1ZU5A

Crystal structure of ftsy from mycoplasma mycoides- space group h32
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
309
structure length
309
Chain Sequence
HPMEKAMLKSAFNFSKDIKKLSKKYKQADDEFFEELEDVLIQTDMGMKMVLKVSNLVRKKTKRDTSFENIKDALVESLYQAYTDNDWTNKKYRIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAGATQQLEEWIKTRLNNKVDLVKANKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKIIQQVEKSAPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLLAFDIDQYIVHLSSGFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational variability of the GTPase domain of the signal recognition particle receptor FtsY
pubmed doi rcsb
source organism Mycoplasma mycoides
molecule tags Protein transport
molecule keywords ftsY
total genus 115
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1zu5A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zu5A02
2GJAA 1KO4A 3I8SA 4HLQB 4QNRA 5FI0B 5CB6A 2ZITA 4NCNA 4FN5A 3HDTA 5J40A 2NMVA 1Q3TA 4M22A 2BMJA 2ZROA 3IBGA 3MRSA 2BM1A 1E2JA 2F55A 1XEWX 1Z3IX 4MRPA 2ZVPX 2FV8A 2IF0A 1XRJA 2CHGA 3QXSA 3V00A 1EFRD 4KYIB 3SR0A 4LYFA 3I62A 3R7WA 2GBLA 3OEED 5CIQA 4MDEA 2YWGA 1HURA 1XTKA 2C5LA 1ZM4A 1Z6GA 1LS6A 4ILEA 4ERNA 3HU2A 4DSOA 4IJMA 2CVHA 3LX5A 4NDZA 1JR3D 1GILA 4ITRC 2WOOA 4B33A 1E1RD 3B1ZA 2TMKA 2EFDB 2CBZA 2OBMA 4Q01A 1DAEA 2ATXA 1I4DD 4B3XA 3FMPB 1OFHA 1WBDA 1F2UB 1Q1BA 1TAGA 1UJ2A 2FN4A 2WM9B 3Q3JB 5AUPB 2VRWA 4JBYA 2OLJA 2Y8EA 4GPTA 1OHHD 1Q1ZA 4PANA 1GL9B 3TKLA 4XWKA 3ONWA 1G3RA 2FOLA 1ZCBA 4MGKR 2GK6A 2WWWA 2ZAOA 3IGFA 3GEEA 3OAAA 4GOKA 2O5VA 2XTZA 2J0VA 5C18A 3BJIC 4PPNA 2CMKA 4GFDA 3PG5A 3LFUA 1IY0A 4ZO4A 4IHQA 2QMOA 2V1XA 1COWA 2XOKD 1JEEA 1SVKA 3KJHA 2GA8A 1GUAA 1UAAA 1E9FA 5EXXA 4BFZA 1XMVA 3D6TB 4Z51A 2F1HA 2NZ8A 5B2ZA 5B57C 2XITA 1H8HD 2FEMA 1G3MA 4MQBA 5EE0A 1E94E 4ZDJA 2ZJ2A 3EXAA 1AGPA 1P9NA 3GJ8A 4ZIRA 4ZI3A 1IXRC 2BVNA 3Q5DA 1JAHA 3HR7A 1Q0UA 4JKYA 1CEEA 2ZRMA 1BIFA 1D9XA 4HB4A 4OQNA 5JRJA 4URXR 1KY3A 1KMHA 3RSLA 1P6XA 3I1FA 1X8LA 4B75A 2QY9A 4B3GA 2ZQ5A 2GEVA 3H86A 4FMDB 4EJSB 4O3MA 1GZSA 1DG1G 2ZR0A 2FE4A 2ZI3A 4TWZA 1BS1A 3OFND 4IW3B 3QVUA 4CEHA 2DR3A 1RRGA 2YOFA 1VHTA 4DIDA 2GDJA 1PVOA 3GLGB 3X1WA 2VHUA 4KLZA 1DAKA 1EFCA 3AKYA 3OF5A 3M6AA 4KO8A 1IN8A 3SI7A 4I1VA 1G3IA 2QL6A 3U3KA 4OBEA 2P5TB 1KY2A 2FA9A 1DOAA 2E1RA 1EWRA 3L0IB 3WNBA 1FQJA 1KI7A 3VKWA 2QM7A 1NMYA 2ZJAA 3KJGA 5FBQB 2WAYA 4DDUA 1XTRA 3PV0A 4L4UA 4BFYA 1GIAA 3CO5A 5FTLA 2JATA 5HKKA 3FGNA 2BWJA 4RZXA 4Z54A 1S1MA 2BEKA 3CW2A 4Z8XA 5H1YA 3WNDA 4Q4JB 1GVNB 3BB4A 4FMBB 5DSZA 4PSAA 2BIFA 2ZSDA 4O0MA 2BKUA 2VLIA 3RC3A 4D4JA 2ZJYA 3AM1A 3FB4A 4TLCA 2O8DB 4B6EA 2XSZA 1LVGA 2ZSBA 4QOSA 3BS4A 2JLWA 2IEYA 1R4AA 2SHKA 2AKAB 4KCGA 1M8PA 2VO1A 3CBQA 3Q8XB 2HYDA 2QNRA 3FFBA 4KSBA 5L3SA 3MWYW 1RC8A 3ASYA 1MOZA 3ZDQA 3O8CA 3GPLA 3WYAA 4BPBA 4OK3A 3GLHA 4PC2A 1F2UA 5G3ZA 2X1VA 4Q47A 4C2TA 3UG6A 3QUSA 2V6JA 2V4ZA 3QPVA 4G0NA 2RGAA 1FOEB 1IBRA 3RS3A 4QJ3A 1KI2A 4DZZA 2HT1A 3CIOA 1OXSC 4P31A 5EE1A 1NSTA 2H7VA 2CCJA 1T9HA 4G3XA 5FBWB 1GFIA 3TW8B 4NCIA 2ODBA 2BBSA 1QHYA 1I2MA 2H5EA 4DC9A 4B3BA 3ZYCA 2PT5A 2ZI5A 2Z6VA 4GMXA 1VG1A 3DM5A 2IYRA 3EIHA 3B1VA 1W36C 1H8EA 3ZIAD 5DYIA 1FZQA 1P2TA 5AJYA 3ZZ0A 1PLJA 3CRW1 1TEXA 5TB5A 2D4HA 1IN5A 4JJZA 3PEWA 1ANKA 3REFA 3TR5A 3IIJA 4AK9A 4Q1AA 4UXIA 1GITA 2QSZA 2AWOA 3T1VA 1KK1A 2FF7A 3B1YA 4TSFD 1FTSA 2ZJBA 5GJBA 2G88A 4TL6A 2XGJA 4G5GA 2WIAA 3TSOA 1NN1A 2EYQA 1CR1A 4B2PA 4YONB 4WXPA 4UXJA 4B3CA 1K6MA 3NHAA 4D25A 1VTKA 2JAQA 2V55B 1PUJA 3H4MA 2RGGA 4Q4AB 3IIKA 5EQTA 3U44A 5EUMA 2V6IA 1XTJA 2GESA 1OFTA 3PENA 4GDFA 1E69A 4V0OA 2OM2A 2ZRJA 2BV3A 2FSGA 4OHYA 1OYYA 1AZTA 5HE8A 5DH9A 3TK1A 3K1JA 3T12A 1XF9A 2X2FA 2ZJ8A 4A8JA 1XXHB 4AD8A 5G3YA 3U7HB 1SVIA 2BJVA 4XTRA 4KBGA 1W0JD 3SC3A 4DHEA 3GJXC 1KSHA 2QN6A 2ZVQX 5GVSA 3KQUA 1N5JA 3KJEA 4A36A 4BFXA 1NMXA 5G53C 1KNXA 4Q1BA 1XEXA 2O8EA 1TPZA 3AVVA 4MKFA 3B5JA 4DUGA 3A4MA 1A4RA 3IBYA 4IXNA 2QQEA 2QAJA 2D62A 2PZEA 1A2BA 1N6PA 5G40A 4GRAA 2CVFA 2QE7A 1NY6A 1G3QA 1U98A 2KI5A 2GAAA 3GEIA 1LF0A 2GF9A 4JYBA 2CCKA 4JVMA 4TYQA 2ZI7A 1ZM9A 1QHXA 2D06A 3VKGA 2HXSA 3AUXA 3BERA 3I73A 3LXXA 3LAWA 1NL3A 2C96A 3A1UA 4HI0E 4JLKA 1RRCA 2A5GA 1VYVA 1XP8A 4LYHA 2ZYWX 4QNMA 3BFVA 3AUYA 3LNCA 3TE6A 2OFOA 1PLLA 4DCVA 4KSCA 2R6DA 4NH0A 3KDSE 2GEUA 5E3HA 2W0SA 2CE2X 2IT1A 4GP6A 4PC6A 3U6KA 1A2KC 3AF0A 3KKPA 3CZQA 4CEJA 3LW7A 4GZMA 3IPXA 4TZ6A 1E9AA 1XTSA 2G77B 3ASZA 3SJZA 1Q12A 1E2LA 1G6HA 4IVRA 4Q03A 5JJLA 4EPTA 1N0VC 2VP2A 4OHZA 1CJMA 1JPNA 5EZ6B 4UNRA 4CW7A 2DFKB 4I99A 2NO7A 3BFKA 1SXJD 2OUKA 3QENA 4Q21A 5E7JA 4V0KA 1CRPA 3U60B 3FMIA 1KNQA 2MSEB 5SZKB 2GBLC 4RY2A 2JLQA 4IOJA 4DLWA 3QF7A 3RWOA 1M7BA 2YYZA 4WZ6A 4PFSA 4D82A 4TMXA 2QAGA 1T3LA 2B92A 2REOA 3D7MA 3K8YA 5KSPA 3HYTA 5KSOA 3VHLB 1MH1A 3CRVA 2W6IA 5FL3A 4OYHA 1C4OA 3BH6A 4RCZA 2Z43A 4ACBA 3T1TA 1G5RA 2QT0A 2OCPA 1G8GA 3OIUA 4OQFA 3RAPR 2IYYA 2RKOA 4F91B 2Z4RA 4Q4AA 1C1YA 1W1WA 2X2EA 4B48A 3UXMA 1KZGB 1W46A 1NP6A 1ZW6A 3T61A 4IOMA 3AP1A 3LD9A 4US0R 2EVWX 3T34A 1U8AA 4K46A 4JMPA 3WP0A 3ECCA 1US8B 4B32A 3TH5A 2EQBA 2WSSA 2GXAA 1OB2A 4HLCA 2A78A 1OHHA 2XXAB 2ORWA 4NYMR 2QROA 1XPOA 4M53A 2H8KA 3NTUA 4QGFA 3FKSA 4MYUA 4UNQA 2ZS7A 1E2MA 1CR2A 1J70A 1P9WA 2QAGC 2VEDA 2CL6X 1W47A 2O0JA 1KKMA 3KXIA 4Z8YA 5TARA 1W4AA 4HZUB 4JT2A 4BQSA 3KQHA 3R7WB 4R9UC 3WYFA 4CZ2A 4RKFA 3LVRE 1BKDR 4LUCA 2CL7X 4EPWA 1SVOA 1E2NA 4MKHA 3QG1A 4BFTA 3V9PA 5L3VA 4PO8A 1FP7A 4EFNA 4CT5A 1M6NA 4J0QA 4EIWA 3K9LA 1OIXA 4M1KA 2IK8A 3KTAA 3BOSA 4HB2A 3SZRA 4LBWA 3I92A 4NE2A 2HF9A 4LJ9A 4LJ7A 4B47A 2P0EA 2ZETA 2PMDA 3C15C 2NPFA 5FBRB 5IK2A 3RYTC 1ZINA 2F1JA 3KQKA 2A5JA 4PO1A 4XD7A 3K70C 4O2LA 4XWAA 4NONA 4NCKA 4FI3C 3UATA 2F3RA 1R10A 3P32A 1T6NA 1NSFA 3LX8A 5F9FA 3IHLA 5FPYA 4DEYA 4PR0A 1TUIA 2KBEA 3LDAA 4MDFA 3G0HA 2PJRA 4ASUA 2HDNB 5C4GB 2PLFA 2YWEA 1RZ3A 1D2MA 1G18A 1G3UA 3NG1A 1U94A 4AKIA 4DB2A 2WJGA 1VIYA 2RGDA 5JHGB 2WWFA 5K8IA 4TMTA 3H0KA 4Q7LA 2F1IA 1UFQA 2JA1A 4JKIA 1KDTA 4F7WA 2ATVA 3B85A 3GLFA 4TMVA 3B1XA 3R8CA 5DN6D 2I1QA 1Z5ZA 4KVGA 2HLDA 1ZM2A 5DNYB 1MKYA 1HEIA 1E79D 1XFAA 1HH4A 1SXJC 2XTMA 1G9XA 3E2IA 3S1AB 5CJ2A 2A9KA 1GTVA 4Y0VA 4QFMA 1G5PA 1XZPA 2WZQA 3LBIA 4MITA 4B73A 2FGJA 2CLDX 3EPJA 3TVTA 4Q1DA 3SQWA 4PAQA 1NF3A 3KB2A 1E4YA 3A58B 3C8UA 5ANRB 2JJ1A 3VX4A 2N1BA 3U7EB 2QMHA 1YR8A 4A8JC 3DO6A 2ZRNA 2YC4C 1GDDA 1Z6YA 4PPFA 2QBYA 4BFWA 1Z0KA 3ZLJA 4QBFA 1J8MF 1S9HA 1W0JA 2YZ2A 4RD0A 3GLGA 1ZUNB 4G5OA 1GNRA 4Q1CA 3I72A 4LGMA 1AJEA 1IXSB 2P65A 2C2HA 2NZJA 3PEUA 4DCNA 1LS1A 2GWHA 5EP1A 4CYMA 3SFZA 4NMMA 2QPOA 1Z0JA 3HU3A 4MGYR 3UANA 1FW6A 1E0AA 2IYLD 4KJZA 5J4YA 4PSVA 1E9DA 4BUJA 1XMJA 2W0MA 3X1YA 4Y0AA 5JI3E 1X86B 5CK5A 1XTQA 1IY1A 3TGPA 2W6JD 1GP2A 2AR7A 3L8YA 2CNWA 1KHTA 2FPMA 4C0BA 1YU9A 2OAQ1 3K0CC 1QVRA 4HZUA 3W90A 5FR1A 5KHOC 2FEOA 4Q4JA 4A4DA 3GD7A 3DMNA 4K81B 2PZGA 4B3FX 5J4KA 1QHIA 3DKPA 3QBTA 3CUEF 4M9QA 3U7FB 1E79A 3LBHA 3DVLA 3MJRA 4QG7A 4R7ZA 1R0XA 4HAZA 5KUTA 2CEAA 4AURA 3PCRB 1EX6A 5K8TA 5HZHA 2B6HA 2JJ8A 5FTNA 5FPSA 5AK0A 5F9HA 3EC2A 2OO7A 1G19A 2D74A 4AYWA 2I4IA 3JVVA 1XMSA 4IOKA 1S8FA 4A0RA 4KBFA 2FG5A 3ZQJA 1KO8A 4IKEA 1W5TA 5TXGA 3K53A 3GLHB 1IN4A 1II8B 4IDPA 2K5UA 5IK2D 2OCYC 1XD8A 4AWXA 4DDVA 3UMSA 2OBNA 1II0A 2H17A 3QKTA 4Q9HA 1BMFD 1S2MA 1SVWA 1KO5A 1X6VA 4BGDA 1JPJA 5JFGA 3VR6A 2WSMA 4BFUA 4Z1MD 3NDBB 4JLNA 1AKYA 2PH1A 1HQYE 1ZYUA 5FFMA 4FD2A 2ONKA 5HCIA 3P4XA 3WMEA 5KNDA 2MMGA 1E98A 2NOAA 1OJLA 1NKTA 2OFXA 2OXCA 5JSZB 3THYB 1A82A 1T8TA 3K0AA 3W8NA 4IDOA 1KSGA 3DZ8A 1J8YF 4QGAA 1JBKA 1GKYA 2ZJ5A 2IHYA 3ZVLA 2XB4A 4LV6A 3G82C 3KQNA 3HJNA 1CJUC 1DBSA 3LA6A 5HTKA 5EJEA 2W6ID 1Z07A 2WWHA 1XZQA 4Q02A 2ZREA 2IXEA 3K9NA 3SYNA 4EJSC 1AZSC 1F60A 2PMKA 3MMPA 1NMZA 4ZV4A 1P61B 5J4VA 2ZRCA 2OESA 2YJTD 3B8HA 2W2TA 4LC0A 5JLJA 3RRNA 1WB9A 2NQ2C 4AC9A 2J0QA 1E9EA 1XJ0A 2RAPA 4AY2A 3CX6A 3PEYA 2O8CB 2FZ4A 3OE7A 1M34E 2AKYA 2AFIE 2WSSD 1SVSA 1MRNA 4H1VA 2C03A 2ZE7A 5FH9A 1P62B 3L82B 1BYUA 2D7DA 4TLBA 1RKBA 2AK3A 5FI1B 3SYKA 3TR0A 3LVQE 1KI3A 3OAAD 3NC0C 2VHQA 3QKRB 4Q4HB 1IQPA 4FXPA 1XEXB 5LB2A 5KYKA 2O8EB 2Q3HA 2C9CA 5M04A 4PHGA 5H70A 4AI6A 2YOGA 4GBMA 5HCNA 1DAMA 3K09A 3MWLA 3I5XA 4DSNA 3GFPA 5BN4A 4LYAA 1CJKC 1ZNWA 2J1LA 1QF9A 1D5CA 3QI2A 1KYIA 3IILA 2CNWD 2XZOA 1AK2A 3ZS9A 1ZD9A 1QHHB 4D80A 2ZSEA 3FMOB 1KI4A 3AF2A 4C9BA 1X1SA 1G8PA 1SULA 4CIDA 2NO1A 3U3JA 3HWSA 3CWQA 3RHFA 3EPHA 4TTQA 1X3SA 3ZZUA 5FBLB 2P6RA 4H1UA 2VYFA 3KUCA 2J7KA 4QJ5A 1E4VA 1RRFA 4R2HA 5EE3A 1E1RA 4KXFB 2OV2A 5CJPA 3N2EA 1Q3HA 4LJAA 1ZIOA 3IIMA 4YDHB 3AKCA 3B9PA 2O8BA 1A7JA 4HDQB 5BWMA 2VIIA 1P73A 2CDNA 1J90A 4WIAA 3W6NA 1EESA 3DM9B 1R8SA 4PQYA 2VTKA 4EQ6A 3WRYC 2DWPA 2HCJB 4EPVA 4WW0A 4A2WA 1E32A 4OQXA 3RVBA 3SHWA 4E22A 1R5NA 3NVAA 4FCWA 2DCUA 1E9SA 3CNNA 1E0JA 1N5IA 2PLRA 1IM2A 2PCJA 2P5SA 4RD2A 3ZD7A 1KDRA 1AGRA 2QU8A 2ZUBA 5JSZA 2CLCX 3L2OB 1ZAKA 4LYJA 4DJTA 5ELXA 2ZR9A 2JLUA 3F8TA 4BZQA 4CT4B 2ZYTX 3NH6A 2P6NA 1XNJA 3W3AA 5GVRA 1RJ9B 4FMDF 1GOTA 3Q9LA 1R0ZA 3B1WA 4QBGB 5BQ5A 3TUJC 1N6RA 4LZZA 2GHIA 4JIMA 3VHXA 4TLAA 4RD4A 2WWGA 3C5HA 821PA 3EASA 1HV8A 4HSEA 3DOFA 1TL7C 2DWOA 5JBQA 2FJUA 2BM0A 4V0NA 2ORVA 1XCMA 4URWR 4WOPA 2YVUA 1TMKA 121PA 3NEJA 1TF2A 1WDTA 4UQOA 2O8CA 4BEBA 4QHYA 8OHMA 1WGWA 5E7MA 2QG6A 4HUQB 1JAIA 1EX7A 4JL6A 4UNNA 4C0SA 1NRJB 4JL5A 1GSIA 1HA3A 1OFUX 1OKKD 3NBFA 3EW9A 4MUBA 3U3MA 4W7SA 5K8LA 4P33A 1E2FA 2WKPA 2NO9A 4EPXA 3EZ6A 4FMCF 3A8TA 1L2TA 4B2IA 4URVR 4YXWA 3TLXA 1PUIA 2GNOA 1EFRA 1XBTA 1HQCA 3QXJA 3BORA 1X8KA 2OZEA 1N0UA 4D81A 5FOWA 4HAXA 3U7GA 4L9WA 2QTFA 4D0GA 2OILA 3SNHA 3BB1A 3D31A 2YHSA 1L7VC 2QGNA 2CLSA 4JJKA 4MGIR 3GFOA 1G5TA 2VHJA 2OXRA 2EWWA 2ZRBA 2EFGA 4HB3A 3JVUA 2NO0A 5A5GA 3ZVNA 1UDWA 5CK4A 2N46A 3QEOA 4Q19A 1DEKA 3PR1A 4I81A 3V4FA 4KODA 4US2R 4AYTA 4OHVA 1YE8A 1KJWA 3K9GA 3RS0A 4CEIB 3FOZA 1ZUIA 2NG1A 2IW3A 2ZYVX 2IYXA 2X19A 3LW8A 5EE5B 4JSYA 3I8XA 2RHDA 4YMUA 2O8BB 4I4LA 1J99A 2ZRPA 4HDOB 4LPSA 4LJYA 2XX3A 3K9HA 4FW9A 3CM0A 3ZS8A 1ELOA 4QXAA 2IS1A 1WRBA 1FUUA 3QXXA 4LDJA 4BEJA 1KI8A 5TY0A 1G41A 4RZUA 1U99A 2GZDA 4JVSB 1F48A 2AXPA 2XEXA 4H9GA 5AJXA 4PZLA 3UPUA 1P9RA 3IDQA 2J59A 3FHCB 3S1AA 3QIAA 3EZ9A 4QRHA 3GJ0A 4II7A 5CLQA 2A7QA 5SZIA 3AB3A 4DIEA 1XX6A 1KJYA 3CONA 5JS7A 2HYIC 4NHOA 4HB0A 1ZJ6A 1L4UA 1ZVQA 2GZHA 4OHXA 3NEYA 2JEOA 3RRMA 3QKUA 1XB2A 1Q21A 2JDID 2D2FA 4HAVA 3AVXA 4C7OB 1XEFA 2GCNA 1E1QD 4IEEA 4MYTA 4Q66C 4BLOA 3KX2A 4C0HA 1ZBDA 1ONBA 4MYHA 1U9IC 1AS2A 2CHQA 3NHBA 1NIJA 3ZJYA 5B30A 4DKXA 3EZ2A 4MA4A 4ZIRB 5C46F 3WNCA 3KXKA 1YZNA 5LDDC 2DFNA 2O52A 2IS6A 2G9NA 2R44A 4JYCA 1EGAA 2OBLA 4MKGA 4R71A 3VU9B 4M9XA 3FYHA 1U0JA 3ZIAA 5KO2A 3SE0A 3FHTA 2AL7A 4RCYA 2F43A 2HF8A 2WTUA 1OH8A 4YMWA 5C2JB 1KOFA 4N0DA 4A15A 4CEHB 5JEDA 1KK0A 2ZS9A 1BYIA 3B13B 3CNOA 3E5HA 3UIEA 4IDHA 1CJVC 1LB1B 4JLJA 2ODNA 3OIWA 4XTCS 1YZTA 2QT1A 2CCGA 3IO5A 3MJHA 3Q85A 1MABA 3PVSA 1CJTC 3EA5A 2JDIA 3BC1A 1KK3A 2J45A 3FVQA 1K5GA 3J81k 2WKRA 4RJLA 4GNKA 3PUZA 3C16C 1TADA 3AV0B 4ON9A 3KZ1E 1W0KD 2ERXA 1GRQA 3SJBA 4G5QA 3SBDA 2QPTA 1X1RA 4DLZA 1Z47A 5H68A 1II8A 4TL7A 1P2VA 1E6CA 1RW4A 2W2VA 3PITA 1OFIA 1CRQA 1KO7A 5KPDA 4OI0A 1FNNA 4HLDA 2ECKA 1KK2A 1R0YA 2C8VA 1NY5A 4ZDWA 2ZRGA 3CPHA 2IF2A 2KB0A 1FUKA 3TMKA 4NCHA 4Q18A 4OK6A 1OB5A 4XJXA 4G1UC 3UK6A 3W5IA 4B71A 1XDBA 4AG5A 4NYMQ 1VHLA 1MR3F 4RVCA 3GFTA 2O0KA 5L3SB 2GTPA 3A1TA 4Q48A 3FPAA 4E03A 1Z6XA 4FWIB 5CYOA 2GVDC 2W6JA 3A4LA 4NPHA 3T1QA 1E96A 3THOA 4C30A 3GLGE 4DCUA 2DB3A 4PAMA 4ZDKA 1E3MA 4OI2A 2QP9X 4LX0A 3TUIC 2YC2C 2IWRA 2Q3MA 2JGNA 4UNSA 4JT4A 3LWNA 4A8JB 2QEQA 2ZRHA 4QHTA 4TQAA 4BLRA 4RFSA 4EUNA 2O8FA 4A6XA 1XCGB 3P20A 2DWQA 1Q22A 5GADl 3TW4A 2GJ9A 2VSOA 5KDDA 4X8MA 4L15A 1GL6A 2FDCA 4C7OA 1G8HA 3WRXC 4L9SA 4LRWA 4KFTA 1OKKA 4L16A 1U9IA 5JEEA 2QQ0A 3U5ZB 5AJZA 1EWQA 1NKSA 1U8YA 1XWIA 4BASA 3THWB 5E4FA 4AKHA 3VQTA 1T0HB 5IDVA 4XH9B 3X1DA 4NL4H 4MRNA 1G291 3OIVA 3RDPA 2GCOB 4D6PA 1Q20A 1N5KA 2P2LA 1F2TB 1QBKC 2CJWA 1NVVQ 2EFHB 2AHOA 3EIEA 1JXMA 4PAOA 4Q4LA 5BYJA 1Z83A 1N2CE 3BD9A 3UKDA 2BMEA 1NJFA 2BOVA 1M1YE 3DDCA 3FKSD 2ZRDA 5TVKA 3AP3A 1G7SA 5EXTA 2AXNA 1DS6A 3NBXX 4M1TA 4BRUA 2JJ2D 1YZLA 2QTVB 2B7CA 1TQ4A 3SBEA 4LK2A 3GEHA 4LJ5A 3C4JA 1KI6A 4BE7B 2WJJA 3NWJA 4ZKEA 1TUEA 1XXHA 1TX4B 5DI3B 4PHFA 2VHTA 3TJZA 1MABB 5BYKA 2KSQA 2PBRA 5B58C 1I4LD 4KHZA 3I61A 3U3OA 2V9PA 2J87A 2JJ1D 3GP8A 1OXTA 4MRSA 2BDTA 1G7CA 1CXZA 1DAFA 3RNLA 2OLKA 2BBOA 4DLRA 2ZUCA 1UBFA 3SHFA 1ESMA 4C0KA 1L4YA 5JJIA 1VCMA 4P4SB 1W49A 3DEFA 3RRZA 4BZPA 3H1TA 2OG2A 3K0FB 2J46A 2AD1A 3TSZA 3K0CA 1MO3A 2J9RA 1GNQA 2RB4A 5JMTA 2QAGB 3TRFA 1JALA 1P2SA 3EARA 2IUUA 4D0LB 1MT0A 1Z0AA 2DYKA 2ZEJA 2ZPTX 4PQFA 4UJ5A 3RANA 5TMPA 1IJEA 5JWHA 1DELA 4F4IA 2C78A 1T91A 4M21A 4DLTA 1AS0A 4KAXA 3CF2A 1TQDA 4GL2A 1E2EA 3QNUA 4MRRA 2ZU0C 2PL3A 4HZIA 2FFHA 3QEJA 1YZUA 4JLBA 3LLUA 1E2HA 2QP4A 3ZZTA 4QHSA 2B7BA 2R6GA 3QSYA 4O25A 3SU8A 5CDFE 4CRWB 4KFRA 4YDSA 2AX4A 1ZM7A 2KE5A 2RMKA 3EWSA 3CRMA 4XOIA 5JCPA 3AVOA 1FL9A 1TU3A 2QTHA 5D3MB 3L0OA 4A1FA 5JS8A 1KGDA 2XXAA 4W5WA 2UZ3A 3N70A 5FR2A 4I1OA 1L8QA 2IXGA 4FIDA 4ZPXA 4AG6A 4R98A 4A0HA 1D6JA 1W36B 4TYWA 4Q1EA 2QENA 4IFEA 4B3DA 4D4KA 4YMTA 1I4TD 1PZNA 4LI0A 4M9SA 3HR8A 4X8LA 4WZBE 4RD1A 4P32A 3SQXA 3I32A 4W9MC 4XVQA 4LOAA 4OKSA 3B82A 3LV8A 4ARZA 2C98A 5DLQC 4P3YA 3CKLA 1Y3AA 5AUNB 3GJ4A 1WF3A 2FGKA 1CTQA 5KDOA 4GI7A 4M1SA 3ZD6A 3MFYA 2FZLA 4QJ4A 4PC3A 4TT3D 1F2TA 2CJWB 2OT3B 1GKUB 2J0UA 2FNAA 4YXWD 4P4TA 1XPUA 5LD2C 1TEVA 2IS4A 5L3QA 1EFHA 2PZFA 4NCJA 1QZXA 5CB8A 1NVXQ 3P26A 3BFXA 2GJSA 3HPQA 5B64A 1P75A 1XJCA 2AD5A 5CM9C 4M4SA 1SQ5A 1ZD1A 3GLIE 4LBZA 5L8VA 1D2NA 2ZXUA 4OJKA 1KI6B 1US8A 4M0LA 3EA0A 2Z83A 1UEIA 3BAFA 4I1SA 5P21A 1R5OA 1OXVA 5FL7D 4OI4A 2VF7A 2ZANA 3LO5A 3QF4B 2ZI4A 2WICA 3RWMB 5F98A 3FKQA 2REXB 1YR9A 2H92A 4DVGA 3BE4A 1S96A 3GCGA 4TSFA 3SDZA 4M1MA 1Z0IA 4IVPA 3A37A 4WVFA 3DL0A 2KWIA 1QG2A 421PA 1TQ6A 4P0TA 2GXQA 1KSFX 2WPDD 1N6KA 1OH6A 4NKRA 2FWRA 2C9YA 4KI0A 1E2GA 4POAA 1ZC3A 2XB2A 4ZCMA 1ZNYA 1GM5A 1ZMXA 3KTAB 5LD2B 1FNMA 4TQ9A 3PEVA 2J7PA 2Q9CA 5KSYA 4IVQA 4BFSA 1KI9A 2G83A 2YWFA 1FFHA 1RPZA 2ZJZA 5A0FA 5IHPA 4B76A 3BRWD 3ZVMA 4BLPA 1Z8FA 5IT5A 3EZ7A 2BEJA 4IOLA 4RD3A 1XTIA 3W8RA 3B2EA 4XVUA 1W4BA 2CL0X 3A1VA 1XD2A 4DUGD 1P2UA 5HR5A 5FUWA 1M2OB 2XOKA 5FL7A 4EFLA 5DN6A 4IDQA 2UKDA 2GZAA 2DFLA 3QKSA 1YZKA 4CF7A 1IONA 2PT7A 5DIFA 3RS2A 3NH9A 3ZVRA 2GAOA 4XSGA 1R5BA 1FX0B 1TU4A 5FBVB 2FSHA 1IN7A 1S3SA 3AGPA 3EG5A 2ZS8A 4P4UA 4U5XA 3TNFA 5C1BA 3GLFB 2VBCA 4G5RA 2V7QD 4OJQA 3T5DA 4OHWA 4TYNA 1OT3A 4W5JA 2IX3A 2YWHA 1FPMA 2E87A 1T4GA 3IQXA 4RD6A 2G0NA 621PA 4TQUS 5TV2A 2Q3FA 3KFXA 4YMSA 2R62A 3Q72A 4OL0A 4WBSA 1HYQA 4ARZB 4ZCIA 5FPHA 3LBNA 3OFNA 4U7DA 2VPPA 2YV5A 1AM4D 5SZJA 1QHNA 1P5ZB 3IO3A 3LY5A 4KYUA 4ESVA 3VNUA 1JB1A 5FOUA 1VYTA 1JJ7A 2IYZA 1VPLA 3GLIA 1G4AE 2ZE5A 3CF6R 3U2QA 3C7KA 2VQSA 2GXSA 3GMTA 3W6PA 3ICQB 1UBGA 3OIYA 1W48A 1TQ2A 5KSZA 2QBYB 2Q6TA 2IL1A 4KFUA 2RGNC 4LJ8A 1OE0A 4PXAA 2FH5B 2GETA 3G5UA 4UXHA 1ZRHA 4NU0A 3IEVA 1JECA 1ESNA 2ZI6A 3C41J 4URZR 2Z5FA 2IYVA 1B23P 1VCNA 1GRRA 1MRSA 4NYIR 3QBVA 1HY3A 5SZHB 3U61B 3NBYC 3IPYA 3GJ6A 4WAUA 5EXPA 5AUOB 3REGA 1E2DA 1OYWA 3A6PC 1NLFA 1W2GA 1N25A 4PPQA 3DHWC 2ZU6A 2R6AA 1UKZA 2PCLA 1WXQA 5JCZA 1GKIA 1KAGA 2DFTA 1AA9A 1CR0A 1JR3E 1DPFA 4GOXA 4QM6A 2Z4SA 2EFEB 1U81A 3QPUA 5LBIA 5DHFA 2GJKA 2WMNB 5JJKA 3QQ5A 1LNZA 1R8QA 3P4YA 5FPTA 4JBXA 3X1XA 3KB1A 4JLPA 1UKYA 4HAWA 1ZU4A 2HCBA 1N6IA 2BKEA 2G0TA 2GK7A 2OCAA 1O87A 1S1CA 1NG1A 3A1SA 4QBHA 4DCSA 5F3WB 1RVDA 5BN5A 3SYLA 1WBBA 3CH5A 3VNVA 4AKGA 3SEAA 2PX3A 4A2PA 1S0UA 1UKVY 2RGBA 3TQCA 4LWZA 4DWJA 1Z22A 1LY1A 2C95A 1KDOA 4TMKA 4NBSA 5EE9A 2R2AA 3AVWA 4ZDIA 1AQYA 4JLDA 4M1WA 5FTJA 2WJVA 3ND8A 3CX8A 3LQQA 1AKEA 4A92A 3EIQA 1Z08A 5FUXA 3JZAA 2AN9A 3O47A 4DEXA 2Q9BA 1XJQA 4LSGA 4C0LA 3K70D 3QOFA 1XD2B 4ESHA 1P60A 4NP6A 5J4LA 1NBMA 2PEZA 4BLSA 1CP2A 3ETLA 1OXUA 4F93B 3EC1A 2L0XA 1A5TA 1VCIA 4LBVA 1NVVR 1Z6TA 4QGHA 3VR5A 2ANCA 4BRWA 2O8FB 4LC1A 1FX0A 1OLOA 2WBLC 1ZM3A 4MRVA 1KMQA 3CPEA 4TYYA 4LY6A 3VR3A 3IQWA 3R8FA 1VIAA 4BLTA 2DY1A 2ZIAA 3TVDA 1E99A 2RHMA 4GOJA 3K0AB 4LBYA 3NXSA 1GWNA 1D2EA 1S4QA 3EWAA 4JLMA 2ASEA 1JXOA 2REBA 5UKDA 3UMRA 1TF7A 2I1VB 2FSFA 2N42A 4D26A 1G1MA 3SJAA 4A82A 1KAOA 3BB3A 3EX7C 1EG7A 2J3EA 3RLFA 2A5FA 2MSCB 2RGXA 4ACAA 1YJ5A 1OIWA 1T8UA 3AF1A 3P27A 4WZAE 2JLVA 3LH5A 3EZFA 1KMHB 4TT3A 1DO2A 2XNSA 2J41A 2J5XA 2VL7A 1H65A 1XD9A 1NNEA 1DO0A 2XAUA 4S2EA 1Q1EA 1D8TA 1GNPA 2JASA 1SXJA 1HUQA 2ZSAA 3W5JA 4B2LA 2R6CA 4UKDA 5HKKD 1NJGA 5EP3A 2H18A 2WOJA 4DLUA 2QRNA 4QL3A 1JNYA 1W4RA 3FTQA 3L0SA 3RRYA 1NVWQ 3W34A 1Q1QA 4URUR 1QVAA 1R2QA 1P72A 2C04A 1BH2A 1JR3A 3NKVA 4RSGA 4Q4HA 1SKQA 3VAAA 4F92B 2G6BA 3F3YA 2B8WA 2NGRA 2LKCA 5AR1A 3RS5A 5JECA 221PA 5DHAA 3I5YA 2P3SA 1XEWY 1FQKA 3MCAA 2A3RA 2MMCA 2WWYA 4PHHA 2VSXA 5FOTA 3W3ZB 2FX3A 2OE2A 3D3QA 1LTQA 3T06B 2Q9AA 1AQUA 2G3YA 1J7KA 3K0EA 3L8ZA 3LRPA 1YQTA 4B74A 3MWJA 1N6OA 3M4YA 4P4SA 3HPRA 3EAQA 3PIRA 3K0FA 3T35A 2FPLA 4Q9IA 4DXAA 5EP2A 4E5UA 1QHHA 4BECA 1P3JA 1SZPA 2RGNA 1TNDA 1RJ9A 1SGWA 3KKQA 3M0EA 3U6BA 3LQRA 4DLYA 2ZRIA 2E9SA 2J0SA 1OH5A 4PO9A 3B7GA 4NYJQ 3BH7A 4Q5IA 3TSWA 2QI9C 5C4MA 2RH5A 1G64A 2X77A 2VP5A 4M8NE 3SS8A 4TLEA 2CE7A 2CXXA 3AQ4A 1NBME 2FU5C 3DPUA 1G21E 3EPKA 1YZQA 4OK5A 1CU1A 4V0MA 3CNLA 4JVLA 3BXZA 3TIFA 2Q21A 1VG9B 1EXMA 1R6BX 1TF5A 1NN0A 4EQ6B 4MUAA 4D4LA 2YOHA 3N5CA 2ZAMA 3SOPA 2EYUA 1JJVA 2HV8A 4Q9KA 1WMSA 3CZPA 5JWRA 5GJWC 2JIZA 2WWXA 1HE8B 5AJVB 1TTTA 3TAUA 2GVZC 1V43A 1CBUA 4G5SA 1UBCA 4IEIA 4XD7D 3GJ3A 2QGZA 3MWKA 2QM8A 4C0QC 3OE7D 1AS3A 2GILA 2CK3D 2VP0A 1MO5A 1YR7A 2BJWA 4D4MA 1WE2A 2AK2A 1N0WA 1ODFA 1T3SA 4ASUD 2UVQA 1MV5A 2P6UA 2V3CC 3A1WA 4US1R 3GLFE 2ORIA 2GCPA 2JCSA 2GEDA 5FTMA 1NIPA 4X8HA 1CULC 4JL8A 1G7RA 5FOVA 1DAHA 4B34A 3V4RA 5IF9A 5DGXA 3UG7A 5GJCA 4KLNA 2R8RA 2XJ9A 2V8OA 4GSYA 4I1UA 3RC8A 2ZJOA 3CRQA 4X8OA 4YLGA 3QG5A 2BHRA 2ODEA 1E9RA 4BWYA 4QC2A 4HATA 1E0SA 3OZXA 1COWD 3CWZA 1SXJB 3B6EA 1KIMA 5BN3A 2RCNA 3C14C 2W2XA 4PPGA 2A5DA 4RZ2A 4DLSA 3K0SA 4Q9LA 1ZD8A 2HT6A 5LPNA 4EAQA 1ZCAA 2QP3A 2D2EA 4C0AC 2ZM5A 1Z29A 3NDPA 2PX0A 2Z0MA 4OI1A 4L8GA 2ZYUX 1QHGA 2XZLA 1OSNA 2H16A 3KUDA 4PZZA 2HXYA 2VP9A 3HU1A 3QF4A 2NIPA 4C3ZA 2CK3A 3AVTA 2DPXA 5E95A 3VX3A 4Q1FA 1B0UA 3RSOA 2VH5R 1DTSA 2WMOB 2ZE8A 1PLKA 3OESA 1YRAA 4DT1B 4TTRA 2WV9A 2VHCA 5CDFA 3KKNA 4LHVA 1IY2A 3PUVA 4PTLA 1BO6A 2D7CA 3Q7QA 3FMFA 4HEJA 4HYYA 2NO6A 1E9BA 2IEZA 5J47A 5JWOA 2R6FA 3B60A 3KFVA 3T5GA 3WHKA 3D8BA 5L3RA 5JZVA 4F4CA 5HZKA 3A36A 1Z28A 4EDHA 3GJ7A 3KQLA 1ETUA 1YR6A 5E7IA 1VKJA 1PJRA 1F6BA 2GJ8A 1J2JA 4CEIA 2VP6A 521PA 1NBMD 2ZRLA 4KFSA 3TUZC 4ZCLA 1SHZA 1G8FA 1II9A 1Z06A 3U3RA 1E2KA 4IXMA 4JLVA 1E2IA 3I4LA 4TTPA 4Q9JA 1E2QA 4CDGA 3ADCA 1Z0FA 4LCBA 4MKIA 3MSXA 1VG8A 5KPJA 3K09C 1LF5A 4TLDA 2P67A 1EFTA 1KI1A 1ZP6A 1W0KA 4DSUA 1DAIA 2ERYA 2F6RA 2QE7D 3KJIA 2IUTA 4LV5B 3AVYA 1XPRA 1FTNA 2ZTSA 2JLXA 3VU9A 4G01B 1SKYB 3NIBA 2EU8A 1UF9A 4Q7JB 3TQFA 3VR1A 3VR2A 3MUFA 4K8OA 5HE9A 2IXFA 2F43B 3AP2A 2EFCB 2FFAA 3QY0A 3BK7A 5A4JA 1LFDB 1XMIA 1BOFA 3F5FA 5BW8A 3X2SA 4DDTA 5EP4A 2F7SA 2V1UA 3PFIA 1JI0A 2FMXA 3WHLA 4V0LA 3RABA 2FPKA 4NYIQ 5KNBA 4B6FA 5G41A 2IHBA 1G8YA 1F5NA 4EPRA 2VA8A 4IFBA 2IWHA 2BMFA 4JBWA 1C9KA 4HLUC 4DDWA 1NVUQ 3UWOA 721PA 1W7AA 2J7PD 1Q44A 4W5HA 3CRRA 3X1ZA 1Z63A 3ICEA 1OV4A 4L5BA 3PJRA 2IYSA 5CIWA 2EWVA 3WY9A 3B9QA 1MO4A 4WXRA 2IYWA 3OEHA 4DLXA 3QE0A 2HUPA 1OH7A 1UADA 4DCTA 2OEPA 3GQBA 3PUXA 5H8WA 4B43A 2CHVA 2BBTA 4DB4A 1R0WA 1M7GA 4GZLA 2G1KA 4M1YA 4C0JA 1N6HA 2MSDB 3KL4A 2GRJA 4RFVA 2IC5A 3HYRA 1M74A 1QDEA 1KSJA 2OFWA 4EFMA 4S35A 2KJQA 4HUTA 2UZIR 3DKVA 4XVRA 4BFVA 1ZIPA 2YKGA 1HT1E 4QGGA 4M1OA 2ZI9A 1CF4A 2QMUA 4MH0R 2ZE6A 1GG2A 4GT1A 4NTZA 4QKQA 3FE2A 3DZDA 3AVQA 4AKEA 4Q7KA 4E09A 4B44A 3FDIA 4C2UA 1WCV1 1OXXK 4GMDA 4V02A 1WQ1R 3VFDA 3VKHA 1YRBA 2O0HA 1E2PA 4TMZA 3AVUA 5LB4A 1Z6AA 1U8ZA 3AEZA 4RFSB 1WA5A 3Q5EA 2B8TA 1ZUHA 2JJ2A 4FCVA 2NTYC 3BH0A 3I3SR 1O3YA 3ADBA 3R9IA 5KNCA 1T5IA 4TYPA 1F3OA 3KXLA 3MLEA 2PJZA 4CGZA 2IS2A 1IXZA 2AWNA 1SVMA 3WBKA 1OPXA 5EZ5A 2AFHE 4HDCA 2HLDD 3SN6A 4PZYA 1H8HA 2B21A 2WJHA 5IRCD 3GLHE 4URYR 1M7HA 1PV4A 3ADKA 3THWA 1N6LA 4XSHA 3QPWA 1U90A 2JLYA 3PUYA 1VECA 3LLMA 2ODWA 2D3WA 4QBIA 2ZRFA 2GCOA 4EKDA 4XWOA 2XJ4A 4OQMA 3SJCA 3W6OA 3CH4B 5EUQB 4JLOA 2JLRA 2A30A 5AJWA 4PC7A 3M1IA 5FOSA 2VF8A 3MAAC 2PEYA 3VTKA 6Q21A 1VYUA 1CS4C 2W00A 4FINA 4EJSA 1N5LA 1T0JB 2NPIA 1NG9A 5JRZA 3IHWA 3O8BA 4PX9A 4M9ZA 3ZH9B 3QVVA 1IN6A 2WPDA 1X8JA 2YNMA 3AKEA 4Q00A 1CR4A 3R9XA 2FFBA 3IUYA 1UDXA 2WAXA 2IYTA 2KBFA 1Q57A 4JLAA 4LHZA 5CM8B 3QJYA 2IYUA 4QM7A 1QG4A 2DHRA 3ZGXA 2DBYA 1CIPA 3T15A 4UJ3A 5DI9A 2YINC 3CR8A 4BLQA 3GJ5A 4LHYA 3THXA 1N6NA 1JQLB 1U2RA 1QRAA 1JEDA 3PXGA 3AF4A 2BC9A 1HTWA 2XNDA 1OF1A 1IHUA 4CVNA 1ZNZA 2HJGA 4A6PA 4F38A 3AH8A 4BZXA 2X8AA 3BWDD 1CLUA 1G20E 1N3BA 1EK0A 4AIIA 3UMFA 1SXJE 2H1LA 4A0GA 3E1SA 1DARA 3OEHD 4TZ0A 3AGQA 3O8DA 2QMEA 2O8DA 2JLZA 5BXQC 4KITB 3DOEA 5DO9A 1EFUA 5TDHA 1DE0A 1RYHA 3LXRA 4CEJB 2JIZD 4KU4A 1T3HA 2BMDA 3RS4A 5FTKA 5AUQA 1FMJA 2WVJA 3THYA 5AWFC 3BBPA 1GRNA 1UM8A 4TN1A 5FUVA 4Z1MA 1E9CA 1FMLA 3OHMA 2WWIA 4LPKA 4JS0A 4U02A 1BMFA 5DI3A 1UKEA 3HP1A 4PC1A 5DISB 4UNPA 1W5SA 2ZRAA 1R7RA 3Q7PA 3MGCA 2W83A 3R9WA 3VMFA 1KZ7B 4HAYA 2C9OA 3CX7A 2OSBA 4DBLC 1Z0DA 2ZUDA 3H84A 1FP6A 2H57A 5HPYB 4EPYA 4FWTA 4AYXA 1ZC4A 1LW7A 2XNDD 4C4PA 1RYFA 2OCBA 1XCPA 3TAHA 3R20A 3QXCA 1KJZA 3FHOA 2BCJQ 2XSZD 4JVNA 1UBEA 1OW3B 2Q0HA 2GF0A 4FMCB 3O8RA 5J5CA 4IRUB 4V0ME 1W2HA 3QXHA 5CLLA 1RFLA 1YZGA 2F1RA 4HAUA 4R2IA 5J4HA 4PHTA 2A5YB 4GP7A 1IAQA 3TBKA 1JQJC 2VSFA 2WJIA 1NLYA 2IA5A 3ND9A 3WMFA 3B78A 1RIFA 1CKEA 2J0UB 3H2YA 3VR4A 1SVLA 2W58A 3U4QA 1V5WA 3U44B 1W44A 1SKYE 1K8RA 2XTNA 1DADA 1S3GA 2WJYA 4LJ4A 1ZNXA 2JLSA 2LCFA 1E0KA 1QHSA 2GXUA 1DVRA 4FCTA 2QZ4A 5CITA 4B35A 4A0FA 4TMWA 4DLVA 1UPTA 2WIBA 2QPAA 4RKEA 2RGCA 3C5CA 2C99A 5D3MA 3UWKA 3EPLA 4LHXA 1D9ZA 2ZRKA 2BBWA 3KKMA 3THXB 1DAGA 3F0TA 4M2LA 2QUZA 5KTYA 3P1JA 4U00A 4DRZA 3OEEA 4NZYA 5FUYA 4YQFA 4N0EA 4YC7A 4MYCA 3NBZC 3FWYA 4N1AA 4JSTA 1DG3A 3CPJB 4F4JA 4PSKA 3RS7A 5F2EA 5KDLA 2I3BA 2OAP1 1MO6A 4JZKA 1HT2E 2XZPA 1Y63A 3AKDA 2LWIA 1RE0A 3N2IA 1G17A 2IUSA 3QKRA 3AF3A 3PQCA 1P7CA 1SHKA 1YKSA 2HEIA 2RGEA 2WKQA 2ONJA 2V7QA 3L0PA 5FOXA 1NN3A 3PUWA 3IEUA 1S9DA 3T1OA 1AN0A 5L3QB 5KU1A 1KDPA 3CR7A 2LKDA 5DYGA 5K8UA 4DT1A 3CB4A 1IOZA 2WHXA 1NI3A 2C77A 4KV9A 1E1QA 3W9YA 2R65A 5JI2E 2ZSFA 2VP4A 1YVDA 2F9LA 1UEJA 4A9AA 1U0LA 2IBMA 2QA5A 3QKSB 3K70B 3WBJA 1GAJA 1W4CA 1I2DA 2ANBA 2QRZA 4V03A 4WA7A 1IJFA 4N3NA 4A2QA 4OQLA 2HJVA 3NC1C 4IDNA 1A1VA 3ZQ6A 1LV7A 2F3TA 1HE1C 1WP9A 3WXMA 4ZKDA 2R9VA 3AVPA 4ABYA 1YHNA 2QORA 3KKOA 5GJVC 1VCOA 2GKSA 3L43A 5D3QA 1NN5A 1U0HC 1XU4A 2OHFA 1NLZA 1K5DA 4E07A 3MD0A 2FFQA 1G16A 4TL9A 3CF0A 4MGZR 2V54A 3DMDA 2F9MA 1P4SA 1KO1A 1H8ED 5DE3A 4DSTA 4HUQA 3BGWA 5CYPA 1OIVA 5KOYA 5FPKA 4YMVA 2G1JA 4KVAA 2A2ZA 4NYJR 1VMAA 4LHWA 2BCGY 3BIFA 4HLUA 3JZMA 1G7TA 1T5LA 2IYQA 4LJ6A 1JR6A 3GLIB 4ZI2A 4XIGS 5JHHB 3FFAA 1Z2CA 1VG0B 3IKJA 4PQRA 4D2IA 3U4QB 1KTVA 4LV8B 2EW1A 1RRPA 3SFVA 3WMGA 1ZU5A 3WP1B 4O2RA 1KKLA 1VDZA 1XXHE 1GL7A 1W36D 4TL8A 1G6OA 4Q7MB 3A4NA 1G4UR 2QSYA 3E70C 4RZ3A 3ADDA 1Z2AA 2ZR7A 2FSIA 3MG9A 1AIPA 3CLVA 5EXSA 3WYGA 4D0NA
chains in the Genus database with same CATH superfamily
1PNTA 3BTSA 3I8SA 1JXQA 2GPJA 4NH4A 3OJ0A 5CB6A 2NMVA 3HDTA 1A8SA 2XUKA 2BMJA 3HU5A 3IBGA 4ZOAA 4NECA 3MRSA 5BT8A 4TVBA 1ZEJA 2ZVPX 2X9QA 1DUIA 1N7HA 1Z82A 3GYGA 4G0YA 3HFJA 4N5LA 5FNZA 3ZQVA 2FV8A 4IZHA 4I3MA 5KNDD 4RTNA 1JFSA 2CHGA 1V1MB 2XMGA 1LK5A 1EFRD 3L7NA 3PHLA 3QXSA 4LYFA 4MV5A 2PUWA 2GBLA 4N6CA 1U9YA 2I29A 2C7VA 3DR3A 2Q45A 1J06A 2IOFA 4N47A 5CIQA 4FT4A 2B25A 1U1CA 4TXNA 1Z6GA 3G7NA 3HU2A 4JKVA 2BAGA 1PKXA 1K86A 2O6LA 2X40A 1LBEA 1AB6A 4FR5A 4NDZA 5ALYA 3EFOA 1CZNA 1H1LA 1JR3D 2Y92A 4HFMA 4P54A 3R0IA 2QUPA 1MPTA 4UQPA 1ZN2A 4O4LA 3LCRA 4Z99A 1Y7LA 1DCMA 1NW5A 3CE9A 3IB6A 1L9XA 4L5CA 1FNSA 1UEXC 4TWIA 3G2QA 5C8YA 2EFDB 3O7MA 5A7GA 3OD1A 4FJ1A 2DUMA 1PFYA 3C24A 2XM4A 3AOEA 3H2GA 3N0WA 1CX9B 3K6BA 1Q1BA 2E5WA 2EXXA 3LUAA 5JYEA 1E3WA 4JRZA 3OZSA 3W3AH 5H4GA 1MN6A 1UWCA 1YL6A 2VRWA 4UVEA 2Y8EA 1JE1A 1GFWA 1LLCA 3G8YA 1VPEA 1TQHA 1MB4A 4BWGA 3HMKA 4YP1A 2CNBA 4PANA 5IT9A 5FI5A 3TKLA 3OPYI 3PXDA 2FOLA 2QDXA 4MGKR 1B6GA 2ZAOA 4BEWA 1AGXA 1ISFA 2P9FA 4RM3A 1RPZA 3IGFA 3GEEA 3OAAA 4GOKA 3TRDA 2WZCA 1IRXA 3IBTA 4BNDB 5C18A 2RHLA 2VQFB 1PJ3A 4KR3A 4GIBA 5KYNA 2OAEA 1RYNA 4GFDA 1CDDA 3NYWA 4WZBA 4HDNA 2WNHA 2X1LA 4BNVA 4P1ZA 3E22A 1JH9A 2YJ6A 2V1XA 1K7EB 1SOUA 1JEEA 4GDMA 4UPEA 2ECFA 2YZ7A 1E9FA 4KK3A 5TF0A 1ENPA 2C2YA 2Q0SA 3PUIA 5B57C 2F1HA 5BURA 2JGDA 1EUCB 1Z45A 2A59A 4XGRA 1FYXA 3DZGA 3R1IA 3WGLA 1IBSA 1Y6ZA 3UXEA 3LLIA 3EXAA 3AY3A 4JJ8A 1X1TA 4JJEA 2DKFA 3HR7A 1OVMA 2PIAA 1O3UA 3C1AA 1SO8A 4QASA 2C54A 3FNGA 4X3CA 5LIPA 2W7TA 1UK6A 4ZQGA 1KY3A 2WZGA 3RSLA 1QE0A 4OXRA 1P6XA 2K2WA 3V1YA 4E5YA 4LHEA 3KETA 2QY9A 1Z8NA 4JJGA 4M0UA 1THTA 5C1DA 5J2UF 3OTGA 1DX9A 1DG1G 4U9DA 1GZSA 1LJ8A 3WGYA 2FE4A 2ZI3A 4TRNA 5DWQA 3DVSX 4TUYB 3OFND 4D9JA 5B3KA 1XVVA 4IW3B 1Z4JA 4EMBA 4CEHA 2GS9A 2HFIA 1WDWB 1FVOA 2EHDA 2OK7A 1DXOA 5DW3A 3OQBA 2H4FA 4NMLA 1DAKA 4CIXA 3OF5A 4FW8A 1E1DA 1V54C 2R60A 3BE6A 4ND8A 4WLFA 2Q5IA 1CZOA 2X15A 3F74A 1Y4UA 4Y6SA 3ZKWB 3ZZNA 4AZSA 3CZRA 3U3KA 4E15A 3FM9A 1ST6A 4QTXA 4KH1A 1DOAA 4DAOA 3S4YA 2C4UA 3L0IB 1OBCA 1R6UA 1KI7A 1YO6A 2PU7A 1ZHZA 1N7IA 1UZLA 3VKWA 4EO7A 4OP3A 2BTQA 5CIVA 2VSQA 2WAYA 5FBQB 5CLFA 2PZJA 4JYMA 2QRPA 3TKAA 2P2CA 2IP2A 2L17A 3D6FA 3PV0A 4L4UA 3CO5A 4NESA 1Z5PA 1WTYA 3ROEA 2GFIA 2XI4A 1GZ7A 4L6CA 1XDDA 1QP4A 4RZXA 3C87A 2FR8A 3D7SA 3NT2A 1S1MA 2BEKA 1VKNA 2O07A 4UUPA 1I0IA 4XYEA 1OWOA 4EHBA 1WWKA 3GNQA 3HBJA 2AA3A 4FFVA 4FMBB 3GDOA 1D09A 3C1UA 3LGAA 3AL2A 1T9KA 3RC3A 3I2GA 3WZ2A 3PU6A 3KVOA 3C4VA 3AM1A 5T4HA 4HWTA 3U16A 1WBJB 1L3IA 1LVGA 4O4JF 3BS4A 1VC2A 3FUXA 4QOSA 1JSRA 4HNTA 5KTTA 3P9SA 2OQMA 1E1MA 1UJMA 4K6KA 1TAUA 4IUYA 2UUCB 5FTWA 4N41A 2R7WA 4BJTA 5ALHA 1M8PA 3DTVD 3WAGA 5AKEA 2HV6A 4M9UA 3CAXA 3ZDQA 2EZTA 2OHVA 3SC6A 5JIBA 4YASA 1KS9A 5BSMA 3JVEA 3DLAA 4FSHA 4J7UA 4RF2A 4YK5A 3Q1LA 4ZQFA 3Q0IA 2X1VA 3GFQA 4N0MA 2QUAA 4A16A 1GNVA 3QUSA 3O2JA 3QPVA 2YWXA 5B53A 2G07A 5JQGB 3R7NA 1QF7A 2RGYA 4H3VA 1IBRA 1CGNA 4QDTA 3CIOA 1M83A 3F1KA 4RW0A 4IY1A 1NSTA 2GHRA 2H7VA 1YQGA 4G3XA 1O5HA 3LCCA 2QKYA 3UOAB 3A4VA 4N6OA 3JARA 3OCWA 4FHZA 3SYTA 4YRGA 2C2ZA 2UXCB 1XRNA 3P8ZA 1I2MA 2H5EA 4C6RA 4R1OA 4B3HA 2GYUA 3BRJA 1OCEA 4IO0A 3ZYCA 5KNBA 5EMNA 4MULA 1PR4A 2HEGA 1NBBA 1B6SA 2X7JA 1PSDA 3DZIA 1MOSA 3MT0A 4HWPA 1G6Q1 5I9LA 3WODF 1FYEA 2H5LA 1KFKB 2CD7A 5K7SA 3K9FC 4IDDA 1UDAA 3SZOA 5CLIA 2D4HA 5TB5A 3WJ7A 5C7YA 3H6HA 1OZ0A 3PEWA 4EGFA 1YLMA 2DPLA 4I1MA 2ZIXB 1ESCA 1NZFA 2WA1A 4FGLA 5EL0A 5I9TA 3RYIB 1CGOA 2R9RB 1D1BA 3T1VA 5K8UA 1AGYA 2XBMA 2Y0EA 3SZGA 3VHQA 1FFBA 4TSFD 1FTSA 1FRNA 3VF0A 2FMFA 2G88A 3GDHA 2R7OA 2IOFK 4L5YA 3JWJA 4NZPA 4TL6A 4CG2A 4H54A 2WIAA 4P7JA 4FC6A 1CR1A 4D25A 3E1GA 1B0AA 3LPNA 5EQTA 1M6WA 2A1TR 2V6IA 2Q1WA 1G20A 4WKGA 3MINB 1FLAA 1I1HA 5KOHB 4IDAA 2HF2A 3DONA 2QI9F 5DX8A 2AG0A 1W4ZA 1XZCA 1YR1A 1AZTA 2BI7A 5HE8A 4JCCA 3QNMA 5H9WA 3TK1A 2V9CA 1XE3A 4FFSA 4CLRB 2EDAA 4BQFA 5BQGA 1NXOA 1XXHB 4GOOD 5G3YA 1CE8A 4Q24A 3TTVA 1EQAA 2IY9A 4ND8B 1W0JD 2Y69C 2XLEA 2Z4TA 3UWSA 4TRRA 2OYCA 1YDEA 3GJXC 1N5JA 4BFXA 2V7XA 4BU0A 3F3SA 4DM4A 4RGVA 3AVVA 3TSAA 3DDUA 4JGIA 5JDIC 1FY2A 2KPOA 3VZSA 4LDRA 3DEYX 4DUGA 1NQAO 3BRWA 2YH2A 1KRHA 1SOMA 1A4RA 2VNAA 4RCVA 4YBZA 4YNBA 1M0EA 4FONA 3NOOA 5AI8A 3ENVA 5LJIA 1FW8A 4AJ2A 4UPDA 3H6KA 3RK4A 1CY6A 4UAVA 3KDPA 1N6PA 3R3YA 3H1FA 2QE7A 2VHVA 2HU2A 1NY6A 3E3AA 1G3QA 4PXSA 3AG2C 1JA1A 3F7NA 4GR9A 2XM0A 3QLVA 5AH0A 1KQPA 4D97A 3PQ5A 4TYQA 3VU3A 1Z13A 2DU8A 1UMDA 3COSA 4LAFA 2XUZA 3IVAA 4AZTA 1LPBB 1RFGE 4Q37A 1YVRA 3BERA 3LXXA 5CCBA 1XZJA 1SK9A 2D7JA 2ZYGA 2EBHX 4OOFA 4ZV9A 1SU4A 2HRDA 3RWBA 4NMXB 4QX6A 2GPAA 4GKJB 4XB6B 1YDFA 5IY5C 4JLKA 5CH3A 1YIDA 3ICCA 4HXGA 2I2CA 3ROQA 2Y77A 1SU8A 2D0PB 1DBWA 1MJGM 2ZYWX 2C57A 3BFVA 4QNMA 3RYHA 4DA8A 2O1WA 1FMVA 1L5WA 2CLFB 3TE6A 2JK1A 4KSCA 1KC1A 3HCNA 2R6DA 3FOPA 4NH0A 2PUFA 5T6BA 2CE2X 2IT1A 2HADA 3FOFC 4OXNA 3U3XA 3CZQA 4CEJA 2A0UA 4IH9A 2BKLA 4KXXA 2YEVA 1L1EA 2B99A 3OCYA 4JWKA 2YY7A 3WQHA 3CRZA 4AJ4A 4G0OA 3HEMA 3SJZA 1Q12A 1E2LA 1G6HA 4DW8A 4RH0A 2P8SA 1FBNA 4DR1B 2IXTA 1GGEA 2FZWA 4I19A 3OQJA 4OPMA 3ZU6A 1TW2A 4YR7A 5JY1A 2WTEA 1E1YA 1P7PA 5DTMA 5CA0B 4YV2A 1CJMA 1JPNA 3HSYA 5EZ6B 4H7DA 3V7UA 4BQRA 4UNRA 2DFKB 3PKJA 3BFKA 3S9OA 3IAUA 1A77A 3CZ4A 4RDCA 5LYJB 1KNQA 2MSEB 1ID8A 2PAFA 2YJGA 3H9JA 3TCKA 1LC3A 2GBLC 2VYNA 1SCJA 3UA3A 2I15A 1A4UA 2GB4A 2YHAA 3MN1A 1NVGA 2AGVA 3FWKA 3AFGA 4BN4A 2AOUA 1ZWLA 4BFCA 1JGTA 3GELA 4EKGA 1NI5A 4ZRNA 1QORA 3O91A 4TMXA 2QAGA 2REOA 1FFSA 1UMBB 3AG4C 3D59A 5SY4A 2OFFA 2XRHA 1PF7E 2ZT7A 3ST7A 4ZMBA 3GVPA 4J1TC 3OWHA 3U9MA 3ED1A 3K0KA 4LE1A 3NM5A 2A7XA 3CRVA 3PUKA 3SM3A 4DJFC 1Y37A 3BIJA 4RCZA 4YRDA 4B40A 2QT0A 2OCPA 1FNTc 1JQ5A 1G8GA 1RD4A 2GO1A 3HJTA 2RKOA 3OIUA 4NEQA 1YDGA 4NENB 3RAPR 1XZEA 2XL6A 1C1YA 1W1WA 1HWYA 3IUQA 5CM2Z 5DLYA 3UXMA 1NDUA 3L6UA 1BW9B 3BXPA 4JXJA 3R7LA 2OV4A 4UZSA 4K0RA 1Y3DE 2VJYA 1K06A 2J0XA 3IDAA 4AE4A 5AVYA 3ZXSA 4BIIA 5JZOA 1IAVA 1U8AA 1CUUA 2ZJ6A 1OBFO 3D7LA 2GZMA 4K46A 4JXXA 2YYSA 1QGDA 3FPSA 5EMHA 5EJ7A 2Q1YA 3PGKA 1FLVA 2EQBA 4B09A 1I2BA 2Y4OA 3KYJB 1M8JA 3EOBI 3EFBA 3HJBA 1KRXA 2Z3WA 4LXUA 2OYSA 4ARBA 4N5NA 2XXAB 4CG3A 5HQTA 2ORWA 2AXQA 2YLIA 3C5VA 4NYMR 1PS0A 1VYHA 3KHSA 4M53A 2G06A 4YRAA 2PGOA 4CV0A 1CR2A 1EVQA 1ZJ5A 2VEDA 4JJ4A 2O0JA 4IRMA 3ZG6A 4CFSA 3MYFA 4G84A 4NFHA 4ZVUA 4BQSA 2QR5A 1SZCA 1WP4A 4INJA 4JT2A 3V4SA 2AJTA 3R7WB 1ZZPA 2YXPX 3FX2A 4V3BA 5FBKA 5BOSA 1E3LA 4CM9A 5CW2A 4PZUA 1ML4A 2R48A 5K51A 4LUCA 2YVKA 4KN9S 4JQZA 2CL7X 1L4HA 4QE3A 5BP7A 2HSDA 1QMPA 2ZYAA 3RF6A 3QMVA 2ZBRA 3I01A 1F12A 4BFTA 5TLSA 1BNCA 4GLJA 1PK8A 1M6NA 4PNPA 4DQ0A 5JYDA 1AC5A 2IK8A 5B12A 3SZRA 3KTAA 1NBAA 1LNQA 4OM8A 2G5GX 3HCOA 3WTCA 1M2WA 4JODA 2G36A 2YV2A 1N1CA 1C0KA 2P0EA 1JF8A 1W35A 1V2GA 1KZ4A 1TYZA 3CF4A 1MMGA 3EQ9A 5FBRB 3VO9A 4DBLE 2CUTA 4V1CA 5F51A 5JXJA 5IM4F 3OJEA 5CDHA 3BMXA 1TW3A 1E7WA 2O0LA 4L0QA 3KQKA 4XD7A 4LTDA 3TDMA 1Q3KA 4IIBA 3IDSA 3F49S 4R1PA 3U9SA 4XWAA 1XTZA 1EQ2A 3TLYA 3LQYA 2Y66A 2XHZA 3D54D 1EK2A 5KINB 2IZ1A 3EW7A 1T6NA 1NSFA 1XDUA 3ILHA 3IHLA 5HFJA 5JNLA 1ABEA 1HE5A 2OTCA 2VXBA 1PZXA 1TUIA 2KBEA 2C0PA 3GROA 1UKAA 3JV7A 3LDAA 4PR0A 3C6QA 5KQGA 2HDNB 3UJDA 4ER7A 4LF4B 4D99A 5JZSA 2RH4A 5HEKA 2PQMA 4PGHA 5FLEX 5KBYA 1G18A 2BM9A 4NWIA 4E4RA 1G3UA 5TMDA 1QO0A 3NG1A 1PQPA 2H52A 4JOSA 3SEZA 4JCHA 1EDEA 1X7ZB 2XMDA 4C0XA 5CVTA 5K8IA 1YFKA 2QAIA 3I2IA 2ZUTA 1E84A 4KGVA 1OR3A 5HSWA 3Q5GA 1XC7A 3JQBA 3B85A 4PR9A 3ENNA 1J25A 4PLYA 5E4YA 2WM2A 4F7DA 5BMVF 1V3QE 3G5LA 2WV7A 4KXWA 4BKOA 4HAOA 5JSQA 3FCAA 1MKYA 5M34A 3O1IC 5WRFA 1XFAA 1HH4A 3E2IA 3IOYA 4KQEA 5LZ5A 2A57A 1LC0A 2IHZA 3G17A 2ENUA 1ORTA 3ESAA 1GA6A 2J31A 2OOKA 2GEJA 4GD3Q 1EIZA 2WZQA 1UMBA 3KSBC 1U8XX 2EP7A 3OQIB 3GT4A 3TNLA 1KY4A 5F4ZA 1TWCA 2HO4A 2ZK7A 3KB2A 4PAQA 3D5QA 3IVXA 1F1JA 3TLKA 3E9CA 2G8LA 2JFBA 2N1BA 3I52A 3VX4A 3U7EB 2X51A 2VSNA 4ODIA 3IULA 1SA0A 4LGCA 4IB4A 1U6KA 3D3WA 4FDUA 4NULA 3RJ5A 1Q17A 3VI3B 3FOBA 2GA9A 4M98A 4KXVA 3WFJA 4OIQF 4K86A 4PYJA 3AX6A 2OLEA 5MN6A 4ZAVA 2XUDA 4LZAA 1TVEA 1Y8ZA 1OA1A 5A5VA 1J4AA 5KOJB 4IYRA 4M9RA 1PT8A 4RD0A 3RVOA 3NVDA 1I6KA 1GNRA 2VT7A 3EN0A 1IG0A 2RCYA 1ADCA 1IXSB 2C2HA 3FZNA 4FBGA 4MPTA 3VAZA 1DOZA 2A14A 2AFIA 2V59A 4ICIA 3M6LA 2XF2A 3K05A 4NMMA 1Z0JA 1GARA 1OAOC 1W19A 3FETA 3HU3A 4MGYR 3SFZA 4KJZA 2WF9A 3ZNNA 1VPWA 3IQ6A 3LCJA 4PF1A 4O4HB 5I8ZA 1CY8A 2C3PA 3ENWA 3NP9A 1ZA1A 1X86B 2GZ1A 3HCEA 1DKRA 4RJ2A 3TOZA 3GGCA 3LNTA 1DJQA 4REOA 5C34B 1GP2A 1YOVB 1UQRA 1WCIB 2CNWA 4C0BA 3CLTD 4CQMD 3ODPA 1XI2A 4YRCA 2B8NA 1O96A 4NCXA 2G63A 1WMFA 1CERA 3IAM1 1RMQA 3FHDA 2A9QA 1ZOIA 2ZKIA 3RH3A 5LWHA 1ADFA 1FSZA 4QYMA 4A4DA 3AZPA 3PL1A 3DMNA 2BUBA 2RHCA 4QEDA 5ALZA 3V97A 1I13A 1O57A 4RHFA 3BL5A 3DKPA 3UAVA 2WHPB 3S0XA 4C87A 2ODTX 1SIOA 3LBHA 4XQGA 5D01A 4BQIA 4KE8A 5CI9A 2Q4BA 5EJ5A 1I5RA 5L0GA 3PCRB 2UAGA 3C1OA 1FMFA 1QFXA 1WVIA 3C6KA 2VYQA 4EH1A 5AK0A 2ZXWC 2UUPA 3EC2A 2OO7A 2GD0A 2IVFA 3QJ5A 3ESDA 5C32A 3U0VA 1H6GA 1CNEA 2QR2A 1FMTA 1QFYA 2I2XB 1N2CA 3SXPA 5C3MA 4IKEA 4TTSA 3K53A 1II8B 4BXOA 1MQSA 2K5UA 4MPPA 3RQFA 1CQJB 2EJBA 3N7UA 4AWXA 4BRZA 3OM9A 3DVRX 2OBNA 2AUNA 1U2SA 2H17A 3MOSA 1BMFD 1S2MA 2B4TO 2QJTA 5E4TA 2DERA 3IXQA 4HDRB 2QWXA 3BULA 2DQ4A 4ND5A 5HOQA 4Z1MD 4OGGA 5CXQA 5MFZA 5B2EA 1ECBA 2PH1A 2DJIA 5JVDB 4UC0A 3C8MA 2PWPA 1Z73A 3CKMA 5JY6A 1TQGA 2ONKA 5AXBA 2YMLA 1MMAA 3L4BC 2PS1A 4K2AA 1GZVA 4KE7A 1OJLA 1NKTA 1WL8A 2OFXA 4CDVA 3ORQA 4R1SA 5H5JA 2H1IA 1RMVA 3VSCA 3A10A 5KHAA 4D4JA 2JVIA 1MORA 1J8YF 1YJGA 1FFXA 2P68A 4WSOA 2IHYA 2W43A 2OVFA 3V1UA 4EX7A 4U63A 5HXAA 2GAFA 4LV6A 3AM5A 1WU7A 3ZKAA 4CDMA 3KQNA 1NR5A 3HSSA 5JNTA 5KJFA 4WEQA 3DT6A 1QOZA 3HNLA 3IH5A 3KOYA 1VGQA 3KOXA 2W6ID 4I14A 1SXIA 2WWHA 2ZREA 5FO0A 5HIKA 2XB6A 3WJAA 1F60A 3OZFA 4N8EA 1OGYA 4LRUA 3BT7A 4EENA 1ST3A 4EHPA 1XDZA 3VDRA 5A4IS 5J4VA 3FWNA 5JLJA 2Q5QA 3RRNA 3JQCA 4AC9A 1GGKA 3ASUA 3NB0A 4U7JA 2ONCA 3OICA 4JOCA 4GKKB 1RAHA 3K5IA 3L77A 2PMFA 1KEUA 3R3SA 4F5DA 3BMCA 5IS2A 2Q7XA 1UZAA 2IYOA 1WNTA 2RAPA 4E2FA 4F2WA 5T7BA 3CX6A 3WKDA 1QB7A 3N24A 2EIMC 4Y6GB 3ZHTA 1XZBA 1ORHA 1NXPA 1M34E 1QTIA 1XFDA 2EHJA 2ES4A 4WASA 3BEDA 3R41A 1Z8HA 2HLHA 4AKHA 1BYUA 4BNZA 2HMAA 3AMVA 1QIDA 1Y3IA 3TR0A 4LMAA 4NARA 1OUMA 3EDMA 4OH1A 4RAOA 3NC0C 1VSQA 1BXRB 1IQPA 1Y34E 4E0IA 2JFGA 2YHUA 3MWEB 1GT6A 4FQ5A 3QPBA 4FXPA 3DTTA 3NWPA 4IHJF 1U0TA 1QQBA 4N49A 5M04A 2SKDA 5ALGA 4AI6A 1T2NA 5LKAA 3OC6A 4D3ZA 3I5XA 4NPCA 2FW0A 3EDOA 4N0QA 3SIPA 3AFHA 5BN4A 2XQIA 2WVHA 3DBVO 4YUWA 1ZNWA 1UODA 2B82A 3FMSA 1PAUA 1K8ZB 2GN0A 2OV6A 4FQ8A 3QKIA 1YRHA 4U39A 4EUKB 3OO0A 4EL0A 2A92A 1PTKA 2E0IA 1I1NA 3TDNA 4OIMA 2K6GA 3ZS9A 5LQMA 1QHHB 1KXZA 3EISA 4LQCA 1E6KA 4BZZA 3AF2A 1L5VA 5I6DA 3P9KA 1TVKA 4DIBA 1EX1A 2VLBA 3HWSA 4QGBA 4IIJA 3S81A 2VHZA 2QF7A 2F67A 2A0FA 4GUDA 3LXUX 2WFLA 5FBLB 2P6RA 4H1UA 1ZCJA 4RIHA 2VYFA 4HN4B 2J7KA 4QJ5A 4ZJZA 1ZK4A 4GRIA 3TZCA 5BUZA 1T5HX 3IQZA 4KXFB 2X58A 4JELA 1LJUA 2I4LA 2OV2A 5C0OE 4CFZA 3DQPA 4LF6B 3LLKA 1WXEA 1KJNA 1WXGA 1T01A 4NTFA 3VRCA 3H5LA 3I39X 1RR6A 2AC4A 5T3WA 5DNVA 2QTBA 4BXOB 1Q95A 1A7JA 3LECA 4LNUB 1AXEA 1KORA 1P73A 2CDNA 2JFHA 3CS3A 3NCHA 3DM9B 1Z2OX 2GSWA 3QU9A 4J3FA 4R1TA 3PXBA 3WRYC 2I99A 3WGUA 5J1SB 5E1DA 1CUZA 4MWOA 1Z16A 1Q0FA 3SQNA 1HT0A 4B3JA 4EHNA 3EZGA 4XE5A 3SHWA 1R5NA 1KP2A 4WKBA 1R0SA 5H3HA 4RWEA 1E0JA 5F3RA 1E77A 4G85A 4RMHA 4CMEC 1A7DA 2PCJA 3ZBQA 5CFPA 2QX4A 3PUHA 4DQDA 2FW6A 3BDAA 3N8NA 3OZWA 4RJIA 4WQMA 3L6DA 4DANA 2QU8A 3GGDA 4BP3A 3ZGLA 2CMGA 2JZCA 2CLCX 4K6FA 2XNKA 1ZAKA 3ASNC 5JSZA 1KKUA 1PWYE 3DPSA 2QYHA 2ZBEA 4EQZA 4DJTA 2ZW9A 3KQMA 1I3NA 1P6QA 2ZR9A 5CEEA 3F8TA 1WAMA 2ZYTX 3NH6A 4GUAA 1ORDA 1C8VB 3W79A 2B2CA 4WESA 4XM0A 3OUTA 3DLIA 1Q7TA 3N87A 3MQFA 3EUAA 4Y18A 5BQ5A 1FS4A 4QU0A 2H7OA 1TJ4A 5C4IA 3V8VA 2GRUA 3OZVA 1VJRA 2GHIA 4PGAA 1YS4A 2XCUA 4CTKA 4P9TA 1GNLA 1Z4QA 3AG6A 4II2A 4H0FA 1HV8A 4IJWA 4IHJB 3DOFA 5A06A 2CFRA 3DE5X 2ORVA 1A76A 4N5DA 4ZCQA 1POXA 1XCMA 1ZMBA 2HU8A 4WOPA 2YVUA 4ROSA 1DWUA 3NEJA 1M9NA 2Q3EA 5ALRA 4BTEA 4Z0HO 4GM4A 2C4WA 1UOEA 2QRKA 5FUMA 3BXOA 1QIJA 3KNZA 3NKLA 1NFOA 1NAHA 5CNKA 2BMAA 2V7BA 4HUQB 1WVMA 4YRIA 1JAIA 4JL6A 4I3GA 1IZYA 4IYJA 4QECA 4C0SA 2PL5A 2VZ9A 3ZDBA 3C1TA 1OKKD 1EM6A 2GPSA 3BMNA 3RQSA 1AK9A 1H2BA 4QVIA 5LCXA 4Q39A 4H7PA 1E2FA 3HKCA 5BNZA 2NO9A 4EI7A 3IAM6 3POVA 4Z49A 3CCFA 4C78A 4GWLA 5A9TA 4LTNA 3TLXA 3IQEA 1PUIA 5HM6A 4UTVA 5LQKA 1IB6A 1L5OA 2GSDA 1KBOA 1XBTA 3BORA 3CF4G 1JDSA 3TQHA 1E83A 1N0UA 4WVLA 2RB5A 3MM4A 5J1TB 1A4IA 3ABZA 4FVTA 4HFRA 2P5YA 1BOOA 3RIXA 3SNHA 2CBXA 2VXYA 4DLKA 1JHAA 256BA 4KQ6A 3WKBA 3HYSA 4R83A 1E7RA 4OHBA 4DZTA 4A23A 1JJIA 3F6SA 4CS8A 3GFOA 2OXRA 5LL6P 1YNSA 2NO0A 3VJLA 3TJ6A 2OGSA 1EWKA 1UT6A 1A0BA 1KR2A 1N8NA 1QLHA 2PA0A 4Y98A 1CNMA 3JW8A 4O2BB 2ZXEA 1QZZA 4AZ3A 4CCWA 4AYTA 1IHXA 1WXHA 3IOCA 3K9GA 3TOVA 4WJZA 1ZUIA 2IW3A 2WI8A 3LW8A 1YVEI 2X19A 4GX1A 4MCJA 4TTTS 4ZPJA 1TD1A 1E3IA 2RHDA 2YV3A 5T8KA 2P30A 2YXBA 2G08A 1XGKA 4HXYA 4IIYA 4P7FA 2FOIA 3QFRA 3WK4A 3ZDFA 3CG4A 3WLEA 4RA6B 4UBIA 2ZRPA 1H4SA 3IUEA 4LPSA 4QWMA 5ARBA 1WMDA 1P8AA 3FZYA 2JGAA 1D0YA 1EAYA 4E30A 1UZUA 1CD5A 3C6YA 1L7DA 4KN8A 4G9EA 4RHYA 4EKEA 1ELOA 4N7JA 4Q9AA 3T1NA 4KPEC 1Q0MA 2MINB 3EHMA 3L1VA 1GZDA 4FCCA 1KJIA 4H3SA 3QXXA 3K6SA 4NZMA 3HCPA 4RA9A 5TY0A 3KZCA 4UBMA 3GH1A 2W4IA 4KG7A 5B1IA 3CQZA 1G41A 2CVOA 4AUMA 4RZUA 3HJFA 5DF1A 2PS9A 2OPBA 3UMVA 4B7UA 2A9VA 2ICAA 2YBEA 1SN7A 2AXPA 5CMLA 4JJIA 3BRSA 4QATA 3UPUA 1P9RA 1Y4SA 3HJAA 3IDQA 4JI5B 2HQSA 4YRSA 2HK6A 4NOJA 3CLRD 5FP0A 2D2XA 3S1AA 2UUAB 1RHUA 3EGOA 4WXMA 3PHF2 1GR1A 3MPOA 4ZLDA 4QRHA 4MSUA 1CY2A 3DOJA 4FDLA 3DTVA 1XX6A 3R6TA 4KGXA 5CPBA 2B30A 1ISGA 1JYEA 3DS8A 3LK6A 5L7TA 4X5OA 2JJYA 1ZVQA 3AUFA 4W63A 3ENZA 3FTPA 3DL7A 4KPGA 2NM0A 3HCFA 1KDVA 3G85A 1Q21A 2JDID 2XKJE 3Q12A 3FYTA 4HAVA 4X3OA 3AVXA 5TT1A 2H4XA 1QE3A 1XRMA 2HC9A 2JJQA 2ZTLA 4MYTA 4BLOA 2HXGA 4MYHA 2HSWA 1AS2A 3LHIA 3NHBA 1NIJA 2OBFA 4JUAA 4G0QA 2H48A 5BNFA 3ZJYA 5JAUA 5LQAA 2ZUSA 1GQFA 3G88A 4ZEXA 3ZW7A 4ZIRB 3AY6A 1DTWB 1D2RA 3M4JA 2V7EA 5AXDA 3WGHA 1ZHOA 3QPAA 3OT4A 1U4NA 3CMMA 4MCAA 4JEAA 4EF6A 2OBLA 3CRNA 4MKGA 4O2BF 4EEKA 4YJHA 2BFBA 2E55A 3PXCX 4OCZA 3AWIA 3BG5A 3FYHA 1P3Y1 4NY1A 3VR6D 1QYIA 1RTTA 1EUYA 1DAOA 4LGVA 3SE0A 1UAYA 5U4QA 2MWMA 3DWWA 2TRSB 2ZWMA 3IT0A 1Y1RA 1TFOB 1OOEA 1T13A 3K5WA 4RCYA 4XGKA 1OC4A 2H65A 5JUWA 2WTUA 5AVJA 4EY4A 1JIJA 3FHJA 4B6JA 3EA4A 3U4DA 4K6MA 3IE0A 1T9GR 2JCYA 2WLTA 1KK0A 2ZS9A 1TK3A 3E5HA 3TRIA 2QX6A 5BSFA 1T43A 3UIEA 3HFSA 2WMDA 4IDHA 1B76A 1LB1B 1SWWA 3WA6A 4WBNF 2GNPA 4JX8A 3R7SA 5CLJA 2IXAA 2LCIA 1BGXT 3O03A 5AXCA 3K1IA 1MABA 1S2GA 4AO8A 1USUA 2R1TB 2P78A 2IZ7A 2JDIA 2CLHB 1KFBB 2J45A 1KK3A 3B52X 1JEAA 4ZI7B 4KNVA 2WKRA 1KTIA 1OWMA 1UKCA 1TCUA 1Z2EA 3DBIA 3JAKB 3L0DA 3VNRA 3FDZA 3MK31 3KZ1E 2NXJA 2ERXA 2GK3A 4ZTUB 1ORRA 3SJBA 3U0CA 3BCRA 1ZQ1A 3F5MA 4I6JA 1XLUA 4AZ3B 2K7FA 1Z47A 5H68A 1LI7A 1D0IA 4K1OA 1JDPA 1OGJA 2HOQA 3PRHA 4QRIA 1QOPB 3FVTA 3RVRA 1CRQA 3EOAI 1GA1A 2E85A 1ML3A 3KQPA 4O29A 1PWZA 1KK2A 2DWCA 3AW8A 3I9V6 1FS6A 3MAJA 4I9GA 4DV3B 1LA2A 1F1BA 2R2GA 3OPMA 2EX1A 3R0JA 1Z2DA 2VJMA 3R3ZA 4HH0A 4U7FA 5AKLA 3CH6A 4DILA 4NCHA 5KYXA 4OK6A 2QLAA 4Q18A 4ZVNA 4XJXA 3IEXA 3DCNA 4XKJA 2VCEA 3W5CA 1TFUA 3D6HA 1R4ZA 4IKPA 4AJ9A 3UK6A 4C29A 4EA8A 2FDRA 1Y9JA 5ALFA 4KQMA 1EEHA 2WJ6A 2SCUB 4NBRA 5FI3A 2JFNA 5L3SB 3MOIA 4Q48A 3DBRA 5JPDA 3LUBA 2GVDC 2EEZA 3GLGE 1FPQA 4U5EE 4J03A 1Z3CA 4DV4B 3H3JA 1QIEA 2NV2B 4N4AA 1KPGA 3F46A 2C83A 2EQAA 3C7DB 4OI2A 2ISSD 1NW6A 3E5RA 1EP2B 3IVRA 3NEPX 2FFRA 3NBAA 1Z12A 2CV2A 1ULSA 2JGNA 1JHQA 1FFTC 3LSTA 3LWNA 4JT4A 2QEQA 4S2UA 1JFVA 4UNSA 5K3FB 3JYQA 4YP5A 3UJ6A 2NSHA 1TECE 1GPJA 2O8FA 4W1RA 3P20A 3KT8A 4DZRA 1EE1A 4YT2A 1VGVA 2VSOA 5THQA 3KPVA 1F6DA 1X7YB 2PMBA 4X8MA 5HQ3B 5KVVA 3EOZA 5CPFA 1C3OB 2KQUA 2YJ3A 3FYCA 4M8LA 4MINA 3DZHA 3M6UA 3HI4A 1VMEA 3JR7A 3NHWA 4MS1B 2G3VA 3AJRA 3P52A 5L4SA 4KFTA 2DBRA 3DAPA 3HZRA 4L16A 3B0PA 1IM5A 2FY8A 5FWDA 5AJZA 1VRVA 1QUEA 1XTBA 3MOGA 1GEEA 3TKYA 4H77A 2J9XB 5HRCA 2AEMA 1FFGA 5LU9A 5LZ8A 2GCOB 3HCBA 2P2LA 1JJFA 4YAEA 1NVVQ 2EFHB 3FYDA 4H0CA 4JLSA 4LE0A 1RI3A 4L4SA 1Z83A 3MCVA 5H3LA 3UKDA 1M2HA 1NJFA 3JSZA 3K33A 2ODPA 1NVMB 5TVKA 3AP3A 5A03A 2W11A 1DS6A 4BRUA 2C58A 3L7MA 4JP3A 1YZLA 3A28A 3UTDA 4DLAA 3FF1A 2NTVA 3PQ4A 4YGXB 1WD5A 4JDUA 4DWOA 4KZPA 2XRYA 1U8EA 4AJKA 2HUJA 2WF8A 1O6FA 2C0CA 4OHMA 1PE0A 4MW0A 4X65B 2Z57A 4IJUA 1A7VA 1JDBB 4WNIA 4FESA 5LYJF 4CN8A 2R66A 2VHTA 2NSFA 1M75A 5ALEA 2XTAA 1MABB 3AT1A 5E38A 5BYKA 4PJNA 1RRMA 5CUQA 2KW5A 3I61A 3U3OA 2X0KA 5K3DA 2VZLA 3IR7A 1ACLA 3HY4A 2OCXA 2RGRA 1FU7A 5KB3A 2OKUA 4HQFA 1Q92A 1CXZA 2QVGA 1CS0B 1YJBA 4JZAA 1R64A 2OLKA 2XVYA 5AW9A 1S7CA 3PFNA 2OBBA 1AKVA 1JRAA 1IL0A 1UBFA 4R2LA 2I4TA 4JA0A 1WEKA 1VCMA 2CY0A 3RFVA 3DEFA 2YL2A 2GBCA 2JLCA 4E7OA 5BV7A 2OG2A 4OX9B 2RK3A 2COEA 4F56A 2J46A 2AD1A 2FR8C 2FRDC 3LAYA 3K0CA 4REQA 1MO3A 4RQBA 2B36A 1GNQA 5JMTA 4RENA 2C4HA 3P9YA 3DE0X 4PCLA 2DECA 2PBEA 4D0LB 1MT0A 1Z0AA 2DYKA 2ZPTX 4UJ5A 3RANA 2CNOA 2E5FA 5I51A 2JAUA 1U7TA 4BUCA 1IJEA 5TMPA 5AC4A 1DELA 4F4IA 2C78A 4KAXA 3C98A 5BQ3A 2AW5A 4M0MA 5FOQA 4LZPA 5ADWA 3KQQA 4MRRA 4E5KA 2PL3A 1F8FA 4HZIA 2FFHA 5HM8A 13PKA 1ZJJA 3DE3X 3P9QA 3K9QO 4RPKA 3ULKA 4JITA 2VDPB 3SSAA 1SBQA 1M73E 4QYIA 1WMAA 3LLUA 1E2HA 2FOXA 3ZZTA 1NTOA 2IXBA 2WSBA 2R6GA 2YFKA 4GEKA 4XEUA 3KQYA 4F84A 3UTCA 3LTNC 1UFOA 4PFPA 3FBGA 3Q15C 4O25A 5DBEX 2X6TA 4WTOA 3V3KA 2JLBA 4QRDA 4AZWA 4C2BA 3RTCA 3NO4A 3Q3GE 1ZM7A 3EWSA 1RT9A 4LSWA 4D8YA 1KGDA 1NXVA 2VUSA 3EDRA 2DHEA 3M3PA 4A0HA 1PCXA 1VXOA 3ESRA 3TCXB 1RE1A 4NJMB 2J9WA 1ZI8A 5JSKA 4AZVA 3RAFC 1HGXA 4D4KA 3V1MA 3G02A 3D0KA 1I4TD 4LI0A 4M9SA 1RXVA 4MW2A 1RYDA 4MS3A 4TOIA 4X8LA 4BAZA 3EMKA 5IKOA 3ES9A 1DO8A 4LYEA 4XVQA 5CA1A 3B82A 2Z58A 3I1IA 2C98A 3PNSA 5DLQC 5EKDA 2Z1NA