1ZU5A

Crystal structure of ftsy from mycoplasma mycoides- space group h32
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
309
structure length
309
Chain Sequence
HPMEKAMLKSAFNFSKDIKKLSKKYKQADDEFFEELEDVLIQTDMGMKMVLKVSNLVRKKTKRDTSFENIKDALVESLYQAYTDNDWTNKKYRIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAGATQQLEEWIKTRLNNKVDLVKANKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKIIQQVEKSAPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLLAFDIDQYIVHLSSGFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational variability of the GTPase domain of the signal recognition particle receptor FtsY
pubmed doi rcsb
source organism Mycoplasma mycoides
molecule tags Protein transport
molecule keywords ftsY
total genus 115
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1zu5A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zu5A02
1KI3A 5KHOC 4AI6A 4HATA 1E79D 4BPBA 4PR0A 4Q9KA 3FVQA 2DFKB 5BQ5A 3K70D 4QNRA 1M74A 1ZUNB 1XTIA 3HU3A 1Z06A 5UKDA 4V0NA 1XX6A 4C0HA 2Q0HA 4OQFA 4XWAA 4GPTA 1P9WA 5IF9A 4EKDA 1VCOA 5KOYA 2O8EA 4MRSA 1OXXK 1RFLA 1W0KA 2PLRA 2FWRA 2ZSFA 3QF4A 4KLZA 1XFAA 3SZRA 4D25A 4TMXA 1KNQA 2A5DA 1Z8FA 5FPSA 1VYTA 1MO6A 3WMEA 5FBRB 3RRZA 4Z1MA 4LZZA 3G82C 4MGZR 1KSJA 1OXUA 3MD0A 2ANCA 1XDBA 1PZNA 1G17A 1LF5A 3K0CC 1YZLA 4N1AA 4U00A 4BUJA 5KSPA 5D3QA 3LAWA 2GBLA 1IN4A 3R9XA 1R2QA 2ZI7A 3FMPB 3GLFE 1FP6A 2B7CA 2ZQ5A 3SDZA 3CRW1 2UVQA 4B3CA 4CEHB 1IY2A 4Q9LA 3DPUA 2AKAB 2ZEJA 1BOFA 3KXKA 4GOJA 1LY1A 2OXRA 3UANA 4BLPA 5CYPA 4KITB 4DDVA 3TVTA 3BB1A 3AVXA 3HR8A 2R6CA 3PIRA 121PA 1NKTA 1BKDR 1JQJC 4HAYA 3T1VA 1IM2A 2YJTD 5DI9A 1QDEA 3KUCA 4ZIRB 1GL6A 4MQBA 4R2IA 4N3NA 1D2EA 2B92A 2IHYA 4PAQA 5DHFA 2JA1A 2BEKA 2V55B 2IS2A 2ZRIA 1LS6A 2BV3A 3V4RA 1KI7A 3TK1A 1E0KA 5J4HA 2QROA 3JZAA 4QJ5A 4P4SB 1C9KA 1NF3A 4Z54A 2XZOA 2I1QA 3MFYA 3SHFA 4GOKA 3E2IA 4E07A 1IY1A 1JBKA 1N5KA 2FN4A 5LDDC 1OE0A 3LXXA 3Q3JB 3ASZA 2XZLA 4ZI3A 2BMJA 1EX7A 4JLOA 4JBXA 4HUQA 3L8ZA 3A6PC 3I73A 1AGRA 2WAXA 2CE2X 4L5BA 4I1UA 3KTAB 1BH2A 1COWA 1AS3A 2C04A 2XITA 1JR6A 2QAGA 2JJ2D 4W5WA 1SHKA 1T3LA 1IOZA 3WBKA 1P73A 1IN7A 2Z4SA 1AZSC 2BJWA 1P2UA 2F1JA 3TR0A 1P75A 1E94E 1VYUA 3KJIA 2HYDA 4A92A 4DXAA 3PITA 4URWR 4DCVA 4D4LA 4M0LA 3TQFA 2F43B 1ZYUA 2XB4A 3K8YA 2HLDA 2VF8A 3RSOA 4QBHA 4G3XA 5G41A 2DCUA 4TLDA 3QPWA 3SR0A 3PCRB 1MRNA 2O8FB 2LKDA 4PSVA 1DARA 3QBTA 3LW7A 3RS5A 4C30A 4I4LA 2EU8A 4EQ6B 2WSSA 3D31A 1P9RA 2FZLA 4WA7A 1OYYA 3WP0A 1XU4A 2ZJOA 1OIVA 1NBMD 3CNOA 3FHCB 4HUQB 4LHYA 1QG4A 4Q7KA 1QHHB 4GOXA 5E7MA 5F2EA 5SZIA 3U7FB 2QM7A 3CIOA 1GNRA 3NKVA 5HE8A 5JHHB 4EAQA 3U44A 3CH5A 3OAAA 2ZIAA 3PUWA 1VG1A 1OSNA 5E3HA 5H8WA 3QKSA 4MRPA 2ATVA 1N5JA 5K8IA 4KVAA 4BZXA 4LYJA 2QEQA 3ETLA 4B75A 2R6GA 2F43A 4QNMA 2J46A 5HKKD 5KNCA 4G5QA 3T34A 3A4LA 3SN6A 2B8WA 3LY5A 2BMDA 3P27A 3SJZA 3W5JA 5DI3B 1YJ5A 2QQ0A 3P4YA 1BIFA 3QOFA 4PANA 3QE0A 4B2IA 4XD7D 2ZREA 3PEWA 2YOGA 4GMXA 3SNHA 4X8OA 1E4YA 2R6FA 4OHWA 1KYIA 3C15C 4DB4A 2ZI9A 3PG5A 4OI4A 1QHGA 3QKUA 1RIFA 1GITA 1DVRA 1F60A 2P6NA 4FMDF 3U44B 5HCIA 1DBSA 4R98A 1XB2A 2PEYA 3BE4A 2ZUBA 3ZVMA 4TYYA 4FD2A 5CIQA 1AS0A 5J4VA 2OAP1 2W6ID 4C2UA 1CF4A 3VR2A 1G8YA 2N1BA 4HYYA 3CRVA 4JL5A 5FBWB 2GVZC 1M7GA 3AVTA 3U7GA 2ZRKA 2J3EA 3R8CA 4JKYA 4CEJA 2RGXA 4IDPA 5JWOA 1RZ3A 2AL7A 2IC5A 2XJ4A 1P72A 3I1FA 4C4PA 3MWKA 1KO5A 4KFUA 1CJKC 1R7RA 1GM5A 1E9AA 2JEOA 2AD5A 4NZYA 5F98A 5FTNA 3VTKA 2C2HA 4DEXA 2YC2C 4LHXA 1CJTC 2G83A 1HV8A 1FQKA 4Q1BA 4WZAE 3ZYCA 1M8PA 3QUSA 1UBGA 4D4KA 2WSSD 4QRHA 4IOJA 4UJ3A 1COWD 4ZPXA 4BZPA 2BM0A 2ATXA 3B78A 3FFBA 1BYUA 2RGDA 1QBKC 4WZBE 1US8B 2FPLA 1NLFA 2QGZA 1F3OA 1RE0A 2BCJQ 2EFEB 3BFXA 1DS6A 2PT5A 2BMEA 2G6BA 2A5GA 2FEMA 1CR4A 3TSOA 4Q02A 1ZM9A 2YC4C 1YZUA 1JALA 1CIPA 3C4JA 4ARZA 2BKEA 3QEOA 4PQRA 3AF3A 2BCGY 1ZVQA 4V02A 3TBKA 1XJCA 3LBIA 2AWNA 2OCPA 1WQ1R 3VFDA 1U0LA 4EPXA 3PEUA 4KBGA 3W6OA 2NO1A 2J7PA 1XNJA 3QXHA 5AUPB 5JSZB 1OV4A 1VIAA 3JVVA 3GLFA 1G18A 3KB2A 3QPVA 2GJ8A 2D74A 2GF0A 4M1TA 8OHMA 1TQ6A 2V9PA 3AEZA 3ASYA 1YE8A 3K09C 3HP1A 2QTVB 3SJAA 5L3SA 2XTZA 1OJLA 3L0OA 4QL3A 5KNDA 4OK6A 2EWWA 2FSGA 1NP6A 4B3BA 1KO4A 1II0A 1FX0A 2C9CA 4NYJR 1T0HB 4NCIA 2G88A 5EP1A 2Q6TA 1VECA 4G5RA 1KSFX 2Q3HA 1HE1C 5GADl 1Y63A 2ZSEA 1XCMA 4QGGA 5JS7A 2XXAA 3X1ZA 3ADBA 1E2MA 1R8QA 1VDZA 2OFOA 3IPYA 2BIFA 2FZ4A 5HR5A 1N6IA 2LKCA 2WJIA 1K5GA 2GCOA 4ARZB 4D80A 3K09A 2IEYA 1W4BA 5GJCA 4YMUA 2C98A 3K9NA 3KFXA 3TRFA 2B6HA 2O8CA 1N3BA 4EPTA 5JFGA 1US8A 1Q20A 4I81A 2WJVA 5LPNA 2BKUA 2CK3D 2VHUA 4LDJA 3BWDD 2ZJZA 3A1WA 3B1XA 5AJXA 3N70A 3GP8A 3VKHA 3THWB 4MKFA 4RZ2A 1N6OA 1MO4A 4MYTA 1T6NA 2Z4RA 1ESNA 4V0OA 1Q3TA 3CX8A 1IY0A 1EFTA 2JGNA 4JMPA 3PENA 5E7JA 1FPMA 4E22A 2ZJ5A 1U8YA 4BASA 1OIXA 4G0NA 2FSFA 3NBYC 1J90A 5EUMA 2ORIA 4UNQA 4MKGA 2F6RA 2WHXA 4IXMA 4TN1A 3NEJA 4PZYA 621PA 3CX6A 4ZCIA 1P2VA 1S1CA 3AUXA 3UWKA 1SQ5A 4Z8XA 3F3YA 3WNCA 3WRXC 3LVRE 1TNDA 4URXR 3OEED 2DPXA 5J4LA 2WJGA 3L0PA 3GFPA 5TARA 1EG7A 5B2ZA 3SE0A 2EQBA 5IT5A 1GZSA 4NONA 4TMVA 4IEEA 1DPFA 2Q21A 1HQCA 2FFQA 1E2KA 1OXVA 3PQCA 2NPIA 2PMDA 1J8MF 4JLMA 4RY2A 3I3SR 3DZ8A 4OL0A 1SKYE 3MLEA 1S9DA 2EVWX 5A4JA 1PUIA 1WCV1 4RD1A 1GRRA 5SZJA 2J7KA 4KYUA 2PH1A 4JLAA 4PXAA 4ZIRA 3VNUA 4B3FX 4PSKA 4ACAA 1LW7A 4RD0A 2FU5C 2GZAA 2CNWA 4LOAA 3RANA 4ZI2A 3O8RA 1G9XA 4TQUS 3OIYA 1MV5A 3BH6A 1DG3A 3B13B 5K8TA 3P26A 4QGAA 1YZKA 3RC3A 5KTYA 2EYUA 1G8GA 1E98A 1OPXA 4MDEA 5CITA 3I72A 3G0HA 4R9UC 5EXXA 3NWJA 3CZQA 5G3ZA 4MRNA 1E2EA 4Q9IA 3NEYA 1WA5A 1ZD1A 4RZ3A 4RVCA 1XPRA 2IS6A 1A2KC 2QPOA 1W44A 3RWOA 4LYAA 1OFHA 3QI2A 1NG1A 1O87A 2IS1A 2VHCA 1CJUC 1NBME 5DE3A 5DO9A 2CCKA 3L2OB 5B64A 3BB3A 1HQYE 1ZUIA 2GEDA 1W0JA 2D4HA 2EYQA 5JJKA 3QXCA 4NYMQ 4TTQA 1RRGA 2QUZA 1XD8A 4M2LA 4QBFA 4IW3B 3X1YA 4Q1EA 1TUEA 2ZANA 3LLUA 1FTNA 3PUYA 4FWIB 1GSIA 3OE7D 4YMSA 3IKJA 2LWIA 2WZQA 4OHZA 4A36A 4M1MA 3EZFA 1KAOA 1U0JA 1VG8A 2W6JA 1OF1A 1EGAA 3TUIC 4IDHA 3M0EA 4YDHB 5H70A 1NN0A 1N0UA 4LHVA 2ZS8A 1Z0AA 1QG2A 4QJ3A 2IA5A 3RVBA 4AG5A 5EXTA 4DIEA 3KQHA 2CL7X 1N0VC 3TVDA 2F7SA 1KGDA 3T1QA 4MA4A 1KDOA 3FFAA 2WBLC 3X1WA 1T91A 5TV2A 3KJHA 4A9AA 4TZ0A 5AUNB 4KI0A 3BB4A 2CHVA 4OI0A 5KDOA 3CR7A 1NKSA 4GP6A 2GKSA 1YZNA 4PO8A 3EWSA 4MUAA 1HT1E 3LO5A 4KFTA 1W0KD 1TF7A 4NCHA 4HZUA 3U3JA 4AYWA 2IK8A 2ZS7A 3UG6A 3GLGE 1Z2AA 1YZQA 1UKVY 2ZJ8A 1T8UA 1OH6A 1JEEA 4C0QC 3HR7A 4PZZA 4JZKA 4P0TA 1XZPA 1MRSA 2ZRJA 4PFSA 3ZH9B 4DLTA 2CLDX 3ADCA 2EFDB 2EFHB 4HB3A 4PSAA 2FDCA 5FPHA 2VPPA 2IX3A 4M8NE 2UZ3A 1KI4A 3V9PA 4NU0A 4DCSA 2GETA 4LSGA 5BN4A 2P3SA 1GILA 2VP6A 3M4YA 2QPAA 3ZIAA 1XMJA 4B43A 2GF9A 3AVQA 2HJVA 1NMXA 3LD9A 4FN5A 3TNFA 3Q7QA 2IXFA 3T06B 2ZVPX 1T3SA 4AY2A 5B58C 2CVHA 4P4SA 4PZLA 3VX4A 4C0SA 3U2QA 1KMQA 2DY1A 2QAGB 2DWPA 3ZJYA 1QZXA 1TPZA 1YR6A 1DO0A 3EWAA 3K70C 3T12A 3JVUA 1KI9A 5JI2E 5KUTA 4DLWA 1N5LA 3IO3A 3I32A 3ONWA 4LPSA 1G8HA 2X19A 3TJZA 5JLJA 1PLJA 1A5TA 4MRVA 1OFUX 4K81B 3RRYA 1H65A 4MKHA 2QP4A 4FIDA 1ZC4A 1G4UR 4NYMR 3B60A 3CW2A 4A8JB 4DEYA 4DUGD 1RVDA 3TH5A 1XBTA 3DKPA 1FUUA 1MO3A 1U8AA 5DYIA 3EA0A 2J0QA 1C4OA 5HZHA 5CJ2A 2FOLA 1IAQA 1N6HA 4CDGA 3X1XA 4HAZA 4OQMA 1E0AA 4QKQA 2PBRA 4LBVA 4Q66C 4ASUA 4XVUA 3K0CA 2ASEA 1JR3A 2H16A 2OE2A 4RKEA 1TTTA 2YHSA 4MRRA 1EWRA 5CB8A 2WMNB 2ZSAA 2ERYA 4TLEA 1NLYA 2ZI4A 1RPZA 1G6HA 3MJRA 2JLXA 4Q03A 3ZS9A 5JRZA 2QNRA 4QHTA 5EP2A 3RNLA 4RZUA 3BK7A 2JLSA 4I1OA 3SFZA 1G5PA 1MKYA 3AP2A 5BN5A 2A9KA 2XJ9A 3B1VA 5FTLA 2WWWA 3TR5A 3CNLA 4UKDA 1SXJC 2FFBA 3T1TA 1H8HA 4IJMA 2WVJA 1KI6A 2IYTA 4PO1A 4JYBA 1JR3D 3TLXA 4W9MC 2RB4A 2YINC 4MYHA 4AIIA 2VIIA 2MMGA 1U2RA 5EE9A 1QHIA 1GVNB 3LDAA 5FR2A 4C7OB 1FUKA 4MKIA 1UAAA 1CP2A 4K8OA 3UPUA 2DWOA 2RMKA 3WHLA 5DI3A 1RRCA 2ODEA 3K9LA 4GRAA 4A0RA 4AK9A 3QKTA 1ZUHA 1AKEA 4CW7A 4DC9A 4L15A 3R7WA 1XMIA 2JLWA 5FBQB 2XEXA 1Z6XA 2A2ZA 3CNNA 5HCNA 3VQTA 3RYTC 4G5OA 3MMPA 4LC0A 1GRNA 2AX4A 1DELA 1W47A 2PZFA 3QEJA 5P21A 4CEIA 4NBSA 3UKDA 1SXJE 4WW0A 4Z8YA 4TMWA 4Q4LA 3LFUA 2QENA 4Q9HA 3VKWA 3AH8A 4F4IA 5C4MA 4QHYA 4LV6A 2A30A 1Z08A 5FOXA 4A0HA 4KSCA 3ZQ6A 1TF2A 3EPJA 2O8CB 4EFMA 2CMKA 5FPYA 1ODFA 4AWXA 4BEBA 3I61A 5FR1A 1NVUQ 3OESA 5G3YA 4KJZA 5FBLB 3T35A 1Y3AA 1MOZA 4IOLA 3RS2A 3EW9A 2VHTA 4M1WA 5D3MB 4POAA 5DGXA 4PC7A 4HDQB 2PX3A 1L7VC 5KDDA 1KMHB 3QVVA 5SZKB 3Q5EA 1GKUB 4Y0AA 4NE2A 2IYUA 3Q8XB 5SZHB 4DT1B 4LPKA 4TTRA 4EJSC 2HXSA 3ZQJA 2REXB 3VHLB 2OESA 3BOSA 2CXXA 1VMAA 3C5CA 5CB6A 3W34A 2FA9A 1MABA 1OKKD 1NY5A 2FGJA 3IGFA 2ZTSA 4LUCA 4JLBA 4C7OA 4P32A 4HB0A 3AUYA 3GLIB 1OT3A 1AQUA 3R20A 5BXQC 1D2MA 2HCJB 2O8DB 2V54A 1YRBA 3I92A 3LBHA 4IRUB 4RD6A 3MAAC 2VHQA 3HU1A 4B47A 2GK6A 4RCYA 2VF7A 3SYLA 4TT3A 2B7BA 3TAUA 4AYXA 5JS8A 4A15A 1TQDA 4WIAA 3PEYA 1D5CA 4BLOA 1HYQA 1WDTA 1M1YE 3N2EA 1WP9A 4P4TA 3R8FA 3FHTA 1W2HA 1F6BA 4KYIB 2PJRA 3CWZA 1JEDA 2IWRA 1ONBA 1XXHE 2A5FA 3B1WA 4US2R 5JCZA 1DAIA 1DADA 4TMZA 3REFA 4XSGA 2AWOA 4C0JA 2KBEA 3W5IA 1GL7A 5J4KA 3DMNA 1UEIA 3FKQA 3WYFA 1KDTA 3CR8A 2K5UA 5IRCD 3OEHD 3RRNA 4EUNA 3P4XA 3FB4A 4UNSA 2C8VA 3TW4A 1FX0B 5JECA 1GIAA 1JJ7A 3K0EA 4G5SA 5KU1A 1MABB 1Q12A 3EPKA 1DAFA 1D2NA 2FG5A 2QMEA 4LJ6A 2QP3A 5E4FA 2HLDD 1CS4C 1F2UA 2R62A 1GWNA 4LHWA 1GL9B 1FNMA 2FFHA 3ZZTA 1KMHA 4MDFA 3TE6A 3KXLA 3PV0A 3EG5A 1DO2A 2ZSBA 5JRJA 1EXMA 2VBCA 3BRWD 1WF3A 4NCJA 4G1UC 1TQ2A 1XMSA 1E32A 4FCWA 5LBIA 1NL3A 2CE7A 1HTWA 1NBMA 2PZGA 2WJHA 4GL2A 3RC8A 4D4JA 3T5DA 2OBLA 5EE0A 2IBMA 1IXRC 2DFLA 2GJAA 1CJMA 2HUPA 5LD2C 1N2CE 1ZC3A 2GWHA 2WV9A 3VR1A 4BZQA 1OIWA 2JJ1D 4JLJA 4OK3A 4EPYA 4W5HA 1UDXA 3EIHA 3HWSA 2NO9A 2VYFA 1E1RD 2IYLD 2BBSA 1NVXQ 2QRZA 2FJUA 2VSOA 1V43A 2WWIA 3NHAA 4BFUA 1Q57A 1OFIA 2C95A 1W5SA 2OCBA 2IXGA 3C8UA 4D26A 1TMKA 2GXUA 3P32A 4I1VA 3VMFA 2P5SA 2PL3A 4GMDA 1W36D 2GNOA 1Z83A 4AKGA 1KJYA 2F1IA 3FDIA 3U6KA 4O2RA 5F3WB 2GVDC 1CR1A 2BEJA 5FUVA 3FMOB 2XB2A 1GNPA 4II7A 3ZLJA 4DLYA 1HUQA 3MWYW 4RFSA 4R71A 1J70A 2NGRA 5GVSA 2Q9CA 3B85A 1UM8A 5CM8B 3GCGA 4FMBB 1U99A 2EW1A 4XD7A 3U60B 1T4GA 2ZRFA 1R10A 2NTYC 4QGHA 4V0LA 1G41A 2W0SA 1J7KA 3AVPA 3V00A 1G3UA 4HLUA 4EPVA 3RSLA 2HT6A 1ZCBA 3NG1A 1E0JA 1F2UB 4LV5B 1R6BX 2V4ZA 2AK2A 1EFUA 3EZ2A 1X3SA 1UKZA 2QP9X 3C16C 4EFNA 4RJLA 2REOA 4HDOB 3WYGA 5AJVB 2NOAA 3OEHA 5LB4A 4AG6A 4Q7LA 1IN5A 5EXSA 4ZO4A 1YZTA 2ZYTX 2CBZA 3IILA 5TXGA 4TL6A 1HA3A 3ADDA 1OH5A 3ICEA 5JJIA 4L9WA 2I1VB 3QKRA 4FMCB 2R44A 2ZRLA 4LC1A 3W6PA 4QM7A 2PMKA 1E2LA 1R5OA 5IK2A 1N6LA 3PEVA 2GZDA 2PCLA 3NBZC 3QSYA 3LVQE 3WMGA 2VO1A 2QPTA 3HPRA 4Z51A 4CRWB 4UNRA 1HE8B 1AQYA 4XWKA 1XD9A 2ZU0C 4WZ6A 3MUFA 1II9A 4XH9B 4HDCA 1M34E 4IDOA 3U4QB 1WXQA 2ZS9A 2W0MA 4QG7A 4XVQA 1CR0A 2AD1A 2J59A 1VTKA 3QG5A 5KSZA 3QENA 2CNWD 3TW8B 4OHXA 1ELOA 4JVNA 1D8TA 2V7QD 3Q7PA 4IEIA 3BAFA 3U7HB 2JLVA 5KSYA 1BO6A 1II8B 1VCIA 2SHKA 4P33A 2VP0A 3A58B 4BE7B 4A8JA 4FWTA 2QG6A 3GJXC 1M6NA 3D6TB 4Q21A 3W3AA 5HPYB 3QKRB 4GZLA 1XEXB 4NL4H 4JLKA 4S35A 1NRJB 5GJVC 1T9HA 4C2TA 3IIKA 1HT2E 5G53C 3NXSA 2WKPA 2OT3B 2V7QA 5DYGA 2Q9AA 4GP7A 1W0JD 3QXSA 4B2PA 1KJZA 1NSTA 4PX9A 1PVOA 1Z07A 4KODA 2ZR0A 1YR7A 2JJ1A 3L0SA 4DLVA 4L8GA 1IXSB 3U4QA 2ZRMA 2WOJA 2H7VA 4TMTA 2X2EA 4IDQA 1G64A 3LX5A 1VPLA 3P1JA 2X8AA 2WTUA 5AR1A 5DNYB 2E9SA 1WGWA 3O47A 5IDVA 1KI6B 1GUAA 3MRSA 2C5LA 3QVUA 5FL3A 3SFVA 3GLGA 5L3VA 4QBGB 5TVKA 2FF7A 1XD2A 3KTAA 1KTVA 1Q1ZA 5CDFE 2C9YA 3LX8A 2WIAA 1G16A 2QT1A 4AURA 2J1LA 2ERXA 2OO7A 1E2JA 1OHHD 1A7JA 2AKYA 4HI0E 2IXEA 3NH9A 1BMFA 3BXZA 4YDSA 1HEIA 1ZJ6A 1UF9A 4PPNA 1KY2A 1KKLA 2Z5FA 3K0AA 1II8A 4PTLA 3THOA 1RYFA 1E9BA 2VQSA 4M1SA 3U6BA 1Z28A 4M1OA 2MSDB 4TTPA 4CVNA 3THYA 821PA 2DHRA 1ZU4A 4B6FA 1LTQA 1NN3A 2RGCA 1CKEA 2Z6VA 3NBFA 4LJ9A 4CT4B 1Q44A 5C18A 5JWRA 3GJ3A 3K0FB 2RHDA 5FUYA 1DAHA 1OXSC 3S1AA 4EFLA 4ERNA 4A2PA 4XSHA 4X8HA 2V6JA 2Z83A 3KKOA 3ZGXA 3EZ6A 2ZROA 1QHHA 4IVPA 4P3YA 2BM1A 1SVMA 4N0EA 4TQAA 4TSFD 3VX3A 2I3BA 1T3HA 3NDBB 3VU9B 1XP8A 1XTSA 2NZ8A 5D3MA 3DMDA 2OLKA 1W4AA 2N42A 1I2DA 4KFSA 4LBWA 4AKHA 3RS0A 1AZTA 2JIZA 1JXOA 3QKSB 1A2BA 4CF7A 4BRWA 2ZRAA 4JBWA 3DOFA 3ADKA 2QQEA 2QSZA 1PUJA 1UEJA 4IHQA 1O3YA 1E69A 2JLRA 2VSFA 5C4GB 3W90A 4BGDA 1JJVA 1G5TA 2CLCX 2BBOA 4TWZA 2ORWA 1D9ZA 2KI5A 2FV8A 3OEEA 1XPOA 1SULA 3UXMA 1Q3HA 2JDIA 4LJYA 4JLVA 2WSMA 5EE5B 2J45A 2G3YA 2IL1A 1LFDB 2CJWB 4F91B 1Z22A 4NPHA 1YHNA 5KPDA 2FSHA 5FTKA 4A4DA 5FUWA 4TYNA 2PZEA 721PA 1GRQA 1KHTA 1WE2A 1K6MA 4BLQA 2ZAMA 1L2TA 1TAGA 3TQCA 4B44A 2QORA 4CEJB 2RKOA 3U3KA 3H84A 4TMKA 4DWJA 4DSUA 2AR7A 1N6RA 1Q1BA 3THWA 4CYMA 4A1FA 4G01B 4B32A 3Q72A 3CWQA 1D9XA 1R0ZA 2DFNA 3SJCA 1E2GA 1M2OB 1ZD8A 3AGQA 1QHSA 2G1JA 2ZITA 3A4NA 3S1AB 1IONA 2IYVA 3TGPA 2ZXUA 3D8BA 4W7SA 3BS4A 2R6AA 2O52A 3BERA 3CRMA 3UMRA 4MUBA 3GLIE 1IN6A 3NIBA 4JIMA 2L0XA 2MSCB 2OSBA 4DLRA 2XX3A 1G8FA 3FOZA 1U9IA 4OKSA 5HE9A 1KO7A 2GAAA 1ZM7A 1OB2A 1R0XA 5DSZA 4H1VA 3OFNA 4UQOA 3BIFA 1N25A 2QZ4A 5C1BA 5E7IA 2Q3MA 3IQWA 1JXMA 1DAEA 4A2QA 5TDHA 1W49A 4BWYA 4JVSB 2YWGA 4R7ZA 3RABA 1E96A 1SVIA 4OQXA 2OAQ1 1N6PA 1Q21A 2WKRA 1NMYA 3AVYA 1NIPA 3X2SA 3GPLA 2BVNA 2QMOA 3OHMA 4Q1DA 3U61B 2IYQA 1KK2A 1RKBA 3W8RA 3T5GA 4TYQA 4UXJA 1Q22A 3LNCA 3WBJA 3UK6A 2OHFA 4B71A 2W58A 1DEKA 4DT1A 1T0JB 3GLHA 3NTUA 5JJLA 3GLFB 3ND9A 3OIVA 1W4RA 5KO2A 2RHMA 3UATA 1E1QA 1NSFA 2GXQA 2PT7A 2XSZD 3AF0A 3ZDQA 2WM9B 1GKIA 2ZYVX 4O2LA 4TYWA 5JI3E 3A1TA 2CK3A 2O8DA 2QE7D 2OFXA 3EZ7A 5HTKA 4E5UA 3AVWA 2BC9A 1DG1G 2G1KA 3NBXX 1DE0A 3RWMB 4D0NA 4IVQA 5J47A 1LF0A 2H8KA 1I4TD 5TY0A 4JT4A 2FMXA 3AB3A 2FE4A 3GD7A 3DM5A 3H4MA 2WWHA 3A36A 2OV2A 1J99A 1AS2A 2DFTA 2CCJA 2XNDD 4URYR 4EPRA 5CK5A 4XOIA 2ZRHA 3I8XA 2VEDA 1YR8A 3NH6A 2JIZD 2UKDA 4GI7A 5EZ6B 2JCSA 3C41J 3BD9A 3CONA 4H1UA 1XZQA 2I4IA 2NO0A 3CM0A 5EUQB 3TAHA 2QE7A 3KB1A 5JBQA 1F2TB 2N46A 5DN6A 2HV8A 2ZI6A 4RD2A 2OILA 1GAJA 2OUKA 5AWFC 4DLXA 1P2TA 1ZAKA 2OBNA 3FPAA 3LBNA 1E9CA 4FCTA 1H8EA 2F3RA 3N2IA 3UIEA 3LRPA 4BFXA 3SQXA 2ZR9A 1UJ2A 1ZNWA 3D7MA 3Q5DA 1N6NA 3BC1A 2VA8A 1Q1EA 3EA5A 3VR5A 3R9WA 1X86B 1XWIA 4Q1CA 3IDQA 4Q4AB 1CBUA 4Q5IA 3T1OA 2YWHA 4QXAA 3KZ1E 4MGIR 1E2FA 2QGNA 3V4FA 3KQNA 1XJ0A 2AN9A 2Q9BA 1S3SA 5IHPA 2QN6A 1Z0KA 1IXZA 1TU3A 3AVVA 4A6XA 2ZYUX 1CLUA 4Q9JA 2HDNB 5JEDA 3BH7A 1EFRD 1X8JA 4XTCS 3AGPA 3IQXA 5KDLA 1P9NA 5DIFA 4HZUB 2ZE6A 1ZCAA 3FMIA 3F0TA 3LA6A 3WMFA 1GKYA 1SXJB 3RS7A 2KWIA 4R2HA 5BYKA 2OXCA 1KOFA 5FFMA 1T5IA 4CT5A 3QPUA 2QY9A 5FBVB 2C03A 4PC6A 1PJRA 5AK0A 5KYKA 3UWOA 3WY9A 2W2VA 1R0YA 1ZNXA 2ZRCA 3QJYA 3ZS8A 1P5ZB 4DSOA 4JBYA 5DHAA 5H1YA 2BWJA 5DISB 1QVRA 2QM8A 4QJ4A 1OXTA 4V0MA 2CL0X 2XAUA 4E09A 4EJSA 1NN5A 2H1LA 2IYZA 2IUTA 2YV5A 1OB5A 1P7CA 5CJPA 4UJ5A 3W3ZB 4AKEA 3ZZ0A 2WWGA 2ZE5A 4FINA 4OK5A 4LV8B 4IFBA 2VL7A 4TLAA 2X2FA 4OHVA 1Z6AA 1Z0JA 1CULC 3A8TA 3EARA 4NTZA 2VP5A 3SBDA 3WNBA 1KK0A 2XNDA 2H57A 1EX6A 3L43A 4LJ8A 3GLHE 4RFSB 4ZDJA 2GAOA 1E1RA 3IEVA 4Q01A 4LWZA 1EK0A 2XZPA 2YZ2A 3C14C 3GMTA 2F55A 4YQFA 1UKYA 1P62B 2YOFA 4PQFA 2CHQA 3MCAA 2IYWA 3SU8A 5BW8A 3E70C 4O0MA 3LQRA 4OQNA 4US1R 4TZ6A 4NP6A 5FUXA 2EWVA 2WKQA 2AHOA 3SHWA 3EASA 4P31A 1RW4A 2NZJA 1Z0FA 2EFCB 1E2DA 3U5ZB 1YR9A 2O0HA 2WWFA 2YWEA 4FMCF 5CLLA 1TEVA 2BJVA 5LB2A 1TEXA 1CXZA 1G21E 4CZ2A 3FKSD 5BYJA 2GJ9A 2AFIE 1I4LD 3PR1A 2J0VA 5HZKA 2KJQA 2ZRGA 4CIDA 4DKXA 3K0AB 1KO1A 5C2JB 1G1MA 1XF9A 3UG7A 5B30A 1E0SA 1K5DA 3O8BA 4FI3C 1X6VA 1L4UA 4NCKA 1L4YA 2GEUA 1W48A 3THYB 5F9HA 4D0GA 1OKKA 3B5JA 1WBDA 3FE2A 4XIGS 1NVVR 1J8YF 2JAQA 2KBFA 1G291 3OZXA 3B9QA 1MO5A 1Z6YA 4Q4JA 2G0TA 2J9RA 3PXGA 4BEJA 4C3ZA 4FCVA 4GBMA 3AVOA 4MYUA 2QMUA 4B3GA 1SZPA 4FW9A 4JVLA 4D82A 3RLFA 2P6RA 3AV0B 3ZIAD 1GG2A 2ZUCA 3Q9LA 1SKQA 3K53A 3F5FA 1FW6A 1AK2A 2V8OA 2J0UA 1X1SA 2ONJA 4Q7MB 1BYIA 2GDJA 4PPQA 4DZZA 2VTKA 1AIPA 2RGBA 3CB4A 3QQ5A 3R9IA 1JB1A 5F9FA 1OW3B 2IYYA 3TSZA 1NVVQ 4ESVA 2ZAOA 2H92A 1TUIA 3CRQA 1OH7A 1YRAA 2IW3A 5AUQA 4A2WA 2JJ2A 1UBFA 1P3JA 3B7GA 2FNAA 1SGWA 3AQ4A 3TSWA 1WB9A 221PA 2OFWA 2NG1A 3IEUA 5C46F 3ZVLA 1VCNA 2TMKA 5JWHA 1P4SA 3I5YA 5ANRB 3MSXA 4BFVA 1RC8A 1E2PA 1EWQA 5M04A 2VHJA 3ZZUA 2AXPA 3LW8A 1R5BA 2OG2A 3GFTA 1ETUA 1ZM4A 2VP9A 4Q48A 2GJKA 1BS1A 4M9QA 4BECA 1FMLA 1XD2B 2GRJA 2W00A 4LYHA 1CEEA 2Y8EA 3EIQA 4JS0A 2GBLC 2ZJ2A 4L4UA 3AP1A 2IYRA 4OQLA 4YC7A 4DDTA 4NYIQ 5FI0B 2HJGA 2IF2A 2P5TB 2ZI3A 1JR3E 3RS4A 3CPHA 1WMSA 5FL7D 4PAOA 4B33A 3AKYA 1NJFA 4IKEA 4DSNA 3HDTA 2C9OA 1X1RA 2YYZA 2R65A 3IIJA 2P2LA 2ZJAA 2E87A 5CYOA 1DAGA 1NIJA 1W36B 2NIPA 3RRMA 4F7WA 1KY3A 3DVLA 2OEPA 4ZCLA 3OAAD 3HYTA 1Z63A 3SS8A 4Z1MD 1R0WA 2E1RA 3AF2A 3O8CA 2HXYA 1GOTA 1CU1A 5BWMA 1XMVA 3KFVA 2ZE7A 1S0UA 2FGKA 4Q1AA 1Z5ZA 2OZEA 4HAUA 3AKCA 3GEHA 4KVGA 3K9HA 1V5WA 3H2YA 3KXIA 1U98A 5FOSA 4AKIA 3KJGA 5HKKA 4JLDA 2VLIA 5EE3A 4G5GA 1ZM3A 5EQTA 2C99A 2C96A 3GJ4A 5CIWA 1HURA 2RGEA 4B3XA 3NC1C 4GSYA 1B23P 1WBBA 4MYCA 2EFGA 3BBPA 2RGGA 4RSGA 1Z6TA 4TQ9A 2ECKA 2RCNA 1YZGA 4E03A 1XTKA 2X1VA 4A82A 4F4CA 3QBVA 2J87A 1G5RA 3KKQA 4QOSA 4YLGA 2ZRDA 2F9MA 5FOWA 4DLZA 2JLYA 4JL6A 1EFHA 2BHRA 2QTFA 1E9DA 1S96A 1E2HA 3A1SA 4PO9A 2IYXA 1FFHA 3SI7A 3SJBA 3VU9A 1KSHA 4ESHA 4FMDB 4C0BA 1SKYB 2W6IA 2C78A 3W9YA 4PPFA 4JSTA 2ZJBA 4YONB 4HSEA 4XJXA 4EPWA 1ZIPA 3CUEF 3M1IA 1GFIA 3R7WB 2HEIA 4QM6A 2ANBA 5GJWC 2ZPTX 4LJ5A 1GDDA 4B2LA 4URZR 1A4RA 2FPKA 3GJ0A 3H0KA 1GNQA 5IK2D 1ZRHA 2PLFA 3LWNA 2H18A 4GNKA 4JJKA 1W2GA 2ZI5A 4N0DA 4O25A 4ON9A 4V03A 3ZVRA 1QVAA 1G3IA 3NVAA 2O0JA 5FTJA 3BORA 4LBYA 421PA 4Q7JB 2F1RA 2ZE8A 2GXAA 1ZU5A 521PA 4F4JA 1KIMA 3N5CA 4HAVA 2ZRBA 2H5EA 3AP3A 4TYPA 3AKDA 2QA5A 1ZNYA 2CDNA 4B35A 1UADA 3GJ8A 4TT3D 3MWJA 3ZD7A 1UDWA 2D2FA 3SC3A 5CLQA 3RHFA 5K8UA 4XTRA 2FFAA 1P60A 2GILA 2A7QA 4I1SA 1N6KA 3DDCA 1JAIA 5DH9A 3CKLA 1T8TA 1Z0DA 1QRAA 1XTQA 3GLIA 1G7CA 2P0EA 3HU2A 4ZKDA 1QHYA 2R9VA 4URUR 1LS1A 1NY6A 4BFZA 3QG1A 2QRNA 1E2QA 1W7AA 3VR4A 4PPGA 2WOOA 4O3MA 4DCTA 1KAGA 4HB4A 1W36C 5B57C 2GXSA 5FOVA 4F93B 1P6XA 5EJEA 4MGKR 3IO5A 2ZVQX 4HAXA 3FGNA 4KV9A 2MSEB 2JASA 2OCYC 4JKIA 3KQLA 5AJYA 1MH1A 2VP4A 5H68A 1XCPA 2RGNA 2Q3FA 3KQKA 4QFMA 5CK4A 1PV4A 4MITA 3CF2A 1LVGA 4K46A 4RKFA 2REBA 2FEOA 2GCOB 4UNPA 1OLOA 1UPTA 2PCJA 1S3GA 2WIBA 4A0FA 4M4SA 1XXHA 1M7BA 2B21A 3CF6R 2QBYB 4D2IA 3TKLA 4YMVA 1S1MA 2UZIR 5A5GA 1Z2CA 2O8BA 2WMOB 1E79A 2PX0A 4RD4A 5E95A 2HCBA 2D2EA 2QT0A 4PQYA 1ESMA 1RRFA 1DOAA 4LI0A 4P4UA 4X8LA 4B74A 1G3MA 3B1ZA 1VYVA 2RGNC 2DBYA 4EJSB 1JPNA 2J5XA 3LXRA 1OHHA 3KJEA 4ILEA 1DTSA 1Q0UA 1KDPA 5TB5A 1GTVA 4IFEA 1OFTA 1E2IA 3VR6A 4BFSA 4BFYA 5FI1B 1U0HC 2FH5B 2J7PD 1AM4D 3GFOA 3J81k 2D62A 2QAJA 2Z43A 3E1SA 3U3MA 3PJRA 2CLSA 4JT2A 2XGJA 2F9LA 1F48A 2R8RA 1R4AA 1SVSA 4M53A 1W1WA 2IHBA 2QAGC 4U5XA 3TIFA 2YVUA 4W5JA 5L3RA 1TX4B 3PUXA 5G40A 3I4LA 5EXPA 2O8EB 3ICQB 2NMVA 5FOUA 4DBLC 4QBIA 2IUSA 4ZDWA 3RS3A 4LJ7A 3OF5A 1XXHB 2QBYA 2VRWA 2XSZA 4NHOA 1Z6GA 3LV8A 4M9ZA 3WP1B 5JSZA 1E9EA 4JLPA 1KKMA 2Z0MA 4I99A 5EP3A 2NO6A 2JLZA 1E3MA 1FNNA 5KSOA 3WNDA 1XEWY 1ZBDA 3EPLA 1U8ZA 3CPEA 4AC9A 3VKGA 3ND8A 3ZVNA 2PEZA 3VNVA 1TU4A 2QI9C 4B3DA 4CEHA 4MH0R 1E99A 3AF4A 1IBRA 2KB0A 3IHLA 3HYRA 1W46A 2YNMA 2QU8A 2V1UA 3BFVA 4XWOA 1HY3A 5L8VA 1FTSA 1G7RA 1WRBA 4ABYA 4TL8A 2NPFA 1DAMA 3I5XA 4C0LA 1XEWX 4D81A 3KL4A 3B8HA 4QGFA 5FTMA 2BMFA 4TSFA 3DM9B 3FMFA 4Q4JB 4TLCA 3AKEA 1AKYA 1NNEA 4US0R 4F38A 1KZ7B 3GLGB 1D6JA 2IS4A 1LB1B 1UFQA 3L82B 4L16A 2D06A 4NYIR 3SBEA 1CTQA 2F3TA 3KQUA 3PUVA 3QY0A 5LD2B 3BFKA 3B82A 2ODNA 4EDHA 4PHFA 4WBSA 3IIMA 4TL7A 1EESA 2J0UB 4Q00A 4DHEA 1W5TA 1VHLA 1IN8A 4C0AC 1VCMA 3H86A 2HYIC 2GTPA 1U81A 1SXJA 2YOHA 2YWFA 3ZD6A 3VR3A 2V3CC 4KU4A 1ZP6A 2RAPA 3HPQA 1I2MA 4DDWA 2GZHA 1S2MA 4PHGA 4Q18A 3I8SA 5EE1A 1A1VA 2JDID 5JMTA 1OYWA 3EX7C 1ZD9A 2QSYA 1SVOA 2CL6X 3ECCA 4M21A 1QHNA 1NI3A 3GEIA 2ORVA 1BMFD 1S4QA 4U7DA 1RYHA 1SHZA 4NDZA 3KDSE 1UBEA 3GJ6A 2O8BB 1ANKA 1F5NA 1KDRA 2GJSA 4ACBA 4TLBA 4YMWA 2NQ2C 1IQPA 4AD8A 3WYAA 3UMFA 2OBMA 4DCUA 4RFVA 1QF9A 2A3RA 2XOKD 1T5LA 2DB3A 3IHWA 3QXJA 4DCNA 1J2JA 4M9XA 3SYNA 1AA9A 4YXWD 3H1TA 1YVDA 4EQ6A 1XEXA 5GVRA 2G9NA 4L9SA 2G0NA 4BLRA 2QTHA 2XTNA 3E5HA 3QF4B 1EFCA 4IOMA 4D0LB 4URVR 1R5NA 1VG0B 2BBTA 4OJKA 1VHTA 1E9RA 3W6NA 3IBGA 3DZDA 4TL9A 4UXIA 1FL9A 4GZMA 2JATA 3REGA 4OJQA 3TUJC 4IVRA 3OFND 4JSYA 4XVRA 2D7CA 1TF5A 3HJNA 2CCGA 4D4MA 1L8QA 4U02A 1FMJA 3G5UA 3M6AA 2ZRPA 1ZMXA 1TQ4A 1G4AE 2A78A 4KCGA 2ZYWX 1RJ9B 4ZDKA 3AF1A 4KLNA 2VH5R 4PC2A 2RH5A 4Q1FA 4V0KA 3BJIC 1ZIOA 2O5VA 4WOPA 4ZKEA 1G7SA 3FTQA 4B34A 5TMPA 3PUZA 1VIYA 4A8JC 1LV7A 4WVFA 1SVKA 4GFDA 3OIUA 1NN1A 4HB2A 4AYTA 5J4YA 2VP2A 4HZIA 4KXFB 3U3RA 3IPXA 4NYJQ 1VKJA 2QL6A 3O8DA 4HLCA 4PHHA 3L8YA 1XTJA 5JCPA 1E1QD 2P6UA 3KUDA 5J40A 2YKGA 1SXJD 3DL0A 2WWYA 4JVMA 4BFWA 1YU9A 4Y0VA 4ITRC 4S2EA 2AXNA 5EZ5A 1C1YA 2WPDD 1X8LA 1JECA 3LH5A 4RCZA 2CHGA 4LY6A 1IHUA 4LRWA 4KSBA 1N5IA 4JJZA 4B48A 3GJ7A 4IDNA 1ZINA 3K0FA 4GT1A 3EC1A 1LNZA 1RJ9A 2VSXA 3EAQA 5JEEA 1XPUA 1CR2A 2OM2A 3D3QA 1E6CA 4DLSA 4B76A 4DJTA 1G7TA 3FYHA 3P20A 4PHTA 4BRUA 3SQWA 1G3QA 2C77A 3FWYA 2IYSA 4OI1A 4PAMA 1MR3F 1IJFA 3PFIA 3K70B 3MGCA 3GQBA 2XOKA 2ZJYA 1IJEA 3FHOA 3A1VA 3QIAA 1EFRA 4OYHA 4D6PA 3KKPA 1KO8A 3B9PA 3C7KA 3DEFA 3MWLA 2KSQA 4M9SA 2ODWA 3X1DA 2BDTA 1X8KA 3GLHB 1Z29A 3KX2A 4LGMA 5EP4A 3QF7A 4ZCMA 1U94A 1S9HA 4OBEA 1H8ED 3KKNA 3TUZC 4NKRA 3NC0C 2BBWA 1KZGB 5K8LA 2W6JD 2GEVA 3RDPA 4FXPA 2O8FA 3U7EB 4CEIB 4C0KA 2WJYA 1FOEB 1KI1A 1KI8A 4OI2A 4LBZA 4B6EA 3GEEA 4M1YA 1H8HD 4LYFA 1FP7A 1XEFA 1MT0A 2B8TA 4QC2A 3UMSA 1KK1A 4IXNA 3WHKA 4V0ME 4DSTA 2IT1A 4HAWA 1ZNZA 2W2XA 4LCBA 4WXRA 2RGAA 4PC1A 2ZUDA 1TL7C 1PLKA 1ZW6A 3CZPA 1DAKA 2ZRNA 2HT1A 3WRYC 4BFTA 3LLMA 5FPTA 4UNNA 1KI2A 4M22A 5KNBA 4YXWA 2ONKA 3DKVA 1HH4A 4DUGA 2GA8A 1Q1QA 1G3RA 2OCAA 3CH4B 3OE7A 2CJWA 2P65A 4HUTA 5L3SB 1SVLA 3A37A 5L3QA 4LHZA 1KK3A 3EZ9A 1ZM2A 3BH0A 1F2TA 3DO6A 2R2AA 4NH0A 1G6OA 1G20E 1I4DD 4ASUD 2JJ8A 3EPHA 5CM9C 4WXPA 2WWXA 3CRRA 2IUUA 2GCPA 2WICA 2WJJA 2F1HA 1PLLA 4GDFA 4A0GA 2R6DA 2GESA 4IOKA 1KSGA 2JLUA 1KNXA 1M7HA 1E2NA 2XXAB 1Z3IX 4BLSA 1CJVC 2CVFA 2O0KA 3K1JA 4ZDIA 1Z47A 2D7DA 3BGWA 3AM1A 1YQTA 2ZR7A 1JNYA 3EC2A 4RD3A 2GK7A 3JZMA 1RRPA 4JL8A 4KAXA 3SYKA 1W4CA 1AN0A 2W83A 4DLUA 5J5CA 1SVWA 3GJ5A 3RAPR 5JZVA 1UBCA 5KPJA 5JHGB 5BN3A 2WAYA 2ODBA 2MMCA 4HLQB 4Q4HB 1XTRA 3W8NA 3QNUA 5DLQC 2JLQA 4QHSA 3SOPA 4MGYR 1CRQA 2HF8A 2NO7A 2HF9A 4F92B 1AJEA 2FSIA 4YMTA 3THXB 2ZSDA 4ZV4A 1NMZA 3SEAA 2P67A 5L3QB 1VG9B 3DHWC 2CEAA 3C5HA 4BQSA 1G19A 4J0QA 2DWQA 4BLTA 4Q19A 2WPDA 3K0SA 1GP2A 5AUOB 1FZQA 5A0FA 2G77B 2ZETA 1JI0A 6Q21A 2FPMA 1U9IC 3CO5A 3Q85A 2AFHE 5FOTA 1AGPA 1B0UA 3WXMA 3B6EA 2IF0A 1KJWA 1U90A 2GHIA 2X77A 1JAHA 1A82A 1YKSA 1JQLB 4DB2A 3A1UA 4LX0A 3VAAA 5FPKA 3KKMA 2DR3A 1NVWQ 2A5JA 2J41A 3NHBA 5DN6D 3CF0A 2QMHA 3A4MA 3PVSA 3B2EA 4LJ4A 2AK3A 3F8TA 2OLJA 4HLDA 1E9SA 3T15A 4C9BA 3NDPA 1Z0IA 3CX7A 1P61B 3EXAA 3MJHA 2J0SA 1E4VA 3THXA 1R8SA 3K9GA 3TMKA 1P2SA 1XCGB 4JYCA 4H9GA 2D3WA 3U3OA 1OH8A 4LJAA 1CRPA 2ZU6A 5ELXA 4CGZA 4A6PA 4Q4HA 5CDFA 3VHXA 2PJZA 4Q47A 4KFRA 1NG9A 3OIWA 4HLUC 1K8RA 2FX3A 1G8PA 3EIEA 3DOEA 2KE5A 4X8MA 4WAUA 1N0WA 3IBYA 2IEZA 4EIWA 1E9FA 2BOVA 4PC3A 3LQQA 5GJBA 4DRZA 3MG9A 2ZM5A 4KBFA 4OHYA 2XTMA 3T61A 5AJWA 4NMMA 1UKEA 1FQJA 1NLZA 1XRJA 3QXXA 2IWHA 4M1KA 5FL7A 3L0IB 1JPJA 2XNSA 4DVGA 1QHXA 1S8FA 2LCFA 3B1YA 4B73A 4JLNA 4KO8A 3IUYA 3CPJB 2V6IA 5FH9A 4RZXA 3CBQA 1XJQA 1TADA 2GCNA 3AVUA 4LK2A 5AJZA 3FKSA 4DDUA 3CLVA 2V1XA 2W2TA 2A5YB 4HEJA 4KHZA 1NJGA 4Q4AA 3I62A 2DYKA 4UXHA 4NCNA 2H17A 4DIDA
chains in the Genus database with same CATH superfamily
3G13A 1KI3A 2PX2A 3OUUA 2HI0A 5KHOC 4BWVA 4AJLA 1LPBB 1E79D 4S12A 3FVWA 1VL5A 5IJ0B 4BPBA 1YJGA 4KN5A 1G4HA 2DFKB 3D4OA 3BCSA 5EFOA 2BGUA 5C80A 4NBVA 3DCJA 3OFJA 1I6KA 3PI6A 2RARA 3ORRA 5AHRA 1XX6A 3JR3A 2Q0HA 3CLTC 4QTTB 1Q7EA 4RDAA 2H2DA 3H9UA 5IF9A 4KNVA 1NJ2A 2YIMA 1KVUA 1EEHA 4OA8A 3E0XA 4MRSA 1W0KA 3MJEA 2IH5A 1XFAA 3PUIA 4D25A 3G4ZA 2A5DA 1Z8FA 2Y67A 1VYTA 1WKCA 5DS5A 1YZFA 2RGYA 4U6NA 5FBRB 4Z1MA 2ZJ7A 2QUAA 4AJPA 4L08A 2BGIA 5F77A 2X3UA 4N5DA 4EHNA 5FNVA 1X9GA 4XOUA 3EF3A 4PFQA 4HFFB 3OTIA 5CUQA 1JDBB 5BSFA 1ZMRA 3ZQVA 5F4BA 4KR2A 5DQTA 3OC0A 1FDTA 4HJXA 3I9KA 4LEIA 2H4HA 2ONZA 3QWFA 3LAYA 1R2QA 3S7TA 4O4LA 1N8KA 3IOMA 3SYRA 3V6LA 1F17A 3PD7A 1P2FA 1WDWB 1WUTA 5AXAA 9LDTA 5MFZA 5K2OA 2Q5OA 4PX3A 2O2HA 1QB7A 2I34A 3EMKA 3KXKA 3QWAA 4BLPA 4HDSA 3ZK9A 1YQWA 2LVBA 4CHGA 2XBMA 3PDWA 3QJ5A 5SICE 2O8VA 3HEBA 3F1KA 4KN6A 1W5FA 3LEOA 3FHDA 1N8TA 2R6CA 3HR8A 3ILVA 1T6IA 3ECAA 4MR8A 5L40A 4YRMA 2V3WA 1IM2A 2XEDA 3MQ2A 4IS2A 4INJA 3WKDA 4L7QA 3LUHA 4WUTA 4AJNA 1DT5A 2KW5A 5SY6A 4EUNA 3NYJA 2B92A 2NUPA 1Z26A 3MF4A 1LM3B 2H9IA 2BEKA 1EAMA 1BQEA 3BGOS 2ZRIA 3DVAA 4CSAA 3JARA 2TMGA 3OMWA 3PYLA 3MWEB 1FC0A 4L6AA 1A4UA 5IARA 1K0FA 5KNDH 1E0KA 4H7DA 5DULA 1ECJA 3JZAA 3N8IA 1Q50A 3L7MA 4P4SB 5IBRA 1X0XA 1XTUA 4ETIA 2DUUA 1JG1A 1XZ8A 4EQZA 3OOHA 3D6JA 4L8YA 1XMXA 1IY1A 1JBKA 1RQLA 2EBFX 2VPIA 2ZWAA 5TT0A 3UR3C 3WIBA 3ZX4A 3HYCA 2H7YA 5LDDC 4KZKA 1JR8A 1GQ2A 3F6CA 2GK3A 3GROA 4GOJA 3PPIA 3RBVA 2VT2A 3TI9A 3I6QA 5A0TA 3QOXA 1EX7A 1VLMA 3R8XA 4HUQA 1WHSB 5T3YA 1YWGO 3L8ZA 3UJ8A 1LPSA 2KC3A 1YRYE 5DHRA 1RI5A 1QWOA 3A25A 4GIBA 1BH2A 4M8KA 4ZO6A 2Q2OA 1AS3A 4GECA 5AFSA 4CSAC 2AW5A 1B41A 5C5EA 4PWYA 4XIJA 4L0DA 2HA6A 4OO3A 3E9EA 1EFDN 2JJ2D 4CMJA 4W5WA 1IOZA 1P73A 1GDHA 2AQHA 1IN7A 2XCIA 4OU5A 4F5WA 2Q5EA 5HGJA 2R7UA 1YNOA 2QX9A 1PJ4A 3BXEA 4RE5A 4XEHA 2I8LA 5ESRA 1X13A 1IZ9A 2F1JA 4OSPA 4F1KA 2Z6UA 1E94E 1ZPDA 4C6TA 1N2XA 4DCVA 2R1VB 1EJ2A 5IH7A 2XB4A 4TGLA 4B0PA 3G5MA 4NZNA 1XQWA 2GERA 3SM9A 3PFWO 3UJ7A 4DV0B 1W9HA 3QPWA 3PCRB 4MUEA 2YL1A 3S40A 2XIJA 4PSVA 4B6SA 1ZCFA 3UUFA 2OPBA 3MFNA 1TCCA 3RS5A 5JYDA 3I23A 1CUYA 4EQ6B 1RM4A 1SD2A 3D8TA 4NFLA 5JSLA 4R2WA 1LI5A 1TFKB 2FSVC 3D31A 1P9RA 2JRLA 3H3XA 5HEKA 2PIDA 2EP5A 3RIHA 3IELA 3QVGA 1XU4A 1N5RA 1OIVA 1ZJ4A 3FHCB 2OV8A 1OLUB 4LHYA 4JXXA 4GOXA 5LNK6 2QM7A 2VB6A 3CIOA 3KUUA 5K1ZA 3VJKA 4D46A 5JHHB 4W5NA 1N2CA 1C2TA 3L7LA 4ZT7A 4TVKA 1UXGA 4JWTA 4N0QA 1ENYA 1UBKS 3HCRA 4Y2UA 4CM9D 4OHCA 1NJ5A 2WM2A 4WMLA 1CVIA 2QJFA 4RPHA 4EG7A 3B0VC 4WNIA 1VG1A 2SKCA 3OTOB 4L28A 2FLWA 4CTOA 1JBEA 3OZAA 1LK5A 2W2KB 1D7OA 4FGWA 4Y30A 3QBJA 5ALEA 2ATCA 4ONEA 1EKXA 2MR6A 3AM5A 4QDKA 2R25B 3HEAA 2OCLA 4H08A 3L8DA 3D4NA 3GDGA 1PFWA 2FQWA 2BZ0A 1KC1A 4XRGA 1JHRA 1FTGA 3ESYA 2Q3BA 1NHWA 4X45A 4WVLA 2J46A 1P3Y1 3LBYA 3TW6A 4PPYA 3KXDA 1F9EA 3VAYA 3LJBA 1RXIA 3VM6A 1XYVA 5CH8A 3ZGVA 2QQ0A 4C0WA 3DBRA 2NUTA 3K1TA 3QOFA 4HFRA 4B2IA 2J9VA 4CX9A 4C78A 4D8UA 3Q40A 4ARIA 4INOA 1G1AA 2DUNA 2HGZA 4JR0A 3PNBA 5AVJA 5EWJA 2QTRA 3IUBA 1KYIA 3C15C 4KQEA 5JAIA 4DBQA 4AL0A 1N1DA 4JI4B 3GCZA 4DN6A 2C54A 2J3KA 3Q7GA 1V11B 2PN1A 4ND7A 4QVIA 2PS9A 3OIFA 3QKUA 5CXQA 1RIFA 4BNLA 1AHIA 1UWVA 2UYHA 2HNBA 3UWDA 3BF8A 2OKGA 3WGZA 4JI7B 1GZ4A 3NI2A 1SXIA 4WLOA 4CE6A 4BO7A 2ZUBA 3CB2A 3QVTA 4RHFA 3OF2A 3KBOA 3L0YA 2OEXA 1AS0A 4LZNA 5B1IA 1T5TA 1WZIA 2W6ID 2PRKA 3DLPX 1KAHA 4R7TA 3GEPA 3ZU5A 4EZIA 3ZGZA 1ZW1A 4GLBA 4JL5A 5FBWB 3C7DB 1BHQ1 1L8LA 5HP4A 3CJTA 1DIBA 2HJHA 4NCAA 1VGQA 3HXQA 3QY9A 4IIJF 1GD1O 3R8CA 3DB2A 3LCMA 2RGXA 4GX2A 4KVFA 3JWEA 3NS7A 2IC5A 4KIWA 3S2UA 2ETSA 2FW0A 4C4PA 3ABKC 5K3OA 1R7RA 1E9AA 1F2DA 4KUEA 2WL8A 1XWFA 2AD5A 1J49A 2TYSB 1MV8A 5EZYF 3VTKA 4DEXA 4LHXA 5C8DA 4L74A 4LACB 1HV8A 1L4EA 4MWTA 3ZJTA 1UPBA 3T0IA 3HTKC 1YKGA 2B3DA 3NIGB 1K86A 3DAYA 1MOQA 3M5WA 3LLCA 4QUIA 4CKBA 4QRHA 1Q0DA 1YIDA 3M1LA 1COWD 1VJCA 2ZJ0A 4FBGA 4UJ3A 1SFRA 2BM0A 1B0PA 4ZPXA 3ZLVA 4PNEA 4CLOA 4R7GA 4WKGA 1QBKC 1I9CA 2RSEB 1YA8A 3CLTD 3C1AA 1NLFA 3AL2A 3ZR4B 5I7OA 4OFBA 5IT9A 2LRHA 4M87A 4Y2RA 1DS6A 5CT9A 4R1UA 2G6BA 2Y6VA 3X3HA 1H6BA 4IH4A 4GO1A 4DNQA 5C7OO 3OQ1A 5U1PA 1ZM9A 1H9GA 5KOJB 5AKEA 3OPYB 2GFHA 1PS0A 2OYCA 2VPXA 4PCVA 3LBIA 1MMAA 2AWNA 3LLVA 2OCPA 4U2DA 1WQ1R 3KSMA 1U0LA 1KH2A 1SB9A 5KREA 4ND1A 3D8HA 1XNJA 2J7PA 1JTEA 3EQ6A 4ZGGA 1ATIA 1OV4A 5CVEA 2XYHA 3KB2A 1EU1A 3N7UA 4J1TA 1R4ZA 4W99A 2GJ8A 3TZKA 4S0XA 1W2WB 4ZALA 4Y9TA 5IFKA 2V9PA 3OZEA 2C4KA 3ASYA 4R2XA 1QYIA 3HP1A 1LCIA 3K31A 4DV7B 5JNWA 5EHQA 3A2KA 1LS4A 4QYMA 4HNAA 2XTZA 1LSOA 1OJLA 5BRNA 5KNDA 5E4TA 1PGJA 5K0BA 3B3JA 3QX9A 2FSGA 3OZDA 4EMSA 2AXQA 1FF9A 1KO4A 2FR0A 1FX0A 3I34X 4YEDA 4AP5A 3F9CA 3IP1A 4NCIA 4L6RA 2JA2A 4FOOA 2NSHA 2XYVA 5EP1A 4CKBB 1VECA 2CXQA 4G5RA 1T9AA 5JPIA 3EIOA 1DWOA 4IDDA 4RHTA 4AUKA 1Y63A 5BR8B 4QGGA 1XLVA 3DZJA 4LE1A 1XGKA 4XQ1A 1GQOA 1E2MA 4PYMA 1V3TA 1YQEA 1R8QA 5FF9A 3M15A 3R41A 1EUCA 3S3TA 3K05A 4RVUA 3WGJA 1NBIA 2W6OA 3Q98A 3NORA 2IUEA 4KL8S 2W6MA 5H82A 3V46A 4D80A 5FXMA 3K5WA 5GJCA 3Q8WA 1Q83A 2C98A 4PG8A 2KNHA 3KFXA 2OGZA 2ZKIA 3TRIA 5A4KA 5JRDS 3EE6A 2C0QA 4G5FA 3NBMA 4WJZA 4W8OA 3TTXA 4X6UA 3WKBA 1TTHA 1AGXA 1Z4KA 1XMQB 1Q20A 1A27A 2A1TR 1IPFA 1IWBB 2CXTA 3OG9A 1W2WA 4I81A 1VRWA 2BKUA 2V7EA 2VHUA 4LDJA 2WU4A 2ZJZA 3B6MA 3BA1A 3FZYA 3IPLA 1GXSA 4XDYA 4ZVNA 3GP8A 2XADA 3KWJA 2G67A 4OCZA 4MYTA 3THWB 3U7JA 1KMMA 4L3WA 1TVEA 3NMUF 3ED1A 4XQCA 4G9EA 1Q3TA 1RR6A 5B36A 2D00A 1ZZPA 3CX8A 2JGNA 3OT5A 1ID8A 2R2GA 4MR7A 1U8YA 4BASA 4BMNA 1G4WR 4E4RA 1NSYA 4XM1A 4ZEMA 3NBYC 1J90A 3HGQA 1JZQA 1ECCA 1NW9B 3NEJA 5E2QA 3FXAA 2AXEA 4BE4A 5C8XA 1Z2NX 1S1CA 1BG6A 1GGMA 3DVRX 2GPJA 3W4IA 1KEEA 1JNXX 1ZLYA 4ZYWA 3C2QA 2CDRA 3OEED 3GMSA 2R7OA 1H23A 5AK3A 3L0PA 3OCVA 5IZCA 5J4LA 3U19A 2XCTB 1O7JA 5ALJA 1EG7A 2JAXA 2EQBA 3DBHB 4NONA 1W5AA 4X3OA 2E5LB 1Y8AA 4TMVA 3MTAA 2V6BA 5ADWA 4AY6A 2REQB 3K30A 3QW1A 2CLHB 3NW9A 3ZE2B 5C8YF 3LZCA 3QVYA 4X7BA 3PQCA 4B6JA 4JLMA 5ICEA 3A6FA 3FOPA 3EXG2 2GSWA 5CIYA 3K2EA 4IB4A 1D09A 4OL0A 1CY6A 3MUEA 4QOIA 2Y9MB 3IJEB 5AM0A 5H4HA 3BRQA 4GPBA 5FLEX 2PVCA 1IAVA 1WCV1 2CZCA 2HPZA 1RJDA 2J7KA 3K5HA 3LCVB 1IWOA 3CV3A 5DX1A 5AOVA 1EFVA 1BW9B 2WE7A 2DLDA 2FU5C 1U2SA 1EFKA 2CNWA 2OTCA 3AERB 4BMPB 4EM6A 4TLLB 4A73A 2QLJA 5F5XA 4PZAA 1A9XA 3OIYA 4DBLE 4RA9B 3BH6A 1NQ5A 1DG3A 2ADMA 3B13B 3M1AA 4KO1S 4QGAA 1WMAA 3MBOA 3ZCTA 4L78A 3TPFA 3WL7A 1TZKA 1R3UA 3I72A 3G0HA 4R9UC 1MH9A 1NLUA 3NWJA 3O1LA 1PWZA 1GGHA 3CZQA 1E2EA 3JYQA 4YN3A 3DP9A 1NW4A 3NEYA 1BXKA 2R751 2VAXA 4R81A 3UKOA 1UT6A 3PA6A 4WN9A 5TQ0A 3K94A 1CZUA 2IS6A 5EUBA 2QPOA 3GJTA 1W44A 1QANA 3RWOA 3HDYA 1CWUA 3HBLA 2G40A 1GU1A 1H2EA 4LYAA 1O87A 1GVHA 4XVHA 1IZ8A 3N0VA 3NJRA 5DO9A 5DW0A 2PUAA 2LP4A 2NVUA 3SIRA 4O4HA 1V4AA 1HQYE 5CCDA 1B1CA 1ZUIA 4Z4HA 3WL3A 5JJKA 5C0OE 3QXCA 1OOEA 1C17M 2QUZA 2ZBGA 1PL0A 1XD8A 2R4TA 3U4IA 4EYGA 5C5IA 2PH7A 3PEFA 3X1YA 1TUEA 5JRJA 3U39A 2C7GA 1GQFA 1GSIA 2ZAYA 1VZ3A 4TKUB 1Z5VA 1XQYA 4RNDB 4OHZA 2QZJA 1QPBA 4PACA 2I2XB 2WAAA 4NK4A 4X95A 3RBZA 5SY9A 3IAS1 2WJ4A 3OVMA 4JC5A 5L3ZA 3IKVA 4GVXA 1NWHA 1VLJA 3QYJA 2BFAA 5T4FA 3P9YA 4AECA 1N2HA 1NN0A 4GI1A 2HZ7A 4U8GA 1N0UA 4MV7A 4LHVA 4XGKA 1Z0AA 5DRTA 4QJ3A 3RVBA 4KE7A 3P19A 5AK6A 1V5GA 5CDHA 3FTFA 1T0BA 1XOIA 3THSA 1I7LA 4DIEA 1A88A 5DBIA 4HMQA 3KQHA 1QYVA 1JHOA 4YQEA 1QMGA 1JSLA 3CN9A 1R64A 3D3WA 3IXMA 3IA2A 1ZSYA 3T1QA 3HVRA 3X1WA 1T91A 5CA1F 3HB9A 3WMRA 1XT6A 4M46A 5HFAA 2GN4A 4R8SA 4RQAA 4DNXA 3BB4A 1NI5A 3UEOA 2W4QA 4B7CA 3FNIA 1YZNA 3KHKA 2ZWOA 4TTIA 1HT1E 1IATA 1O4WA 1U2QA 2BAGA 5K6AA 1T8SA 3N07A 4GICA 4K9DA 3TQTA 4CF4A 3L7AA 1PVVA 2ZS7A 3ROTA 5KSWB 3EHDA 2Y0EA 3IVCA 5B3AA 2F8TA 3WLJA 1SUDA 4MP8A 4EG3A 2OWEA 4FHGA 5CLGA 1UKVY 4EECA 4RDXA 2ZJ8A 1GAWA 1P39A 3OY2A 1QZ3A 3GGPA 4HH3C 4J29A 4UTXA 3H2VA 3EOZA 1WPXA 3ASOC 5DNAA 1XZPA 1FDRA 1PRYA 3VNBA 3ZJ5A 2I03A 3NTQA 2A1UA 4A36A 4P34A 4CM4A 1GG5A 1AV7A 3WRYA 4HB3A 5I9TA 4JD5A 5J2UB 5FPHA 2FDCA 3AOEA 2UZ3A 1KI4A 5KAPA 4NU0A 3IBFA 4DCSA 2GHTA 3OCXA 4LSGA 4UHBA 5BN4A 4P36A 2VP6A 2TMVP 1T2CA 1DU4A 1Z36A 1VHJA 4U1RA 1BD3A 5I4IA 3VI4B 1T4BA 4QSHA 3K72B 1LV8A 2FEKA 4IUBS 2QM0A 5IJ9A 1RNLA 1OWLA 2XT0A 3PVCA 4O59O 2GZ2A 2QXUA 4FN5A 2AF3C 1E3JA 3KVVA 3AESA 1DQRA 3Q7QA 3DXFA 4JY7A 3RJ9A 3QW2A 4EKNB 3BTVA 5BT8A 3F73A 2ZVPX 4AY2A 1IMJA 4AZSA 1R6DA 1KMQA 3KOWA 4AZWA 5TJ5E 3ZJYA 1QZXA 4KQIA 2H5IA 5GWXA 1DO0A 6LDHA 3EWAA 5IT4A 2BFBA 3BSYA 3T12A 3OFSA 3TM4A 2UDPA 4HJRA 2BE9A 1YDEA 3C1TA 5KUTA 3ONWA 1SZIA 3PTLA 2PMFA 2BGNA 2XUAA 2R66A 5L7WA 2JBAB 1RMYA 3R0IA 3RB8A 2HU8A 3W5CA 3EEQA 1CYDA 3CZ5A 4NYMR 4J7TA 4RVGA 3GRUA 3TH5A 2IV7A 1U7TA 2JFFA 3DKPA 3UMCA 5IVKA 2FE1A 2CDCA 3EC7A 4RBNA 4GQIA 2BGKA 1IAQA 2IZ7A 1V6CA 4HAZA 4IO0A 5AJTA 5SYAA 1JIQA 5TMBA 1RHMA 2EX1A 3L49A 2Q7DA 3F7NA 1TTTA 1VGRA 2H16A 4RKEA 1X39A 2XAAA 5L51A 4G4IA 4W5RA 4ZC8A 2ZSAA 3EG9B 3MMZA 4TLEA 4C3VA 2CUNA 3ZKWA 1NLYA 2RGWA 3OU2A 4RMIA 1RPZA 2ZFUA 3H9JA 1ISRA 2H1FA 3M79A 2G1AA 4OD4A 4JC7A 2FUG6 4Q03A 3ZS9A 4QHTA 1O6ZA 3RNLA 1MW8X 3BK7A 5K09A 4MVXA 2QVBA 1BN6A 3QLVA 4JU8A 5BN5A 3ZTTA 3K5IA 2LCQA 4JW1A 1ODKA 2WT8A 3B1VA 3H5IA 3BRSA 4OATA 3ZHYA 3BWMA 2AZDA 2YJNA 1K6XA 1SXJC 3L6BA 2IY7A 3QPCA 1H8HA 4IJMA 4R3NA 4CCAA 2WVJA 1FP1D 5JVDA 1EB8A 1KI6A 1GV1A 2SECE 4OMFG 4PO1A 3OT1B 5F12A 2VQ6A 2IXMA 1JR3D 3FUWA 3PR3A 4MYHA 4ZK2A 2VIIA 2MMGA 1TEZA 3OLVA 3ZWDA 3U4AA 1WS6A 3AU9A 3W9BA 1L1QA 2I8CA 3X44A 5K0FA 4FEAA 1UAAA 4K8OA 1EG2A 3I6MA 3TLAA 3WADA 4AN4A 3V5XA 4NEGA 2Z98A 4XI9A 3WHLA 1CNEA 5H3LA 1BR1A 3W7AA 5DLDA 3U3XA 3QV2A 4HGOA 4GRAA 3HCFA 3G79A 2FRVA 4AK9A 16PKA 2Y99A 3QKTA 1ZUHA 3BWEA 1CR6A 1T4MA 3I2KA 1AKEA 3R09A 3TFQA 4I55A 2OZLB 3WGVA 2P41A 4CW7A 2JLWA 1SUBA 3LA8A 4F71A 2VSYA 2FYTA 3HXKA 4BQQA 3EGXA 4IUCS 3WQHA 1Z6XA 3KEQA 5CLIA 3NFYA 2A2ZA 4WK4B 1SB8A 5HCNA 3DT8A 4MB2A 3DYVA 4G5OA 3COJA 2DQYA 2YHBA 2HHAA 3NFRA 3MT7A 4IYJA 2H0QA 3WX0A 1IU9A 1DELA 3QEJA 4ENRA 3DE4X 3OTWA 2YICA 2Z3VA 4B46A 4RANA 4XJTA 3V6MA 1AHPA 4CEIA 1DBVO 1EUCB 3N8NA 3PC8A 3WYEA 1SXJE 2XE7A 2R4QA 3AK4A 4Z8YA 1EPUA 1T6BY 1H2AS 3GFQA 4TMWA 4DLKA 1PR5A 4F5DA 4KYVA 2HFIA 2PMBA 2QENA 4Q9HA 2B1RA 4Q4DA 4FKMA 1NC3A 1QLEC 4KSCA 4R9RA 3WXBA 1OTXA 4YUVA 1CQIB 2NZWA 2R6R1 3OT1A 1H9AA 1RQPA 3NM6B 4IRXA 4KH1A 1VP9A 4Q37A 5B37A 2O8CB 4NDNE 4YT2A 1E5DA 3L40A 1SIBE 4FE7A 3T35A 1Y3AA 1IHXA 1CY2A 1MOZA 1O57A 3IP5A 1MCZA 2C8KA 5DP2A 4M1WA 1E3SA 2VDNB 4C7VA 3CUWA 4B47A 4PC7A 3ET5A 2PX3A 2LBPA 2RHGB 2V5VA 1KMHB 2P5UA 4OHFA 5SZKB 3ETEA 3Q5EA 4Y0AA 3G1WA 4QI0A 3RG8A 1BXRB 3Q8XB 3DFZA 3S2ZA 4B4DA 4NBUA 3L0IA 1LX6A 4NVRA 3RTEA 4QXRA 1U8UA 4P98A 2Q4FA 3K3PA 3O9ZA 4PG6A 3ROEA 5CB6A 2EZ4A 2XGSA 3JS5A 4GL4A 1OKKD 3W34A 2ZTSA 4JLBA 3OMLA 4HB0A 4UQPA 3T52A 5H3CA 5L0GA 4DUYB 2X4IA 4LF5B 2P9ZA 3UAVA 1N57A 4B6PA 2DH6A 3E7FA 3T1YB 1NW3A 1HRDA 4GOOD 1YB1A 3NHWA 2GK6A 2XWQA 2VF7A 5HM8A 3V7UA 4E2YA 1SUWA 3IUEA 2VQEB 2ZXFA 4WIAA 1Z6PA 1D5CA 1RCPA 1FQWA 3DE8A 3K92A 3PD1A 1SO8A 3KLOA 1WDTA 3LVFO 1M1YE 3PL5A 4RLQA 2WIFA 4P4TA 3RGWS 2W2LD 2C5HA 2RBGA 3FCAA 3K6BA 4KYIB 4EBFA 2PJRA 3CWZA 1JEDA 2QAIA 2VXBA 3LLKA 4J6EA 1CEQA 5JCZA 1DAIA 4TMZA 1DBQA 3M2PA 2AWOA 3ZY3A 3KQPA 2PUTA 4N3CA 1E60A 4HX9A 5GZ6A 3X1OA 1UZNA 1XSEA 2C4TA 4K87A 5IYZF 3M5PA 3UCFA 2AN1A 3FKQA 4MVCA 4RY9A 5F64A 3WYFA 4BPRA 3CR8A 2K5UA 2EKPA 1Y82A 1NZDA 2JJQA 3GLKA 2O3RA 5GZ3A 1DZ3A 1D2RA 3TW4A 3FW1A 1FX0B 1JE1A 1GIAA 3K1YA 2I15A 3RHTA 1UBUS 3P0RA 4MJXA 4PLYA 4G5SA 1TYEB 2XB8A 1MABB 2AE2A 2ETVA 4N6OA 3EUEA 1M76A 5K6AC 1YMQA 1GQSA 5GV7A 2QMEA 4W1QA 5E4FA 2Y9PB 3GVPA 3DONA 5HRAA 1CS4C 4L50A 4QRDA 1GWNA 3L7IA 1GARA 4BMDA 4DR2B 1E89A 3PUJA 3IE1A 1AK1A 4BUCA 4F2DA 3IOEA 3NLLA 1CB0A 3KXLA 3ZC3A 4ENUA 1G5HA 4XLLA 5FV4A 1DJPA 3TM5A 1AQNA 3IAFA 4O2AB 4XQ9A 4PXSA 1NJ1A 3FSGD 3G88A 4MTOA 4Y9DA 5DWVA 3EEIA 1DOZA 2ZUFA 2WVNA 4N76A 3A9VA 5ALOA 5DS4A 3ZIBA 1TQ2A 1VPVA 4NJMB 4JNCA 5BSTA 4DJJA 1PR1A 1AKTA 4FCWA 2LFDA 3VYWA 1EDBA 4UULA 5DBGA 5LBIA 3VZBA 5HQ3A 4EATA 1TQHA 1U3CA 2RK3A 5B53A 5EYPA 3MVEA 1GXSB 1SBCA 1T2AA 2IBMA 2OBLA 3RC7A 1G42A 5DNWA 1CJMA 4A23A 4F9GA 1JJIA 4EJSA 1ZC3A 4YYEA 4IMRA 3QNWA 5F7ZA 1PSDA 1BA2A 4C29A 2B4AA 2VT6A 3P9XA 1HXHA 1X7HA 2UYQA 2PR2A 1P5FA 2NO9A 5G4KB 3SSMA 5DLYA 2VYFA 1NVXQ 2VSOA 1V43A 4MW7A 5KJ1A 4PYNA 4Q7EA 1Q0TA 1WASA 1OFIA 2FUNB 2OCBA 2IXGA 2DBRA 4LOKA 4D26A 3ROFA 2I6XA 2WRZA 2ZXOA 3TN7A 1UMBB 2FPIA 2MSKA 2AW3A 2EBWA 4BDTA 4W5OA 1XWJA 4AN1A 1Y34E 1E3EA 2WC1A 3U6KA 3RQEA 1J0AA 1J07A 1T5HX 2V7BA 4JP8A 4X1YA 4TXMA 1O8CA 1V6AA 5F3WB 5EQJB 1GNPA 3DFUA 1LBSA 2YW9A 3MWYW 4RFSA 1QONA 3ZE1B 1J70A 1L7OA 4NFYA 2AVDA 4HNHA 3B85A 1UM8A 1RWNA 2GX6A 3DT6A 4FDAA 1HM5A 4Q39A 3CG0A 3NKLA 3IR6A 4WLFA 4WY2A 4BNXA 5L4SA 1R50A 2PPLA 1A96A 4V0LA 1TZMA 4I5IA 3DLCA 5BQOA 1P0PA 4HLUA 4LW8A 3RSLA 4P7GA 1E63A 1E77A 2HT6A 4PLGA 4RVOA 4UE6A 4B80A 1T1SA 1JFSA 256BA 3MJTA 2MSLA 2V4ZA 2AK2A 1X3SA 3A6ZA 3C16C 1XVLA 4RJLA 1WULS 3S0JA 4MLPA 1WPQA 3UMYA 3GM2A 3MJDA 1NVDA 1XTBA 2GBGA 3OEHA 5PGMA 4B31A 2H8GA 1C7JA 1USGA 2H54A 1BFKA 4JYPA 5F2OA 5JW6A 5EXSA 3I4CA 3UGQA 2VHVA 3X1KA 1EGVB 4YRBA 2PL9A 1V8DA 1J2UA 3ICOA 3S5UA 1RZUA 3RAGA 5JJIA 4C7KA 4AP6A 5BW5A 4J1NA 4L9WA 3QKRA 4QYXA 4GU5A 1PDOA 2RG7A 5EG5A 4MLCA 5M5BA 1KJQA 1L5WA 1Z82A 3AHHA 2W2LA 2O2YA 4M55A 1LA2A 2PWBA 2GZDA 3LVQE 4XLZA 1JV2B 1EDZA 4BIMA 4PFOA 3RYLA 3HPRA 4Z51A 1C3XA 5B4TA 2AFIA 1I1HA 5IJ9B 1GTSA 4CRWB 1XZHA 3MAGA 5CDSA 2QW1A 1HE8B 1AQYA 2A67A 2C31A 3AIOA 1Z4IA 2WUFA 4Q3DA 4TZKA 2GR9A 2Q4EA 4ZQHA 2BONA 3MUFA 1II9A 3T9CA 2POQX 4V1CB 2BFDA 4IF4A 4U5GA 4MX8A 2Z2XA 1BBHA 4WCFA 3F6PA 2R8PA 1CR0A 4KWCA 2AD1A 2J59A 3TDKA 5JFTA 5KSZA 3EAFA 1Z62A 2YRXA 2JD3A 1ELOA 3IV9A 1D8TA 4QAQA 3GVCA 3BAFA 4YJKA 3RC9A 2JLVA 5AHOA 1YQDA 1BVUA 4WZAA 4CDNA 4M7PA 3A58B 4N5LA 4EK9A 1FDVA 4A8JA 5KVVA 1QP0A 1ONPA 1GZ3A 1PYGA 3DWWA 2AUMA 1GUFA 5BPHA 3RSCA 1F0PA 4UMFA 4IXDA 3V8NA 4ZOAA 1X1TA 3ZU2A 5L95A 1DQSA 2HS5A 3HM2A 3I4FA 3B5EA 4CKYA 3VMMA 4MARA 4GZLA 3R0VA 4NL4H 4S35A 3ACCA 5JY6A 3MWDB 5GJVC 2UUIA 4IGFA 4WINA 3HVUA 1SHLA 2JEYA 3I1IA 3NXSA 1NOKA 3T9BA 2OT3B 2WU3A 3W9SA 4GP7A 4II2A 1Q2UA 5C52B 1G5ZA 5EHXA 3QXSA 1E64A 2XB9A 3BDIA 1I24A 1QZZA 1KJZA 4G8BA 4IP0A 1YB7A 5J2TB 4IWXA 1PVOA 7ADHA 1P3DA 2BW0A 1JGTA 1YR7A 3N0XA 3NCTA 1EJBA 3RQGA 2JJ1A 3L0SA 1IXSB 2FMUA 3R4CA 2X5NA 2WOJA 2DFDA 2H7VA 2YL3A 4RULA 1G64A 3LX5A 3ZWMA 3EFBA 3P1JA 1ISFA 4RJIA 2X8AA 2GT1A 3CSDA 1Y5IA 1PTKA 4NX2A 3JWHA 4KC0A 1U28C 2CDBA 3GU3A 1XI2A 1WGWA 3T4PA 4H0NA 2VSNA 3OPYI 1N1GA 1M1ZA 1U3GA 4RMGA 4BCDA 4BFLA 3GLGA 2Y2VA 3VC3A 5TVKA 1SD5A 5U4QA 1Y8QA 1KTVA 1Q1ZA 1OC4A 2INGX 1SOVA 3D9QX 3FPHA 3M82A 2RHLA 1UIRA 1ZQ9A 2Y0CA 3W06A 1A9RA 1G16A 5FV7A 2SNIE 4D99A 4CWAA 1COZA 2ZTUA 5DK6A 2FPGB 1B15A 2I2FA 1BOOA 3NGMA 1PSWA 2I2WA 3GD5A 4IZHA 4RH3A 5HS6A 4WFJA 2I65A 3DQQA 4WLUA 2FDXA 1TJYA 1PW7A 1Y33E 5H80A 3GZNB 2VZ9A 4HS4A 4IJ5A 5A9SA 3TOSA 2GM5A 3OX1A 1B6RA 3SE7A 1Z4NA 3TIVA 4WN3A 4HD8A 1RYFA 3UMKA 2Q1UA 4J9UE 4QYSA 4O2AF 4BB9A 1D04A 2IGTA 2J6HA 2WTEA 4G4SP 1QE3A 2FAPB 1L7DA 1L8AA 1L5SA 3PRKE 5ALHA 4OH1A 3WISA 4MAFA 4DMLA 4LJ9A 3EODA 3ZOZA 2FQXA 1K6IA 3AFGA 3GJ3A 5JWRA 4BGEA 4KPUA 1E6EA 4B3SB 1X9HA 1DAHA 5FUYA 4UTPA 4Z9JA 4EG1A 3OQJA 3TLCA 4J03A 4R0NA 4WEQA 3TQSA 1LWNA 4ROSA 3S27A 5CFPA 2ZUEA 4ZVKA 3UHJA 2C58A 4P3YA 2BM1A 4KBYA 3VX3A 4C4SA 2X4DA 3LF1A 3ZUGA 3ZVKA 3E8SA 4GLFA 3NDBB 3IS3A 3ZG1A 2AZTA 2FWMX 4RA6B 2JEZA 1XTSA 2QVYX 5D3MA 4DGSA 1I9GA 3MXTA 1ULBA 2R1ZA 1NI4A 1UOOA 2N42A 5FLXA 3NGXA 2AOTB 2DMRA 2QVCA 2E4WA 4KFSA 3JU3A 1PNRA 1RADA 3UC5A 4AKHA 3RS0A 2J3QA 5EMJA 3WRWA 2JIZA 4M0PA 3QKSB 2YZSA 3CEJA 4CF7A 4XCVA 4BRWA 1EUQA 1B8UA 1F12A 2PM8A 4BP1A 1THMA 2P69A 3ADKA 4YRAA 3UH1A 1PUJA 4IHQA 5EZSA 4J3NA 1F1BA 2VSFA 5C4GB 4YV1A 5DTRA 3T3PB 2F90A 1C3JA 1JJVA 2CLCX 3QX7A 5EJ4A 3UAWA 4P35A 3ER8A 1FXSA 1K0UA 1XCBA 1PFVA 3MTDA 1MZPA 3ORYA 1XPOA 1CZNA 5HX7A 3VISA 1WXIA 1YJ8A 4FX2A 3QLTA 5EE5B 3RYCA 2J45A 1CPQA 2YVKA 1OD6A 2EF1A 4I19A 4INAA 1LFDB 3WGUA 4F91B 4HFNA 3U16A 4HDNA 2FSHA 1NC1A 4A4DA 1QX3A 5JROA 3U8VA 1K6MA 1ESDA 3SS7X 3JV7A 1TAGA 2O7VA 4K8RB 3L7YA 5C5DA 1BDHA 3L8EA 3LL4A 2RKOA 2JH9A 3H84A 1M6WA 3AF6A 4WL0A 1XYYA 2PGIA 3U4DA 2CWWA 2HDHA 1H7IA 1Q1BA 2GS9A 4JOSA 4KWTA 5F33A 2D1FA 3RCBA 4BNDA 1OQCA 3LM8A 4C5BA 3RVQA 4CYMA 4ZZ1A 4G01B 4UHFA 3UWPA 3LXUX 5BV7A 3CWQA 3JWPA 2VTBB 2VPTA 5KINB 4MUYA 3K0KA 1I30A 2ZITA 5THXA 1IONA 1G2OA 1V8BA 2JVIA 2ZIFA 5AM4A 1MB9A 2VCEA 3BERA 3DV0A 1A2OA 4YRZA 1NXSA 3RYIB 4EF4A 1IN6A 3Q5GA 4JIMA 3IUNA 3D4BA 2O23A 3HB0A 1O03A 4OKSA 3ZXUB 1WVMA 2G5CA 1N92A 2CXSA 3BMNA 1SHTX 3LBAA 1XZLA 4JT9A 4C01A 3DXZA 1K4MA 2QX6A 2JD2A 4AMYA 1Y1PA 4XWKA 4H1VA 4MW9A 4UQOA 1VSVA 1M1YB 1N25A 2QZ4A 4OOFA 4DARA 1VE5A 1LKZA 2VFAA 5K6RA 2AMVA 3IQWA 2REQA 4ZVUA 1JXMA 1S5PA 2W2QA 4BKMA 1DAEA 4TM7A 4KR3A 2OP1A 4C6HA 4K9KA 4YECA 3UW3A 1J1ZA 3SFTA 4BWYA 2EEZA 2BUCA 3NTOA 1E20A 5LQCA 1DIGA 3M6WA 2WTMA 2YWGA 5EXEA 3NV9A 3ZD9A 2E4AA 2OAQ1 3PJFA 3H5TA 5BOVA 3VXKA 5LOVB 1NMYA 3GJQA 3T7CA 2X0FA 3LC1O 3W0LB 2V96A 3QK7A 3OHMA 4CQNA 3SF8B 2I7CA 2IYQA 2ZR8A 4HRXA 2IIVA 4CHTA 2UUAB 1A7VA 1RKBA 3FVYA 3N8KA 3WBJA 4KWHA 4B71A 3LNCA 5M2QA 3UK6A 1E18A 1TFRA 3NASA 4AJJA 4I9HA 3MN1A 4U2BA 1MX3A 1XDUA 5KNCH 1QK4A 1YQGA 5FJJA 4XCXA 3ZCVA 3GT4A 2YL0A 2AC4A 1HF3A 2QKYA 2YDYA 2XSZD 4HOYA 4GEHA 5C3UA 3UATA 3GEDA 2WM9B 1GKIA 1FLDA 4XEUA 5L0FA 3NV7A 3O4IA 4X63A 4TYWA 2Q5LA 1E8NA 3DGEC 4MTCA 4OIPF 3IVXA 4H1HA 1D3AA 5HTKA 1BFUA 2ZTVA 3DLBA 1M1YA 2ZWVA 1RS0A 5ALPA 2I6UA 5EVJA 2H8KA 2J5BA 3AIIA 3NP7A 3UXYA 2W37A 2FMXA 1LPAB 3IP6A 2AS0A 2FE4A 3A26A 1Q2XA 3PR2B 4LMBA 4ZOCA 3RJ5A 1Y6GA 3H4MA 4YR9A 1J00A 2FOXA 3QEMB 3R5SA 5IN4A 4CCYA 2OCXA 4FLEA 4TPKA 3ZI7A 4EPRA 3EXFB 1G6KA 2IOFA 5HW0A 1MFZA 1QCZA 2D1SA 1EQ1A 2Y77A 3CONA 2DFPA 3R23A 5AT1A 5EUQB 2L81A 3TAHA 1XK7A 2P2YA 3KB1A 3GLSA 3ZDRA 2C3PA 3GOHA 4HYTA 3TXXA 4IX9A 4AB1A 1KJNA 4H60A 4CM3A