;  3S9O A;  5KYY A;  2V3C C;  5BUO A;  2VAS A;  3NRH A;  2NSF A;  1BBH A;  3CZ6 A;  2XL6 A;  4YT5 A;  2B0H A;  1ZYR F;  3GM3 A;  1LM3 B;  3WAQ A;  3EGX B;  2GFH A;  2CGE A;  2YEV A;  1G5Z A;  1ZZP A;  5COM A;  2R7S A;  3RFY A;  4MVO A;  4HFK B;  4N4W A;  4U5H A;  2VCC A;  3FHD A;  1PV3 A;  3ATP A;  3IQC A;  3S28 A;  1Z7Q c;  1QKR A;  1OKK D;  4IB4 A;  1H6G A;  4DVY P;  4R32 A;  1ZW2 A;  2Y3G A;  1FAP B;  3PHF 2;  5B1A C;  3H2V A;  4CDY A;  3FDQ A;  1OCO C;  1M57 C;  4XLN F;  4MW3 A;  4CDV A;  2NUP B;  3POV A;  2HFI A;  1K40 A;  1E2X A;  1YAU O;  2YL0 A;  1NU7 D;  2Q9B A;  2A0B A;  1CPR A;  1XZQ A;  2LFF A;  2YHS A;  4IAO A;  3LUT B;  1AEP A;  4MND A;  3U3F A;  2CW0 F;  3V5Y A;  1WAT A;  5BQH A;  3DJN B;  4XPX A;  1VYK A;  1A0B A;  1LE2 A;  5B1B C;  2QLA A;  3ZG1 A;  2YLI A;  3JSE O;  1E83 A;  5L3V A;  1ORS C;  3T6J A;  4U5F E;  3U9M A;  2WZL A;  2R03 A;  4XPY A;  4JC7 A;  3ASN C;  2NUT A;  2J7P A;  2J9W A;  4YL0 A;  5DQT A;  3Q6N A;  3UR3 C;  3ZTZ A;  2DYR C;  2XS8 A;  1VLS A;  1VYI A;  4I1M A;  1T9K A;  1TWC A;  1D1B A;  3R2P A;  4MTF A;  4BJ1 A;  1QLE C;  2XRH A;  3V5Z A;  1LS4 A;  1QQ3 A;  1QSP A;  2UUI A;  1BZ4 A;  2XS1 A;  4ULV A;  5L3Q A;  3DM5 A;  4U9E A;  5F5F A;  2WZF A;  4G0H A;  2H7B A;  1N1C A;  1WN0 A;  3MX3 A;  1TWH A;  4U5D E;  1NZE A;  4YN0 B;  2MYS A;  4IRU A;  3RQF A;  4NTA A;  3UGP A;  3VAY A;  2PP4 A;  5KYX B;  1Y6D A;  3EFO A;  3C18 A;  3JT1 A;  3K66 A;  5T3T A;  3U5S A;  1R4T A;  4AE4 B;  2ZPA A;  3NYJ A;  2ASR A;  5HV9 A;  2HV7 A;  1KNY A;  2ZD9 A;  3IQ6 A;  4ONS A;  4QI0 A;  4E0I A;  3U2M A;  1ZHW A;  1M6T A;  3FMS A;  2HMQ A;  2JX0 A;  2LCH A;  4AL0 A;  3AQC A;  2OKU A;  3AG1 C;  4BJ5 A;  1FFH A;  1Z3I X;  5DS5 A;  1F1M A;  1VK5 A;  3C8Z A;  2I15 A;  3FAP B;  3G50 A;  2XM0 A;  2PX3 A;  2YRF A;  4O7G A;  4WGZ A;  3OWT A;  3RIP A;  2H8A A;  3JCU Q;  4G7H F;  3KKB A;  2Y69 C;  3EGD A;  1Q0F A;  1RJ9 B;  1FFT C;  2GWW A;  2X51 A;  3GOR A;  2XL4 A;  3K33 A;  4P6I C;  4Z9H A;  1I5N A;  3SXM A;  3EZI A;  5EK0 A;  4YWQ A;  3S0X A;  5AGF A;  3T4R A;  4G7O F;  3ABM C;  1OXB A;  2L6G A;  3LS0 A;  1A7D A;  4CJG A;  1V55 C;  4YT4 A;  1XWJ A;  1ZW3 A;  3EH1 A;  4PFP A;  1WGW A;  1E85 A;  3PCV A;  2QE9 A;  1YYJ A;  3ZSU A;  3NDB B;  4AL1 A;  3M4C A;  2D4U A;  2MHR A;  2EIM C;  3H2U A;  3BRJ A;  2XLV A;  4O6N A;  4NQF A;  2L6H A;  2NG1 A;  2A68 F;  1ZHT A;  1VMA A;  4EKW A;  2GAQ A;  2HSQ A;  3HTK C;  2YWA A;  4U9D A;  1WAS A;  3A9C A;  1MMG A;  4K7B A;  3E70 C;  2OCC C;  4BJT A;  4BEM J;  2CYD A;  4BJ6 C;  5DS6 A;  1M2V A;  1Q0K A;  2CDQ A;  2VC9 A;  2ZXW C;  2HS5 A;  1ZHZ A;  1NBB A;  1MMA A;  3ASO C;  1JMW A;  4U5B E;  4Q5S F;  3GWL A;  4I44 A;  4JTC B;  2YL1 A;  1PD0 A;  3G4X A;  3V7O A;  2XXA B;  3ABL C;  1U0B B;  4E0H A;  2NSG A;  2W4M A;  5FZT A;  4D4X A;  1NFN A;  2J46 A;  2BL2 A;  5GPG B;  4C3D A;  4W8K A;  1GM5 A;  4AK9 A;  1OW7 A;  1TFK B;  1ORY A;  1V4A A;  3NG1 A;  4KNW A;  4LAC B;  1LE4 A;  2A69 F;  3C8G A;  1OR2 A;  3ITF A;  2C04 A;  1TWG A;  2CNW A;  4EBJ A;  4XEF A;  2DB4 A;  1AVO B;  3UMH A;  4C7O B;  5KYW A;  3DAF A;  1CGN A;  3CEX A;  4H54 A;  2LSE A;  4XTK A;  2HJ3 A;  1VLT A;  3ZDL A;  2W4B A;  3M1C B;  3NYL A;  1M2O A;  5L0H A;  3EPV A;  3ZTM A;  3AGU A;  4MVS A;  2A6E F;  1PCX A;  4EBB A;  1OW6 A;  1ZHY A;  2G62 A;  5E33 A;  5KYN A;  5KYY B;  3O39 A;  2ZXR A;  3FOP A;  2FGY A;  2M64 A;  1MMN A;  2CCY A;  4LER A;  4QI2 A;  1H7I A;  3SZR A;  2Q9A A;  3L1M A;  3G4Z A;  2KYH A;  3OA1 A;  2QTV A;  1YDI A;  3HLZ A;  4LDR A;  1S05 A;  4X0R A;  5IY5 C;  4XLP F;  1LPE A;  1HY5 A;  3KYJ A;  3ZIB A;  1C02 A;  4JCH A;  4MVM A;  4PK4 A;  2ICW G;  4CS8 C;  4YL1 A;  3NYM A;  4J7Y A;  3UMI A;  4JVS A;  5E3C A;  3NKD A;  4Z9I A;  3B29 A;  1BR1 A;  1MND A;  3MFN A;  5A6B A;  1JPN A;  1ZU4 A;  2WVO A;  2KK1 A;  2C03 A;  1NSG B;  3EHM A;  4OIQ F;  1MNE A;  1MQV A;  3S27 A;  4DOZ A;  2HUJ A;  2AP3 A;  4CX9 A;  1JPJ A;  1U6H A;  4OIN F;  1B68 A;  1YA9 A;  5L0D A;  4P9F A;  5L0F A;  5TJ5 E;  3IQT A;  2Y3H A;  2B0J A;  2EPO A;  1NU9 C;  1JAF A;  2LQG A;  3RQG A;  4EWC A;  1IW7 F;  2P1A A;  4LDQ A;  3FXH A;  1L7C A;  2LIG A;  1K04 A;  2XLW A;  2RSE B;  1T6I A;  1ZVZ A;  3A11 A;  3DMD A;  4JRZ A;  5L0G A;  4G78 A;  4W8P A;  3AGT A;  3CAX A;  2H7V C;  1QZX A;  2KW3 C;  4PJN A;  1APC A;  3H65 A;  4CS8 A;  3VF0 A;  2R05 A;  1RXQ A;  5E3A A;  4Q4Z F;  2R7T A;  3B0V C;  2R7X A;  3U8V A;  1H9T A;  1YZA A;  5D91 A;  4YT2 A;  3AJM A;  3EZH A;  2EIL C;  5B3I A;  2J9B A;  4YJW A;  3U2L A;  4CIP A;  3LEV A;  5A6K A;  3DE9 A;  4PJJ A;  4CS7 A;  4CSA C;  2XLH A;  1RKE B;  4FAP B;  4M63 A;  2Z15 A;  3QZC A;  4O79 A;  1JR8 A;  4IGG A;  2R7W A;  1OCC C;  5HSW A;  2PF4 E;  3LEO A;  2R7U A;  3HKK A;  1O5H A;  4JIO A;  1LS1 A;  3KPH A;  2WL8 A;  1LI7 A;  3JSZ A;  3UMK A;  3VM6 A;  5DLJ A;  2YVK A;  3AG3 C;  5F28 E;  5AC4 A;  3JZ0 A;  4C3B A;  1E84 A;  4J7T A;  5L0J A;  2XLD A;  2IM8 A;  4CDA A;  4IAQ A;  4MVZ A;  4PFO A;  3SP1 A;  3X2Q C;  3TUL A;  3LJB A;  4E17 A;  3U3B A;  3HNI A;  1T01 A;  4C3E A;  2HJM A;  2R9R B;  2KQ9 A;  1SF8 A;  3EG9 B;  3LES A;  3UGO A;  1EI7 A;  5JVE A;  1E86 A;  1NLX A;  1W2W A;  1V54 C;  2XLO A;  3CQZ A;  5JP7 A;  2OQM A;  2VH3 A;  3QVY A;  3ZQY A;  4PR9 A;  2FFH A;  5DS4 A;  3SXZ A;  2D5R B;  4D4N A;  4JW1 A;  5KYX A;  1DOV A;  1JOG A;  3GEH A;  3RQE A;  3QMK A;  1IZM A;  4IJJ A;  4G7Z F;  2A1D D;  5JT4 A;  3TK0 A;  1D1C A;  5KYU A;  5CI9 A;  3T6B A;  5A69 A;  4ZLD A;  1YLM A;  2RD9 A;  4LLC A;  3HJC A;  1HE9 A;  3TOM A;  3C63 A;  5DQZ A;  1YJG A;  5B3S C;  1T6U A;  4U5E E;  2GDC A;  2EPL X;  4LLE A;  3SXK A;  5A6A A;  2VCB A;  3LAY A;  3DJU B;  3R7C A;  3E9V A;  4UDV A;  2OEV A;  1NFO A;  2WB7 A;  4XWJ A;  3M79 A;  2FAP B;  1O3U A;  1S7Z A;  1YVI A;  3M15 A;  2IXO A;  3TD7 A;  2EIK C;  2EPM X;  3I5Q A;  3KH2 A;  1TKN A;  3SYN A;  3MBG A;  2M4E A;  4O6M A;  3J06 A;  4Q7C A;  2LK4 A;  3W2V A;  4PJM A;  1WTY A;  3VYW A;  1EQ1 A;  3ABK C;  3NMK A;  4NY3 A;  4PAC A;  2MWQ A;  1OXK A;  2R25 A;  2J7P D;  2L7A A;  1SR2 A;  4OIR F;  3GEE A;  1NG1 A;  3GEI A;  2JD3 A;  1Y4C A;  1WWP A;  4A2N B;  4MQ9 F;  5EGY A;  3C8G B;  1Q0D A;  3QW0 A;  2JPU A;  2DYS C;  4FX5 A;  3S29 A;  4DBQ A;  3ZC4 A;  2OG2 A;  4LDK A;  1D0Y A;  1M56 C;  4XQ1 A;  3F46 A;  4WJ0 A;  5D92 A;  3RF3 A;  5KYW B;  4OIP F;  3NMI A;  3S90 A;  1V74 B;  4HE8 D;  1RMV A;  3AQB A;  3W8H A;  1BDJ B;  1FMV A;  1YZC A;  3ZWI A;  2HV6 A;  4KC9 A;  3JRM O;  2Q4F A;  3US6 A;  2L9J A;  4F4B A;  2YKZ A;  4I1O B;  2IBF A;  2P0N A;  1Q0M A;  4KNV A;  4AX2 A;  2LD6 A;  3QVZ A;  2XXA A;  3GM2 A;  3M4B A;  4BJ6 A;  4JJG A;  2H7O A;  2YL3 A;  4NC3 A;  3HNK A;  4P9T A;  4EUK B;  3MYI A;  3TJ5 A;  4J32 B;  2QUP A;  3WHN A;  1YAR O;  3GM1 A;  2EPN A;  1KTM A;  2PNO A;  4N6C A;  2DI3 A;  5L0C A;  3IPM O;  2PBE A;  3NMJ A;  2IYL D;  3B0P A;  3HNJ A;  4ULW A;  2F22 A;  5T3W A;  3WG7 C;  2A6H F;  1FTS A;  3DAG A;  4RDA A;  2YLG A;  1BR2 A;  1OQC A;  4JEA A;  2IXP A;  2P7V A;  2L81 A;  5L0I A;  1RKC A;  2QY9 A;  4JZA A;  1FNT c;  4JKV A;  2O9X A;  2Y3D A;  3L34 A;  1KU2 A;  3B9Q A;  1QVX A;  4QDL A;  2OU6 A;  4WAB A;  4ANJ A;  4CIH A;  2BE5 F;  3K1H A;  2Q3T A;  2EIJ C;  5COG A;  3O55 A;  4JCZ A;  3F47 A;  4IWB A;  1J8Y F;  4WGY A;  3IHU A;  1WOL A;  2YL7 A;  3EGX A;  1D0X A;  3KMI A;  3LNM B;  4DRI B;  3B0U X;  3JYH A;  2GA0 A;  1FMW A;  4HFF B;  3LS1 A;  4JTA B;  4B6I A;  1Z23 A;  1I4Z A;  4KBL A;  2I8B A;  1GGQ A;  1C17 M;  1BR4 A;  1YA7 O;  3U9J A;  3DE8 A;  4GYT A;  4OIO F;  2BC5 A;  4EIY A;  2KC3 A;  1VTM P;  2KGO A;  4IAR A;  1FR0 A;  3QTH A;  2XLM A;  2R7R A;  2NUT B;  4K0D A;  3ZVR A;  1TQG A;  5JS5 A;  1DOW A;  3IQ5 A;  4U5G A;  1HMO A;  2NUP A;  3SEO A;  3L0I A;  3GAN A;  2XL8 A;  2J0X A;  3EH2 A;  5T1D B;  4MVQ A;  1OCZ C;  2XM4 A;  1ST6 A;  2AU5 A;  3AG2 C;  4FWV A;  2HSB A;  2IXN A;  2J9U A;  2WVN A;  3LLI A;  4J30 B;  4Z9J A;  2OJQ A;  3AOU A;  4JUR I;  1GQA A;  3O10 A;  2LFD A;  4CS9 C;  3C8G D;  3BEH A;  3T6G B;  1VB5 A;  1HW1 A;  4E7Z A;  2CNW D;  5COF A;  4K1O A;  1GS9 A;  2J0W A;  2L6F A;  3LLK A;  2AVK A;  2HKV A;  1TR2 A;  2Q00 A;  3EFO B;  3K1I C;  2X0C A;  2HZ8 A;  4OD4 A;  3ECS A;  3IEE A;  4BJ5 C;  2NPU A;  2AWC A;  3RH3 A;  1I4Y A;  2YLD A;  1Z5Z A;  3EQL F;  3I4U A;  4MS2 A;  4YT8 A;  3RW0 A;  3N0T A;  1QPU A;  1A7V A;  1RCP A;  4BPM A;  1H9G A;  4MW8 A;  2KSF A;  3FOO A;  4A4A A;  2A0U A;  1PD1 A;  2G3K A;  4GQH A;  2R7V A;  1OR3 A;  3RKO F;  5BQG A;  2P6V A;  1LKX A;  1RKE A;  5JSL A;  2J9V A;  4XEK A;  2DGJ A;  4CJO A;  4EBK A;  3EHN A;  3EGD B;  3N24 A;  4NTB A;  4DJ9 A;  5JLI A;  4KI2 A;  3W8I A;  4C7O A;  4I3M A;  3SXY A;  1R5I D;  2VB6 A;  2ZXO A;  2UUH A;  4XEV A;  4CSA A;  4CS9 A;  1K05 A;  4AE4 A;  3PDM P;  3TQO A;  1AUE A;  3DM9 B;  5DVW A;  3VRC A;  4MVR A;  5A6B D;  3TJ6 A;  5KYU B;  1LI5 A;  3Q7G A;  2IXM A;  2G3V A;  1O87 A;  1ZHX A;  1D1A A;  4EHP A;  2EPK X;  3K1I A;  3EG9 A;  2IOQ A;  4OD5 A;  3CSK A;  3FVY A;  2EIN C;  3DXJ F;  3Q6M A;  5JRA A;  4RBN A;  4ER9 A;  3U0C A;  4U5C E;  1OCR C;  2KNH A;  2W9Y A;  4DRJ B;  1SMY F;  4PJL A;  1HE1 A;  1RJ9 A;  2OJE D;  4BG0 A;  4CBE A;  1Z6A A;  3V5X A;  1UG7 A;  2AWY A;  3JYY A;  3PMR A;  2E87 A;  3DD7 A;  4JEB A;  4DVZ A;  4O6Y A;  1J8M F;  1M2V B;  3GOD A;  1OKK A;  5CIV A;  5BQI A;  3ZQV A;  3LNR A;  5FCL A;  4N6H A;  4MVU A;  1OW8 A;  2WVQ A;  4RD9 A;  3AG4 C;  1G8X A;  2V26 A;  3FAJ A; 
#chains in the Genus database with same CATH homology
 2Y3B A;  3DZA A;  3N2Z B;  2Y39 A;  3EJN A;  3OEO A;  3X1O A;  2KJG A;  3UNG C;  2PX0 A;  1VOM A;  5EHH A;  1MMD A;  3W2W A;  2XSE A;  4FES A;  3K7D A;  4ZLC A;  3MLG A;  3K6B A;  4BEJ A;  5E2Q A;  3Q7L A;  4N06 A;  4E7S A;  3WOD F;  1LVK A;  3SNH A;  2WZG A;  3O6X A;  3JRT A;  2J45 A;  3I5P A;  4HEA J;  2R7O A;  5F5H A;  5CI8 A;  1TWA A;  2PFD A;  4C7O A;  2R7Q A;  3NKE A;  2ZXP A;  4H4K C;  2W45 A;  3KL4 A;  4DBR A;  2Q9C A;  1ZU5 A;  1SZI A;  2YZS A;  4GEH A;  4JJF A;  1D0Z A;  3RYL A;  2V3C C;  5KYY A;  5BUO A;  2VAS A;  3NRH A;  3CZ6 A;  4YT5 A;  1ZYR F;  3EGX B;  2GFH A;  2CGE A;  2YEV A;  2R7S A;  3RFY A;  4HFK B;  4U5H A;  3FHD A;  3S28 A;  4DVY P;  1OKK D;  2Y3G A;  3PHF 2;  5B1A C;  3FDQ A;  1OCO C;  1M57 C;  4XLN F;  2NUP B;  3POV A;  1NU7 D;  2Q9B A;  4BJT A;  2YHS A;  4IAO A;  4MND A;  2CW0 F;  3DJN B;  5B1B C;  1VYK A;  3ZG1 A;  5L3V A;  3T6J A;  4U5F E;  2WZL A;  3ASN C;  2NUT A;  2J7P A;  2J9W A;  5DQT A;  3Q6N A;  3UR3 C;  2DYR C;  1VYI A;  4I1M A;  1TWC A;  1D1B A;  4BJ1 A;  1QLE C;  2XRH A;  5L3Q A;  3DM5 A;  5F5F A;  2WZF A;  4G0H A;  2H7B A;  1N1C A;  3MX3 A;  1TWH A;  4U5D E;  1NZE A;  4YN0 B;  2MYS A;  4IRU A;  3UGP A;  3VAY A;  2PP4 A;  5KYX B;  3EFO A;  3JT1 A;  5T3T A;  3K66 A;  4AE4 B;  2ZPA A;  3NYJ A;  2HV7 A;  4QI0 A;  1ZHW A;  3AQC A;  3AG1 C;  4BJ5 A;  5DS5 A;  1FFH A;  1Z3I X;  1VK5 A;  2PX3 A;  4O7G A;  3OWT A;  3RIP A;  3JCU Q;  4G7H F;  3KKB A;  2Y69 C;  3EGD A;  1RJ9 B;  1FFT C;  2X51 A;  3K33 A;  4P6I C;  2XL4 A;  1Z63 A;  3EZI A;  4YWQ A;  3S0X A;  3T4R A;  4G7O F;  3ABM C;  3LS0 A;  1V55 C;  4YT4 A;  3EH1 A;  4PFP A;  1WGW A;  3ZSU A;  3NDB B;  2EIM C;  4O6N A;  2NG1 A;  2A68 F;  1ZHT A;  1VMA A;  3HTK C;  4K7B A;  4XLP F;  1MMG A;  3E70 C;  2OCC C;  4KI2 A;  4BJ6 C;  5DS6 A;  1M2V A;  2CDQ A;  2ZXW C;  1ZHZ A;  1MMA A;  3ASO C;  4U5B E;  4Q5S F;  4I44 A;  1PD0 A;  3V7O A;  2XXA B;  3ABL C;  2W4M A;  2J46 A;  4C3D A;  4W8K A;  4AK9 A;  3NG1 A;  4KNW A;  4LAC B;  2A69 F;  3ITF A;  2C04 A;  1TWG A;  2CNW A;  4C7O B;  3UMH A;  5KYW A;  3DAF A;  2LSE A;  4XTK A;  2W4B A;  3M1C B;  3NYL A;  1M2O A;  3EPV A;  2A6E F;  1PCX A;  4EBB A;  2G62 A;  1ZHY A;  5KYN A;  5E33 A;  5KYY B;  3O39 A;  2ZXR A;  4LER A;  2FGY A;  1MMN A;  4QI2 A;  3SZR A;  2Q9A A;  3OA1 A;  2QTV A;  3HLZ A;  5IY5 C;  4X0R A;  3ZIB A;  4JCH A;  4PK4 A;  4CS8 C;  3NYM A;  3UMI A;  4JVS A;  5E3C A;  3NKD A;  1BR1 A;  1MND A;  1JPN A;  1ZU4 A;  2WVO A;  2C03 A;  3EHM A;  4OIQ F;  1MNE A;  3S27 A;  4DOZ A;  1JPJ A;  4OIN F;  2Y3H A;  2B0J A;  1NU9 C;  4EWC A;  1IW7 F;  3DMD A;  2H7V C;  1QZX A;  2KW3 C;  4PJN A;  3H65 A;  4CS8 A;  2R7X A;  5E3A A;  4Q4Z F;  2R7T A;  3B0V C;  4YT2 A;  5D91 A;  3EZH A;  2EIL C;  4YJW A;  3LEV A;  4PJJ A;  4CS7 A;  4CSA C;  4M63 A;  2Z15 A;  3QZC A;  4O79 A;  2R7W A;  2R7U A;  1OCC C;  5HSW A;  2PF4 E;  1O5H A;  1LS1 A;  3UMK A;  2WL8 A;  3JSZ A;  5DLJ A;  3AG3 C;  4C3B A;  4PFO A;  3SP1 A;  3X2Q C;  3LJB A;  4C3E A;  2KQ9 A;  1SF8 A;  3EG9 B;  3LES A;  3UGO A;  1W2W A;  1V54 C;  3CQZ A;  2VH3 A;  2FFH A;  5DS4 A;  2D5R B;  4JW1 A;  5KYX A;  4G7Z F;  3QMK A;  1IZM A;  4IJJ A;  2A1D D;  4ZLD A;  1D1C A;  5KYU A;  5CI9 A;  3T6B A;  4LLC A;  3HJC A;  5DQZ A;  5B3S C;  4U5E E;  4LLE A;  3LAY A;  3DJU B;  3E9V A;  2WB7 A;  4XWJ A;  1S7Z A;  2IXO A;  3TD7 A;  2EIK C;  3KH2 A;  3I5Q A;  1TKN A;  3SYN A;  2M4E A;  4O6M A;  4Q7C A;  3W2V A;  4PJM A;  3VYW A;  3ABK C;  4NY3 A;  2MWQ A;  2J7P D;  4OIR F;  1NG1 A;  2JD3 A;  4A2N B;  4MQ9 F;  5EGY A;  2DYS C;  4FX5 A;  3S29 A;  4DBQ A;  3ZC4 A;  2OG2 A;  1D0Y A;  1M56 C;  5D92 A;  3F46 A;  4WJ0 A;  5KYW B;  4OIP F;  4HE8 D;  3AQB A;  3W8H A;  1FMV A;  2HV6 A;  4KC9 A;  2L9J A;  4F4B A;  4I1O B;  4KNV A;  4AX2 A;  2XXA A;  4BJ6 A;  4JJG A;  2H7O A;  4J32 B;  2IYL D;  3B0P A;  4ULW A;  5T3W A;  3WG7 C;  2A6H F;  1FTS A;  3DAG A;  4RDA A;  1BR2 A;  2IXP A;  2P7V A;  2L81 A;  2QY9 A;  4JZA A;  2O9X A;  2Y3D A;  3L34 A;  1KU2 A;  3B9Q A;  4QDL A;  4ANJ A;  4CIH A;  2BE5 F;  3K1H A;  2Q3T A;  2EIJ C;  3F47 A;  4IWB A;  1J8Y F;  3EGX A;  1D0X A;  3KMI A;  3B0U X;  3JYH A;  1FMW A;  4HFF B;  3LS1 A;  4B6I A;  1Z23 A;  4KBL A;  2I8B A;  1BR4 A;  4GYT A;  4OIO F;  2KGO A;  2R7R A;  2NUT B;  4K0D A;  3ZVR A;  4U5G A;  2NUP A;  3SEO A;  3L0I A;  3GAN A;  2J0X A;  3EH2 A;  5T1D B;  1OCZ C;  1ST6 A;  3AG2 C;  4FWV A;  2IXN A;  2J9U A;  3LLI A;  2WVN A;  4J30 B;  4CS9 C;  4JUR I;  4E7Z A;  2CNW D;  2J0W A;  3LLK A;  3EFO B;  1TR2 A;  3K1I C;  4OD4 A;  3ECS A;  3IEE A;  4BJ5 C;  3RH3 A;  3I4U A;  1Z5Z A;  3EQL F;  4YT8 A;  3N0T A;  1PD1 A;  2G3K A;  2R7V A;  3RKO F;  2P6V A;  1LKX A;  2J9V A;  2DGJ A;  3EHN A;  3N24 A;  3EGD B;  3W8I A;  4I3M A;  2VB6 A;  2ZXO A;  4CSA A;  4CS9 A;  4AE4 A;  3DM9 B;  5DVW A;  5KYU B;  3Q7G A;  2IXM A;  2G3V A;  1O87 A;  1ZHX A;  1D1A A;  3EG9 A;  2IOQ A;  4OD5 A;  3CSK A;  3FVY A;  2EIN C;  3DXJ F;  3Q6M A;  4RBN A;  4U5C E;  1OCR C;  2KNH A;  2W9Y A;  1SMY F;  4PJL A;  1RJ9 A;  4BG0 A;  4CBE A;  1Z6A A;  3PMR A;  2E87 A;  3DD7 A;  4DVZ A;  4O6Y A;  1J8M F;  1M2V B;  3GOD A;  1OKK A;  3LNR A;  5FCL A;  2WVQ A;  4RD9 A;  3AG4 C;  1G8X A;  2V26 A;  3FAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...