3WHNA

Hemerythrin-like domain of dcrh i119h mutant (met)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
133
structure length
132
Chain Sequence
DVLVKWSEDLANLPSIDTQHKRLVDYINDLYAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHHMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Hemerythrin-like domain protein DcrH
publication title H2O2-dependent substrate oxidation by an engineered diiron site in a bacterial hemerythrin
pubmed doi rcsb
source organism Desulfovibrio vulgaris
total genus 60
structure length 132
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 3whnA00
2AWCA 2MHRA 4XPYA 3WHNA 2AWYA 1A7EA 2AVKA 4XQ1A 2HMZA 1HMOA 1I4ZA 2HMQA 1A7DA 3AGUA 3AGTA 4XPWA 4XPXA 1HMDA 3WAQA 1I4YA
chains in the Genus database with same CATH superfamily
5TJ5E 4KBLA 1Q0MA 3QTHA 5JRAA 4XPYA 3S84A 5CIVA 1CGME 3DI5A 4MVQA 2AWYA 2XLEA 3L8IA 1T6UA 4MW8A 4U5HA 2AVKA 3G50A 2GDCA 3NYJA 3EZIA 5COFA 2YQYA 1WTYA 2LIGA 2A6HF 4KC9A 3E70C 3DJNB 1RKEB 4PJMA 3ZIBA 4BJTA 1KNYA 2NUPA 2P0NA 2XL4A 1HMOA 2R7TA 1ZHXA 1C03A 1QZXA 1O5HA 5T3WA 1U0BB 1NZEA 4GYTA 4JRZA 2NPUA 2QLAA 4C3EA 1RXQA 3QVYA 4WJ0A 4C7OA 3UNGC 4CDYA 1Y4CA 1OR3A 2OU6A 4PFPA 4U5EE 1NG1A 3JT1A 3SXYA 5KYYA 3S9OA 2UUHA 3CEXA 4N6CA 4G0HA 1AVOB 2G3VA 2PP4A 1EI7A 1LM3B 2E87A 3EG9A 4LACB 4CIPA 1Q0KA 5L0JA 4UDVA 2XLDA 3PCVA 3G4XA 5BQIA 1LE2A 2Q4FA 3QZCA 1HE1A 1T01A 1Z6AA 3O39A 4JZAA 3JSZA 4EIYA 2J9WA 4MVOA 3EH2A 1HE9A 1UG7A 1BR2A 3DWWA 2YWAA 2WL8A 3SXMA 2OCCC 3UMHA 5A6KA 4QDLA 5L3VA 3PHF2 5KYUA 3FHDA 3KPHA 2NSGA 3FMSA 2CNWD 2ZPAA 3RH3A 4CX9A 2XS1A 1V55C 2V3CC 3DE8A 3NKDA 5D92A 4XLNF 3K6BA 4CS9A 5DS6A 5A6BA 2KK1A 5FZTA 3AQBA 1C02A 3S27A 3U9MA 2XLMA 3DM5A 1QKRA 4J7TA 3AGUA 3CSKA 5L0HA 3M15A 2XM0A 4G7ZF 1XZPA 2DI3A 2XXAA 1UFBA 3B0PA 1BR4A 5BQHA 1E85A 2XLOA 4XEFA 3KYIA 1K05A 1D0ZA 4Q4ZF 4EKWA 1OXKA 2D4UA 3ZQVA 2HJMA 4JJFA 1C17M 4Q7CA 4MS2A 4IGGA 3S28A 3O55A 1D0YA 1Z7Qc 3GM2A 1ZHTA 2W45A 3BRJA 2HFIA 1RMVA 2EILC 3LLIA 4LERA 2V26A 2CGEA 4IARA 1G8XA 5JLIA 3EQLF 2YEVA 2H7BA 3T6GB 1Y6DA 4RBNA 2DB4A 2MYSA 2P6VA 2PFDA 4H4KC 4JC7A 2NUTA 2XL6A 1I5NA 1FNTc 4P6IC 3EGDB 3U9JA 2DYRC 3LS0A 4PJNA 4YT8A 3A11A 4E7SA 2C04A 2NUPB 3MFNA 4ULVA 2OJED 1HMDA 5F5HA 3GWLA 3M4CA 4BJ6A 3JRMO 2AWCA 3EPVA 4JIOA 2Q3TA 4MVSA 4W8PA 3TK0A 5DQZA 4C7OB 4FESA 3B9QA 1GGQA 2Y39A 1MQVA 1MMGA 3I5PA 3DAGA 256BA 4AK9A 4JVSA 4JTAB 4J30B 2L81A 3HNJA 4MTFA 3RW0A 3RQGA 4AX2A 1ZYRF 1OXBA 3AQCA 4EUKB 5JUAA 2R7RA 4EBBA 4XTKA 1TFOB 3K1HA 3SZRA 3N2ZB 4D4XA 3GEIA 4CJOA 1FMVA 4ZLDA 1E83A 2J46A 3LUTB 4YK5A 1ZW3A 2A69F 2YRFA 3F47A 4M63A 3M1CB 4B6IA 4X0RA 4I1OB 1YAUO 3SXKA 1YJGA 1LPEA 1OKKA 4U5BE 2BC5A 4OD4A 2I15A 2HKVA 2VC9A 1BZ4A 3X1OA 4BJ6C 3ZDLA 5L0IA 3W2VA 2I8BA 3HNIA 3GANA 3K1IA 1CPQA 3LAYA 3PMRA 3W8HA 4C3BA 2XXAB 1YZCA 3C63A 1L7CA 1V74B 4JTCB 2FAPB 3TD7A 1I4ZA 2RSEB 2LP4A 1QQ3A 4BJ1A 4ER9A 2Y3HA 4BPMA 3UMKA 3S90A 4OINF 3UGOA 3NKEA 1CPRA 1RKCA 1T5OA 4PK4A 4YL0A 2WZGA 2LCHA 4O79A 3MX3A 4JKVA 5BUOA 3LLKA 3H2VA 4AE4A 5AC5A 3EHMA 2KQ9A 2Q9CA 1U6HA 4AL0A 3WHNA 1YVIA 4IAOA 1KTMA 2YL3A 3RIPA 3L1MA 3AJMA 2VB6A 1YZAA 4MTOA 2NUTB 3MLGA 3ATPA 3LEVA 1CGOA 3EH1A 5GPGB 2CW0F 1QSPA 3FOPA 3K1IC 3GWNA 5L0CA 1M56C 2L7AA 1OW8A 4N4WA 2OEXA 4E18A 4LDQA 4DBRA 1GM5A 2ZXWC 1K40A 3LEOA 4DRHB 4XLPF 1EKYA 1APCA 1PD0A 3AG4C 1NU9C 4LDKA 3AG1C 2J9BA 2R7SA 1VB5A 2VCBA 2DGJA 3VF0A 4QI2A 1B68A 3OA1A 2HUJA 2J45A 2JPUA 3IQ5A 3EFOA 4MVZA 2LFDA 1ZZPA 3AG2C 5E3CA 4BEJA 4AL1A 3ZSUA 3L34A 2P61A 3H65A 1RJ9A 4JW1A 2AU5A 2G3KA 2YL1A 2Z15A 1LVKA 2Y3GA 5BQGA 3JZ0A 3W4YA 2W9YA 4IRUA 4LLCA 3EGXA 1J8MF 3CAXA 3FVYA 4NQFA 4XWJA 3RVZA 3C18A 2JX0A 3L8JA 4Z9HA 1ZU5A 4JEBA 4DXWA 1TWGA 1XZQA 3LNRA 5COMA 5A6BD 2M64A 3B0UX 3JYYA 1HW2A 2GWWA 1HW1A 1LS4A 3FXHA 5KYWB 5KYNA 4Z9IA 2Q9AA 3DJUB 3HTKC 4EBJA 1GS9A 1VYIA 2AP3A 2ASRA 4YL3A 3NDBB 2XSEA 1TWHA 4A2NB 2IYLD 3F46A 3DMDA 2YLIA 5JSLA 4K0DA 2L6HA 3U2MA 4EHPA 3L0IA 3O10A 3V5XA 1JPJA 2H8AA 3CZ6A 3WAQA 1OCCC 5JP7A 1NFNA 1TWAA 3K33A 4MW3A 4WGZA 2X0CA 3U3BA 3UR3C 2LQGA 5FCLA 2UUIA 2R7XA 3KMIA 5F28E 2Y3DA 4HFFB 2DYSC 4U9DA 1M2VA 2KNHA 5IY5C 3GM1A 2IXNA 3TJ6A 3VYWA 1D0XA 4AE4B 3PDMP 1LS1A 2IXOA 2YLGA 5A6JA 4CDAA 1NLXA 2QNLA 4PJLA 3S29A 2HSQA 4DRJB 3ZTZA 4MVRA 2IOQA 2EIJC 3DM9B 2R03A 5DQTA 3ASOC 2YHSA 5JVEA 2CDQA 2KW3C 3Q7GA 4EBKA 2R7OA 2GA0A 2BE5F 3KH2A 3T4RA 2LFFA 1G5ZA 3HJCA 3RQEA 1WATA 4YT2A 4J7YA 3Q6MA 1Z5ZA 1SMYF 4IB4A 4XEKA 4CBEA 1A0BA 5A69A 4YL1A 3KKBA 4O6YA 3RYLA 4NCQA 2YL0A 3RVYA 2EINC 1BDJB 2KSFA 3IEEA 3TQOA 5HSWA 3TJ5A 2CCYA 5KYYB 2P1AA 2L6GA 3JRTA 2L9JA 1RCPA 3W2WA 3EG9B 3EFOB 2KJGA 1NU7D 1VMAA 1R5ID 2CYDA 1SYQA 4LDRA 2IXMA 1S05A 1RJ9B 2OEVA 3WODF 4BJ5C 3MBGA 3N24A 1WGWA 1EA8A 3QW1A 2XLHA 3V5YA 4A4AA 1VYKA 1RKEA 3DE9A 3R2PA 3EGXB 1LE4A 1T6IA 4G78A 4JE9A 4CSAA 2P7VA 4KNWA 1M57C 5EHHA 5KYUB 1OKKD 2WVNA 3GORA 4U9EA 3T9OA 4JURI 1U89A 2OJQA 5AC4A 4FAPB 2O9XA 2ETSA 1FR0A 3EZHA 4ONSA 2A0BA 5DVWA 3ZTMA 1OCOC 1E86A 4OIQF 3RQFA 2F22A 4YT5A 3C7JA 4JCZA 3KL4A 3NYLA 2EIKC 1E84A 1NSGB 3IHUA 2OQMA 4OD5A 4PR9A 2R02A 3GODA 2L6FA 3RKOF 3V7OA 4E7ZA 1N1CA 2KYHA 3S0XA 4Q5SF 3G4ZA 3MYIA 1H7IA 1JMWA 1AEPA 2WB7A 4HFKB 3I5QA 4W8KA 5AGFA 5E2QA 2HV7A 3AGTA 3WG7C 1M2VB 4DVYP 2OG2A 3DZAA 4CIHA 1TFKB 3U8PA 5DS5A 2HZ8A 4XPXA 1JOGA 3SEOA 5HV9A 3V5ZA 5B3SC 1MMDA 3VAYA 4CSAC 2J0WA 2A0UA 2QE9A 3J06A 3IQTA 5CI8A 3B71A 5D91A 4DBQA 1G4US 1A7EA 1WN0A 4U5DE 3AOUA 4CS8A 4XQ1A 3C8GD 3SXZA 2R25A 3LS1A 2EPLX 2J9UA 2VCAA 1F1MA 3NMIA 1IW7F 1QPUA 3EJNA 3HLZA 2ICWG 3ABKC 3NG1A 1H9GA 2QY9A 3X2QC 2EPKX 3QVZA 5DLJA 4YT4A 1OQCA 4MQ9F 4YJWA 3C8GA 1EQ1A 1HY5A 2ZXPA 4E0HA 2J9VA 4N6HA 3NMKA 2HS5A 3JSEO 1T6QA 4DJ9A 4PACA 2HMQA 3SNHA 4DRIB 2PX3A 2X51A 3U3FA 2PBEA 3R7CA 3EHNA 4E0IA 5JS5A 1FFTC 1R4TA 4MVMA 1FTSA 2J7PA 3A9CA 1G4WR 2R05A 3NMJA 2YLDA 1TR2A 3NYMA 5B1AC 4J32B 1DOVA 2WZLA 2XLVA 5CI9A 3VM6A 1LIHA 1V4AA 5DS4A 2VH3A 3DXJF 1Z3IX 1O3UA 3EGDA 1VOMA 3DKAA 4KNVA 4MTGA 1BBHA 1L3PA 1GQAA 2HMZA 5T3TA 1VTMP 2MWQA 2VASA 4CS8C 1WOLA 2A6EF 3QW0A 4O6MA 4EWCA 3BEHA 5A6AA 2J8WA 4NTBA 5EGYA 3JYHA 4I3MA 1VLTA 5L0FA 1QLEC 2J0XA 4IWBA 2EIMC 2RD9A 5E3AA 2HV6A 3IPMO 1TWCA 3US6A 4BG0A 5B3IA 2QTVA 1W2WA 1T9KA 1DOWA 3Q7LA 4FWVA 4NY3A 2GFHA 3U0CA 2YZSA 4G7OF 3MYFA 3ZQYA 4XPWA 4RD9A 1OCRC 1WWPA 3U5SA 3ITFA 3ZG1A 2LK4A 2R7WA 5JT4A 1MNEA 4I1MA 1I4YA 3FDQA 4KI2A 2H7OA 1E2XA 2EPMX 2HSBA 1Z23A 2D5RB 4MVUA 2OOCA 1FAPB 3C62A 1ZHYA 4K7BA 2FFHA 3LNMB 1M2OA 5L0DA 3SP1A 1FFHA 2Q7RA 4BJ5A 3TOLA 4ULWA 4O6NA 4CS7A 2W4BA 4P9FA 1H9TA 3QMKA 2CNWA 3K7DA 1H6GA 1SF8A 4R32A 1V54C 1VLSA 3O6XA 2WZFA 2VCCA 4ANJA 1A7VA 1OCZC 3VRCA 4WABA 1AUEA 4E17A 2XRHA 5K0IA 5KYXA 4XEVA 4HE8D 1K04A 2LSEA 3B0VC 1ST6A 1TKNA 3N0TA 4CDVA 4IAQA 1MMAA 4K1OA 4OIRF 2ZD9A 3C8GB 3U8VA 2MHRA 4U5CE 2XS8A 2H7VC 2IXPA 1D1AA 3HNKA 2R7VA 2FGYA 3IQCA 1Q0GA 5E33A 4RDAA 1D1CA 2Q00A 2YL7A 2ZXOA 3ECSA 4DOZA 3H2UA 2R7UA 1KU2A 2YVKA 1Q0FA 1YARO 2Y3BA 4QI0A 1JPNA 5L0GA 4JTDB 3HNLA 1J8YF 2KC3A 3ABMC 1ORYA 1OW7A 2YKZA 2JD3A 1CGNA 3GEHA 4MNDA 2KGOA 2TMVP 4LLEA 2PNOA 4CS9C 1ZHWA 4C3DA 4YN0B 3AG3C 2NSFA 3W8IA 3CQZA 3RFYA 1JRAA 2GAQA 2PX0A 1FMWA 4IJJA 2IBFA 2IM8A 1JAFA 4NC3A 3RF3A 1YA7O 4GQHA 4D4NA 4ZLCA 3TULA 1MMNA 4O7GA 4OIOF 4N06A 1ZU4A 1XWJA 3UMIA 1PV3A 3LJBA 4L6RA 1YA9A 2WVOA 4JJGA 3ZVRA 5T1DB 4OIPF 2NG1A 3JTLO 1A41A 2BL2A 1YYJA 4FX5A 3Q6NA 1BR1A 1Z63A 4JCHA 3GM3A 2OKUA 3C8ZA 3M79A 3T6JA 2C03A 1IZMA 3NRHA 3M4BA 1MNDA 1LI7A 3ASNC 4F4BA 3T6BA 1PCXA 1VK5A 2XL8A 4PJJA 5L3QA 3ZWIA 4YWQA 1ZHZA 3DAFA 3FOOA 3ABLC 2EPOA 3DD7A 1O87A 1PD1A 1ZW2A 1SZIA 4JEAA 4PFOA 4WGYA 1ORJA 2B0HA 2PF4E 1Q0DA 4NTFA 2A68F 4NTAA 4CJGA 2QUPA 1ORSC 3OWTA 5KYWA 3FAPB 3GEEA 4U5GA 1NFOA 1LKXA 2XM4A 1QVXA 1YLMA 1D1BA 1M6TA 2Y69C 3POVA 3B29A 4P9TA 5B1BC 4Z9JA 3ZC4A 2G62A 4U5FE 1S7ZA 3JCUQ 5KYXB 2WVQA 5F5FA 2B0JA 1LI5A 2XLWA 3K66A 2LD6A 2R7QA 2W4MA 2HJ3A 3IQ6A 4I44A 3U2LA 3E9VA 5COGA 4DVZA 2Q9BA 1JR8A 5EK0A 1NBBA 1OR2A 2J7PD 3TOMA 4HEAJ 2M4EA 1A7DA 2R9RB 1SR2A 1ZVZA 3UGPA 1TQGA 4BEMJ 3FAJA 3OEOA 3I4UA 1YYXA 3KYJA 3SYNA 3LESA 2ZXRA 4H54A 1WASA 2EPNA 1OW6A 4GEHA 3HKKA 1YDIA 2A1DD 4G7HF
chains in the Genus database with same CATH topology
2AWCA 2MHRA 4XPYA 3WHNA 2AWYA 1A7EA 2AVKA 4XQ1A 2HMZA 1HMOA 1I4ZA 2HMQA 1A7DA 3AGUA 3AGTA 4XPWA 4XPXA 1HMDA 3WAQA 1I4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWC A;  2MHR A;  4XPY A;  3WHN A;  2AWY A;  1A7E A;  2AVK A;  4XQ1 A;  2HMZ A;  1HMO A;  1I4Z A;  2HMQ A;  1A7D A;  3AGU A;  3AGT A;  4XPW A;  4XPX A;  1HMD A;  3WAQ A;  1I4Y A; 
#chains in the Genus database with same CATH topology
 5TJ5 E;  4KBL A;  1Q0M A;  3QTH A;  5JRA A;  4XPY A;  3S84 A;  5CIV A;  1CGM E;  3DI5 A;  4MVQ A;  2AWY A;  2XLE A;  3L8I A;  1T6U A;  4MW8 A;  4U5H A;  2AVK A;  3G50 A;  2GDC A;  3NYJ A;  3EZI A;  5COF A;  2YQY A;  1WTY A;  2LIG A;  2A6H F;  4KC9 A;  3E70 C;  3DJN B;  1RKE B;  4PJM A;  3ZIB A;  4BJT A;  1KNY A;  2NUP A;  2P0N A;  2XL4 A;  1HMO A;  2R7T A;  1ZHX A;  1C03 A;  1QZX A;  1O5H A;  5T3W A;  1U0B B;  1NZE A;  4GYT A;  4JRZ A;  2NPU A;  2QLA A;  4C3E A;  1RXQ A;  3QVY A;  4WJ0 A;  4C7O A;  3UNG C;  4CDY A;  1Y4C A;  1OR3 A;  2OU6 A;  4PFP A;  4U5E E;  1NG1 A;  3JT1 A;  3SXY A;  5KYY A;  3S9O A;  2UUH A;  3CEX A;  4N6C A;  4G0H A;  1AVO B;  2G3V A;  2PP4 A;  1EI7 A;  1LM3 B;  2E87 A;  3EG9 A;  4LAC B;  4CIP A;  1Q0K A;  5L0J A;  4UDV A;  2XLD A;  3PCV A;  3G4X A;  5BQI A;  1LE2 A;  2Q4F A;  3QZC A;  1HE1 A;  1T01 A;  1Z6A A;  3O39 A;  4JZA A;  3JSZ A;  4EIY A;  2J9W A;  4MVO A;  3EH2 A;  1HE9 A;  1UG7 A;  1BR2 A;  3DWW A;  2YWA A;  2WL8 A;  3SXM A;  2OCC C;  3UMH A;  5A6K A;  4QDL A;  5L3V A;  3PHF 2;  5KYU A;  3FHD A;  3KPH A;  2NSG A;  3FMS A;  2CNW D;  2ZPA A;  3RH3 A;  4CX9 A;  2XS1 A;  1V55 C;  2V3C C;  3DE8 A;  3NKD A;  5D92 A;  4XLN F;  3K6B A;  4CS9 A;  5DS6 A;  5A6B A;  2KK1 A;  5FZT A;  3AQB A;  1C02 A;  3S27 A;  3U9M A;  2XLM A;  3DM5 A;  1QKR A;  4J7T A;  3AGU A;  3CSK A;  5L0H A;  3M15 A;  2XM0 A;  4G7Z F;  1XZP A;  2DI3 A;  2XXA A;  1UFB A;  3B0P A;  1BR4 A;  5BQH A;  1E85 A;  2XLO A;  4XEF A;  3KYI A;  1K05 A;  1D0Z A;  4Q4Z F;  4EKW A;  1OXK A;  2D4U A;  3ZQV A;  2HJM A;  4JJF A;  1C17 M;  4Q7C A;  4MS2 A;  4IGG A;  3S28 A;  3O55 A;  1D0Y A;  1Z7Q c;  3GM2 A;  1ZHT A;  2W45 A;  3BRJ A;  2HFI A;  1RMV A;  2EIL C;  3LLI A;  4LER A;  2V26 A;  2CGE A;  4IAR A;  1G8X A;  5JLI A;  3EQL F;  2YEV A;  2H7B A;  3T6G B;  1Y6D A;  4RBN A;  2DB4 A;  2MYS A;  2P6V A;  2PFD A;  4H4K C;  4JC7 A;  2NUT A;  2XL6 A;  1I5N A;  1FNT c;  4P6I C;  3EGD B;  3U9J A;  2DYR C;  3LS0 A;  4PJN A;  4YT8 A;  3A11 A;  4E7S A;  2C04 A;  2NUP B;  3MFN A;  4ULV A;  2OJE D;  1HMD A;  5F5H A;  3GWL A;  3M4C A;  4BJ6 A;  3JRM O;  2AWC A;  3EPV A;  4JIO A;  2Q3T A;  4MVS A;  4W8P A;  3TK0 A;  5DQZ A;  4C7O B;  4FES A;  3B9Q A;  1GGQ A;  2Y39 A;  1MQV A;  1MMG A;  3I5P A;  3DAG A;  256B A;  4AK9 A;  4JVS A;  4JTA B;  4J30 B;  2L81 A;  3HNJ A;  4MTF A;  3RW0 A;  3RQG A;  4AX2 A;  1ZYR F;  1OXB A;  3AQC A;  4EUK B;  5JUA A;  2R7R A;  4EBB A;  4XTK A;  1TFO B;  3K1H A;  3SZR A;  3N2Z B;  4D4X A;  3GEI A;  4CJO A;  1FMV A;  4ZLD A;  1E83 A;  2J46 A;  3LUT B;  4YK5 A;  1ZW3 A;  2A69 F;  2YRF A;  3F47 A;  4M63 A;  3M1C B;  4B6I A;  4X0R A;  4I1O B;  1YAU O;  3SXK A;  1YJG A;  1LPE A;  1OKK A;  4U5B E;  2BC5 A;  4OD4 A;  2I15 A;  2HKV A;  2VC9 A;  1BZ4 A;  3X1O A;  4BJ6 C;  3ZDL A;  5L0I A;  3W2V A;  2I8B A;  3HNI A;  3GAN A;  3K1I A;  1CPQ A;  3LAY A;  3PMR A;  3W8H A;  4C3B A;  2XXA B;  1YZC A;  3C63 A;  1L7C A;  1V74 B;  4JTC B;  2FAP B;  3TD7 A;  1I4Z A;  2RSE B;  2LP4 A;  1QQ3 A;  4BJ1 A;  4ER9 A;  2Y3H A;  4BPM A;  3UMK A;  3S90 A;  4OIN F;  3UGO A;  3NKE A;  1CPR A;  1RKC A;  1T5O A;  4PK4 A;  4YL0 A;  2WZG A;  2LCH A;  4O79 A;  3MX3 A;  4JKV A;  5BUO A;  3LLK A;  3H2V A;  4AE4 A;  5AC5 A;  3EHM A;  2KQ9 A;  2Q9C A;  1U6H A;  4AL0 A;  3WHN A;  1YVI A;  4IAO A;  1KTM A;  2YL3 A;  3RIP A;  3L1M A;  3AJM A;  2VB6 A;  1YZA A;  4MTO A;  2NUT B;  3MLG A;  3ATP A;  3LEV A;  1CGO A;  3EH1 A;  5GPG B;  2CW0 F;  1QSP A;  3FOP A;  3K1I C;  3GWN A;  5L0C A;  1M56 C;  2L7A A;  1OW8 A;  4N4W A;  2OEX A;  4E18 A;  4LDQ A;  4DBR A;  1GM5 A;  2ZXW C;  1K40 A;  3LEO A;  4DRH B;  4XLP F;  1EKY A;  1APC A;  1PD0 A;  3AG4 C;  1NU9 C;  4LDK A;  3AG1 C;  2J9B A;  2R7S A;  1VB5 A;  2VCB A;  2DGJ A;  3VF0 A;  4QI2 A;  1B68 A;  3OA1 A;  2HUJ A;  2J45 A;  2JPU A;  3IQ5 A;  3EFO A;  4MVZ A;  2LFD A;  1ZZP A;  3AG2 C;  5E3C A;  4BEJ A;  4AL1 A;  3ZSU A;  3L34 A;  2P61 A;  3H65 A;  1RJ9 A;  4JW1 A;  2AU5 A;  2G3K A;  2YL1 A;  2Z15 A;  1LVK A;  2Y3G A;  5BQG A;  3JZ0 A;  3W4Y A;  2W9Y A;  4IRU A;  4LLC A;  3EGX A;  1J8M F;  3CAX A;  3FVY A;  4NQF A;  4XWJ A;  3RVZ A;  3C18 A;  2JX0 A;  3L8J A;  4Z9H A;  1ZU5 A;  4JEB A;  4DXW A;  1TWG A;  1XZQ A;  3LNR A;  5COM A;  5A6B D;  2M64 A;  3B0U X;  3JYY A;  1HW2 A;  2GWW A;  1HW1 A;  1LS4 A;  3FXH A;  5KYW B;  5KYN A;  4Z9I A;  2Q9A A;  3DJU B;  3HTK C;  4EBJ A;  1GS9 A;  1VYI A;  2AP3 A;  2ASR A;  4YL3 A;  3NDB B;  2XSE A;  1TWH A;  4A2N B;  2IYL D;  3F46 A;  3DMD A;  2YLI A;  5JSL A;  4K0D A;  2L6H A;  3U2M A;  4EHP A;  3L0I A;  3O10 A;  3V5X A;  1JPJ A;  2H8A A;  3CZ6 A;  3WAQ A;  1OCC C;  5JP7 A;  1NFN A;  1TWA A;  3K33 A;  4MW3 A;  4WGZ A;  2X0C A;  3U3B A;  3UR3 C;  2LQG A;  5FCL A;  2UUI A;  2R7X A;  3KMI A;  5F28 E;  2Y3D A;  4HFF B;  2DYS C;  4U9D A;  1M2V A;  2KNH A;  5IY5 C;  3GM1 A;  2IXN A;  3TJ6 A;  3VYW A;  1D0X A;  4AE4 B;  3PDM P;  1LS1 A;  2IXO A;  2YLG A;  5A6J A;  4CDA A;  1NLX A;  2QNL A;  4PJL A;  3S29 A;  2HSQ A;  4DRJ B;  3ZTZ A;  4MVR A;  2IOQ A;  2EIJ C;  3DM9 B;  2R03 A;  5DQT A;  3ASO C;  2YHS A;  5JVE A;  2CDQ A;  2KW3 C;  3Q7G A;  4EBK A;  2R7O A;  2GA0 A;  2BE5 F;  3KH2 A;  3T4R A;  2LFF A;  1G5Z A;  3HJC A;  3RQE A;  1WAT A;  4YT2 A;  4J7Y A;  3Q6M A;  1Z5Z A;  1SMY F;  4IB4 A;  4XEK A;  4CBE A;  1A0B A;  5A69 A;  4YL1 A;  3KKB A;  4O6Y A;  3RYL A;  4NCQ A;  2YL0 A;  3RVY A;  2EIN C;  1BDJ B;  2KSF A;  3IEE A;  3TQO A;  5HSW A;  3TJ5 A;  2CCY A;  5KYY B;  2P1A A;  2L6G A;  3JRT A;  2L9J A;  1RCP A;  3W2W A;  3EG9 B;  3EFO B;  2KJG A;  1NU7 D;  1VMA A;  1R5I D;  2CYD A;  1SYQ A;  4LDR A;  2IXM A;  1S05 A;  1RJ9 B;  2OEV A;  3WOD F;  4BJ5 C;  3MBG A;  3N24 A;  1WGW A;  1EA8 A;  3QW1 A;  2XLH A;  3V5Y A;  4A4A A;  1VYK A;  1RKE A;  3DE9 A;  3R2P A;  3EGX B;  1LE4 A;  1T6I A;  4G78 A;  4JE9 A;  4CSA A;  2P7V A;  4KNW A;  1M57 C;  5EHH A;  5KYU B;  1OKK D;  2WVN A;  3GOR A;  4U9E A;  3T9O A;  4JUR I;  1U89 A;  2OJQ A;  5AC4 A;  4FAP B;  2O9X A;  2ETS A;  1FR0 A;  3EZH A;  4ONS A;  2A0B A;  5DVW A;  3ZTM A;  1OCO C;  1E86 A;  4OIQ F;  3RQF A;  2F22 A;  4YT5 A;  3C7J A;  4JCZ A;  3KL4 A;  3NYL A;  2EIK C;  1E84 A;  1NSG B;  3IHU A;  2OQM A;  4OD5 A;  4PR9 A;  2R02 A;  3GOD A;  2L6F A;  3RKO F;  3V7O A;  4E7Z A;  1N1C A;  2KYH A;  3S0X A;  4Q5S F;  3G4Z A;  3MYI A;  1H7I A;  1JMW A;  1AEP A;  2WB7 A;  4HFK B;  3I5Q A;  4W8K A;  5AGF A;  5E2Q A;  2HV7 A;  3AGT A;  3WG7 C;  1M2V B;  4DVY P;  2OG2 A;  3DZA A;  4CIH A;  1TFK B;  3U8P A;  5DS5 A;  2HZ8 A;  4XPX A;  1JOG A;  3SEO A;  5HV9 A;  3V5Z A;  5B3S C;  1MMD A;  3VAY A;  4CSA C;  2J0W A;  2A0U A;  2QE9 A;  3J06 A;  3IQT A;  5CI8 A;  3B71 A;  5D91 A;  4DBQ A;  1G4U S;  1A7E A;  1WN0 A;  4U5D E;  3AOU A;  4CS8 A;  4XQ1 A;  3C8G D;  3SXZ A;  2R25 A;  3LS1 A;  2EPL X;  2J9U A;  2VCA A;  1F1M A;  3NMI A;  1IW7 F;  1QPU A;  3EJN A;  3HLZ A;  2ICW G;  3ABK C;  3NG1 A;  1H9G A;  2QY9 A;  3X2Q C;  2EPK X;  3QVZ A;  5DLJ A;  4YT4 A;  1OQC A;  4MQ9 F;  4YJW A;  3C8G A;  1EQ1 A;  1HY5 A;  2ZXP A;  4E0H A;  2J9V A;  4N6H A;  3NMK A;  2HS5 A;  3JSE O;  1T6Q A;  4DJ9 A;  4PAC A;  2HMQ A;  3SNH A;  4DRI B;  2PX3 A;  2X51 A;  3U3F A;  2PBE A;  3R7C A;  3EHN A;  4E0I A;  5JS5 A;  1FFT C;  1R4T A;  4MVM A;  1FTS A;  2J7P A;  3A9C A;  1G4W R;  2R05 A;  3NMJ A;  2YLD A;  1TR2 A;  3NYM A;  5B1A C;  4J32 B;  1DOV A;  2WZL A;  2XLV A;  5CI9 A;  3VM6 A;  1LIH A;  1V4A A;  5DS4 A;  2VH3 A;  3DXJ F;  1Z3I X;  1O3U A;  3EGD A;  1VOM A;  3DKA A;  4KNV A;  4MTG A;  1BBH A;  1L3P A;  1GQA A;  2HMZ A;  5T3T A;  1VTM P;  2MWQ A;  2VAS A;  4CS8 C;  1WOL A;  2A6E F;  3QW0 A;  4O6M A;  4EWC A;  3BEH A;  5A6A A;  2J8W A;  4NTB A;  5EGY A;  3JYH A;  4I3M A;  1VLT A;  5L0F A;  1QLE C;  2J0X A;  4IWB A;  2EIM C;  2RD9 A;  5E3A A;  2HV6 A;  3IPM O;  1TWC A;  3US6 A;  4BG0 A;  5B3I A;  2QTV A;  1W2W A;  1T9K A;  1DOW A;  3Q7L A;  4FWV A;  4NY3 A;  2GFH A;  3U0C A;  2YZS A;  4G7O F;  3MYF A;  3ZQY A;  4XPW A;  4RD9 A;  1OCR C;  1WWP A;  3U5S A;  3ITF A;  3ZG1 A;  2LK4 A;  2R7W A;  5JT4 A;  1MNE A;  4I1M A;  1I4Y A;  3FDQ A;  4KI2 A;  2H7O A;  1E2X A;  2EPM X;  2HSB A;  1Z23 A;  2D5R B;  4MVU A;  2OOC A;  1FAP B;  3C62 A;  1ZHY A;  4K7B A;  2FFH A;  3LNM B;  1M2O A;  5L0D A;  3SP1 A;  1FFH A;  2Q7R A;  4BJ5 A;  3TOL A;  4ULW A;  4O6N A;  4CS7 A;  2W4B A;  4P9F A;  1H9T A;  3QMK A;  2CNW A;  3K7D A;  1H6G A;  1SF8 A;  4R32 A;  1V54 C;  1VLS A;  3O6X A;  2WZF A;  2VCC A;  4ANJ A;  1A7V A;  1OCZ C;  3VRC A;  4WAB A;  1AUE A;  4E17 A;  2XRH A;  5K0I A;  5KYX A;  4XEV A;  4HE8 D;  1K04 A;  2LSE A;  3B0V C;  1ST6 A;  1TKN A;  3N0T A;  4CDV A;  4IAQ A;  1MMA A;  4K1O A;  4OIR F;  2ZD9 A;  3C8G B;  3U8V A;  2MHR A;  4U5C E;  2XS8 A;  2H7V C;  2IXP A;  1D1A A;  3HNK A;  2R7V A;  2FGY A;  3IQC A;  1Q0G A;  5E33 A;  4RDA A;  1D1C A;  2Q00 A;  2YL7 A;  2ZXO A;  3ECS A;  4DOZ A;  3H2U A;  2R7U A;  1KU2 A;  2YVK A;  1Q0F A;  1YAR O;  2Y3B A;  4QI0 A;  1JPN A;  5L0G A;  4JTD B;  3HNL A;  1J8Y F;  2KC3 A;  3ABM C;  1ORY A;  1OW7 A;  2YKZ A;  2JD3 A;  1CGN A;  3GEH A;  4MND A;  2KGO A;  2TMV P;  4LLE A;  2PNO A;  4CS9 C;  1ZHW A;  4C3D A;  4YN0 B;  3AG3 C;  2NSF A;  3W8I A;  3CQZ A;  3RFY A;  1JRA A;  2GAQ A;  2PX0 A;  1FMW A;  4IJJ A;  2IBF A;  2IM8 A;  1JAF A;  4NC3 A;  3RF3 A;  1YA7 O;  4GQH A;  4D4N A;  4ZLC A;  3TUL A;  1MMN A;  4O7G A;  4OIO F;  4N06 A;  1ZU4 A;  1XWJ A;  3UMI A;  1PV3 A;  3LJB A;  4L6R A;  1YA9 A;  2WVO A;  4JJG A;  3ZVR A;  5T1D B;  4OIP F;  2NG1 A;  3JTL O;  1A41 A;  2BL2 A;  1YYJ A;  4FX5 A;  3Q6N A;  1BR1 A;  1Z63 A;  4JCH A;  3GM3 A;  2OKU A;  3C8Z A;  3M79 A;  3T6J A;  2C03 A;  1IZM A;  3NRH A;  3M4B A;  1MND A;  1LI7 A;  3ASN C;  4F4B A;  3T6B A;  1PCX A;  1VK5 A;  2XL8 A;  4PJJ A;  5L3Q A;  3ZWI A;  4YWQ A;  1ZHZ A;  3DAF A;  3FOO A;  3ABL C;  2EPO A;  3DD7 A;  1O87 A;  1PD1 A;  1ZW2 A;  1SZI A;  4JEA A;  4PFO A;  4WGY A;  1ORJ A;  2B0H A;  2PF4 E;  1Q0D A;  4NTF A;  2A68 F;  4NTA A;  4CJG A;  2QUP A;  1ORS C;  3OWT A;  5KYW A;  3FAP B;  3GEE A;  4U5G A;  1NFO A;  1LKX A;  2XM4 A;  1QVX A;  1YLM A;  1D1B A;  1M6T A;  2Y69 C;  3POV A;  3B29 A;  4P9T A;  5B1B C;  4Z9J A;  3ZC4 A;  2G62 A;  4U5F E;  1S7Z A;  3JCU Q;  5KYX B;  2WVQ A;  5F5F A;  2B0J A;  1LI5 A;  2XLW A;  3K66 A;  2LD6 A;  2R7Q A;  2W4M A;  2HJ3 A;  3IQ6 A;  4I44 A;  3U2L A;  3E9V A;  5COG A;  4DVZ A;  2Q9B A;  1JR8 A;  5EK0 A;  1NBB A;  1OR2 A;  2J7P D;  3TOM A;  4HEA J;  2M4E A;  1A7D A;  2R9R B;  1SR2 A;  1ZVZ A;  3UGP A;  1TQG A;  4BEM J;  3FAJ A;  3OEO A;  3I4U A;  1YYX A;  3KYJ A;  3SYN A;  3LES A;  2ZXR A;  4H54 A;  1WAS A;  2EPN A;  1OW6 A;  4GEH A;  3HKK A;  1YDI A;  2A1D D;  4G7H F; 
#chains in the Genus database with same CATH homology
 2AWC A;  2MHR A;  4XPY A;  3WHN A;  2AWY A;  1A7E A;  2AVK A;  4XQ1 A;  2HMZ A;  1HMO A;  1I4Z A;  2HMQ A;  1A7D A;  3AGU A;  3AGT A;  4XPW A;  4XPX A;  1HMD A;  3WAQ A;  1I4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...