3WHNA

Hemerythrin-like domain of dcrh i119h mutant (met)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
133
structure length
132
Chain Sequence
DVLVKWSEDLANLPSIDTQHKRLVDYINDLYAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHHMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemerythrin-like domain protein DcrH
publication title H2O2-dependent substrate oxidation by an engineered diiron site in a bacterial hemerythrin
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Metal binding protein
total genus 60
structure length 132
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 3whnA00
1I4YA 2AVKA 1HMDA 4XPXA 3AGTA 2MHRA 2HMZA 4XPWA 1A7EA 3WAQA 2HMQA 2AWYA 1A7DA 4XQ1A 3WHNA 3AGUA 4XPYA 1HMOA 2AWCA 1I4ZA
chains in the Genus database with same CATH superfamily
2XM0A 3AG2C 2Q7RA 1YA7O 1OCCC 2IYLD 2YL0A 2LP4A 1ST6A 3ABLC 5COMA 3RQEA 2OU6A 3JSEO 4IJJA 5JS5A 5E3AA 3DD7A 1ZHYA 3PDMP 1O87A 3NMKA 2FAPB 4FESA 4Z9JA 2XLVA 4DXWA 1PV3A 2IBFA 4CDVA 1NU7D 4CBEA 2OKUA 2MHRA 1JMWA 3RW0A 3ZQVA 4CDYA 4CDAA 4N6HA 2EILC 2AU5A 1TWGA 4AL0A 5AC4A 1K05A 3GM2A 1SZIA 1Q0FA 2YRFA 4JKVA 3WAQA 3Q7LA 2A0UA 5DVWA 1C17M 1W2WA 1H9TA 3EZHA 3QW0A 3RYLA 2BC5A 1LS1A 2FFHA 1E86A 2D4UA 3LLKA 1WN0A 1L3PA 4O6MA 4PJJA 4CS9A 3GM3A 5JP7A 1HMOA 3LS1A 4EBJA 1U0BB 2VC9A 2XLEA 2YVKA 2Y3GA 3H2UA 4YT5A 4C3DA 3B0VC 3MFNA 4CJGA 2PBEA 5L0DA 3L1MA 3K1IC 3DMDA 2OG2A 2Q00A 2W4MA 2XS8A 3I5QA 2QNLA 2HV7A 1DOVA 2NUPA 1PCXA 1MQVA 1ZHZA 2KSFA 1Z63A 2OQMA 3CSKA 3ZTZA 2J9BA 2IOQA 4MQ9F 1Y4CA 3ECSA 3EHMA 3IHUA 4FWVA 4G0HA 2ICWG 1IZMA 1YJGA 2J8WA 3C8GD 3DJUB 3O10A 3TQOA 4YN0B 2MYSA 2UUIA 2M4EA 3Q6NA 2KC3A 5L0CA 1A7DA 5DQZA 4MVRA 1O3UA 3W8IA 4BG0A 2E87A 2PX3A 4J30B 1UFBA 2EIJC 2ZXRA 4O7GA 1FTSA 1H9GA 1Y6DA 3R2PA 4ONSA 3DAGA 1S7ZA 1EI7A 1IW7F 4GYTA 1FFHA 4EHPA 1JR8A 4BJTA 4OIOF 3MX3A 2ZXOA 4XEKA 3DAFA 1FMVA 2C03A 2HKVA 1APCA 4K0DA 1Q0MA 1XZQA 3AOUA 3RQGA 2WZGA 1D1BA 3NMIA 1YZCA 3FAPB 3LLIA 4MS2A 1YVIA 5TJ5E 5A6BD 4U9DA 4JTDB 4MVOA 3S9OA 3U2MA 4MNDA 2XXAA 4MW8A 1G8XA 3R7CA 3VM6A 1YYJA 5JT4A 4MVUA 3SEOA 4DVYP 1OKKD 3AG1C 1Z7Qc 4EKWA 5AGFA 3QZCA 5KYYB 2P7VA 3MYIA 5HSWA 1RMVA 2V3CC 2LK4A 5FZTA 1KTMA 3QMKA 3O39A 2HS5A 3EGXB 1KNYA 3EGDA 3GEHA 3OWTA 1QVXA 1LE4A 1LVKA 2LFFA 2ZPAA 3K66A 1FR0A 1NG1A 1ZZPA 5COGA 3S29A 1FNTc 1EQ1A 1HE9A 3B71A 3CQZA 2GFHA 4J7TA 4YL3A 2NUTA 2C04A 2X0CA 3QVZA 3TD7A 1RKEB 3U9JA 2H7OA 1WATA 4IAOA 2YL7A 3T6GB 5A6KA 3AGTA 2EPKX 1FMWA 5D92A 1ZW2A 1JAFA 1TQGA 3FVYA 2XLMA 3ZG1A 4MTOA 3KH2A 4IRUA 1MMNA 2YLDA 1MMDA 2J9VA 1ORJA 2JD3A 3J06A 2XLHA 2O9XA 3HNIA 3NYMA 256BA 4I3MA 5CI9A 3IQ6A 3LUTB 5T3TA 2KJGA 2HJMA 4ULVA 2CDQA 2R7RA 2TMVP 3HTKC 1S05A 1T6UA 4C3EA 4A4AA 2HSQA 1YA9A 2LCHA 1LS4A 2P1AA 2P61A 4C7OB 2R7OA 2Z15A 2EPOA 3M4CA 4NTAA 2CNWA 1K04A 4OIQF 3U3BA 1WTYA 1Z6AA 4PR9A 5A6AA 4YK5A 1RJ9B 4U5EE 4Q5SF 2YWAA 3EFOB 3I5PA 2I15A 3EH2A 4N4WA 1XWJA 2IXPA 3JYYA 1BR1A 4JIOA 2R7TA 1OQCA 3SXYA 3JCUQ 1DOWA 2R05A 2HFIA 1LE2A 2XSEA 2CYDA 2YZSA 1Z3IX 2J0WA 1D0XA 3QVYA 2HV6A 3CEXA 3DM9B 4BPMA 1M6TA 3HKKA 3AJMA 2EIMC 1BZ4A 3AQCA 1T9KA 4JURI 4K1OA 1I5NA 4U5GA 3W2WA 4I44A 3AG4C 3LNMB 5DS6A 2OJED 1BDJB 1MNDA 4GEHA 4L6RA 3SXKA 1I4YA 2ZD9A 1HW2A 2AVKA 1EKYA 1OXBA 2KW3C 5KYWA 3EZIA 3JZ0A 4O6NA 2Y69C 1ZHWA 2OOCA 3VYWA 4BJ1A 1MMAA 2J0XA 4CS8A 1PD0A 5BQIA 1AEPA 3H2VA 4K7BA 4LLEA 2RD9A 4PJLA 5CIVA 2VCCA 1YDIA 4IB4A 4XLPF 3AG3C 4PFOA 1VMAA 3ABKC 4H54A 3OEOA 5GPGB 5BQGA 4EWCA 4E18A 4BEJA 2EPLX 4IARA 1D0YA 1G4US 2DYSC 4NC3A 2OEXA 3G4ZA 1VYKA 2RSEB 3KKBA 1PD1A 2Q9AA 3WG7C 5KYNA 4CSAA 2A68F 4LDQA 4BJ6A 4EBKA 4OIPF 1RXQA 1J8YF 2R02A 3AQBA 3US6A 2AWCA 1L7CA 3EHNA 3ZWIA 4KBLA 1BR4A 1LIHA 4C3BA 4P9FA 1SYQA 3KMIA 4CS8C 3IPMO 3GANA 1M2OA 1VYIA 2KGOA 2L7AA 3BEHA 2R03A 3HLZA 5KYUB 2YL1A 3ASNC 4JEBA 2PP4A 1QLEC 2XL6A 2R25A 3KYJA 4N6CA 4PK4A 2NG1A 4HEAJ 4WGYA 1CPRA 3EQLF 2BL2A 2CCYA 2X51A 2NSGA 2VCBA 3UMIA 1A7EA 2ZXWC 2B0JA 3X2QC 3G50A 4B6IA 3LESA 2I8BA 4CSAC 1K40A 5F5FA 4G7ZF 4AE4B 2VASA 3ASOC 4BJ6C 3LS0A 3U0CA 2LD6A 3RVZA 4CS9C 4XWJA 2HJ3A 2L6HA 4AK9A 4YJWA 3GODA 3S90A 4W8PA 2J45A 2DGJA 4NY3A 2DYRC 3LJBA 3EG9B 4JCZA 4JJFA 1M2VA 1TWAA 4U5DE 4RBNA 3DXJF 2WVQA 2KK1A 4I1OB 3C62A 5COFA 3K6BA 4Z9IA 1VOMA 3TOMA 1GS9A 3U3FA 5DLJA 3G4XA 3M1CB 2R7SA 4O6YA 2G3VA 3N2ZB 2YEVA 1Q0GA 4ULWA 3SXMA 3VAYA 2P0NA 4E7ZA 1NFNA 4P6IC 1E85A 4Q4ZF 5B3IA 4KC9A 2WZLA 1J8MF 1ZYRF 3H65A 4JEAA 2R7UA 3RKOF 1HW1A 1CGNA 4JZAA 5F5HA 2J9UA 4G78A 1E84A 3KL4A 1JPJA 3ZSUA 3T6BA 3K33A 2YL3A 4JC7A 3ZC4A 4CJOA 2L6GA 2B0HA 3E70C 2ZXPA 1HY5A 1JOGA 3M79A 2Q3TA 4IGGA 4E7SA 4YWQA 1HMDA 2F22A 2GA0A 4KNWA 4XPXA 4CIPA 3NYLA 2H7VC 4OINF 2XLWA 1YARO 2ETSA 1TWCA 2J46A 4CS7A 4YL1A 1D1CA 1OW7A 2NPUA 3FOOA 2XS1A 1Q0DA 4J32B 4DOZA 4OD5A 2D5RB 5KYXB 3L0IA 3A9CA 1NU9C 3GEEA 2R7XA 4MVSA 4U9EA 2ASRA 4D4XA 1U89A 5L0HA 3IQ5A 4KNVA 2A6EF 4DRHB 1E2XA 4RDAA 3ZTMA 2IXOA 1C03A 2GWWA 1BBHA 1LI7A 1NBBA 3CZ6A 4NTBA 5D91A 1I4ZA 4FAPB 3DWWA 1ZVZA 1AUEA 3SYNA 1WWPA 2NSFA 2A0BA 2Y3DA 4YT8A 3DJNB 2PF4E 3ZIBA 4PACA 3U5SA 3KPHA 2XLDA 4DVZA 2J9WA 3JRTA 5DS4A 2PFDA 1ORSC 2HSBA 3RH3A 3RFYA 4DBQA 4MTFA 2BE5F 2HMZA 2Q9CA 5JRAA 3MBGA 3RVYA 1R5ID 4MVQA 4OIRF 4XPWA 4EBBA 1OCZC 1QPUA 2IM8A 3U2LA 5A6JA 1CGOA 4XQ1A 2W4BA 2R7QA 3JT1A 4DBRA 2HZ8A 5KYYA 3N0TA 5BUOA 1SR2A 3SP1A 3V5YA 1B68A 3EJNA 1TWHA 3HNJA 1A41A 3NRHA 3S84A 1QQ3A 3JTLO 4JCHA 4MVZA 3GEIA 2KYHA 4XLNF 4JTAB 2UUHA 1YYXA 3EGXA 4FX5A 2NUPB 1T01A 2YLIA 1VTMP 4BJ5A 1VB5A 3CAXA 4LACB 3UMKA 5JSLA 3GM1A 4W8KA 2XL4A 3T9OA 4CX9A 2QY9A 5B3SC 3TOLA 1RKEA 3SNHA 1NSGB 3V5ZA 1D1AA 2L81A 5EGYA 3C63A 4WGZA 1QKRA 4XEVA 1LPEA 2DB4A 1GQAA 1RCPA 1Z23A 4DRJB 3C8GA 1A7VA 5L0FA 1D0ZA 2AWYA 1CPQA 4QDLA 1V55C 3KYIA 5T1DB 2W9YA 3F46A 3HNKA 3MYFA 2J7PD 4AL1A 3S0XA 4IWBA 1WGWA 4LLCA 5E33A 1LM3B 3TJ5A 3AGUA 4HE8D 2IXMA 4NCQA 2CNWD 4BJ5C 1ZU4A 2KNHA 3UGPA 3NKEA 4LDKA 4C7OA 2WB7A 3FAJA 1ZW3A 3JSZA 3HJCA 3NG1A 2EPNA 5B1AC 1BR2A 3RQFA 1WASA 3WODF 2XXAB 2Y3BA 1OR2A 4ZLCA 1RKCA 3W2VA 3ITFA 3T4RA 3K1IA 4BEMJ 1C02A 5FCLA 3UGOA 1JPNA 5A6BA 1RJ9A 3EFOA 1LI5A 4U5HA 4ER9A 3L8JA 3GWLA 1ZU5A 2R7WA 2LQGA 2R9RB 2P6VA 4N06A 2FGYA 3UNGC 4UDVA 3OA1A 1OKKA 3UMHA 3M15A 3C8ZA 3EGDB 3A11A 5JLIA 1F1MA 3PMRA 4J7YA 1T6QA 1SF8A 3DM5A 2PX0A 3F47A 4MTGA 4P9TA 2QTVA 4GQHA 3ZVRA 4DJ9A 1MMGA 1VLSA 2NUTB 4HFFB 2LFDA 3GORA 2YLGA 2IXNA 2XRHA 4PFPA 2H8AA 5B1BC 1U6HA 4U5CE 3S28A 2LSEA 1TFKB 1WOLA 5T3WA 5EHHA 2LIGA 3QTHA 4M63A 2HUJA 5F28E 3Q7GA 5L3VA 1V4AA 4XEFA 3PCVA 3LEOA 2XLOA 1T6IA 2AP3A 2EIKC 4QI2A 1GGQA 3DE8A 1OR3A 1YZAA 4JJGA 2DI3A 5A69A 1QZXA 3FHDA 3ATPA 4G7OF 2WL8A 4O79A 1H6GA 4NQFA 2CGEA 3SXZA 4JTCB 2L6FA 5JUAA 4IAQA 3HNLA 3JYHA 1OW6A 2M64A 3ABMC 3VRCA 1E83A 4I1MA 2Y3HA 4RD9A 1CGME 4X0RA 1Z5ZA 2Y39A 2XL8A 3JRMO 4H4KC 3PHF2 3NYJA 4CIHA 1M57C 2PNOA 3EPVA 4XPYA 2R7VA 1KU2A 3S27A 4E0IA 1TR2A 4JRZA 4WJ0A 3TK0A 3I4UA 5IY5C 4U5BE 3DI5A 2VB6A 2OEVA 2WVOA 3LNRA 4G7HF 5EK0A 3U8VA 3DKAA 2H7BA 4NTFA 1R4TA 3FOPA 3RF3A 5L0IA 4ZLDA 5KYUA 2Q9BA 1AVOB 1ZHXA 3ZDLA 1YAUO 1QSPA 1JRAA 3GWNA 2YKZA 3POVA 3IEEA 4MVMA 1M56C 4HFKB 5E3CA 3K1HA 1NZEA 3E9VA 4R32A 2GAQA 4LDRA 3WHNA 4AE4A 1Q0KA 2KQ9A 2CW0F 1FFTC 3SZRA 5L0JA 5KYWB 2G3KA 3FMSA 1OCOC 5DQTA 4YT4A 3N24A 1V74B 1EA8A 2A6HF 1VLTA 3EG9A 3B9QA 4EIYA 5HV9A 2QUPA 5AC5A 5E2QA 1TFOB 1ZHTA 2L9JA 4Z9HA 1G4WR 3U8PA 4YT2A 3W4YA 3C8GB 1OW8A 4D4NA 2GDCA 2A69F 2VCAA 4WABA 3M4BA 3TJ6A 3DE9A 2A1DD 3NMJA 3W8HA 1O5HA 2V26A 1ORYA 1XZPA 3C18A 4MW3A 4A2NB 2OJQA 3QW1A 4E17A 3B0UX 3FDQA 3B0PA 4QI0A 3L8IA 3ZQYA 4PJMA 4YL0A 2JPUA 1GM5A 2J7PA 3NKDA 4JVSA 5L3QA 1SMYF 3BRJA 3B29A 5K0IA 4Q7CA 5JVEA 3O55A 4E0HA 1LKXA 2YQYA 4LERA 5L0GA 4JE9A 2W45A 4U5FE 3UR3C 4ANJA 3L34A 1FAPB 3LEVA 1N1CA 2OCCC 1TKNA 4F4BA 1OCRC 1A0BA 3C7JA 2EINC 2QLAA 3TULA 3MLGA 1H7IA 4PJNA 5CI8A 3FXHA 1HE1A 1UG7A 2WZFA 3X1OA 2MWQA 1G5ZA 3VF0A 3T6JA 4OD4A 4AX2A 3Q6MA 1OXKA 4DRIB 1NLXA 1VK5A 1MNEA 2XM4A 2YHSA 3LAYA 3V5XA 2HMQA 1YLMA 3V7OA 5BQHA 3IQTA 4XTKA 2JX0A 5DS5A 4KI2A 1M2VB 3IQCA 5KYXA 1NFOA 3NDBB 3O6XA 2QE9A 4JW1A 4EUKB 1T5OA 1V54C 2VH3A 3EH1A 3RIPA 3K7DA 3U9MA 2G62A 2WVNA 2EPMX 3DZAA 2Q4FA
chains in the Genus database with same CATH topology
1I4YA 2AVKA 1HMDA 4XPXA 3AGTA 2MHRA 2HMZA 4XPWA 1A7EA 3WAQA 2HMQA 2AWYA 1A7DA 4XQ1A 3WHNA 3AGUA 4XPYA 1HMOA 2AWCA 1I4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I4Y A;  2AVK A;  1HMD A;  4XPX A;  3AGT A;  2MHR A;  2HMZ A;  4XPW A;  1A7E A;  3WAQ A;  2HMQ A;  2AWY A;  1A7D A;  4XQ1 A;  3WHN A;  3AGU A;  4XPY A;  1HMO A;  2AWC A;  1I4Z A; 
#chains in the Genus database with same CATH topology
 2XM0 A;  3AG2 C;  2Q7R A;  1YA7 O;  1OCC C;  2IYL D;  2YL0 A;  2LP4 A;  1ST6 A;  3ABL C;  5COM A;  3RQE A;  2OU6 A;  3JSE O;  4IJJ A;  5JS5 A;  5E3A A;  3DD7 A;  1ZHY A;  3PDM P;  1O87 A;  3NMK A;  2FAP B;  4FES A;  4Z9J A;  2XLV A;  4DXW A;  1PV3 A;  2IBF A;  4CDV A;  1NU7 D;  4CBE A;  2OKU A;  2MHR A;  1JMW A;  3RW0 A;  3ZQV A;  4CDY A;  4CDA A;  4N6H A;  2EIL C;  2AU5 A;  1TWG A;  4AL0 A;  5AC4 A;  1K05 A;  3GM2 A;  1SZI A;  1Q0F A;  2YRF A;  4JKV A;  3WAQ A;  3Q7L A;  2A0U A;  5DVW A;  1C17 M;  1W2W A;  1H9T A;  3EZH A;  3QW0 A;  3RYL A;  2BC5 A;  1LS1 A;  2FFH A;  1E86 A;  2D4U A;  3LLK A;  1WN0 A;  1L3P A;  4O6M A;  4PJJ A;  4CS9 A;  3GM3 A;  5JP7 A;  1HMO A;  3LS1 A;  4EBJ A;  1U0B B;  2VC9 A;  2XLE A;  2YVK A;  2Y3G A;  3H2U A;  4YT5 A;  4C3D A;  3B0V C;  3MFN A;  4CJG A;  2PBE A;  5L0D A;  3L1M A;  3K1I C;  3DMD A;  2OG2 A;  2Q00 A;  2W4M A;  2XS8 A;  3I5Q A;  2QNL A;  2HV7 A;  1DOV A;  2NUP A;  1PCX A;  1MQV A;  1ZHZ A;  2KSF A;  1Z63 A;  2OQM A;  3CSK A;  3ZTZ A;  2J9B A;  2IOQ A;  4MQ9 F;  1Y4C A;  3ECS A;  3EHM A;  3IHU A;  4FWV A;  4G0H A;  2ICW G;  1IZM A;  1YJG A;  2J8W A;  3C8G D;  3DJU B;  3O10 A;  3TQO A;  4YN0 B;  2MYS A;  2UUI A;  2M4E A;  3Q6N A;  2KC3 A;  5L0C A;  1A7D A;  5DQZ A;  4MVR A;  1O3U A;  3W8I A;  4BG0 A;  2E87 A;  2PX3 A;  4J30 B;  1UFB A;  2EIJ C;  2ZXR A;  4O7G A;  1FTS A;  1H9G A;  1Y6D A;  3R2P A;  4ONS A;  3DAG A;  1S7Z A;  1EI7 A;  1IW7 F;  4GYT A;  1FFH A;  4EHP A;  1JR8 A;  4BJT A;  4OIO F;  3MX3 A;  2ZXO A;  4XEK A;  3DAF A;  1FMV A;  2C03 A;  2HKV A;  1APC A;  4K0D A;  1Q0M A;  1XZQ A;  3AOU A;  3RQG A;  2WZG A;  1D1B A;  3NMI A;  1YZC A;  3FAP B;  3LLI A;  4MS2 A;  1YVI A;  5TJ5 E;  5A6B D;  4U9D A;  4JTD B;  4MVO A;  3S9O A;  3U2M A;  4MND A;  2XXA A;  4MW8 A;  1G8X A;  3R7C A;  3VM6 A;  1YYJ A;  5JT4 A;  4MVU A;  3SEO A;  4DVY P;  1OKK D;  3AG1 C;  1Z7Q c;  4EKW A;  5AGF A;  3QZC A;  5KYY B;  2P7V A;  3MYI A;  5HSW A;  1RMV A;  2V3C C;  2LK4 A;  5FZT A;  1KTM A;  3QMK A;  3O39 A;  2HS5 A;  3EGX B;  1KNY A;  3EGD A;  3GEH A;  3OWT A;  1QVX A;  1LE4 A;  1LVK A;  2LFF A;  2ZPA A;  3K66 A;  1FR0 A;  1NG1 A;  1ZZP A;  5COG A;  3S29 A;  1FNT c;  1EQ1 A;  1HE9 A;  3B71 A;  3CQZ A;  2GFH A;  4J7T A;  4YL3 A;  2NUT A;  2C04 A;  2X0C A;  3QVZ A;  3TD7 A;  1RKE B;  3U9J A;  2H7O A;  1WAT A;  4IAO A;  2YL7 A;  3T6G B;  5A6K A;  3AGT A;  2EPK X;  1FMW A;  5D92 A;  1ZW2 A;  1JAF A;  1TQG A;  3FVY A;  2XLM A;  3ZG1 A;  4MTO A;  3KH2 A;  4IRU A;  1MMN A;  2YLD A;  1MMD A;  2J9V A;  1ORJ A;  2JD3 A;  3J06 A;  2XLH A;  2O9X A;  3HNI A;  3NYM A;  256B A;  4I3M A;  5CI9 A;  3IQ6 A;  3LUT B;  5T3T A;  2KJG A;  2HJM A;  4ULV A;  2CDQ A;  2R7R A;  2TMV P;  3HTK C;  1S05 A;  1T6U A;  4C3E A;  4A4A A;  2HSQ A;  1YA9 A;  2LCH A;  1LS4 A;  2P1A A;  2P61 A;  4C7O B;  2R7O A;  2Z15 A;  2EPO A;  3M4C A;  4NTA A;  2CNW A;  1K04 A;  4OIQ F;  3U3B A;  1WTY A;  1Z6A A;  4PR9 A;  5A6A A;  4YK5 A;  1RJ9 B;  4U5E E;  4Q5S F;  2YWA A;  3EFO B;  3I5P A;  2I15 A;  3EH2 A;  4N4W A;  1XWJ A;  2IXP A;  3JYY A;  1BR1 A;  4JIO A;  2R7T A;  1OQC A;  3SXY A;  3JCU Q;  1DOW A;  2R05 A;  2HFI A;  1LE2 A;  2XSE A;  2CYD A;  2YZS A;  1Z3I X;  2J0W A;  1D0X A;  3QVY A;  2HV6 A;  3CEX A;  3DM9 B;  4BPM A;  1M6T A;  3HKK A;  3AJM A;  2EIM C;  1BZ4 A;  3AQC A;  1T9K A;  4JUR I;  4K1O A;  1I5N A;  4U5G A;  3W2W A;  4I44 A;  3AG4 C;  3LNM B;  5DS6 A;  2OJE D;  1BDJ B;  1MND A;  4GEH A;  4L6R A;  3SXK A;  1I4Y A;  2ZD9 A;  1HW2 A;  2AVK A;  1EKY A;  1OXB A;  2KW3 C;  5KYW A;  3EZI A;  3JZ0 A;  4O6N A;  2Y69 C;  1ZHW A;  2OOC A;  3VYW A;  4BJ1 A;  1MMA A;  2J0X A;  4CS8 A;  1PD0 A;  5BQI A;  1AEP A;  3H2V A;  4K7B A;  4LLE A;  2RD9 A;  4PJL A;  5CIV A;  2VCC A;  1YDI A;  4IB4 A;  4XLP F;  3AG3 C;  4PFO A;  1VMA A;  3ABK C;  4H54 A;  3OEO A;  5GPG B;  5BQG A;  4EWC A;  4E18 A;  4BEJ A;  2EPL X;  4IAR A;  1D0Y A;  1G4U S;  2DYS C;  4NC3 A;  2OEX A;  3G4Z A;  1VYK A;  2RSE B;  3KKB A;  1PD1 A;  2Q9A A;  3WG7 C;  5KYN A;  4CSA A;  2A68 F;  4LDQ A;  4BJ6 A;  4EBK A;  4OIP F;  1RXQ A;  1J8Y F;  2R02 A;  3AQB A;  3US6 A;  2AWC A;  1L7C A;  3EHN A;  3ZWI A;  4KBL A;  1BR4 A;  1LIH A;  4C3B A;  4P9F A;  1SYQ A;  3KMI A;  4CS8 C;  3IPM O;  3GAN A;  1M2O A;  1VYI A;  2KGO A;  2L7A A;  3BEH A;  2R03 A;  3HLZ A;  5KYU B;  2YL1 A;  3ASN C;  4JEB A;  2PP4 A;  1QLE C;  2XL6 A;  2R25 A;  3KYJ A;  4N6C A;  4PK4 A;  2NG1 A;  4HEA J;  4WGY A;  1CPR A;  3EQL F;  2BL2 A;  2CCY A;  2X51 A;  2NSG A;  2VCB A;  3UMI A;  1A7E A;  2ZXW C;  2B0J A;  3X2Q C;  3G50 A;  4B6I A;  3LES A;  2I8B A;  4CSA C;  1K40 A;  5F5F A;  4G7Z F;  4AE4 B;  2VAS A;  3ASO C;  4BJ6 C;  3LS0 A;  3U0C A;  2LD6 A;  3RVZ A;  4CS9 C;  4XWJ A;  2HJ3 A;  2L6H A;  4AK9 A;  4YJW A;  3GOD A;  3S90 A;  4W8P A;  2J45 A;  2DGJ A;  4NY3 A;  2DYR C;  3LJB A;  3EG9 B;  4JCZ A;  4JJF A;  1M2V A;  1TWA A;  4U5D E;  4RBN A;  3DXJ F;  2WVQ A;  2KK1 A;  4I1O B;  3C62 A;  5COF A;  3K6B A;  4Z9I A;  1VOM A;  3TOM A;  1GS9 A;  3U3F A;  5DLJ A;  3G4X A;  3M1C B;  2R7S A;  4O6Y A;  2G3V A;  3N2Z B;  2YEV A;  1Q0G A;  4ULW A;  3SXM A;  3VAY A;  2P0N A;  4E7Z A;  1NFN A;  4P6I C;  1E85 A;  4Q4Z F;  5B3I A;  4KC9 A;  2WZL A;  1J8M F;  1ZYR F;  3H65 A;  4JEA A;  2R7U A;  3RKO F;  1HW1 A;  1CGN A;  4JZA A;  5F5H A;  2J9U A;  4G78 A;  1E84 A;  3KL4 A;  1JPJ A;  3ZSU A;  3T6B A;  3K33 A;  2YL3 A;  4JC7 A;  3ZC4 A;  4CJO A;  2L6G A;  2B0H A;  3E70 C;  2ZXP A;  1HY5 A;  1JOG A;  3M79 A;  2Q3T A;  4IGG A;  4E7S A;  4YWQ A;  1HMD A;  2F22 A;  2GA0 A;  4KNW A;  4XPX A;  4CIP A;  3NYL A;  2H7V C;  4OIN F;  2XLW A;  1YAR O;  2ETS A;  1TWC A;  2J46 A;  4CS7 A;  4YL1 A;  1D1C A;  1OW7 A;  2NPU A;  3FOO A;  2XS1 A;  1Q0D A;  4J32 B;  4DOZ A;  4OD5 A;  2D5R B;  5KYX B;  3L0I A;  3A9C A;  1NU9 C;  3GEE A;  2R7X A;  4MVS A;  4U9E A;  2ASR A;  4D4X A;  1U89 A;  5L0H A;  3IQ5 A;  4KNV A;  2A6E F;  4DRH B;  1E2X A;  4RDA A;  3ZTM A;  2IXO A;  1C03 A;  2GWW A;  1BBH A;  1LI7 A;  1NBB A;  3CZ6 A;  4NTB A;  5D91 A;  1I4Z A;  4FAP B;  3DWW A;  1ZVZ A;  1AUE A;  3SYN A;  1WWP A;  2NSF A;  2A0B A;  2Y3D A;  4YT8 A;  3DJN B;  2PF4 E;  3ZIB A;  4PAC A;  3U5S A;  3KPH A;  2XLD A;  4DVZ A;  2J9W A;  3JRT A;  5DS4 A;  2PFD A;  1ORS C;  2HSB A;  3RH3 A;  3RFY A;  4DBQ A;  4MTF A;  2BE5 F;  2HMZ A;  2Q9C A;  5JRA A;  3MBG A;  3RVY A;  1R5I D;  4MVQ A;  4OIR F;  4XPW A;  4EBB A;  1OCZ C;  1QPU A;  2IM8 A;  3U2L A;  5A6J A;  1CGO A;  4XQ1 A;  2W4B A;  2R7Q A;  3JT1 A;  4DBR A;  2HZ8 A;  5KYY A;  3N0T A;  5BUO A;  1SR2 A;  3SP1 A;  3V5Y A;  1B68 A;  3EJN A;  1TWH A;  3HNJ A;  1A41 A;  3NRH A;  3S84 A;  1QQ3 A;  3JTL O;  4JCH A;  4MVZ A;  3GEI A;  2KYH A;  4XLN F;  4JTA B;  2UUH A;  1YYX A;  3EGX A;  4FX5 A;  2NUP B;  1T01 A;  2YLI A;  1VTM P;  4BJ5 A;  1VB5 A;  3CAX A;  4LAC B;  3UMK A;  5JSL A;  3GM1 A;  4W8K A;  2XL4 A;  3T9O A;  4CX9 A;  2QY9 A;  5B3S C;  3TOL A;  1RKE A;  3SNH A;  1NSG B;  3V5Z A;  1D1A A;  2L81 A;  5EGY A;  3C63 A;  4WGZ A;  1QKR A;  4XEV A;  1LPE A;  2DB4 A;  1GQA A;  1RCP A;  1Z23 A;  4DRJ B;  3C8G A;  1A7V A;  5L0F A;  1D0Z A;  2AWY A;  1CPQ A;  4QDL A;  1V55 C;  3KYI A;  5T1D B;  2W9Y A;  3F46 A;  3HNK A;  3MYF A;  2J7P D;  4AL1 A;  3S0X A;  4IWB A;  1WGW A;  4LLC A;  5E33 A;  1LM3 B;  3TJ5 A;  3AGU A;  4HE8 D;  2IXM A;  4NCQ A;  2CNW D;  4BJ5 C;  1ZU4 A;  2KNH A;  3UGP A;  3NKE A;  4LDK A;  4C7O A;  2WB7 A;  3FAJ A;  1ZW3 A;  3JSZ A;  3HJC A;  3NG1 A;  2EPN A;  5B1A C;  1BR2 A;  3RQF A;  1WAS A;  3WOD F;  2XXA B;  2Y3B A;  1OR2 A;  4ZLC A;  1RKC A;  3W2V A;  3ITF A;  3T4R A;  3K1I A;  4BEM J;  1C02 A;  5FCL A;  3UGO A;  1JPN A;  5A6B A;  1RJ9 A;  3EFO A;  1LI5 A;  4U5H A;  4ER9 A;  3L8J A;  3GWL A;  1ZU5 A;  2R7W A;  2LQG A;  2R9R B;  2P6V A;  4N06 A;  2FGY A;  3UNG C;  4UDV A;  3OA1 A;  1OKK A;  3UMH A;  3M15 A;  3C8Z A;  3EGD B;  3A11 A;  5JLI A;  1F1M A;  3PMR A;  4J7Y A;  1T6Q A;  1SF8 A;  3DM5 A;  2PX0 A;  3F47 A;  4MTG A;  4P9T A;  2QTV A;  4GQH A;  3ZVR A;  4DJ9 A;  1MMG A;  1VLS A;  2NUT B;  4HFF B;  2LFD A;  3GOR A;  2YLG A;  2IXN A;  2XRH A;  4PFP A;  2H8A A;  5B1B C;  1U6H A;  4U5C E;  3S28 A;  2LSE A;  1TFK B;  1WOL A;  5T3W A;  5EHH A;  2LIG A;  3QTH A;  4M63 A;  2HUJ A;  5F28 E;  3Q7G A;  5L3V A;  1V4A A;  4XEF A;  3PCV A;  3LEO A;  2XLO A;  1T6I A;  2AP3 A;  2EIK C;  4QI2 A;  1GGQ A;  3DE8 A;  1OR3 A;  1YZA A;  4JJG A;  2DI3 A;  5A69 A;  1QZX A;  3FHD A;  3ATP A;  4G7O F;  2WL8 A;  4O79 A;  1H6G A;  4NQF A;  2CGE A;  3SXZ A;  4JTC B;  2L6F A;  5JUA A;  4IAQ A;  3HNL A;  3JYH A;  1OW6 A;  2M64 A;  3ABM C;  3VRC A;  1E83 A;  4I1M A;  2Y3H A;  4RD9 A;  1CGM E;  4X0R A;  1Z5Z A;  2Y39 A;  2XL8 A;  3JRM O;  4H4K C;  3PHF 2;  3NYJ A;  4CIH A;  1M57 C;  2PNO A;  3EPV A;  4XPY A;  2R7V A;  1KU2 A;  3S27 A;  4E0I A;  1TR2 A;  4JRZ A;  4WJ0 A;  3TK0 A;  3I4U A;  5IY5 C;  4U5B E;  3DI5 A;  2VB6 A;  2OEV A;  2WVO A;  3LNR A;  4G7H F;  5EK0 A;  3U8V A;  3DKA A;  2H7B A;  4NTF A;  1R4T A;  3FOP A;  3RF3 A;  5L0I A;  4ZLD A;  5KYU A;  2Q9B A;  1AVO B;  1ZHX A;  3ZDL A;  1YAU O;  1QSP A;  1JRA A;  3GWN A;  2YKZ A;  3POV A;  3IEE A;  4MVM A;  1M56 C;  4HFK B;  5E3C A;  3K1H A;  1NZE A;  3E9V A;  4R32 A;  2GAQ A;  4LDR A;  3WHN A;  4AE4 A;  1Q0K A;  2KQ9 A;  2CW0 F;  1FFT C;  3SZR A;  5L0J A;  5KYW B;  2G3K A;  3FMS A;  1OCO C;  5DQT A;  4YT4 A;  3N24 A;  1V74 B;  1EA8 A;  2A6H F;  1VLT A;  3EG9 A;  3B9Q A;  4EIY A;  5HV9 A;  2QUP A;  5AC5 A;  5E2Q A;  1TFO B;  1ZHT A;  2L9J A;  4Z9H A;  1G4W R;  3U8P A;  4YT2 A;  3W4Y A;  3C8G B;  1OW8 A;  4D4N A;  2GDC A;  2A69 F;  2VCA A;  4WAB A;  3M4B A;  3TJ6 A;  3DE9 A;  2A1D D;  3NMJ A;  3W8H A;  1O5H A;  2V26 A;  1ORY A;  1XZP A;  3C18 A;  4MW3 A;  4A2N B;  2OJQ A;  3QW1 A;  4E17 A;  3B0U X;  3FDQ A;  3B0P A;  4QI0 A;  3L8I A;  3ZQY A;  4PJM A;  4YL0 A;  2JPU A;  1GM5 A;  2J7P A;  3NKD A;  4JVS A;  5L3Q A;  1SMY F;  3BRJ A;  3B29 A;  5K0I A;  4Q7C A;  5JVE A;  3O55 A;  4E0H A;  1LKX A;  2YQY A;  4LER A;  5L0G A;  4JE9 A;  2W45 A;  4U5F E;  3UR3 C;  4ANJ A;  3L34 A;  1FAP B;  3LEV A;  1N1C A;  2OCC C;  1TKN A;  4F4B A;  1OCR C;  1A0B A;  3C7J A;  2EIN C;  2QLA A;  3TUL A;  3MLG A;  1H7I A;  4PJN A;  5CI8 A;  3FXH A;  1HE1 A;  1UG7 A;  2WZF A;  3X1O A;  2MWQ A;  1G5Z A;  3VF0 A;  3T6J A;  4OD4 A;  4AX2 A;  3Q6M A;  1OXK A;  4DRI B;  1NLX A;  1VK5 A;  1MNE A;  2XM4 A;  2YHS A;  3LAY A;  3V5X A;  2HMQ A;  1YLM A;  3V7O A;  5BQH A;  3IQT A;  4XTK A;  2JX0 A;  5DS5 A;  4KI2 A;  1M2V B;  3IQC A;  5KYX A;  1NFO A;  3NDB B;  3O6X A;  2QE9 A;  4JW1 A;  4EUK B;  1T5O A;  1V54 C;  2VH3 A;  3EH1 A;  3RIP A;  3K7D A;  3U9M A;  2G62 A;  2WVN A;  2EPM X;  3DZA A;  2Q4F A; 
#chains in the Genus database with same CATH homology
 1I4Y A;  2AVK A;  1HMD A;  4XPX A;  3AGT A;  2MHR A;  2HMZ A;  4XPW A;  1A7E A;  3WAQ A;  2HMQ A;  2AWY A;  1A7D A;  4XQ1 A;  3WHN A;  3AGU A;  4XPY A;  1HMO A;  2AWC A;  1I4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...