2Q3TA

Ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at3g22680
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
121
structure length
121
Chain Sequence
GSLLRRAEMYQDYMKQVPIPTNRGSLIPFTSWVGLSISMKQLYGQPLHYLTNVLLQRWDQSRFGTDSEEQRLDSIIHPTKAEATIWLVEEIHRLTPSHLHMALLWRSDPMYHSFIDPIFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein At3g22680
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 41
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09187 RdDM_RDM1 RNA-directed DNA methylation 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.690 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2q3tA00
2Q3TA 1VK5A 3GANA
chains in the Genus database with same CATH superfamily
2NUPA 2QTVA 2Y3DA 4K1OA 4F4BA 3JRTA 2Y69C 2A69F 2OQMA 2XS1A 4FESA 4XEKA 5FZTA 1FMWA 5B1AC 5L3QA 2XS8A 2G3KA 1FFTC 1O87A 1LKXA 3HJCA 2Q7RA 2YRFA 3PMRA 3NYLA 1H9TA 3DKAA 3G4XA 2ETSA 5T1DB 1ZHTA 2H7BA 2IXMA 2Q9AA 2QY9A 4ULVA 2Q9BA 1A7DA 3W2WA 4JEAA 4LERA 5JSLA 4CS9A 1RCPA 2C04A 3AJMA 3QVYA 3S27A 1HY5A 2HFIA 2VCBA 1OW6A 1XWJA 2YLIA 2Y39A 3C8ZA 3VF0A 3JYHA 5DVWA 1V4AA 1PD0A 2KQ9A 3ATPA 2DI3A 5L0GA 3B9QA 2OU6A 3FMSA 2KC3A 3GM3A 1TFOB 3EH1A 1G4US 1N1CA 3Q7GA 3ITFA 3CSKA 5EK0A 3ZG1A 1E84A 4LLEA 3EFOA 2GWWA 2JX0A 4WJ0A 4AE4A 2EPKX 3KH2A 1F1MA 1Z5ZA 2LFDA 2GA0A 1E85A 2I8BA 1QVXA 4MQ9F 5F5FA 3U0CA 1TWAA 2OJED 1Z6AA 1YYJA 1RMVA 4I1OB 2GDCA 1ORYA 4CX9A 1JAFA 4NQFA 5JVEA 5KYYA 4H54A 4NC3A 3JT1A 2EPNA 2L7AA 3PCVA 1OR2A 1E2XA 2YHSA 1XZPA 3SP1A 3ZWIA 4KNWA 3MYFA 4CS8C 1OXKA 1I4ZA 1VLTA 3OWTA 3U8PA 1YZAA 1QKRA 3HNLA 3T6BA 3OA1A 2H7VC 2OKUA 3NDBB 2A68F 3LLIA 2ICWG 4E0HA 1T6QA 2R02A 3AQCA 2EIJC 3SXZA 4JCZA 4D4NA 3RYLA 5KYWB 4G7HF 4IAOA 4DRJB 1H7IA 1TQGA 3W8IA 5L0FA 5CI9A 3LAYA 4Z9HA 3GWNA 3LLKA 3JSZA 1WWPA 4PJMA 4YT5A 3K7DA 1NFNA 3LESA 3HKKA 1K40A 1O5HA 2V26A 2J7PD 4BJ1A 3AG4C 4N06A 4Q5SF 4E18A 3L8IA 3V7OA 1W2WA 3LS1A 4HE8D 2PX0A 1OQCA 1D0YA 1UG7A 4OD5A 1YVIA 3EGDB 5L0HA 2IXNA 4Q7CA 4U5GA 3UMIA 1JPNA 3NG1A 3U8VA 2R7TA 2R05A 2R7UA 3GODA 4U9DA 3U9JA 5E2QA 3NMJA 3ZTZA 5BQIA 2R03A 2LFFA 3DD7A 4NTFA 4ONSA 1SR2A 3HLZA 2VC9A 4OIQF 3KYJA 5L0DA 5KYUB 2MYSA 1Q0KA 2IYLD 4UDVA 2R7SA 3EHMA 3UNGC 1BR4A 4M63A 1LS4A 2R25A 2YZSA 3DAFA 3B0VC 1Z3IX 4U5HA 2EILC 2PNOA 1HMDA 1JPJA 2R7QA 1SZIA 4U5BE 2HMZA 2WVNA 1FFHA 3RVYA 2HSQA 3U3FA 2J9VA 2ZXWC 1NU7D 3IQ5A 3QW1A 5KYNA 1NG1A 5JLIA 5KYXA 1VK5A 2XLVA 3IQTA 3LNMB 5BUOA 3K33A 3LUTB 1PCXA 3MFNA 4RBNA 1NSGB 2VCCA 2QUPA 1M2VB 4JW1A 3L34A 3VAYA 3EJNA 3KPHA 5IY5C 3RIPA 3C8GA 5BQGA 4RD9A 1ZZPA 3TJ6A 1ZHWA 4CS7A 2PF4E 3HNKA 1J8YF 2A6HF 4W8PA 3TQOA 4XQ1A 3C63A 2NUTB 1SYQA 4L6RA 1QSPA 4XTKA 2O9XA 4WGYA 3X1OA 4AL0A 5DS4A 4N6HA 2CW0F 4XWJA 1V74B 2IOQA 3DE9A 3NKDA 2EINC 4BEMJ 3JCUQ 3AQBA 4IRUA 4PFOA 3C62A 4R32A 5JUAA 2IXPA 4LDQA 1NZEA 2HV7A 3EG9A 3TOMA 3LEVA 4G0HA 1M57C 4MTOA 1QZXA 2L6GA 5E33A 2EPMX 3RW0A 1L3PA 4MW8A 2CYDA 2HJ3A 1Y6DA 4Z9IA 1HW2A 4WGZA 5L0JA 4DVYP 2JD3A 3GEHA 3IQ6A 1B68A 1L7CA 3DMDA 4IJJA 4CJGA 3J06A 4PK4A 3LEOA 4U5CE 1Q0DA 3ABMC 5BQHA 2YVKA 3ZTMA 2AWCA 3CZ6A 1KTMA 4Z9JA 1FAPB 4U5FE 3UMHA 4A2NB 3CEXA 5EHHA 2XL6A 1YA7O 1A7VA 1RXQA 4CSAC 4MW3A 1I4YA 3MLGA 3VYWA 2A0BA 4D4XA 3DM9B 1MNEA 2YL1A 4JZAA 5E3CA 2NSFA 1A7EA 2J0XA 1MMNA 3EFOB 3QTHA 1VTMP 3FOPA 3LJBA 2ZXRA 3Q7LA 1GGQA 4LDRA 4P9FA 1Z7Qc 1GQAA 5TJ5E 4E7SA 4G78A 2KYHA 1OR3A 1TFKB 2R7OA 1DOVA 2R7XA 1OCCC 3CQZA 1ORJA 1BZ4A 2XSEA 4HEAJ 2EPOA 4KNVA 3LS0A 2LP4A 5JT4A 3MX3A 1RJ9A 2W4BA 3QZCA 3M79A 2P7VA 3AG2C 3K1HA 5KYYB 3MYIA 3RQFA 4PFPA 5A6KA 1NBBA 1OCOC 2WVOA 5GPGB 3W4YA 3U2MA 2FGYA 2KK1A 2J46A 4CDYA 3GM1A 4I3MA 3DAGA 4YT2A 2VH3A 1IW7F 4IGGA 1TKNA 2I15A 4OIPF 3PDMP 3GEIA 1SF8A 2B0JA 1UFBA 3EGXA 1EI7A 3L8JA 4HFFB 1JOGA 3WHNA 1ZYRF 2CGEA 1Q0MA 3K6BA 1LPEA 1O3UA 3UMKA 1OW7A 4FAPB 5DLJA 2VASA 1BBHA 3EZHA 3DZAA 2J45A 1D1BA 2W4MA 1YA9A 2ZPAA 3FOOA 3AGTA 4N4WA 2XXAA 3SNHA 1PV3A 2J9WA 2WL8A 1DOWA 4PACA 1JRAA 2Y3GA 4C7OA 3SZRA 1WASA 4U9EA 4YL3A 4JURI 3MBGA 1ORSC 3EPVA 1QLEC 2J8WA 1VMAA 3F46A 5D91A 4MVSA 3R7CA 3U3BA 2AP3A 1U0BB 2LSEA 4YJWA 1YYXA 4EWCA 4YWQA 2J0WA 4KC9A 3AG1C 4JJFA 3AOUA 2PX3A 5T3TA 1OKKA 3K66A 4QI0A 4JCHA 5CIVA 5EGYA 4W8KA 4H4KC 3G4ZA 4BG0A 4Q4ZF 1CPRA 2D4UA 4O6MA 4CSAA 2HJMA 3TULA 3UR3C 1WTYA 4OINF 2LD6A 3C18A 3V5ZA 3VM6A 5HSWA 4C3DA 2Y3HA 4FX5A 2YL3A 3SXYA 2AWYA 2YL7A 5E3AA 5DS5A 2OG2A 1FR0A 3DJUB 4JRZA 3TD7A 1KNYA 4E17A 1C02A 1TWGA 4MVOA 4EBJA 3V5YA 5K0IA 2OCCC 5AC5A 2ZD9A 1H6GA 2RSEB 3EZIA 3JZ0A 1VOMA 1M56C 4MVMA 2OEXA 3TOLA 3C8GD 3ZQYA 4BJ6A 2XLDA 3C8GB 2CNWA 1XZQA 2WZFA 1LM3B 1ZU5A 3JTLO 1EQ1A 1ZHZA 3VRCA 2TMVP 4MVUA 4MVRA 2BL2A 4CS8A 2B0HA 2LQGA 4K7BA 1RKEB 2V3CC 4JC7A 2XXAB 3QW0A 2XL8A 1WATA 2OEVA 1R4TA 2J9UA 2NPUA 3EGDA 1LE4A 2IXOA 4DXWA 2ASRA 1ZW2A 1MQVA 4PJNA 5L0IA 2RD9A 1M6TA 2QE9A 1D0ZA 1ZU4A 1BR1A 3BEHA 2XL4A 4EBBA 3M4BA 1TWCA 4XPWA 3DWWA 4CS9C 1YZCA 4P9TA 3NKEA 3U5SA 2QNLA 2A1DD 4HFKB 3DXJF 3RQEA 4DRIB 2FFHA 1D1AA 2UUHA 1T6IA 2NUPB 2PFDA 2XLHA 2YL0A 1RKCA 3L1MA 1LIHA 3KL4A 4RDAA 3E70C 4OIRF 1CGNA 3O6XA 5COMA 4PJLA 4OD4A 2ZXOA 3FHDA 1PD1A 2P1AA 4CDVA 2G62A 1CGOA 3A11A 4LDKA 3NMIA 3SXKA 3X2QC 1LVKA 4U5EE 3W2VA 4QI2A 4XEVA 5F28E 1C03A 4P6IC 2YLDA 3S29A 1Z63A 2PBEA 2Y3BA 5DS6A 1HE9A 2VB6A 3NRHA 1Q0GA 1VB5A 2WZGA 1M2VA 3H2VA 5B1BC 2LCHA 4EUKB 1AUEA 3B0UX 1HW1A 4BJTA 4DRHB 3UGOA 3B71A 1ZHXA 1AVOB 1Q0FA 2P6VA 3M1CB 3RFYA 3SXMA 3SYNA 5FCLA 4BJ5A 1VLSA 2XRHA 3FXHA 4NTBA 4XPYA 5L0CA 3ASNC 2YWAA 1YDIA 2NUTA 3TK0A 4BEJA 1MMDA 4JJGA 3JYYA 4AE4B 2M64A 3E9VA 4IARA 3H2UA 1GM5A 2D5RB 4MVZA 2HUJA 2IM8A 1Z23A 2WVQA 1S7ZA 4QDLA 1BR2A 2EPLX 1HE1A 3ABKC 1V55C 2HSBA 3DM5A 4PJJA 3RF3A 5DQZA 4G7OF 3F47A 2EIMC 2R7RA 3Q6MA 1EKYA 4NCQA 1APCA 3EGXB 5A6BA 1MMAA 2GAQA 2UUIA 2WZLA 2OJQA 3G50A 2KJGA 4YT4A 4KI2A 3EHNA 3WODF 2FAPB 5L3VA 1R5ID 1I5NA 3FVYA 4BPMA 2GFHA 3T6JA 4GQHA 4B6IA 2KSFA 5AGFA 5COFA 1QQ3A 1M2OA 3EH2A 1LI7A 2Z15A 1AEPA 1EA8A 3GM2A 1OCZC 4XEFA 4NY3A 2XLOA 4JVSA 3NMKA 2W45A 3DI5A 3V5XA 1YJGA 4O79A 1K05A 1OCRC 4O7GA 3S28A 4NTAA 1E83A 3US6A 2DYRC 3O39A 4C7OB 1YARO 3T4RA 2EIKC 3B29A 4EBKA 4WABA 3GORA 5D92A 4MS2A 2E87A 2YEVA 4MNDA 4C3EA 1OXBA 4LACB 3RQGA 4OIOF 2W9YA 1MNDA 5JRAA 3K1IA 1BDJB 4JE9A 5B3IA 1U89A 2HS5A 4ULWA 4CBEA 4J7TA 4CIHA 3JSEO 4DVZA 1D1CA 2L6HA 3M4CA 4FWVA 1JMWA 4JTAB 1OKKD 3HNIA 4N6CA 2NSGA 1VYIA 3I5PA 4J7YA 2P0NA 4XPXA 1H9GA 2L6FA 4MVQA 2QLAA 4BJ6C 3ECSA 3KKBA 2CCYA 1G8XA 2A6EF 2DGJA 1NLXA 2JPUA 4IWBA 2PP4A 4JIOA 3WG7C 1C17M 2DB4A 1YLMA 3OEOA 3SEOA 1K04A 5A69A 3T6GB 1E86A 1D0XA 2R7WA 2Q9CA 2X51A 5A6JA 4A4AA 2HMQA 3POVA 2C03A 4YT8A 1T9KA 3FDQA 2Q3TA 1S05A 3U2LA 2AVKA 1OW8A 3NYMA 3DJNB 2YKZA 3IHUA 1TWHA 2XM4A 4AK9A 4E7ZA 3GANA 2J9BA 4GEHA 3W8HA 3UGPA 2XLEA 2HV6A 3LNRA 3T9OA 3ZQVA 1NFOA 2CNWD 4X0RA 4I44A 3C7JA 2L9JA 1WOLA 3FAJA 2P61A 3AGUA 3N2ZB 4JTDB 3RKOF 3TJ5A 2AU5A 1FTSA 1A0BA 4YK5A 2VCAA 2X0CA 5KYXB 4EIYA 3S0XA 5KYWA 1LS1A 3ASOC 3IPMO 4U5DE 3N24A 4J32B 4IB4A 3S84A 1U6HA 2YQYA 1V54C 2OOCA 4YL1A 3B0PA 1G4WR 2WB7A 3HTKC 3IEEA 4O6YA 1TR2A 3WAQA 3NYJA 2IBFA 2Q4FA 1QPUA 1WGWA 2J7PA 3O10A 4XLNF 3U9MA 4GYTA 3ZVRA 3QMKA 1FNTc 2DYSC 2H7OA 3CAXA 3AG3C 2L81A 3EQLF 3FAPB 1J8MF 1NU9C 4O6NA 1G5ZA 5AC4A 1T01A 1T6UA 1ST6A 4J30B 3ABLC 4LLCA 4AL1A 4ER9A 1ZHYA 2H8AA 3EG9B 3HNJA 1LI5A 4YN0B 4BJ5C 3L0IA 2XM0A 2G3VA 4EHPA 3H65A 2KNHA 3DE8A 3IQCA 4I1MA 3M15A 2A0UA 1ZW3A 2F22A 2BC5A 4PR9A 4YL0A 5COGA 5KYUA 2R7VA 1JR8A 5T3WA 1SMYF 3Q6NA 1WN0A 3GEEA 3ZSUA 2KW3C 3JRMO 5JP7A 1VYKA 4MTGA 3BRJA 2Q00A 256BA 3RH3A 5B3SC 4ANJA 2HKVA 3A9CA 2R9RB 4KBLA 3PHF2 1IZMA 3I4UA 4CDAA 4EKWA 2NG1A 2LIGA 4MTFA 3S90A 3S9OA 4JKVA 1A41A 3N0TA 4JTCB 4K0DA 3ZC4A 4IAQA 1RKEA 4ZLDA 1Y4CA 4DBQA 4XLPF 3QVZA 5JS5A 5DQTA 3KYIA 2KGOA 5HV9A 4DBRA 4CIPA 4CJOA 2M4EA 3KMIA 1CPQA 2HZ8A 2XLWA 2LK4A 2MHRA 1ZVZA 2XLMA 2ZXPA 3GWLA 3RVZA 4AX2A 1CGME 4C3BA 4E0IA 5A6BD 1HMOA 2CDQA 5CI8A 3ZDLA 2MWQA 1RJ9B 3O55A 4DJ9A 4G7ZF 5F5HA 1KU2A 1LE2A 1MMGA 3I5QA 3R2PA 3K1IC 1FMVA 3ZIBA 4DOZA 4ZLCA 2YLGA 4JEBA 1GS9A 1T5OA 5A6AA 2BE5F 1YAUO
chains in the Genus database with same CATH topology
2NUPA 2QTVA 2Y3DA 4F4BA 3JRTA 2Y69C 2A69F 5B1AC 4FESA 5L3QA 1FMWA 2G3KA 1FFTC 1O87A 1LKXA 3HJCA 3PMRA 3NYLA 5T1DB 1ZHTA 2H7BA 2IXMA 2Q9AA 2QY9A 2Q9BA 4CS9A 3W2WA 4LERA 2C04A 3S27A 4CSAC 2Y39A 3JYHA 5DVWA 1PD0A 3B9QA 3Q7GA 3ZG1A 3EH1A 1N1CA 3ITFA 3CSKA 4LLEA 3EFOA 4WJ0A 4AE4A 3KH2A 1Z5ZA 2I8BA 4MQ9F 5F5FA 1TWAA 1Z6AA 4I1OB 5KYYA 3JT1A 2YHSA 3SP1A 4KNWA 4CS8C 3OWTA 3T6BA 3OA1A 2H7VC 2A68F 3LLIA 3AQCA 2EIJC 5KYWB 3RYLA 4G7HF 4IAOA 3W8IA 5CI9A 3LAYA 3LLKA 3JSZA 4PJMA 4YT5A 3K7DA 3LESA 1O5HA 2V26A 2J7PD 4BJ1A 3AG4C 4N06A 4Q5SF 3V7OA 1W2WA 3LS1A 4HE8D 2PX0A 1D0YA 4OD5A 3EGDB 2IXNA 4Q7CA 4U5GA 3UMIA 1JPNA 3NG1A 2R7TA 2R7UA 3GODA 5E2QA 3DD7A 3HLZA 4OIQF 5KYUB 2MYSA 2IYLD 2R7SA 3EHMA 3UNGC 1BR4A 4M63A 3DAFA 2YZSA 3B0VC 1Z3IX 4U5HA 2EILC 1JPJA 2R7QA 1SZIA 4U5BE 2WVNA 1FFHA 2J9VA 2ZXWC 1NU7D 5KYNA 1NG1A 5KYXA 1VK5A 5BUOA 3K33A 1PCXA 4RBNA 4JW1A 1M2VB 3L34A 3VAYA 3EJNA 5IY5C 3RIPA 4RD9A 1ZHWA 4CS7A 2PF4E 1J8YF 2A6HF 2NUTB 4XTKA 2O9XA 3X1OA 5DS4A 2CW0F 4XWJA 2IOQA 3NKDA 2EINC 3JCUQ 3AQBA 4IRUA 4PFOA 2IXPA 1NZEA 2HV7A 3EG9A 3LEVA 4G0HA 1M57C 1QZXA 5E33A 4DVYP 2JD3A 3DMDA 4IJJA 4PK4A 4U5CE 3ABMC 3CZ6A 4U5FE 3UMHA 4A2NB 5EHHA 3MLGA 3VYWA 3DM9B 1MNEA 4JZAA 5E3CA 3EFOB 2J0XA 1MMNA 3LJBA 2ZXRA 3Q7LA 4E7SA 2R7OA 2R7XA 1OCCC 3CQZA 2XSEA 4HEAJ 4KNVA 3LS0A 3MX3A 1RJ9A 2W4BA 3QZCA 5KYYB 2P7VA 3AG2C 3K1HA 4PFPA 1OCOC 2WVOA 2FGYA 2J46A 4I3MA 3DAGA 4YT2A 2VH3A 1IW7F 1TKNA 4OIPF 1SF8A 2B0JA 3EGXA 4HFFB 1ZYRF 2CGEA 3K6BA 3UMKA 5DLJA 2VASA 3EZHA 3DZAA 2J45A 1D1BA 2W4MA 2ZPAA 2XXAA 3SNHA 2J9WA 2WL8A 2Y3GA 4C7OA 3SZRA 4JURI 3EPVA 1QLEC 1VMAA 3F46A 5D91A 2LSEA 4YJWA 4EWCA 4YWQA 2J0WA 4KC9A 3AG1C 4JJFA 5T3TA 2PX3A 1OKKA 3K66A 4QI0A 4JCHA 4W8KA 4H4KC 4BG0A 4Q4ZF 4O6MA 4CSAA 3UR3C 4OINF 5HSWA 4C3DA 2Y3HA 4FX5A 5DS5A 5E3AA 2OG2A 3DJUB 3TD7A 1TWGA 2OCCC 3EZIA 1VOMA 1M56C 4BJ6A 2CNWA 2WZFA 1ZU5A 1ZHZA 4CS8A 4K7BA 2V3CC 2J9UA 3EGDA 2IXOA 4PJNA 1D0ZA 1ZU4A 1BR1A 2XL4A 4EBBA 1TWCA 4CS9C 3NKEA 2A1DD 4HFKB 3DXJF 2FFHA 1D1AA 2NUPB 2PFDA 4RDAA 3KL4A 4OIRF 3E70C 4CBEA 3O6XA 4PJLA 4OD4A 2ZXOA 3FHDA 1PD1A 2G62A 3X2QC 1LVKA 4U5EE 3W2VA 4QI2A 4P6IC 3S29A 1Z63A 2Y3BA 5DS6A 2VB6A 3NRHA 2WZGA 1M2VA 5B1BC 3B0UX 4BJTA 3UGOA 1ZHXA 2P6VA 3RFYA 3M1CB 3SYNA 5FCLA 4BJ5A 2XRHA 3ASNC 4BEJA 2NUTA 1MMDA 4JJGA 4AE4B 3E9VA 2D5RB 2WVQA 5B3SC 1Z23A 1S7ZA 4QDLA 1BR2A 5EGYA 3ABKC 1V55C 3DM5A 4G7OF 4PJJA 5DQZA 3F47A 2EIMC 2R7RA 3Q6MA 3EGXB 1MMAA 2WZLA 4YT4A 2KJGA 4KI2A 3EHNA 3WODF 5L3VA 3FVYA 2GFHA 3T6JA 4B6IA 3EH2A 1M2OA 2Z15A 1OCZC 4NY3A 4JVSA 2XXAB 2W45A 4O79A 1OCRC 4O7GA 3S28A 2DYRC 3O39A 4C7OB 3T4RA 2EIKC 5D92A 2E87A 2YEVA 4MNDA 4C3EA 4LACB 4OIOF 2W9YA 1MNDA 4ULWA 4CIHA 4DVZA 1D1CA 4FWVA 1OKKD 3I5PA 1VYIA 4BJ6C 3ECSA 3KKBA 1G8XA 2A6EF 2DGJA 4IWBA 2PP4A 3WG7C 3OEOA 3SEOA 2R7WA 1D0XA 2Q9CA 2X51A 3POVA 2C03A 4YT8A 3FDQA 2Q3TA 3NYMA 3DJNB 1TWHA 4AK9A 4E7ZA 3GANA 4GEHA 3W8HA 3UGPA 2HV6A 3LNRA 2CNWD 4X0RA 4I44A 2L9JA 3FAJA 3N2ZB 3RKOF 1FTSA 5KYXB 3S0XA 3NDBB 5KYWA 1LS1A 3ASOC 4U5DE 3N24A 4J32B 1V54C 3B0PA 2WB7A 3HTKC 3IEEA 4O6YA 1TR2A 3NYJA 2BE5F 1WGWA 2J7PA 4XLNF 4GYTA 3ZVRA 3QMKA 2DYSC 2H7OA 3AG3C 2L81A 3EQLF 4O6NA 1J8MF 1NU9C 1ST6A 4J30B 3ABLC 4LLCA 1ZHYA 3EG9B 4YN0B 4BJ5C 3L0IA 2G3VA 3H65A 2KNHA 4I1MA 2R7VA 5KYUA 5T3WA 1SMYF 3Q6NA 3ZSUA 2KW3C 1VYKA 3RH3A 4ANJA 3PHF2 4KBLA 1IZMA 3I4UA 2NG1A 4K0DA 3N0TA 4ZLDA 3ZC4A 4DBQA 4XLPF 5DQTA 2KGOA 4DBRA 2M4EA 3KMIA 4AX2A 2ZXPA 4C3BA 2CDQA 5CI8A 2MWQA 1RJ9B 4G7ZF 5F5HA 1KU2A 1MMGA 3I5QA 3K1IC 1FMVA 3ZIBA 4DOZA 4ZLCA 2KQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q3T A;  1VK5 A;  3GAN A; 
#chains in the Genus database with same CATH topology
 2NUP A;  2QTV A;  2Y3D A;  4K1O A;  4F4B A;  3JRT A;  2Y69 C;  2A69 F;  2OQM A;  2XS1 A;  4FES A;  4XEK A;  5FZT A;  1FMW A;  5B1A C;  5L3Q A;  2XS8 A;  2G3K A;  1FFT C;  1O87 A;  1LKX A;  3HJC A;  2Q7R A;  2YRF A;  3PMR A;  3NYL A;  1H9T A;  3DKA A;  3G4X A;  2ETS A;  5T1D B;  1ZHT A;  2H7B A;  2IXM A;  2Q9A A;  2QY9 A;  4ULV A;  2Q9B A;  1A7D A;  3W2W A;  4JEA A;  4LER A;  5JSL A;  4CS9 A;  1RCP A;  2C04 A;  3AJM A;  3QVY A;  3S27 A;  1HY5 A;  2HFI A;  2VCB A;  1OW6 A;  1XWJ A;  2YLI A;  2Y39 A;  3C8Z A;  3VF0 A;  3JYH A;  5DVW A;  1V4A A;  1PD0 A;  2KQ9 A;  3ATP A;  2DI3 A;  5L0G A;  3B9Q A;  2OU6 A;  3FMS A;  2KC3 A;  3GM3 A;  1TFO B;  3EH1 A;  1G4U S;  1N1C A;  3Q7G A;  3ITF A;  3CSK A;  5EK0 A;  3ZG1 A;  1E84 A;  4LLE A;  3EFO A;  2GWW A;  2JX0 A;  4WJ0 A;  4AE4 A;  2EPK X;  3KH2 A;  1F1M A;  1Z5Z A;  2LFD A;  2GA0 A;  1E85 A;  2I8B A;  1QVX A;  4MQ9 F;  5F5F A;  3U0C A;  1TWA A;  2OJE D;  1Z6A A;  1YYJ A;  1RMV A;  4I1O B;  2GDC A;  1ORY A;  4CX9 A;  1JAF A;  4NQF A;  5JVE A;  5KYY A;  4H54 A;  4NC3 A;  3JT1 A;  2EPN A;  2L7A A;  3PCV A;  1OR2 A;  1E2X A;  2YHS A;  1XZP A;  3SP1 A;  3ZWI A;  4KNW A;  3MYF A;  4CS8 C;  1OXK A;  1I4Z A;  1VLT A;  3OWT A;  3U8P A;  1YZA A;  1QKR A;  3HNL A;  3T6B A;  3OA1 A;  2H7V C;  2OKU A;  3NDB B;  2A68 F;  3LLI A;  2ICW G;  4E0H A;  1T6Q A;  2R02 A;  3AQC A;  2EIJ C;  3SXZ A;  4JCZ A;  4D4N A;  3RYL A;  5KYW B;  4G7H F;  4IAO A;  4DRJ B;  1H7I A;  1TQG A;  3W8I A;  5L0F A;  5CI9 A;  3LAY A;  4Z9H A;  3GWN A;  3LLK A;  3JSZ A;  1WWP A;  4PJM A;  4YT5 A;  3K7D A;  1NFN A;  3LES A;  3HKK A;  1K40 A;  1O5H A;  2V26 A;  2J7P D;  4BJ1 A;  3AG4 C;  4N06 A;  4Q5S F;  4E18 A;  3L8I A;  3V7O A;  1W2W A;  3LS1 A;  4HE8 D;  2PX0 A;  1OQC A;  1D0Y A;  1UG7 A;  4OD5 A;  1YVI A;  3EGD B;  5L0H A;  2IXN A;  4Q7C A;  4U5G A;  3UMI A;  1JPN A;  3NG1 A;  3U8V A;  2R7T A;  2R05 A;  2R7U A;  3GOD A;  4U9D A;  3U9J A;  5E2Q A;  3NMJ A;  3ZTZ A;  5BQI A;  2R03 A;  2LFF A;  3DD7 A;  4NTF A;  4ONS A;  1SR2 A;  3HLZ A;  2VC9 A;  4OIQ F;  3KYJ A;  5L0D A;  5KYU B;  2MYS A;  1Q0K A;  2IYL D;  4UDV A;  2R7S A;  3EHM A;  3UNG C;  1BR4 A;  4M63 A;  1LS4 A;  2R25 A;  2YZS A;  3DAF A;  3B0V C;  1Z3I X;  4U5H A;  2EIL C;  2PNO A;  1HMD A;  1JPJ A;  2R7Q A;  1SZI A;  4U5B E;  2HMZ A;  2WVN A;  1FFH A;  3RVY A;  2HSQ A;  3U3F A;  2J9V A;  2ZXW C;  1NU7 D;  3IQ5 A;  3QW1 A;  5KYN A;  1NG1 A;  5JLI A;  5KYX A;  1VK5 A;  2XLV A;  3IQT A;  3LNM B;  5BUO A;  3K33 A;  3LUT B;  1PCX A;  3MFN A;  4RBN A;  1NSG B;  2VCC A;  2QUP A;  1M2V B;  4JW1 A;  3L34 A;  3VAY A;  3EJN A;  3KPH A;  5IY5 C;  3RIP A;  3C8G A;  5BQG A;  4RD9 A;  1ZZP A;  3TJ6 A;  1ZHW A;  4CS7 A;  2PF4 E;  3HNK A;  1J8Y F;  2A6H F;  4W8P A;  3TQO A;  4XQ1 A;  3C63 A;  2NUT B;  1SYQ A;  4L6R A;  1QSP A;  4XTK A;  2O9X A;  4WGY A;  3X1O A;  4AL0 A;  5DS4 A;  4N6H A;  2CW0 F;  4XWJ A;  1V74 B;  2IOQ A;  3DE9 A;  3NKD A;  2EIN C;  4BEM J;  3JCU Q;  3AQB A;  4IRU A;  4PFO A;  3C62 A;  4R32 A;  5JUA A;  2IXP A;  4LDQ A;  1NZE A;  2HV7 A;  3EG9 A;  3TOM A;  3LEV A;  4G0H A;  1M57 C;  4MTO A;  1QZX A;  2L6G A;  5E33 A;  2EPM X;  3RW0 A;  1L3P A;  4MW8 A;  2CYD A;  2HJ3 A;  1Y6D A;  4Z9I A;  1HW2 A;  4WGZ A;  5L0J A;  4DVY P;  2JD3 A;  3GEH A;  3IQ6 A;  1B68 A;  1L7C A;  3DMD A;  4IJJ A;  4CJG A;  3J06 A;  4PK4 A;  3LEO A;  4U5C E;  1Q0D A;  3ABM C;  5BQH A;  2YVK A;  3ZTM A;  2AWC A;  3CZ6 A;  1KTM A;  4Z9J A;  1FAP B;  4U5F E;  3UMH A;  4A2N B;  3CEX A;  5EHH A;  2XL6 A;  1YA7 O;  1A7V A;  1RXQ A;  4CSA C;  4MW3 A;  1I4Y A;  3MLG A;  3VYW A;  2A0B A;  4D4X A;  3DM9 B;  1MNE A;  2YL1 A;  4JZA A;  5E3C A;  2NSF A;  1A7E A;  2J0X A;  1MMN A;  3EFO B;  3QTH A;  1VTM P;  3FOP A;  3LJB A;  2ZXR A;  3Q7L A;  1GGQ A;  4LDR A;  4P9F A;  1Z7Q c;  1GQA A;  5TJ5 E;  4E7S A;  4G78 A;  2KYH A;  1OR3 A;  1TFK B;  2R7O A;  1DOV A;  2R7X A;  1OCC C;  3CQZ A;  1ORJ A;  1BZ4 A;  2XSE A;  4HEA J;  2EPO A;  4KNV A;  3LS0 A;  2LP4 A;  5JT4 A;  3MX3 A;  1RJ9 A;  2W4B A;  3QZC A;  3M79 A;  2P7V A;  3AG2 C;  3K1H A;  5KYY B;  3MYI A;  3RQF A;  4PFP A;  5A6K A;  1NBB A;  1OCO C;  2WVO A;  5GPG B;  3W4Y A;  3U2M A;  2FGY A;  2KK1 A;  2J46 A;  4CDY A;  3GM1 A;  4I3M A;  3DAG A;  4YT2 A;  2VH3 A;  1IW7 F;  4IGG A;  1TKN A;  2I15 A;  4OIP F;  3PDM P;  3GEI A;  1SF8 A;  2B0J A;  1UFB A;  3EGX A;  1EI7 A;  3L8J A;  4HFF B;  1JOG A;  3WHN A;  1ZYR F;  2CGE A;  1Q0M A;  3K6B A;  1LPE A;  1O3U A;  3UMK A;  1OW7 A;  4FAP B;  5DLJ A;  2VAS A;  1BBH A;  3EZH A;  3DZA A;  2J45 A;  1D1B A;  2W4M A;  1YA9 A;  2ZPA A;  3FOO A;  3AGT A;  4N4W A;  2XXA A;  3SNH A;  1PV3 A;  2J9W A;  2WL8 A;  1DOW A;  4PAC A;  1JRA A;  2Y3G A;  4C7O A;  3SZR A;  1WAS A;  4U9E A;  4YL3 A;  4JUR I;  3MBG A;  1ORS C;  3EPV A;  1QLE C;  2J8W A;  1VMA A;  3F46 A;  5D91 A;  4MVS A;  3R7C A;  3U3B A;  2AP3 A;  1U0B B;  2LSE A;  4YJW A;  1YYX A;  4EWC A;  4YWQ A;  2J0W A;  4KC9 A;  3AG1 C;  4JJF A;  3AOU A;  2PX3 A;  5T3T A;  1OKK A;  3K66 A;  4QI0 A;  4JCH A;  5CIV A;  5EGY A;  4W8K A;  4H4K C;  3G4Z A;  4BG0 A;  4Q4Z F;  1CPR A;  2D4U A;  4O6M A;  4CSA A;  2HJM A;  3TUL A;  3UR3 C;  1WTY A;  4OIN F;  2LD6 A;  3C18 A;  3V5Z A;  3VM6 A;  5HSW A;  4C3D A;  2Y3H A;  4FX5 A;  2YL3 A;  3SXY A;  2AWY A;  2YL7 A;  5E3A A;  5DS5 A;  2OG2 A;  1FR0 A;  3DJU B;  4JRZ A;  3TD7 A;  1KNY A;  4E17 A;  1C02 A;  1TWG A;  4MVO A;  4EBJ A;  3V5Y A;  5K0I A;  2OCC C;  5AC5 A;  2ZD9 A;  1H6G A;  2RSE B;  3EZI A;  3JZ0 A;  1VOM A;  1M56 C;  4MVM A;  2OEX A;  3TOL A;  3C8G D;  3ZQY A;  4BJ6 A;  2XLD A;  3C8G B;  2CNW A;  1XZQ A;  2WZF A;  1LM3 B;  1ZU5 A;  3JTL O;  1EQ1 A;  1ZHZ A;  3VRC A;  2TMV P;  4MVU A;  4MVR A;  2BL2 A;  4CS8 A;  2B0H A;  2LQG A;  4K7B A;  1RKE B;  2V3C C;  4JC7 A;  2XXA B;  3QW0 A;  2XL8 A;  1WAT A;  2OEV A;  1R4T A;  2J9U A;  2NPU A;  3EGD A;  1LE4 A;  2IXO A;  4DXW A;  2ASR A;  1ZW2 A;  1MQV A;  4PJN A;  5L0I A;  2RD9 A;  1M6T A;  2QE9 A;  1D0Z A;  1ZU4 A;  1BR1 A;  3BEH A;  2XL4 A;  4EBB A;  3M4B A;  1TWC A;  4XPW A;  3DWW A;  4CS9 C;  1YZC A;  4P9T A;  3NKE A;  3U5S A;  2QNL A;  2A1D D;  4HFK B;  3DXJ F;  3RQE A;  4DRI B;  2FFH A;  1D1A A;  2UUH A;  1T6I A;  2NUP B;  2PFD A;  2XLH A;  2YL0 A;  1RKC A;  3L1M A;  1LIH A;  3KL4 A;  4RDA A;  3E70 C;  4OIR F;  1CGN A;  3O6X A;  5COM A;  4PJL A;  4OD4 A;  2ZXO A;  3FHD A;  1PD1 A;  2P1A A;  4CDV A;  2G62 A;  1CGO A;  3A11 A;  4LDK A;  3NMI A;  3SXK A;  3X2Q C;  1LVK A;  4U5E E;  3W2V A;  4QI2 A;  4XEV A;  5F28 E;  1C03 A;  4P6I C;  2YLD A;  3S29 A;  1Z63 A;  2PBE A;  2Y3B A;  5DS6 A;  1HE9 A;  2VB6 A;  3NRH A;  1Q0G A;  1VB5 A;  2WZG A;  1M2V A;  3H2V A;  5B1B C;  2LCH A;  4EUK B;  1AUE A;  3B0U X;  1HW1 A;  4BJT A;  4DRH B;  3UGO A;  3B71 A;  1ZHX A;  1AVO B;  1Q0F A;  2P6V A;  3M1C B;  3RFY A;  3SXM A;  3SYN A;  5FCL A;  4BJ5 A;  1VLS A;  2XRH A;  3FXH A;  4NTB A;  4XPY A;  5L0C A;  3ASN C;  2YWA A;  1YDI A;  2NUT A;  3TK0 A;  4BEJ A;  1MMD A;  4JJG A;  3JYY A;  4AE4 B;  2M64 A;  3E9V A;  4IAR A;  3H2U A;  1GM5 A;  2D5R B;  4MVZ A;  2HUJ A;  2IM8 A;  1Z23 A;  2WVQ A;  1S7Z A;  4QDL A;  1BR2 A;  2EPL X;  1HE1 A;  3ABK C;  1V55 C;  2HSB A;  3DM5 A;  4PJJ A;  3RF3 A;  5DQZ A;  4G7O F;  3F47 A;  2EIM C;  2R7R A;  3Q6M A;  1EKY A;  4NCQ A;  1APC A;  3EGX B;  5A6B A;  1MMA A;  2GAQ A;  2UUI A;  2WZL A;  2OJQ A;  3G50 A;  2KJG A;  4YT4 A;  4KI2 A;  3EHN A;  3WOD F;  2FAP B;  5L3V A;  1R5I D;  1I5N A;  3FVY A;  4BPM A;  2GFH A;  3T6J A;  4GQH A;  4B6I A;  2KSF A;  5AGF A;  5COF A;  1QQ3 A;  1M2O A;  3EH2 A;  1LI7 A;  2Z15 A;  1AEP A;  1EA8 A;  3GM2 A;  1OCZ C;  4XEF A;  4NY3 A;  2XLO A;  4JVS A;  3NMK A;  2W45 A;  3DI5 A;  3V5X A;  1YJG A;  4O79 A;  1K05 A;  1OCR C;  4O7G A;  3S28 A;  4NTA A;  1E83 A;  3US6 A;  2DYR C;  3O39 A;  4C7O B;  1YAR O;  3T4R A;  2EIK C;  3B29 A;  4EBK A;  4WAB A;  3GOR A;  5D92 A;  4MS2 A;  2E87 A;  2YEV A;  4MND A;  4C3E A;  1OXB A;  4LAC B;  3RQG A;  4OIO F;  2W9Y A;  1MND A;  5JRA A;  3K1I A;  1BDJ B;  4JE9 A;  5B3I A;  1U89 A;  2HS5 A;  4ULW A;  4CBE A;  4J7T A;  4CIH A;  3JSE O;  4DVZ A;  1D1C A;  2L6H A;  3M4C A;  4FWV A;  1JMW A;  4JTA B;  1OKK D;  3HNI A;  4N6C A;  2NSG A;  1VYI A;  3I5P A;  4J7Y A;  2P0N A;  4XPX A;  1H9G A;  2L6F A;  4MVQ A;  2QLA A;  4BJ6 C;  3ECS A;  3KKB A;  2CCY A;  1G8X A;  2A6E F;  2DGJ A;  1NLX A;  2JPU A;  4IWB A;  2PP4 A;  4JIO A;  3WG7 C;  1C17 M;  2DB4 A;  1YLM A;  3OEO A;  3SEO A;  1K04 A;  5A69 A;  3T6G B;  1E86 A;  1D0X A;  2R7W A;  2Q9C A;  2X51 A;  5A6J A;  4A4A A;  2HMQ A;  3POV A;  2C03 A;  4YT8 A;  1T9K A;  3FDQ A;  2Q3T A;  1S05 A;  3U2L A;  2AVK A;  1OW8 A;  3NYM A;  3DJN B;  2YKZ A;  3IHU A;  1TWH A;  2XM4 A;  4AK9 A;  4E7Z A;  3GAN A;  2J9B A;  4GEH A;  3W8H A;  3UGP A;  2XLE A;  2HV6 A;  3LNR A;  3T9O A;  3ZQV A;  1NFO A;  2CNW D;  4X0R A;  4I44 A;  3C7J A;  2L9J A;  1WOL A;  3FAJ A;  2P61 A;  3AGU A;  3N2Z B;  4JTD B;  3RKO F;  3TJ5 A;  2AU5 A;  1FTS A;  1A0B A;  4YK5 A;  2VCA A;  2X0C A;  5KYX B;  4EIY A;  3S0X A;  5KYW A;  1LS1 A;  3ASO C;  3IPM O;  4U5D E;  3N24 A;  4J32 B;  4IB4 A;  3S84 A;  1U6H A;  2YQY A;  1V54 C;  2OOC A;  4YL1 A;  3B0P A;  1G4W R;  2WB7 A;  3HTK C;  3IEE A;  4O6Y A;  1TR2 A;  3WAQ A;  3NYJ A;  2IBF A;  2Q4F A;  1QPU A;  1WGW A;  2J7P A;  3O10 A;  4XLN F;  3U9M A;  4GYT A;  3ZVR A;  3QMK A;  1FNT c;  2DYS C;  2H7O A;  3CAX A;  3AG3 C;  2L81 A;  3EQL F;  3FAP B;  1J8M F;  1NU9 C;  4O6N A;  1G5Z A;  5AC4 A;  1T01 A;  1T6U A;  1ST6 A;  4J30 B;  3ABL C;  4LLC A;  4AL1 A;  4ER9 A;  1ZHY A;  2H8A A;  3EG9 B;  3HNJ A;  1LI5 A;  4YN0 B;  4BJ5 C;  3L0I A;  2XM0 A;  2G3V A;  4EHP A;  3H65 A;  2KNH A;  3DE8 A;  3IQC A;  4I1M A;  3M15 A;  2A0U A;  1ZW3 A;  2F22 A;  2BC5 A;  4PR9 A;  4YL0 A;  5COG A;  5KYU A;  2R7V A;  1JR8 A;  5T3W A;  1SMY F;  3Q6N A;  1WN0 A;  3GEE A;  3ZSU A;  2KW3 C;  3JRM O;  5JP7 A;  1VYK A;  4MTG A;  3BRJ A;  2Q00 A;  256B A;  3RH3 A;  5B3S C;  4ANJ A;  2HKV A;  3A9C A;  2R9R B;  4KBL A;  3PHF 2;  1IZM A;  3I4U A;  4CDA A;  4EKW A;  2NG1 A;  2LIG A;  4MTF A;  3S90 A;  3S9O A;  4JKV A;  1A41 A;  3N0T A;  4JTC B;  4K0D A;  3ZC4 A;  4IAQ A;  1RKE A;  4ZLD A;  1Y4C A;  4DBQ A;  4XLP F;  3QVZ A;  5JS5 A;  5DQT A;  3KYI A;  2KGO A;  5HV9 A;  4DBR A;  4CIP A;  4CJO A;  2M4E A;  3KMI A;  1CPQ A;  2HZ8 A;  2XLW A;  2LK4 A;  2MHR A;  1ZVZ A;  2XLM A;  2ZXP A;  3GWL A;  3RVZ A;  4AX2 A;  1CGM E;  4C3B A;  4E0I A;  5A6B D;  1HMO A;  2CDQ A;  5CI8 A;  3ZDL A;  2MWQ A;  1RJ9 B;  3O55 A;  4DJ9 A;  4G7Z F;  5F5H A;  1KU2 A;  1LE2 A;  1MMG A;  3I5Q A;  3R2P A;  3K1I C;  1FMV A;  3ZIB A;  4DOZ A;  4ZLC A;  2YLG A;  4JEB A;  1GS9 A;  1T5O A;  5A6A A;  2BE5 F;  1YAU O; 
#chains in the Genus database with same CATH homology
 2NUP A;  2QTV A;  2Y3D A;  4F4B A;  3JRT A;  2Y69 C;  2A69 F;  5B1A C;  4FES A;  5L3Q A;  1FMW A;  2G3K A;  1FFT C;  1O87 A;  1LKX A;  3HJC A;  3PMR A;  3NYL A;  5T1D B;  1ZHT A;  2H7B A;  2IXM A;  2Q9A A;  2QY9 A;  2Q9B A;  4CS9 A;  3W2W A;  4LER A;  2C04 A;  3S27 A;  4CSA C;  2Y39 A;  3JYH A;  5DVW A;  1PD0 A;  3B9Q A;  3Q7G A;  3ZG1 A;  3EH1 A;  1N1C A;  3ITF A;  3CSK A;  4LLE A;  3EFO A;  4WJ0 A;  4AE4 A;  3KH2 A;  1Z5Z A;  2I8B A;  4MQ9 F;  5F5F A;  1TWA A;  1Z6A A;  4I1O B;  5KYY A;  3JT1 A;  2YHS A;  3SP1 A;  4KNW A;  4CS8 C;  3OWT A;  3T6B A;  3OA1 A;  2H7V C;  2A68 F;  3LLI A;  3AQC A;  2EIJ C;  5KYW B;  3RYL A;  4G7H F;  4IAO A;  3W8I A;  5CI9 A;  3LAY A;  3LLK A;  3JSZ A;  4PJM A;  4YT5 A;  3K7D A;  3LES A;  1O5H A;  2V26 A;  2J7P D;  4BJ1 A;  3AG4 C;  4N06 A;  4Q5S F;  3V7O A;  1W2W A;  3LS1 A;  4HE8 D;  2PX0 A;  1D0Y A;  4OD5 A;  3EGD B;  2IXN A;  4Q7C A;  4U5G A;  3UMI A;  1JPN A;  3NG1 A;  2R7T A;  2R7U A;  3GOD A;  5E2Q A;  3DD7 A;  3HLZ A;  4OIQ F;  5KYU B;  2MYS A;  2IYL D;  2R7S A;  3EHM A;  3UNG C;  1BR4 A;  4M63 A;  3DAF A;  2YZS A;  3B0V C;  1Z3I X;  4U5H A;  2EIL C;  1JPJ A;  2R7Q A;  1SZI A;  4U5B E;  2WVN A;  1FFH A;  2J9V A;  2ZXW C;  1NU7 D;  5KYN A;  1NG1 A;  5KYX A;  1VK5 A;  5BUO A;  3K33 A;  1PCX A;  4RBN A;  4JW1 A;  1M2V B;  3L34 A;  3VAY A;  3EJN A;  5IY5 C;  3RIP A;  4RD9 A;  1ZHW A;  4CS7 A;  2PF4 E;  1J8Y F;  2A6H F;  2NUT B;  4XTK A;  2O9X A;  3X1O A;  5DS4 A;  2CW0 F;  4XWJ A;  2IOQ A;  3NKD A;  2EIN C;  3JCU Q;  3AQB A;  4IRU A;  4PFO A;  2IXP A;  1NZE A;  2HV7 A;  3EG9 A;  3LEV A;  4G0H A;  1M57 C;  1QZX A;  5E33 A;  4DVY P;  2JD3 A;  3DMD A;  4IJJ A;  4PK4 A;  4U5C E;  3ABM C;  3CZ6 A;  4U5F E;  3UMH A;  4A2N B;  5EHH A;  3MLG A;  3VYW A;  3DM9 B;  1MNE A;  4JZA A;  5E3C A;  3EFO B;  2J0X A;  1MMN A;  3LJB A;  2ZXR A;  3Q7L A;  4E7S A;  2R7O A;  2R7X A;  1OCC C;  3CQZ A;  2XSE A;  4HEA J;  4KNV A;  3LS0 A;  3MX3 A;  1RJ9 A;  2W4B A;  3QZC A;  5KYY B;  2P7V A;  3AG2 C;  3K1H A;  4PFP A;  1OCO C;  2WVO A;  2FGY A;  2J46 A;  4I3M A;  3DAG A;  4YT2 A;  2VH3 A;  1IW7 F;  1TKN A;  4OIP F;  1SF8 A;  2B0J A;  3EGX A;  4HFF B;  1ZYR F;  2CGE A;  3K6B A;  3UMK A;  5DLJ A;  2VAS A;  3EZH A;  3DZA A;  2J45 A;  1D1B A;  2W4M A;  2ZPA A;  2XXA A;  3SNH A;  2J9W A;  2WL8 A;  2Y3G A;  4C7O A;  3SZR A;  4JUR I;  3EPV A;  1QLE C;  1VMA A;  3F46 A;  5D91 A;  2LSE A;  4YJW A;  4EWC A;  4YWQ A;  2J0W A;  4KC9 A;  3AG1 C;  4JJF A;  5T3T A;  2PX3 A;  1OKK A;  3K66 A;  4QI0 A;  4JCH A;  4W8K A;  4H4K C;  4BG0 A;  4Q4Z F;  4O6M A;  4CSA A;  3UR3 C;  4OIN F;  5HSW A;  4C3D A;  2Y3H A;  4FX5 A;  5DS5 A;  5E3A A;  2OG2 A;  3DJU B;  3TD7 A;  1TWG A;  2OCC C;  3EZI A;  1VOM A;  1M56 C;  4BJ6 A;  2CNW A;  2WZF A;  1ZU5 A;  1ZHZ A;  4CS8 A;  4K7B A;  2V3C C;  2J9U A;  3EGD A;  2IXO A;  4PJN A;  1D0Z A;  1ZU4 A;  1BR1 A;  2XL4 A;  4EBB A;  1TWC A;  4CS9 C;  3NKE A;  2A1D D;  4HFK B;  3DXJ F;  2FFH A;  1D1A A;  2NUP B;  2PFD A;  4RDA A;  3KL4 A;  4OIR F;  3E70 C;  4CBE A;  3O6X A;  4PJL A;  4OD4 A;  2ZXO A;  3FHD A;  1PD1 A;  2G62 A;  3X2Q C;  1LVK A;  4U5E E;  3W2V A;  4QI2 A;  4P6I C;  3S29 A;  1Z63 A;  2Y3B A;  5DS6 A;  2VB6 A;  3NRH A;  2WZG A;  1M2V A;  5B1B C;  3B0U X;  4BJT A;  3UGO A;  1ZHX A;  2P6V A;  3RFY A;  3M1C B;  3SYN A;  5FCL A;  4BJ5 A;  2XRH A;  3ASN C;  4BEJ A;  2NUT A;  1MMD A;  4JJG A;  4AE4 B;  3E9V A;  2D5R B;  2WVQ A;  5B3S C;  1Z23 A;  1S7Z A;  4QDL A;  1BR2 A;  5EGY A;  3ABK C;  1V55 C;  3DM5 A;  4G7O F;  4PJJ A;  5DQZ A;  3F47 A;  2EIM C;  2R7R A;  3Q6M A;  3EGX B;  1MMA A;  2WZL A;  4YT4 A;  2KJG A;  4KI2 A;  3EHN A;  3WOD F;  5L3V A;  3FVY A;  2GFH A;  3T6J A;  4B6I A;  3EH2 A;  1M2O A;  2Z15 A;  1OCZ C;  4NY3 A;  4JVS A;  2XXA B;  2W45 A;  4O79 A;  1OCR C;  4O7G A;  3S28 A;  2DYR C;  3O39 A;  4C7O B;  3T4R A;  2EIK C;  5D92 A;  2E87 A;  2YEV A;  4MND A;  4C3E A;  4LAC B;  4OIO F;  2W9Y A;  1MND A;  4ULW A;  4CIH A;  4DVZ A;  1D1C A;  4FWV A;  1OKK D;  3I5P A;  1VYI A;  4BJ6 C;  3ECS A;  3KKB A;  1G8X A;  2A6E F;  2DGJ A;  4IWB A;  2PP4 A;  3WG7 C;  3OEO A;  3SEO A;  2R7W A;  1D0X A;  2Q9C A;  2X51 A;  3POV A;  2C03 A;  4YT8 A;  3FDQ A;  2Q3T A;  3NYM A;  3DJN B;  1TWH A;  4AK9 A;  4E7Z A;  3GAN A;  4GEH A;  3W8H A;  3UGP A;  2HV6 A;  3LNR A;  2CNW D;  4X0R A;  4I44 A;  2L9J A;  3FAJ A;  3N2Z B;  3RKO F;  1FTS A;  5KYX B;  3S0X A;  3NDB B;  5KYW A;  1LS1 A;  3ASO C;  4U5D E;  3N24 A;  4J32 B;  1V54 C;  3B0P A;  2WB7 A;  3HTK C;  3IEE A;  4O6Y A;  1TR2 A;  3NYJ A;  2BE5 F;  1WGW A;  2J7P A;  4XLN F;  4GYT A;  3ZVR A;  3QMK A;  2DYS C;  2H7O A;  3AG3 C;  2L81 A;  3EQL F;  4O6N A;  1J8M F;  1NU9 C;  1ST6 A;  4J30 B;  3ABL C;  4LLC A;  1ZHY A;  3EG9 B;  4YN0 B;  4BJ5 C;  3L0I A;  2G3V A;  3H65 A;  2KNH A;  4I1M A;  2R7V A;  5KYU A;  5T3W A;  1SMY F;  3Q6N A;  3ZSU A;  2KW3 C;  1VYK A;  3RH3 A;  4ANJ A;  3PHF 2;  4KBL A;  1IZM A;  3I4U A;  2NG1 A;  4K0D A;  3N0T A;  4ZLD A;  3ZC4 A;  4DBQ A;  4XLP F;  5DQT A;  2KGO A;  4DBR A;  2M4E A;  3KMI A;  4AX2 A;  2ZXP A;  4C3B A;  2CDQ A;  5CI8 A;  2MWQ A;  1RJ9 B;  4G7Z F;  5F5H A;  1KU2 A;  1MMG A;  3I5Q A;  3K1I C;  1FMV A;  3ZIB A;  4DOZ A;  4ZLC A;  2KQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...