1ZU5A

Crystal structure of ftsy from mycoplasma mycoides- space group h32
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
309
structure length
309
Chain Sequence
HPMEKAMLKSAFNFSKDIKKLSKKYKQADDEFFEELEDVLIQTDMGMKMVLKVSNLVRKKTKRDTSFENIKDALVESLYQAYTDNDWTNKKYRIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAGATQQLEEWIKTRLNNKVDLVKANKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKIIQQVEKSAPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLLAFDIDQYIVHLSSGFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ftsY
publication title Conformational variability of the GTPase domain of the signal recognition particle receptor FtsY
pubmed doi rcsb
source organism Mycoplasma mycoides
molecule tags Protein transport
total genus 115
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1zu5A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zu5A02
5FOSA 2VP5A 2N1BA 1GL9B 5HKKD 1VCIA 121PA 2YVUA 3ZIAA 1RPZA 1U0LA 3NHBA 4A4DA 4U02A 4DCVA 3NEJA 1D2EA 1FPMA 2QP9X 2ZJOA 3LVRE 4EIWA 3ICEA 2FE4A 2GETA 2B21A 2JIZD 4PPNA 2EFGA 2BBWA 1VG8A 2A5DA 2DHRA 3CH4B 3VHLB 5D3MB 2F43B 2ZUDA 1UKZA 4C2TA 1QDEA 4G1UC 4RD2A 4BZPA 3CPJB 4XIGS 2H5EA 3NBZC 5F3WB 4A0GA 4B73A 5DSZA 5JWHA 1Y3AA 4DDUA 4AURA 1KI9A 4IEEA 5IHPA 2GCPA 2G0NA 1PV4A 1T8TA 2AFIE 5KDLA 4HLUA 2C99A 1BO6A 4M9QA 3WRYC 4JL8A 1E0KA 4D4LA 2FG5A 3F3YA 4L4UA 1UDXA 4QGHA 3WYFA 3OIWA 3C41J 4A8JC 5CJ2A 4Q1AA 3QIAA 4ILEA 3TW4A 3T61A 2WMOB 1JJVA 4M1YA 5LD2C 5TVKA 5H1YA 4GP6A 5FR1A 3WMFA 2EQBA 3A4LA 1G8FA 3K9NA 4P4UA 1RJ9A 3NKVA 4GZLA 4NYJQ 3BBPA 2A3RA 4O25A 1E9DA 3UWKA 5HZHA 2OILA 3U44B 4HLUC 1MR3F 4PAQA 2G6BA 2OFWA 4UXIA 5LB4A 4HB2A 2MSEB 4XTRA 1QZXA 4G5RA 1E2JA 4S2EA 5JSZA 1XXHB 2R8RA 2OXRA 4WAUA 4OI1A 3SHFA 4DLWA 3U6KA 1NBME 3QPWA 3OE7A 5B57C 2JLXA 2R62A 2ASEA 4Q4JB 4UJ5A 3AVPA 4G3XA 2QPTA 4C30A 5KDDA 3TR5A 2I3BA 1MABA 3IBGA 5KNCA 2PX3A 3QF4A 2EFHB 3SU8A 4UJ3A 3K1JA 2ZR0A 3P20A 4MRSA 3KKQA 5DGXA 3GLGE 4R98A 1I4LD 2D06A 2C9CA 4DSNA 4G5QA 3U4QB 4IVQA 5JWRA 3VR4A 4TYWA 2IYZA 1W4BA 2Z5FA 3BXZA 2RGAA 4GSYA 3H0KA 3EIEA 3IEUA 4EPVA 5EE1A 4EJSA 3GJ7A 4ZCIA 1F2TA 4CEIA 2Q3MA 4LHXA 5FFMA 1GNPA 1O87A 2X2EA 3C14C 2VA8A 1HE8B 1LS1A 1XMVA 2UZIR 1N6NA 2REOA 1EK0A 2ZPTX 1R8QA 3LX5A 1NLFA 3TE6A 5EZ6B 1XEWX 1EWQA 2GK7A 4XVQA 2V6JA 3FKSA 5FUVA 1ZNXA 5AUOB 4GDFA 2ZI5A 2R6FA 1XNJA 2LCFA 2W6ID 5K8LA 1E94E 1XTRA 5CLLA 2C9YA 3MFYA 5EQTA 1S0UA 4DB2A 5KPJA 2O8BA 4UNRA 2OBNA 1JB1A 4DT1A 4U7DA 2W2TA 1VCMA 2IYXA 2X19A 4RSGA 1KDRA 1UFQA 5E7MA 4DDWA 3BAFA 3KXIA 4IFBA 2BC9A 4KYUA 3EPKA 1KNXA 4OQXA 4EFNA 1Q57A 4PXAA 4EAQA 2GNOA 2GEUA 3S1AA 2PT5A 3BOSA 2JLUA 5IF9A 3B78A 3K09A 3KKMA 1KI2A 3DMNA 3OAAA 2AK3A 4IXMA 1QHYA 2XZPA 1W49A 4M1KA 4NYIQ 4YQFA 1U8YA 3N70A 5JWOA 2F1RA 4ZV4A 3D3QA 1GWNA 2QU8A 5AWFC 4R9UC 2Q21A 3KJHA 1NJGA 1B23P 4AWXA 5E95A 1G21E 2NZ8A 3EZ2A 3ZS9A 4RZ3A 3B60A 1G5RA 3EWAA 3GD7A 2C78A 4BEJA 2I4IA 4XWKA 1YR8A 1OFTA 3EXAA 3K09C 4MKIA 4BLSA 4OI0A 1R5OA 2W58A 2BEJA 4D0NA 3LWNA 4Q7JB 1A2KC 3RHFA 4NU0A 3AVTA 2VP4A 1JBKA 2V3CC 4IDOA 2PJRA 3GLHA 2IYQA 1NI3A 1FQKA 4DCSA 1E32A 3AV0B 3RS7A 4DDTA 4TQUS 1NG9A 3B7GA 2IHBA 5CM8B 2MMCA 3GJ8A 1G8HA 2GCNA 1YZNA 1M1YE 3OF5A 4CDGA 1KK3A 4HI0E 1WA5A 1OH6A 3RS4A 1E0SA 1IN4A 1HT1E 2VYFA 1YZQA 3LA6A 5C4MA 4R2IA 3OEEA 4B3BA 5L3SA 4KV9A 4Q9LA 2GJ9A 2AWNA 3DEFA 3L8YA 4TLCA 3LO5A 2GZHA 4BRWA 3FMFA 3KFVA 2ZQ5A 2ZRGA 3QXHA 5H70A 1IBRA 2OCYC 1JQLB 2A78A 4L9SA 4JYBA 2IF0A 1G5PA 1LFDB 1OIWA 3GLGB 1Z6XA 5JEDA 2EVWX 1DG1G 1UKEA 4DLXA 2CHQA 2A2ZA 1R2QA 3RRNA 2AL7A 2FMXA 1FQJA 2ZJYA 2ZUBA 4QHYA 1AIPA 2LKDA 5G3YA 1ZD1A 3K8YA 1SVIA 4MRRA 2CLDX 3LQRA 1COWA 1UM8A 1PVOA 3T5DA 3AKYA 3IQWA 2OCBA 3BFXA 2WSSD 3ZD7A 1E2NA 1TU4A 1ZUNB 2GCOA 2C77A 2MSDB 1GTVA 3OIUA 1OH5A 3R9WA 1XTJA 4M9ZA 1FNMA 5BN5A 1ESNA 4B44A 3UPUA 5CK4A 2GAOA 2GEDA 1OSNA 2VO1A 3IIJA 1PLLA 1AKEA 4QHTA 1ZP6A 3AKEA 3L8ZA 3KUCA 2FSGA 3RRYA 2ZI7A 3I8SA 1VG0B 2XJ9A 4X8LA 2EFCB 1EFHA 1DOAA 4A92A 4KXFB 5J5CA 2Z6VA 4TLBA 4CF7A 1CR1A 4KO8A 4HB4A 5FPSA 4B6EA 3RLFA 2XZOA 3VAAA 3LBNA 2O0HA 3GEHA 2QM8A 4BECA 4FIDA 3FMIA 1OJLA 2CHVA 2XAUA 3MSXA 5G53C 3U3MA 5TXGA 4XOIA 3KFXA 4Q1DA 4A8JB 3SEAA 4BFZA 1EFUA 4MDEA 2FU5C 4K8OA 4LPSA 4Q4LA 1KHTA 2CNWA 3A4MA 1YHNA 4HLCA 3P4YA 3U3RA 1P9WA 5KU1A 5LD2B 1NMYA 2GBLA 4TWZA 4ABYA 3ZS8A 3NIBA 4XSHA 1U9IC 1SULA 1TQ4A 3NH6A 4BZQA 2KE5A 4B3DA 4DUGD 3PEVA 3AUXA 4X8MA 821PA 4A15A 2JDIA 4NDZA 4TLDA 5DYGA 4OHWA 4PC3A 3QKUA 1HEIA 2JEOA 2JJ2A 4KYIB 4AK9A 4LI0A 2WZQA 4B75A 4D2IA 3T1OA 3WBJA 1WB9A 4V02A 3AUYA 4FMCB 1P2UA 3IQXA 4JL5A 2VL7A 3HYTA 1IN5A 4EPWA 3I5YA 1UEIA 1XZQA 3U60B 1N6IA 2GBLC 3K0CA 1KKLA 4PHHA 4RKEA 1EX7A 3BS4A 3HPRA 3CKLA 4PO1A 1NN0A 4OBEA 1MKYA 5EUMA 4ASUD 3OHMA 1R10A 1WBDA 1RRFA 2F7SA 1N6RA 1XRJA 5TV2A 3SC3A 4O3MA 1AM4D 2DFTA 1KDTA 3NDPA 3HR8A 5FOWA 5JZVA 4PZYA 2IYLD 1Q1EA 1W2GA 4IRUB 4PPGA 1JPJA 4RZ2A 3R7WB 2F1HA 3HJNA 4Q18A 3KTAA 2GF0A 2AFHE 3AGPA 3X1ZA 1E2FA 1TEVA 4Q7MB 4Z8YA 2PCJA 1VG9B 1Z0KA 3LNCA 5KUTA 2J7KA 3DZDA 1RE0A 2D2FA 3K9LA 2J1LA 4C0HA 3H84A 1QHXA 1XU4A 3U5ZB 3PV0A 2XB4A 3V00A 3X1WA 2XTZA 3G5UA 5IT5A 4AD8A 3CF6R 2ZYVX 4G5SA 2CXXA 3SBDA 3MRSA 1ZM9A 2BMDA 4DLYA 3UMSA 4DCNA 1NY5A 1ZNZA 2D2EA 2GDJA 1OYYA 2YNMA 4JBXA 3SYKA 3IIKA 3FPAA 1Z0DA 1YJ5A 2YWGA 3BE4A 4O2LA 4V0KA 4IDPA 1KDOA 2AX4A 1UBEA 1OPXA 4B2PA 2QG6A 1D5CA 5JBQA 3THYA 1UBGA 4JBYA 5DYIA 1GRNA 1GILA 3L2OB 4TSFA 4A2WA 1TQ2A 4ZDJA 1A1VA 2B7BA 4QXAA 2ERYA 1FUUA 2QUZA 1WQ1R 5DN6A 4OQLA 1TQDA 3T12A 4H1VA 1SXJC 2DFNA 1GITA 4AKEA 1F5NA 2GJKA 3AF3A 4LJAA 3NC0C 4BFSA 1E2DA 4YMUA 2XJ4A 4WA7A 5AJWA 1VECA 4ZCLA 2R65A 1YRBA 5KNDA 1SHZA 4G0NA 4DLVA 5CDFA 2DFKB 5EE3A 4V03A 3Q3JB 3DOEA 4UNQA 5FOUA 3CM0A 2GILA 1AQYA 3N2EA 4M53A 1YU9A 2NO9A 3NXSA 1J99A 1Q1QA 1M7GA 3KKNA 2P67A 4ARZA 1G64A 4V0LA 3RS0A 4BFXA 1XPUA 3RC3A 1JPNA 4Q48A 2ZSFA 1XEXA 4RY2A 3W9YA 5CB6A 3CRMA 2C8VA 1I4DD 5C1BA 1AGRA 1ETUA 3ZZ0A 1N0UA 2AN9A 1W7AA 4P4SB 2RHDA 1H65A 3WRXC 1AA9A 4BLRA 5JS7A 1IN6A 2A30A 3C4JA 4IDQA 4LYJA 3CX7A 4L5BA 2NQ2C 3ONWA 3VX4A 2ZYTX 3EX7C 1W4AA 2W00A 3I5XA 2O8CA 4QG7A 4XSGA 1NL3A 4LC1A 2HJGA 1Z0IA 2QORA 1BH2A 2YWEA 2ZRCA 3D6TB 3EAQA 3QPUA 3HR7A 4PAMA 4BUJA 1P72A 5FL7D 2J3EA 1U0HC 2OLKA 2WKRA 1PUIA 1GL7A 2JAQA 4OQMA 1PLJA 1RKBA 2VRWA 2WWXA 1NSFA 1Q20A 5IK2A 4A2PA 1NKTA 1X1SA 2JASA 2ODBA 2ODEA 3B6EA 3M0EA 2PBRA 3BB1A 4JT4A 3KQKA 3MD0A 3QVVA 1E4YA 4ZI3A 3FB4A 1VKJA 2IUSA 1Z6TA 5GJCA 4D80A 2GF9A 2WHXA 1E6CA 1MOZA 1W0JD 2IYVA 5CB8A 2QEQA 1AQUA 1UDWA 1E96A 1A5TA 3BH6A 3KQUA 1DAMA 3EPLA 1XP8A 3WYGA 4LBVA 5GJWC 4BPBA 1JAIA 1KKMA 3GFTA 5KSOA 1RYHA 4DLZA 2G77B 2EU8A 1UKYA 2V7QA 3P4XA 4K46A 4Q19A 1QHIA 5IRCD 1J90A 1FP7A 1VDZA 3SZRA 1L4UA 2ZR7A 4CT4B 2VSOA 3QSYA 5JCZA 3EC1A 2QAGC 3DMDA 2IEZA 4V0ME 3WP0A 2Q3HA 3OEHA 1UKVY 1S3SA 3I8XA 1Q12A 1F6BA 3I1FA 2WVJA 4ITRC 5LBIA 4B3FX 2WOOA 4OQFA 4WZAE 3MUFA 1ZCAA 4KBFA 2H8KA 3KXLA 5FI0B 4KVAA 1IM2A 1P7CA 2JJ1A 3QENA 2BBOA 1TEXA 2P0EA 4LCBA 2F1JA 5JFGA 2QE7D 4CW7A 1M6NA 1QHHB 1SXJE 2WJVA 3CRRA 3TSZA 2YZ2A 1IN7A 3I32A 5CIWA 3TH5A 1KI3A 1FTNA 3IHLA 3KL4A 4M0LA 3T35A 5JI2E 1G3UA 3U7FB 3IO5A 2H18A 2ZJAA 2J0SA 2QTFA 3ADDA 1Z8FA 2AKYA 2NZJA 3FDIA 1EFTA 1W44A 4JL6A 5J4LA 1KO1A 1WF3A 4FI3C 2WICA 1KI6A 3I72A 3KUDA 2NMVA 2R2AA 3DVLA 3F8TA 3THOA 3WNDA 2BBSA 2WV9A 4HAVA 4IVPA 2REXB 1FOEB 1E9BA 4PC6A 1W0KD 1K5DA 3SE0A 4M22A 4HB3A 4B3CA 2IK8A 3FVQA 1NVVQ 2FA9A 3KKPA 4PC7A 4RJLA 1AZSC 1Z28A 2AXNA 3ND8A 1GNQA 2GWHA 4P31A 3PXGA 2V4ZA 4YMSA 3Q7QA 3THXB 3O47A 4OHZA 2V55B 1W48A 3P27A 1XBTA 2PCLA 2VHUA 2ZM5A 1PZNA 3RC8A 1ZRHA 2J41A 1OHHD 1U8ZA 4TYPA 4URYR 4OHYA 1GRRA 4RD0A 3GLIA 3CNNA 2EFDB 1OH8A 3R9IA 3MCAA 4E22A 2QRZA 5DHFA 5KSZA 3C7KA 5FOTA 3EG5A 2OFXA 1VMAA 2BCJQ 1XTIA 1ZM2A 3I73A 3K0FA 1ZU5A 2XXAB 1G41A 2O0JA 2PLRA 4C4PA 5K8IA 3GP8A 3C15C 3WP1B 4YC7A 2UVQA 2R6GA 4TLAA 4B3XA 2YHSA 3NDBB 3QBTA 5DLQC 2QNRA 4ZDIA 4UNNA 3WXMA 3VNVA 2V54A 1E1RD 1FFHA 4BWYA 4ZCMA 4B32A 3FHTA 2BM0A 2KJQA 3A1TA 4URUR 2NG1A 1GFIA 1KIMA 3TGPA 1VHTA 2EFEB 5C4GB 1WP9A 3MGCA 2GKSA 1ZNYA 3LW8A 3X2SA 1FX0B 1H8ED 1G291 2GESA 4GOXA 2QENA 1VYTA 2H7VA 5JHGB 1G7TA 1T3HA 2GXQA 1XD2A 3QF7A 2N46A 4Q7LA 1R7RA 1XJQA 2HEIA 3SJBA 3U7HB 4CEJA 4C2UA 4GMDA 2QGNA 5L3QA 4O2RA 3FFBA 4D0GA 1F3OA 3QQ5A 2QTHA 3RWMB 4DVGA 5SZJA 1I4TD 1W36C 3H1TA 2HYIC 4QM7A 2QA5A 2JLVA 4LX0A 2FFHA 1E79D 2PZFA 2J7PD 3D31A 1E9FA 3RS5A 3CX6A 2ZRKA 3Q85A 1T8UA 4R71A 4JLDA 4TL6A 1QG2A 4TYNA 1ZMXA 3AB3A 3EZFA 4ACAA 4B6FA 5EE5B 4N1AA 5TY0A 4JLJA 4QHSA 5FH9A 2NO7A 3QG5A 5JCPA 2G88A 4EFLA 3NTUA 4JT2A 4NHOA 4D4MA 1ANKA 3UATA 3WMEA 5GADl 2OE2A 1SXJB 3CPHA 1G4AE 3EWSA 5JJLA 4Q9KA 4L15A 2ONJA 1T3LA 2ZU0C 2D7CA 2ZJ5A 1P2TA 1L8QA 2ZU6A 4M4SA 1XPRA 2V9PA 4LJ7A 3AVVA 4HEJA 1N2CE 3M4YA 3RSOA 4DKXA 4MYCA 2GZDA 2NO6A 2IYWA 1NN3A 4QFMA 5CYPA 1KNQA 3A58B 2IYUA 4DB4A 2SHKA 1D2MA 1US8B 3NBXX 4R7ZA 4B3GA 1P61B 4DBLC 3A6PC 2OM2A 2OUKA 4IKEA 4KLNA 4QL3A 3SNHA 1KYIA 3X1XA 1JXMA 2KBFA 2CVHA 5BW8A 4A0RA 4AKIA 2ZYWX 3CUEF 4HAZA 3WYAA 5HKKA 2C2HA 4BLOA 4XTCS 1HE1C 3IKJA 4L9WA 3IO3A 4HUTA 2IL1A 4POAA 2B7CA 1AS0A 4YMWA 1LF0A 2RGDA 4MH0R 3K70C 1T5IA 3QXCA 1PUJA 4YLGA 4L8GA 4LJ6A 1CKEA 1VHLA 4AYXA 2ZS9A 4ZI2A 1OXSC 4RVCA 1Q22A 2FFBA 5AJZA 2ATVA 2JATA 4LC0A 2RH5A 4PHFA 5EUQB 1TMKA 1R4AA 3TNFA 2FSFA 3KB1A 3THWB 1CS4C 1M7BA 2ZRLA 3W3AA 2YV5A 4PX9A 4YONB 4LJ8A 2IX3A 4XWOA 3TR0A 4KAXA 3PUWA 3CNOA 1NNEA 2QQEA 3WMGA 1SKYE 1GKIA 1C4OA 1VIAA 1DAKA 4LJ5A 1QG4A 1D6JA 2QP3A 3RDPA 3JZMA 3KDSE 1MV5A 4EQ6A 2VHQA 2H57A 1S96A 5CJPA 4QRHA 4CEHA 1X8JA 3X1DA 3CIOA 3MWJA 2J5XA 2O5VA 1BYUA 4P33A 5DISB 4K81B 2AD1A 1XB2A 2YJTD 3QJYA 2GJSA 1IN8A 2ZS8A 4JVLA 1D8TA 3J81k 2QI9C 2ECKA 2QAGB 3HDTA 1VYUA 2XZLA 2GAAA 1HQCA 2IYSA 1JR6A 2B8TA 1IXZA 5DH9A 3ZZUA 3DO6A 3K0AB 2QZ4A 3RS2A 4B48A 1E9AA 5A5GA 1AS2A 1XMJA 1Z29A 1OT3A 4KFTA 3BJIC 4TLEA 1P5ZB 1S3GA 2J0UA 5DE3A 4JJZA 1SVOA 2ORWA 3B1YA 2CBZA 5EP3A 4YMTA 4ESHA 2QN6A 2V8OA 1FP6A 3MG9A 5FPKA 3LXXA 1SVMA 4PZLA 2W2XA 4DLRA 2RGGA 4NTZA 2QTVB 3BD9A 4TZ0A 4TMKA 1DAFA 2BJWA 2VH5R 1O3YA 3GJ6A 2ZRBA 2C9OA 3P32A 2Y8EA 1KAGA 2IS2A 5DNYB 4HAXA 1ZCBA 4LV6A 3C5HA 3LAWA 2WWYA 3SI7A 2CJWB 2H92A 2YOHA 3VKGA 4NL4H 1YZUA 5G3ZA 2D62A 4A1FA 2FF7A 1LB1B 1DO0A 2JLRA 1IJEA 3B13B 1XJCA 3QEOA 1OIXA 2BMFA 1Z0AA 1TTTA 4C0JA 2O8DA 3IBYA 3TAUA 1QVRA 3EASA 5M04A 2HDNB 2JLSA 4LJYA 4EJSC 1OW3B 1T9HA 1ZBDA 1JR3E 2ZI6A 3UXMA 4E09A 1TUEA 4RD6A 5AJYA 3LXRA 1A7JA 2V1UA 2ZRAA 1R6BX 4M2LA 3SJCA 4GI7A 4Q4AB 1A82A 3VR6A 3QKRB 1JALA 5FPYA 2R9VA 4HSEA 3OIVA 1X86B 4JJKA 2Q9CA 4M1OA 3VQTA 2I1QA 1C9KA 1DG3A 3IGFA 1E2IA 2VF8A 4FCWA 4IDHA 1E2HA 1NN5A 3U2QA 2XX3A 2C03A 5KTYA 1KMHB 1XEWY 2FFQA 3SYLA 1J8MF 3QG1A 3IHWA 2W0MA 2ZRHA 2GEVA 4M8NE 2DWPA 3OAAD 2DPXA 2HLDA 4LJ4A 3TVTA 3ZDQA 2ZRJA 1G7CA 1DADA 1G8PA 1ZUIA 2Z0MA 3A1WA 2G0TA 3ASYA 1X8LA 4JVMA 3P26A 3H86A 2ZTSA 2ANCA 4MGIR 1H8HD 3W8RA 3QEJA 2ORVA 2F3TA 5DI3A 2WJHA 1JAHA 4IEIA 1G3QA 2PZEA 5JHHB 3QVUA 1SKYB 3SQXA 3QPVA 1N5LA 2E1RA 3T1VA 2C96A 2FDCA 2IS1A 2ZREA 1U2RA 5CYOA 4QBFA 1Z06A 1TU3A 4C0AC 4Y0AA 2GXSA 2ZE6A 4KFSA 3V4RA 4HDCA 4LYAA 2ZVQX 4DEYA 1W36B 2B92A 3DOFA 1HTWA 2O8EA 3UIEA 3QUSA 3VR1A 4UNPA 2R6AA 3EW9A 3TK1A 4J0QA 1Z63A 3PUYA 2E9SA 3CW2A 3IUYA 3PEUA 4Q5IA 2X2FA 3W90A 1OB2A 3GFOA 3ADCA 1OFHA 3CLVA 4YDHB 4DJTA 3PENA 3MWLA 1M8PA 1CJTC 1J8YF 1YRAA 3VU9B 1ZYUA 1HT2E 2BKUA 4CVNA 4GFDA 3UMFA 3DM5A 3SFVA 4LGMA 3CNLA 3N5CA 4AI6A 5F98A 3HPQA 2JLZA 1KSFX 5EP4A 3VKWA 2A5GA 3VR2A 2IT1A 1IAQA 3B1ZA 2H17A 3IIMA 2DWQA 4MA4A 2VHTA 3RYTC 1OXUA 3BRWD 2ANBA 4LBZA 5FPTA 2ZITA 4X8OA 5KSPA 4UXJA 4MKFA 4PQRA 1QHGA 2OHFA 1N25A 4ZIRA 2IA5A 2ZETA 3QY0A 2IUTA 1GIAA 1YR7A 2CMKA 1W4RA 2IEYA 1E69A 4IHQA 4Z1MD 3GEEA 2BMJA 1DPFA 4ZPXA 1OXTA 1MT0A 2AWOA 2ZJZA 3GFPA 5D3QA 1D2NA 3QKSB 2WSSA 2FX3A 3BH7A 1AZTA 3MAAC 2O8FB 2V1XA 4CYMA 2AXPA 3DHWC 3PUZA 1N3BA 1NVXQ 3T34A 2QBYB 1E1QD 3R8FA 1Z0FA 2J9RA 2WM9B 4TL7A 1E99A 4MYUA 4UNSA 5SZHB 1G20E 2ZUCA 3UMRA 5JEEA 1MRSA 1P2SA 1MO6A 1BIFA 2PMKA 2JGNA 4MKGA 5BQ5A 2B6HA 4AYTA 4XD7A 3K53A 4A82A 2FPLA 4JLVA 3BWDD 2XNDA 2YYZA 3D8BA 3KQLA 1IJFA 4CT5A 3NH9A 1NIJA 4P32A 3ASZA 3ND9A 1IONA 1Q44A 2XOKD 3LBIA 4DHEA 1GKUB 4P4TA 1KI1A 1KJZA 4KI0A 3QNUA 4TZ6A 3AP3A 3EIHA 5AJVB 3PQCA 5LB2A 4NCHA 4HUQA 2CL6X 3AH8A 4OK5A 3TQCA 1Z6AA 3R20A 3MMPA 1TL7C 1G9XA 1KTVA 2A9KA 1ZVQA 1MO5A 3TMKA 5FR2A 3TBKA 3SJAA 1XTSA 1R5NA 4MGKR 2WWWA 2W6JD 4HZUA 2JDID 2AHOA 1I2MA 3R8CA 4C0BA 1II8A 1Q1BA 1P4SA 3HU2A 1EX6A 4C7OA 4FWIB 1S2MA 1Z6GA 2HUPA 4RFVA 4LUCA 4DUGA 2P6UA 3T15A 3GLFA 4B2IA 1KI7A 1HY3A 4D0LB 2D4HA 2E87A 1RJ9B 2IXGA 3BORA 3GLHE 1XTKA 4NCIA 1NMXA 4Q4HA 4ACBA 4NYMR 1JNYA 4B34A 2KB0A 1AKYA 1L4YA 5FBVB 5AJXA 1Z07A 4DDVA 1Z08A 2FEOA 3A36A 2PT7A 4FINA 1CJKC 4IVRA 5JSZB 5A4JA 1E2QA 3TLXA 2XB2A 2IXFA 1DS6A 1Z3IX 2OBLA 1VIYA 2CE2X 2ZRPA 4OJQA 3O8CA 4ASUA 1YE8A 4JKIA 2XTMA 5J47A 4URXR 2QSZA 3ETLA 3KJEA 5FBRB 4U5XA 4XJXA 2G9NA 3K0CC 1MABB 3QF4B 1KAOA 4MYHA 4E5UA 4Q47A 4R2HA 4JMPA 2BOVA 2KWIA 1F2UA 5JJIA 2UKDA 3CF0A 1G6OA 2R6DA 4OL0A 2BMEA 2VBCA 4AIIA 2J87A 3U3OA 4MGYR 4DLSA 1SXJD 4EJSB 4JLBA 1OFUX 3Q9LA 1F2TB 4XWAA 4CEIB 2G1JA 3ZYCA 3ZD6A 4LSGA 1DE0A 5EE9A 2OEPA 4YXWA 4D82A 4ZDKA 2Q9BA 1KO4A 2GK6A 3SOPA 4F7WA 2GXAA 2PZGA 4TSFD 1RIFA 2DBYA 2WJGA 1VCOA 1SVKA 4I1OA 4NBSA 5G40A 1ZM7A 4LZZA 5B2ZA 5DN6D 2CK3D 4QGFA 4LY6A 3K0SA 1UBFA 5H68A 4A0FA 1P73A 2O8BB 4FCVA 4W5HA 4QNMA 2CLCX 3W6OA 1KO5A 4RFSA 4A6PA 4DT1B 1V43A 1X3SA 4LRWA 3PEWA 4PO8A 1W2HA 4QBGB 4QBIA 4JLKA 5HTKA 1S8FA 4JLPA 1T3SA 3BFKA 4MYTA 1VPLA 1P3JA 2PEZA 1E9EA 1TF7A 1Z47A 1SKQA 2H1LA 2PMDA 5HPYB 1FMLA 1RZ3A 3SQWA 1NVUQ 4FWTA 3S1AB 4LHWA 3GMTA 2XSZA 1EFRD 4F4IA 1XFAA 3GJ3A 3MWKA 8OHMA 5D3MA 2F43A 1W47A 2BDTA 5TB5A 4BGDA 1QF9A 2ZE5A 5J40A 1YZGA 4PPFA 2NO1A 1XD9A 4TQ9A 4PHTA 3NBYC 4M9SA 1PLKA 5KHOC 3LLMA 3VNUA 3O8DA 4D26A 1IXRC 3RAPR 4URVR 1CRPA 1N5IA 1YR6A 2PX0A 5HZKA 2NPFA 1VG1A 2WWGA 2P6RA 2OBMA 2HV8A 2YC2C 1CR2A 1OF1A 3VKHA 2OAQ1 1X8KA 4OK3A 3UKDA 4Q21A 3X1YA 3E5HA 4TT3A 4FMBB 4C0QC 1J7KA 1ESMA 4PZZA 2EW1A 2P3SA 3GLHB 4PQYA 5IK2D 5E7IA 5FL7A 1DELA 3ZGXA 3W6PA 1G3IA 3AVWA 2OG2A 1DO2A 3UK6A 2ODNA 2RMKA 3U44A 4ZO4A 5FUXA 3EZ7A 4QC2A 2BCGY 2OFOA 3B1VA 1KDPA 1K8RA 4QJ4A 3KKOA 3TSOA 2IYTA 1W0JA 3PVSA 5L3SB 1XXHA 1UF9A 2WWFA 1T91A 4U00A 2V7QD 1LTQA 1JXOA 2IC5A 4GPTA 3A1VA 4LJ9A 4P0TA 2ZSBA 2ZAMA 3P1JA 4Q4JA 5DIFA 1DBSA 3SR0A 1TNDA 4F38A 3OEHD 2F9MA 2BHRA 4BFTA 3AQ4A 1XJ0A 4LV5B 1ZJ6A 3B2EA 3UG7A 1XDBA 3U4QA 4BFWA 1YR9A 1KJYA 3LH5A 2WKQA 3DDCA 4B71A 5KDOA 4RD1A 2ZE7A 1GP2A 3MLEA 2A5JA 4IW3B 2GCOB 1HQYE 2NO0A 3T5GA 1CJMA 4Q7KA 4W9MC 3HP1A 3ADBA 1GAJA 1KSJA 2QE7A 5AK0A 5J4KA 3BFVA 1TUIA 5GJVC 2IYRA 2RAPA 1HH4A 2CHGA 1SQ5A 4GZMA 3Q5EA 1DARA 1G8YA 1KK0A 2ERXA 1HV8A 1KI8A 1M2OB 4RD4A 2VP0A 1OV4A 2J59A 1OB5A 2CL0X 1CJVC 2IW3A 2QMUA 3VR3A 4TTQA 1N6OA 2FGJA 3OFND 4Q00A 1KSGA 2ZEJA 2ZANA 4IFEA 3BK7A 3VR5A 5CDFE 3A8TA 1U99A 3D7MA 4QGGA 1BYIA 2GRJA 3NWJA 4JKYA 1K6MA 4BQSA 5JS8A 3W6NA 3TUIC 5A0FA 1E9SA 1ZD8A 3F0TA 2GHIA 1D9ZA 2QRNA 2WJIA 4LPKA 4Q01A 2R6CA 1N0WA 1S4QA 2MSCB 3B5JA 4JYCA 2Z4RA 5BN3A 1GRQA 2VHCA 3EPJA 1E0AA 3B85A 1FUKA 4II7A 4W5JA 4RZXA 3EPHA 1Q3HA 2ZI9A 1P9NA 4GT1A 2ZSDA 3VHXA 1KO8A 4N0DA 1OHHA 2W83A 3BERA 3QI2A 2ZRMA 1U90A 1OKKD 4KCGA 4AG5A 3SHWA 2GZAA 2N42A 2IBMA 1DAEA 3W8NA 1E2MA 4M9XA 5SZIA 1VYVA 4FW9A 2WPDD 1W36D 1L2TA 1CF4A 2CE7A 3TUJC 1AS3A 3QOFA 5FI1B 1E98A 1MH1A 1TPZA 1S9HA 2CDNA 5FOXA 3RWOA 2A5FA 5HR5A 5JMTA 5AUQA 3TW8B 6Q21A 4QM6A 2B8WA 1W5TA 3WHKA 5GVSA 1PJRA 3MJHA 1UADA 1KZGB 1N6PA 1II9A 2AD5A 1F48A 3W5JA 1GKYA 2IXEA 1BMFA 2V6IA 3A1SA 1CLUA 4QJ3A 4NCKA 4LYFA 2XGJA 1E3MA 3HU1A 1P60A 4TMXA 5EXSA 1KY3A 1NSTA 4E03A 3L43A 4G01B 4I1VA 1ZIOA 3TIFA 1NBMA 3PR1A 4TTRA 1WMSA 4TQAA 2WIAA 3AVQA 3KTAB 5FBLB 2XTNA 1WGWA 1CTQA 2C04A 3E1SA 3FKQA 3T06B 4NCNA 3TUZC 2UZ3A 3H4MA 3VMFA 3GLGA 3IPXA 3G82C 3UANA 4B43A 4KSCA 2RGBA 3M6AA 3CWQA 2F55A 1W46A 3ZVNA 1YZKA 3CRW1 2Q9AA 4TL8A 1Z2CA 1DAHA 1MRNA 1NLYA 2ZVPX 5G41A 4F93B 4WW0A 1CULC 1DEKA 1NRJB 3BH0A 2BIFA 2CVFA 1GG2A 4DIDA 4DSOA 3THYB 1E2EA 2OO7A 1TAGA 4OYHA 4F4JA 3PIRA 5KO2A 1SZPA 1G7RA 3ZJYA 4W7SA 4V0OA 5FUWA 1JR3D 3EZ6A 2Q0HA 4AYWA 2F6RA 4NPHA 3F5FA 2Q3FA 3AF1A 4PPQA 1FMJA 3CH5A 3SS8A 3K70D 3ZIAD 2AKAB 4C0SA 1CEEA 3ECCA 2CCGA 2RKOA 3CRQA 5FTMA 2OT3B 3RS3A 1Z22A 4BE7B 4EPTA 4LOAA 4HB0A 2P65A 5TMPA 4GBMA 4JVSB 1IY1A 5JRJA 1J2JA 5C2JB 2DYKA 1G8GA 1NVWQ 1P9RA 2WBLC 4M1TA 1RC8A 1CP2A 3V9PA 1SVSA 3IPYA 5GVRA 4JLOA 2JIZA 4ARZB 2WMNB 3EA5A 3NVAA 5UKDA 1GL6A 1MO4A 2QT1A 4DWJA 1XEXB 4M21A 5E3HA 2AR7A 1A4RA 2Q6TA 1IOZA 4A8JA 3PG5A 2ZAOA 3JVUA 4TYQA 5JJKA 4UQOA 4MUAA 3IILA 3GLIE 2JA1A 1SVWA 3AVUA 1CR4A 3C16C 5EP2A 2VHJA 4LDJA 2G83A 5EP1A 4ZKDA 2O52A 4LWZA 1XMSA 721PA 1GNRA 4JBWA 4L16A 1GSIA 3WHLA 2O8CB 5JRZA 4HLDA 4NYJR 5F9HA 4O0MA 4OQNA 4US0R 4FMDF 1U98A 1CRQA 4Z54A 2P5SA 1NY6A 3NEYA 3RABA 1IY0A 4IXNA 5IDVA 2HCBA 4QJ5A 2QY9A 2Z83A 3A4NA 4YMVA 4M1SA 5GJBA 4KHZA 3PUVA 4GRAA 4RCYA 4BLQA 3ZVRA 2CCJA 2CCKA 2WTUA 4HZIA 1NN1A 1Q1ZA 1GDDA 1X6VA 3OE7D 4HAUA 1EGAA 3CR8A 4WIAA 3B9PA 1TF5A 2FJUA 3QXXA 3AM1A 4TMWA 4NMMA 1OLOA 2ZIAA 3QXJA 2D3WA 2F9LA 2YKGA 4D4JA 1II0A 3DKPA 3RRZA 4DCTA 1LVGA 1NJFA 1WCV1 2MMGA 3R7WA 5J4HA 5FTJA 2RGCA 3GEIA 2FWRA 3SJZA 4FD2A 1ONBA 1E2LA 2ZI4A 3KXKA 2VEDA 2OLJA 3GJXC 4X8HA 2LWIA 1N5JA 2GA8A 1EESA 4QOSA 5KNBA 1OH7A 4BFUA 4I81A 4KSBA 2IS6A 4ON9A 4F4CA 5K8UA 2FGKA 1KI4A 1E2KA 3FKSD 3LLUA 2DR3A 1XF9A 2QL6A 3C5CA 4YDSA 621PA 3R9XA 4FCTA 4BASA 3BGWA 5FTLA 4GNKA 1WXQA 4OKSA 1KSHA 3LVQE 1OE0A 5FBWB 2ZSAA 1KK2A 2W6IA 4Q9HA 1JEEA 4IDNA 4PSKA 2VQSA 3FFAA 3B9QA 3RRMA 3G0HA 1KI6B 2FFAA 4N3NA 1Q3TA 5C18A 3LW7A 4NYIR 4TN1A 4M1WA 3M1IA 2HF9A 2C5LA 2WOJA 4HLQB 2PL3A 5FPHA 1U8AA 2ORIA 3PEYA 3FGNA 4C0LA 5BN4A 1J70A 3UG6A 4TMVA 3W3ZB 1HURA 1N6LA 4C9BA 2WJYA 4ERNA 3TRFA 2ZR9A 2HLDD 5F9FA 2D7DA 4URWR 1UJ2A 2HT6A 4MKHA 3LX8A 5BXQC 3GLIB 1UAAA 4KFUA 3LRPA 2EYQA 3L0IB 4AG6A 4EKDA 1JJ7A 4DSUA 3B1XA 4TYYA 2AK2A 4MQBA 4PTLA 4P4SA 4B33A 2NGRA 3FMPB 3V4FA 2WSMA 3H2YA 3K0FB 5EE0A 3I62A 3AVXA 2ZRDA 1H8HA 4IOJA 4HAWA 2NPIA 4WZBE 4I99A 1QBKC 2RGNA 3B1WA 1G5TA 1TX4B 4MGZR 2FN4A 1NP6A 3ZVLA 4QBHA 4BLTA 3DKVA 2YOGA 4M1MA 5AUNB 5KSYA 2W2VA 5HCNA 4URZR 2FV8A 4S35A 4ESVA 5J4VA 3ZQJA 4A2QA 2EYUA 1XD2B 4CEJB 1XPOA 2IHYA 3C8UA 2VP9A 1WE2A 3OIYA 5L3QB 3OEED 3Q72A 3JZAA 2J0QA 4I4LA 2RGNC 2VPPA 3W5IA 4JZKA 4MDFA 1UBCA 3TAHA 3CZPA 3GQBA 2Z4SA 1T5LA 3OESA 4LYHA 2BWJA 2RHMA 4BEBA 4G5OA 4BZXA 4B76A 1XWIA 1GUAA 1S9DA 1Z83A 4JIMA 2IWHA 2BEKA 5JECA 3U6BA 1COWD 1XTQA 2A5YB 2ONKA 2ZS7A 5FBQB 1KMQA 2C98A 2O0KA 2ZJ8A 4WOPA 1QRAA 1IHUA 1ODFA 4XH9B 5TARA 4XVRA 3UWOA 4PSVA 4LBYA 2REBA 3Q8XB 2WKPA 1XCMA 1QHHA 1IY2A 1WRBA 1ZINA 2HJVA 2JLQA 3HU3A 3LBHA 3GJ5A 2JJ8A 5BYJA 4KU4A 3PCRB 2OCPA 5DI9A 2WWHA 1BOFA 1R0YA 4I1SA 2ZE8A 2NOAA 3I92A 1T6NA 2EWWA 1NIPA 4Z1MA 3SN6A 5JI3E 4BLPA 2Z43A 2HYDA 4CRWB 3K70B 4QGAA 2GJ8A 3GJ0A 4NONA 4Y0VA 1CU1A 2YWFA 1TF2A 4B2LA 4Q9IA 1UPTA 2ZRIA 1E1QA 1RYFA 5ANRB 4KITB 4JLMA 4NKRA 1LW7A 1RW4A 1UEJA 1U0JA 2QGZA 4OHXA 1I2DA 2TMKA 5HE8A 1HUQA 2QROA 4XD7D 1ZC4A 2W0SA 1DVRA 4QNRA 1FW6A 4WVFA 2VSFA 2XNDD 4TL9A 3EA0A 4C0KA 4C3ZA 1QHNA 1D9XA 2HCJB 1CXZA 5FL3A 2LKCA 2ZXUA 1U9IA 3AF0A 2CNWD 3THXA 1GM5A 1TQ6A 1NG1A 5F2EA 4NH0A 2ZYUX 4HDOB 2QPAA 2HT1A 1HYQA 2HXSA 3DM9B 4DIEA 1AJEA 3I3SR 4EPRA 4NE2A 2XOKA 1T0JB 5EZ5A 1YQTA 3FE2A 1KZ7B 1KK1A 3SFZA 2ZJ2A 2D74A 2H16A 4Q1FA 2YOFA 1M7HA 2ATXA 4RZUA 1MO3A 4TMTA 2WWIA 2X77A 4H9GA 2VF7A 4A6XA 1S1CA 3PJRA 1M34E 1TADA 1EWRA 3WNBA 1F60A 4JS0A 2JJ2D 3O8BA 3BC1A 2XXAA 2RGEA 2J46A 1G3RA 3CB4A 3OZXA 4WBSA 2FPMA 4H1UA 3REGA 4DLTA 2QAJA 1Q0UA 4HDQB 4PQFA 4EQ6B 4D25A 1IQPA 2W6JA 4CEHB 3LFUA 4DCUA 4D4KA 1GVNB 3Q5DA 4NZYA 2IYYA 5EXPA 3EC2A 4AC9A 3AKCA 4KLZA 2L0XA 2NIPA 2FZLA 3PFIA 1N6KA 1FX0A 4Z51A 2FSHA 1E2GA 3L0OA 2FOLA 1ELOA 2XEXA 3WBKA 5KYKA 1XCPA 1BS1A 3DL0A 1K5GA 1EG7A 4Q1BA 4PR0A 4B35A 3B82A 3L82B 5B30A 4PFSA 2P2LA 521PA 3LV8A 1NKSA 3BB3A 4NYMQ 3QKTA 4IOLA 4DSTA 1OFIA 3PITA 2JLWA 4WXPA 5L3VA 1B0UA 4GOJA 2J0UB 1IXSB 3K9GA 4CIDA 3BIFA 2OAP1 4D6PA 5H8WA 2FEMA 1RRGA 1N6HA 2VSXA 2DWOA 2VLIA 5L8VA 2X8AA 2F1IA 4F92B 4V0MA 2GVDC 3LD9A 3CO5A 1DAGA 1G7SA 1R8SA 1FNNA 3AP2A 3TKLA 2X1VA 3JVVA 2PEYA 4Q1CA 1G18A 1LY1A 4FXPA 4HAYA 5E4FA 5CLQA 1AK2A 5LDDC 3FHOA 4OI4A 1N0VC 2HF8A 4NCJA 1SXJA 4DC9A 3RNLA 4YXWD 4PC1A 2RCNA 3NHAA 4I1UA 2C95A 2QMOA 2O8DB 3ADKA 4RKFA 3ZVMA 3B8HA 3TJZA 3EIQA 3ZZTA 4D81A 1R0XA 2CL7X 4JSYA 4EDHA 3BB4A 3DPUA 1OXXK 4MRVA 1US8A 2QT0A 1E4VA 4PANA 1FZQA 3U7EB 4DZZA 4IJMA 1OYWA 2WAYA 3NBFA 2CK3A 1Z2AA 3U7GA 1ZM4A 3E70C 3SYNA 5B64A 2ZROA 3EARA 5BWMA 3MWYW 2BBTA 3KQNA 2QMHA 3FWYA 1R0ZA 5E7JA 3TVDA 221PA 3CR7A 3AVYA 5B58C 4TTPA 2XSZD 4CZ2A 2P6NA 2J45A 1P62B 3TQFA 4KVGA 1JI0A 4PSAA 4GP7A 3VTKA 1Z6YA 1WBBA 4GL2A 1EFRA 2DFLA 1RRPA 3AEZA 3WNCA 5DI3B 2WIBA 4EFMA 2OSBA 1ZD9A 3CONA 3THWA 3A1UA 1JEDA 1QHSA 2DCUA 4Q1EA 4E07A 1CR0A 1HA3A 1RFLA 1GZSA 1G17A 2G1KA 4FN5A 4LV8B 4RD3A 5DO9A 2PLFA 4OI2A 1G3MA 4G5GA 3CWZA 1FL9A 4P3YA 2WJJA 2IF2A 4TT3D 2IS4A 2A7QA 1ZW6A 3IDQA 3GLFE 4BFYA 4GOKA 2OCAA 3KJGA 3T1QA 1BKDR 3KQHA 1N5KA 2O8EB 5AUPB 5LPNA 4MUBA 1XD8A 3RANA 4DXAA 1NLZA 3AP1A 4OJKA 1KGDA 1G1MA 1R0WA 2ZRFA 1S1MA 4US1R 1E2PA 1G4UR 2QSYA 5DHAA 5CITA 3RSLA 2QAGA 1XCGB 1CJUC 4Z8XA 5FUYA 4MRNA 2KSQA 3E2IA 2EWVA 2VIIA 3K0AA 1OXVA 1ZNWA 3AKDA 3CF2A 3FHCB 421PA 1P75A 3T1TA 5EJEA 4IOKA 2GXUA 1Q21A 4MRPA 4Q02A 2QP4A 1YKSA 3L0PA 1LNZA 3ZH9B 1GOTA 3FYHA 1G19A 1XX6A 5CIQA 2JJ1D 2OESA 1A2BA 3WY9A 2YINC 4JLNA 2WAXA 2HXYA 4ZIRB 4ZKEA 1XEFA 2VP6A 3TSWA 3FMOB 1E9RA 4PO9A 1VTKA 3GPLA 1U94A 2CEAA 3KZ1E 4FMDB 4JVNA 4BRUA 2RGXA 2QM7A 4UKDA 1Y63A 2QPOA 4AY2A 2XITA 1YZTA 4Q66C 2NTYC 4WZ6A 3HYRA 2CJWA 3KJIA 4LK2A 1FTSA 2BV3A 5HE9A 3QE0A 4AKGA 4LBWA 1G16A 2OXCA 1ZUHA 1U81A 5CK5A 3CZQA 3I61A 1NVVR 1NMZA 1P2VA 4ZDWA 4FMCF 1E0JA 1AN0A 3GCGA 4LHZA 5EXXA 4Q9JA 5L3RA 3EZ9A 1G6HA 1Z5ZA 3U3KA 1W5SA 2GJAA 4PAOA 5AR1A 4Q4AA 2JCSA 1V5WA 3QKRA 2BKEA 2IWRA 3OFNA 3GJ4A 1KJWA 2YC4C 1W0KA 4LHYA 2FH5B 4HYYA 4HATA 2VP2A 3CPEA 5FOVA 3KX2A 5ELXA 2GTPA 1RVDA 2PJZA 3CRVA 3Q7PA 1LV7A 4RCZA 4A9AA 1KMHA 5P21A 2ZRNA 1JECA 2PH1A 2FPKA 4EPYA 2FSIA 4JSTA 2ZSEA 1NF3A 1SVLA 1CIPA 2FNAA 1LS6A 4B47A 1SGWA 2RB4A 4LHVA 4IOMA 4CGZA 4EUNA 4HUQB 2G3YA 1ZIPA 1OIVA 4OHVA 3FOZA 4DLUA 4QKQA 1X1RA 4A0HA 1VCNA 2DB3A 1WDTA 4DRZA 5FTKA 3W34A 3ZLJA 3NG1A 4NP6A 2ZJBA 2GVZC 4KJZA 4B74A 2F3RA 3IEVA 4HZUB 4MITA 4N0EA 2YWHA 3AVOA 2JLYA 1II8B 4C7OB 4TMZA 3L0SA 2VTKA 3LDAA 1YVDA 2KI5A 3AF4A 4KODA 3MJRA 3GLFB 5CM9C 4DEXA 1OKKA 2R44A 4PC2A 3ZQ6A 1E1RA 3AGQA 4Q4HB 5KOYA 2QMEA 3LQQA 2WPDA 2P5TB 1H8EA 5TDHA 3A37A 1T4GA 3AF2A 2ODWA 3SDZA 1W4CA 1XMIA 2I1VB 4JLAA 1BMFD 4W5WA 3I4LA 1DAIA 3N2IA 4US2R 3KB2A 1L7VC 4UXHA 2CLSA 5SZKB 1P6XA 2J0VA 3NC1C 4F91B 4PHGA 1SHKA 1XXHE 1T0HB 4KFRA 3VU9A 3DZ8A 2KBEA 4GMXA 3VFDA 1NBMD 1E9CA 4A36A 4AKHA 3U61B 3ICQB 1EXMA 1E79A 3FTQA 2J7PA 1KY2A 1M74A 4OK6A 3K0EA 3PUXA 3O8RA 1XZPA 4Q03A 3RVBA 1F2UB 1ZAKA 4XVUA 5J4YA 5KPDA 2BM1A 2FZ4A 2QQ0A 2DY1A 1DTSA 1LF5A 3LY5A 1CBUA 4KBGA 3SBEA 1ZU4A 1YZLA 1AGPA 3CX8A 4V0NA 3VX3A 5K8TA 4EPXA 2BVNA 2ZI3A 2OV2A 5JLJA 2BJVA 1KOFA 1Z0JA 1ZC3A 2IUUA 3U3JA 5C46F 1EFCA 1QVAA 2K5UA 5BYKA 1ZM3A 5EXTA 3REFA 2OZEA 5HCIA 3K9HA 3HWSA 1JQJC 3QKSA 2O8FA 1R5BA 3QBVA 1C1YA 1KO7A 3CBQA 4BFVA 1RRCA 2QBYA 1JR3A 2XNSA 5FTNA 4RFSB 4WXRA 3QXSA 1W1WA
chains in the Genus database with same CATH superfamily
5U4XA 4CR7A 5HKKD 1U0LA 2SECE 3VDNB 2QP9X 3LVRE 4GKVA 2WUFA 3DBLB 4GU5A 2EGHA 3PYMA 2IZ7A 3GWNA 1ZOOA 4TV9B 2OVFA 4DDUA 3ZWYA 3N7TA 1YACA 2CC2A 3WYFA 4Q1AA 2AWYA 4ZAYA 4JX9A 4QTTB 4M1YA 3LYLA 2OEVA 3MCWA 2RC5A 1SOAA 4GXNA 4IIBA 4CKXA 2YV2A 2Q5HA 1E2JA 5CT9A 1RQLA 3BA1A 1GXSA 4NPCA 3WLAA 2Y77A 1B4DA 4RIEA 1L9KA 3AETB 3UMIA 2ZR0A 3KKQA 2R8EA 4TRNA 5AI0A 3G17A 3ACCA 3USZA 2E48A 4GSYA 1JDJA 3IEUA 3TTWA 4ZCIA 2HPZA 4CEIA 4LHXA 5ILGA 4NJEA 1V2HE 1U0BB 2Y67A 3LX5A 2LIGA 1A9SA 5EZ6B 3P9PA 5FUVA 1RR6A 2H59A 2O8BA 3FCSB 1T2NA 2P2GA 4RTNA 2XM4A 1U4OA 4NECA 4ZANA 3LY7A 4IYRA 4EFNA 1V16A 5IF9A 1MX9A 5JWOA 3KD2A 5H9WA 1Z16A 1MJFA 1DIOB 4JN6B 1JLLB 2DPLA 2XLEA 1FF9A 4H0NA 3TFWA 1AHHA 2A9RA 4HYEA 3LWNA 4I8IA 2PAAA 4UFPA 4MQEA 1IZYA 1F4LA 4RA9B 2V7GA 1YZNA 2VT7A 2A9FA 4CDGA 3HWX1 1KK3A 3AM5A 1M9NA 1QRTA 2H7YA 1NW4A 1X7XA 1Y33E 4EGFA 4DBRA 2YMPA 5IY5C 4LDRA 2FG7C 3DTNA 3H19A 5F5XA 2ZRGA 4HN9A 2IHKA 2H2FA 4DLXA 2CHQA 2NO4A 4QELA 4ZU1X 4G1MB 5LQRA 3T5DA 1ZUNB 3S2GA 4AIRA 1RYEA 5F5LA 1FNMA 5IKOA 3UMBA 4CJXA 2GAOA 3SQDA 1J4AA 2RIRA 1P6QA 3DW3X 2GZMA 3S29A 4MMXB 4CM9A 5LNK1 4MGEA 1ORIA 3LOPA 5I4CA 2Z6VA 2ZUUA 4B0OA 3I1JA 1LLQA 4ZOAA 1K66A 3T38A 3W04A 3KFXA 1XA3A 1LRJA 3W5AA 1G5IA 5BPHA 2BP7B 3U3RA 1U1EA 1JEJA 2GBLA 2Q6OA 5EIWA 4TWZA 3FDXA 2H1VA 4PACA 4BBAA 1GYRA 3AUXA 1KORA 5BT8A 4O0LA 1FYVA 3UUWA 4PC3A 5FXMA 3WWYA 1S2DA 4FOLA 1I6LA 4EY7A 3AUYA 4E2WA 1KZ4A 1BMTA 4PO1A 3K66A 3R09A 3DJNB 4PK4A 3QMKA 2WAAA 1AM4D 4YL0A 3RH3A 4FNGA 2VXCA 5DGHA 2WFZA 3T1NA 1T9BA 5AT1A 1MC5A 2Q7RA 3GLVA 4HH1A 2LIVA 4F86A 1EUDA 3OUUA 1XNQB 3RSZA 1PG2A 1Y5LA 2Q2WA 1Q0FA 5T3UA 3ND7A 4ATNA 1CZLA 3KVOA 3OTWA 2GNAA 3WBFA 3Q41A 3UC9A 1KVSA 4DCJA 5CVEA 4DJAA 2KQUA 2II6A 3OY2A 3Q0TA 5EE3A 3E1GA 3KYIA 3BN3A 1IBCA 3E4DA 3KLPX 5DBEX 2P67A 1XPUA 4V0LA 3DL2A 4Q48A 3ESXA 5AHOA 4IRMA 5JS7A 2CMDA 3O3CA 1G59A 4LRUA 3N86A 4F7DA 1B76A 4LC1A 2HI0A 4EOGA 4X92A 2QORA 1HBJA 5BQHA 5SV2A 1TWHA 3ZWPA 5FDFA 1MIOA 2I7CA 3B6EA 4QUAA 4BP3A 2IYVA 5LKAA 4KTTE 1WSBA 3OZRA 3H5LA 1XP8A 1QPZA 3P4XA 1KH2A 5DTQA 3NBMA 3A31A 4ZI5A 1RP1A 5ESXA 1UKVY 4FLEA 1CVIA 3PA6A 1IM2A 2Y1OA 3VOSA 4KXQA 3OLCX 2QE7D 1C0EA 1V8PA 3ET4A 3EXIA 2P1AA 3PRYA 5C0OE 1O0SA 1F9AA 1HOXA 3PB3A 1QU2A 1AXGA 4PC6A 4M22A 1AZSC 2TMGA 3A0UA 2PCLA 2HMZA 3RC8A 1ZRHA 2J41A 3ZNOA 3CKYA 2CXSA 3HJHA 4FDUA 3R9IA 2OHIA 4EKWA 8GPBA 4TV8F 3K35A 4OVKA 2O0JA 5TJ9A 3ZGVA 3WP1B 1GSOA 2P4EA 3I2FA 1ULZA 1S6YA 4ZCMA 3OZIA 2CSUA 1HLGA 4XXHA 1E1KA 3SEFA 3RF6A 3RIYA 5MF6A 5KMGB 4O2RA 4KOEC 1E7YA 3LUKA 5K2OA 3UQZA 1LLUA 2QN2A 3AIOA 3IMCA 3RG2A 3OLWA 3ENQA 3JQ8A 4RW0A 2PKQP 5TY0A 4EHJA 4P3NA 4EFLA 1UPCA 1JLSA 4MVJE 4NF2A 5EFZA 4LJ7A 2E18A 1LSSA 2WUGA 1NN3A 1IG3A 1D2MA 1IHDA 3HHEA 1H9TA 2XAAA 1WMAA 5CLGA 1U8XX 4WPGA 2IH4A 4WFQA 2GD6A 2C2HA 3OZTA 1UPAA 2J5QA 4POAA 1ACMA 5TPWB 2C58A 3ZXSA 4DQKA 1JEYA 2PUJA 3B3JA 3L0CA 3ETDA 2XIJA 5K51A 2EBUA 5IMBA 3KHSA 2JATA 3F7MA 1TMKA 2FSFA 1IK4A 1FMVA 2ZRLA 3DE2X 3I52A 1YDMA 2V7UA 1TJ4A 1DAKA 4KMOA 4D9BA 2H57A 3ES9A 2YJTD 3RYFB 3PF8A 4XYGA 2QAGB 1RYYA 4PYRA 4IKPA 4WOCA 3DO6A 4LVOA 3TCNA 1P7ZA 4BGUA 4JJZA 5DNVA 3F3KA 2QM0A 3COSA 3OIDA 3VAYA 2A1UA 3WFJA 3GGPA 4NFLA 4DV4B 4U7JA 4D41A 5ALPA 1YZUA 3WYNA 3GGGA 4N0PA 2BFCB 1YO6A 3POVA 4RY9A 4LJYA 5BP7A 4AZVA 5BOSB 3A06A 3QWAA 4JLSA 2IP1A 3HA2A 5FPYA 5BWCA 1TA0A 5ED4A 3L7OA 2H2HA 1NURA 1D4OA 3CH7A 2I8BA 2OZVA 3K9WA 3G2QA 2ZRJA 2XKBA 1G7CA 4UTNA 3NP9A 4JVMA 3P26A 3HC7A 2I3DA 2ORVA 5CGQB 1XKQA 1RRVA 2WJHA 4EZEA 4DCGA 1XZDA 2M1ZA 1K98A 4P3PA 3ZWOA 3WIVA 4C0AC 5L7YA 2AMLA 1P74A 2X41A 4PZAA 2PSDA 1Z63A 4UD2A 3IUYA 1OB2A 2Z30A 4KN9S 5AM4A 3GFOA 1CEXA 5D51S 2XUHA 2V4MA 4DANA 1Z5WA 2QRLA 1HT2E 1YE3A 3AG6A 3VR2A 2C8KA 3RUEA 1X3LA 2R86A 2ZJ0A 4HNAB 4GMFA 4CG1A 4X7RA 4MR9B 1UPXA 3IP1A 2ZETA 4ITVA 3VZBA 1A7DA 5KYUA 3DBHB 2UV8A 3I5QA 3R8FA 2B69A 1I14A 3ZLTA 1Y37A 3BD6A 3KPUA 1Z45A 1ZGGA 4XCQA 5EEGA 4MKGA 3E1KA 2FPLA 3LCVB 3U09A 2I9PA 4TS4A 2G9ZA 2VNHA 2HPVA 2XOKD 3MJFA 2QD1A 1Z13A 5KKCA 5IYZA 4RQBA 1XELA 1B8VA 1KEWA 2HIAA 3AH8A 1YQWA 4PZCA 3E3LA 3GDHA 1FYEA 3CG0A 2IYNA 1E3WB 1DTWB 2REQB 3R0IA 1C2TA 3HO1A 2P6UA 2GK4A 4G1BA 3LLCA 1NMXA 2NZ2A 1Q91A 4B34A 4B6QA 2FZGA 1E7QA 2PT7A 2Y3IA 3M33A 1RM3A 3D54D 4OJQA 4ASUA 1PNTA 1QTNA 3ZNNA 2QSZA 1U4SA 2ZUTA 3BE5A 5CEJA 3MN1A 1MEEA 3M1LA 2A0UA 1JQ5A 5FHQA 3CGWA 3P0HA 1KPGA 3V1YA 4J2OA 4OL0A 3ANMA 1OFUX 4PV7A 5I01A 2XV1A 5E6SB 4BEWA 2DC1A 4FLMA 1EUZA 2WJGA 5A9TA 2EIXA 1ZCJA 3R8XA 4NG4A 1OOEA 2IZ6A 3LT1A 1E3EA 1T3SA 2AU5A 2H1LA 1Z47A 1GPMA 1L5MA 3C8ZA 2INGX 4F3RA 3GMTA 1LE4A 1FTGA 2WT4A 3DFMA 4M8SA 2V65A 3PX2A 4NBLA 4TQ9A 1KJNA 1RDFA 2B0CA 1PLKA 2VHEA 5KHOC 3O8DA 5KHAA 1IXRC 4H4EA 2P6RA 4YS6A 4C76A 8ABPA 3KQSA 1BHO1 3HRKA 4IIJB 1UBUS 1XZKA 3RAFC 1EIWA 4HO1X 5JNTA 3JAWA 5EMHA 2L82A 1RYNA 3V4OA 1HYEA 3K33A 3B1VA 2VDWB 2WWFA 4MCHA 4FNAA 1GAQA 4DXDA 1Q16A 3B38A 1MP0A 1GN8A 3H2SA 4RD9A 1GPYA 3DDOA 4YCDA 1C3OA 2OOCA 2XODA 1B8NA 2VUIB 4H54A 1NC1A 3S81A 3HSSA 2JPDA 2FTKE 1TK9A 3G2JA 2WMYA 1W85A 4K6FA 1YDGA 2PR2A 3ZE0B 2CL0X 2EQAA 1KFJB 3O73A 2G5PA 3CH6A 1OR3A 4AF7A 2CNNA 1X7DA 1QR2A 2O6LA 1EGVB 1ORJA 2VDNB 3TTTA 2GVNA 2QNLA 3H99A 4Q3BA 1Y3DE 2JVJA 3VVMA 3IBSA 2VKTA 3C4QA 1E6WA 1M1XB 3NOVA 4CIHA 2A5FA 4V0RA 2B34A 3NHPA 3F1KA 3W5JA 2PMFA 2XD4A 1I94B 2QW0X 1GDHA 3CSUA 1PVDA 3DT8A 3L43A 1ZIOA 1EK6A 3P0EA 1U2GA 3I2YX 4KE8A 1PHPA 1VKNA 4WLNA 4CL0A 3CU5A 3BH0A 3EMDA 5G0TA 3ZGOA 2M6RA 3GC6A 1BXGA 5EESA 3G5MA 5EPEA 1JDBB 3EZ6A 3J7AC 3LP5A 2O48X 2XSEA 3JWHA 4PFKA 4TRMA 2VNKA 1Z22A 2CLIB 4UOQA 4LOAA 5YASA 4JVSB 1K2VN 4ETIA 3IPYA 2X5XA 3ABQB 5UKDA 3LT0A 4B8YA 1T1SA 2AUTA 1GG5A 4UQOA 4MUAA 1JQKA 5HUHA 4N3BA 2ZSIA 1K27A 1M6WA 1V1RA 3RUCA 2R25B 1J5XA 1QMPA 2OZPA 4IIGA 5FOQA 5GJBA 3KYJB 4TT8A 2P91A 3SEOA 3PHCA 4YGYA 3HVJA 3PC7A 2P3OA 3T9EA 3DKPA 2IZ5A 3OPNA 3U1BA 1V0JA 4J1SA 3KXKA 5DHSA 3LXUX 1RBMA 4C1BA 3F5MA 3WGZA 3ZNQA 1P1KA 1VA4A 3KP1A 3ZWNA 3TOCA 3TJ6A 2PGOA 4H08A 4IBOA 4MP3A 3R4CA 2WOJA 4MKXA 2LNDA 2ORIA 3PEYA 5T41A 1V25A 1WMFA 3FDZA 1NQTA 1XLVA 4PYQA 4PTLA 5FORA 3H2YA 1CUEA 3MT7A 4ZT7A 2WTBA 3L4JA 1JDVA 5D91A 1Y6GA 3MBOA 3EZGA 3LQYA 3ZVLA 5FO0A 5CHYA 4CTOA 1QP0A 4D44A 1BGWA 3ESAA 4JZKA 3FW1A 3WMRA 3FCOA 3LS1A 1UFOA 4JA2A 3OPVA 1ZEJA 3FPFA 3LWBA 1ORTA 3BXEA 3NCTA 4G2NA 3VZSA 2N75A 3BULA 5BN1A 5DGTA 2YIJA 1ITZA 3DBOB 1B15A 4YR9A 5DI9A 4ME6A 3EXHC 3MOGA 3FZQA 4QGAA 3IR7A 1PT9A 1KEPA 2BMWA 2UYCA 4GZ5A 4EG8A 4KACA 4CCAA 3OG9A 3QHAA 1RQ7A 4BQEA 3UNGC 4IAOA 1DVRA 1RZUA 1IUNA 4YDRA 5DT9A 1A9PA 4PNZA 1WUJS 3BZWA 2ZCJA 1ZMRA 3I76A 1DRWA 3DV0B 5HHTA 4CQNA 1CS0A 4X0RA 5LP6F 2RGEA 5KWIA 4EQ6B 1Q0UA 1R00A 3F6SA 2H7XA 3NT2A 3LFUA 5JAMA 2PYDA 3EC2A 3LFTA 5MFPA 1WUKS 1N6KA 1YONA 5AW2A 2SCUB 4JIOA 3HCPA 5IBRA 5AVTA 2YZMA 3UOGA 2GVDC 5DCYA 3LPNA 1WATA 3PDCA 1UG7A 2LVBA 2X1VA 1Y6DA 2YNMD 5CXQA 4YPOA 3FJOA 5LDDC 1N0VC 2WM3A 2ZT7A 4RKFA 5KYYB 4KGVA 1I33A 4A5OA 1OXXK 1TZCA 4EUKB 4X1YB 3DWWA 4FDLA 2CK3A 1HT3A 1YCDA 3LL4A 1NHGA 2JCVA 4LZNA 3HZOA 2V7EA 1N2OA 4IHJB 2XXBA 1ETHA 1SKBA 1WBBA 2DQZA 4UUMA 2F1KA 3COWA 1E1CA 4TS9A 2WF9A 3THWA 1JEDA 3MS2A 4P3OA 3NTXA 5DXAA 2C2KA 4G5GA 3A7EA 2VK4A 4ZO9A 1BR4A 4O6MA 2GBGA 4RHXA 1N2IA 2AX3A 4C7VA 4DV2B 1KGDA 2GF2A 1R0WA 4KYTA 1QH8B 2F48A 1W581 2QSYA 1FMTA 1TU0A 3DJYA 3TRIA 1BD4A 1PX2A 4MV7A 1BA2A 2QKYA 4MVUA 3L0PA 4U5CE 4J1TA 1VM6A 4B3JA 3BTVA 5H3LA 3K8OE 4ZIRB 4MQUA 3REQB 5K0CA 1R27A 4GQHA 1VTKA 2RJOA 3KZ1E 2PO7A 2EZTA 1JZTA 1W9MA 4IFTA 4LBWA 2OPBA 3ELUA 3I53A 2DQKA 5KOHA 2JIDA 1E0JA 3GCGA 2P9JA 2CFOA 4L5AA 1UBOS 1NUQA 1CJCA 3OFNA 3L4BC 3JAKB 5ELXA 3KX2A 3Q7PA 2FSIA 1Y7LA 1WXHA 1LS6A 1RHMA 2RB4A 1Q95A 4QDJA 1ZH0A 4RZHA 2ZJBA 4KJZA 4MITA 3IAM6 1II8B 1EVKA 2WVQA 3AF4A 3D3WA 1CUCA 4EMTA 2ZIUB 5KOIA 1QR6A 3DUWA 2EKBA 2WPDA 4U3JB 2P5TB 3OCVA 1SZJG 4HXGA 1NLMA 4JLAA 2Y27A 1GTSA 1DAIA 4F5ZA 3OICA 4PHGA 5JJBA 2PD6A 5E1DA 4B0PA 4AKHA 3PHHA 1J0AA 4AXBA 4BTLA 1P5JA 1DTSA 1LF5A 2Q3TA 1ZGJA 2AG0A 4LOKA 4HEHA 5JYEA 2MSLA 3KEQA 4V0NA 2AZDA 1JIXA 4AE4A 3R6DA 1KOFA 3QVKA 1FNCA 4ILKA 3DTTA 4MYRA 4TRJA 4Y9DA 5F4BA 2A1TS 4L2IB 1E60A 2XNSA 1RHQA 4KX3A 2B1GA 1NMSA 1C29B 2AF4C 1TIKA 4DCVA 2ZJOA 1UQRA 5ICCA 1UDBA 2PUFA 4RD2A 4OP1A 3TIXB 2A69F 1QGED 1QIFA 3WQQA 1ZHZA 4L4UA 1I3KA 5AJUA 3F1LA 1TZ2A 3AR8A 5CJ2A 1HE2A 3TW4A 3TQRA 5K3BA 3UW3A 3OE5A 5HZHA 1PS8A 4NV0A 2OFWA 2MSEB 3F4LA 4FX2A 3MAGA 4JP3A 2OZLB 3OE7A 3C3MA 1CPQA 3GWZA 3AVPA 1P8JA 1TTHA 2VB6A 2EFHB 3T8YA 5C8VA 3QOYA 3VVLA 1I4LD 4KIWA 2B61A 4TYWA 4CCSA 4BMNA 1KVTA 4XQGA 3H4IA 4GOMD 1IZ0A 3RT1A 2RHTA 4NENA 2PNJA 1MTZA 4KXVA 1G42A 4JYZA 4CM7A 2QOEA 3VR0A 4LMAA 5H16A 1EI9A 3A32A 5LYJA 1RLMA 2OBNA 5I7OA 2W2TA 2NWQA 4LZOA 4UZFA 1UFQA 1K8QA 3ST7A 3K9FC 2GEJA 3CLSD 4IRXA 3U62A 4ALJA 4EI9A 1C3EA 2E7ZA 1IUPA 3B52X 3GHYA 3DMNA 4JEMA 1ODTC 1JN0A 3N70A 4DY4A 1VJGA 3P2YA 4J7AA 4XCVA 4ZV4A 1DBWA 1F38A 1B23P 3L92A 5KKNB 5HCUA 2EGGA 4J1QA 5JNUA 5PNTA 2DM6A 4A5SA 4S0ZA 3FPHA 1A2KC 3HXLA 4MVOA 1E32A 4DDTA 2CHUA 4C43A 3O94A 4JGIA 5FAKA 1FP4B 1AN9A 1L5HA 4E5YA 4RPLA 1RHJA 3WLHA 1K92A 4KV9A 5AVKA 5C3UA 5IH3A 1X1TA 4Q5SF 4UTPA 1PR4A 5J5AA 2J6CA 1Z6XA 5JUAA 1YB1A 2A2ZA 2ZJYA 1UC5B 1AHIA 3T9FA 3UH0A 3S44A 2V96A 5JP7A 4YMIA 4TN5A 2KGOA 2OCBA 3TPCA 3WDMA 2RK6A 1IBMB 3R23A 2V5UA 1YVUA 3U0BA 4JZYA 3EVTA 4F6CA 3HCEA 4O79A 4E6EA 4J76A 4MVZA 5J5CA 1OLXA 5C8XA 5A5DA 3IDOA 3TQHA 3LBNA 1LW6E 3M89A 2R8XA 4KQGA 4NU6A 5B1EA 4IZIA 1UT8A 1YHNA 1AQ6A 5EIOA 1O08A 4Y18A 3DUFB 1SULA 1C9EA 3AEQA 3ROZA 5B1BC 4JYPA 2BGRA 2PUWA 3ZK9A 1NW7A 1RRMA 2NNWB 3OZAA 3WBJA 1G4HA 2JD3A 4JL5A 4Q3NA 3AHGA 3MT8A 2NUPB 3D4LA 4LLEA 4WGZA 2Y9PB 1PQPA 4KO4S 1V7PC 5A5VA 4XGQA 4PXYA 2AFHE 4F56A 4UTRA 1FRQA 2Y76A 3OHSX 5HSWA 1RT9A 2QN7A 1KDOA 1UBEA 3OLYA 3A1EA 4ZT6A 1GILA 4K03A 1W35A 2B7BA 3T1YB 1VI6A 5AW0A 4H1VA 3GFVA 4JYMA 2H2AA 1X77A 3P19A 4G0NA 5HJEA 4IZ6A 3DJUB 3Q3JB 4V03A 1AQYA 2NO9A 4OO3A 3VYVA 1U5BB 1P29A 1JEQB 4CI9A 4WQMA 3CURA 3HY4A 1ETUA 1TEZA 2EV9A 2PUTA 2Q6IA 3JYQA 5LCXA 5B3JC 5DDIP 4YHHB 3F4BA 4JHXA 1Q0PA 1ADYA 1UOQA 3A4TA 5IK2A 2ODEA 4JT4A 3QVVA 3EZIA 1J0EA 1HORA 5AK6A 3R6GA 3BH6A 4X45A 1C80A 1U1DA 3MNFA 3F67A 2XB8A 2OVBA 3EJNA 1RWWA 2BF7A 2AFHB 4BVAA 3EC1A 5LBIA 5TT1A 2DECA 1YOVB 4DBVO 3TZBA 1CY2A 4PCLA 2M6SA 2WVOA 1VRWA 1K0UA 5CIWA 4YMGA 5T8KC 3T35A 3KL4A 1NASA 1YU6A 2AJCA 2WF7A 5DNUA 3BK2A 1E0DA 1Z8FA 3VR5D 1ENYA 4HNHA 1L8AA 4FI3C 1RU3A 3KUDA 3QOXA 3S90A 1SB8A 3KVNA 1TKAA 4B3CA 2WVNA 3NBAA 4YMSA 4QPCA 1CERA 2WY2D 3GYBA 3IKMB 4XWJA 2A86A 4G0UA 5P8WA 5T3WA 3K0FA 2CUTA 5C52B 2KYHA 4MQ9F 4ZZ3A 4Y6PA 1Z7GA 3N2KB 4NOKA 4XPWA 1AK1A 4KUEA 4L5YA 3NRHA 3R0ZA 1RAEA 1F3OA 3RWMB 5C8ZA 3MTQA 4QM7A 3FYUB 5E1OA 2JIOA 1OZFA 2GGSA 4PLHA 3PRHA 3KEFA 3OTOB 1L4KA 2N1MA 2LDBA 3A6KA 3NASA 3OOWA 2CWWA 3EJ6A 1VP9A 4Z2YA 2C5SA 4JTAB 2HBZA 4B3GA 1PGJA 2X8LA 3TJ5A 3O4FA 4R9NA 1KYIA 4ENTA 3AOEA 2AOUB 1K7YA 1M56C 2AI3A 2I7TA 4JI1B 1CDOA 4DM7A 3O8LA 1MC8A 3KYDB 3E7PA 4Z4GA 2WG1A 2Q07A 5FAXA 2B30A 2KLHA 1U0GA 3KQVA 2JH8A 5IJ9B 3X1DA 2VYQA 2ZS8A 4G0WA 4PLTA 5CB4A 2GD0A 4B48A 3UAYA 3IP8A 2CF6A 2VJKA 1A7AA 1M33A 1HEUA 4BVBA 2J30A 5CT4A 1H69A 3PX3A 3IUMA 3MG9A 5FPKA 4P0PB 1ECLA 5F5NA 4CF5A 1ISIA 1MF7A 3LRTA 4D92A 4BNFA 3QIVA 5JQGB 5HYVA 3DAPA 1W8DA 3JTEA 4OXIA 3U4GA 2BEVA 3T0IA 1E66A 2D6FA 1LDNA 4QTZA 1A82A 2EKLA 4MVJG 5MN4A 4DYDA 1HRDA 1OBCA 2YZNA 1NN5A 1PQ4A 4QFDA 4NBNA 1DMSA 4V2IA 2DPXA 2HLDA 1DADA 3VZRA 2NX2A 2Z5LA 4BO4A 3DMTC 1EXNA 4DIOA 4RADA 5FNVB 1DBVO 4MPJA 5IEBA 2VDVE 3QVUA 4I3FA 1HQKA 1NUUA 1C7QA 1VMDA 5DMXA 4Y0AA 3KU1A 3EVFA 2CVOA 2R7WA 4UNPA 3TK1A 1FY2A 2QYSA 4KP7A 2A1TR 1FU4A 4YQEA 1UPUA 4GFDA 3G8DA 1T4MA 3LT4A 3R7NA 3B5EA 1FMFA 1FFTC 1L3CA 1NR5A 3RUHA 4XR4A 4UXJA 4W63A 1QHGA 2XDQB 4LOLA 3RVOA 5IASA 5K8CA 3HRIA 1DPFA 1Z4LA 2O8FB 4N39A 1N3BA 2FSVC 2ZSUA 3WQBA 5JEEA 1P2SA 5DGDA 3LZDA 5I9MA 1I32A 1N4AA 4PY2A 3GCDA 4W6QA 4GE3A 3NH9A 1BGVA 1IXYA 4YN0B 5EMLA 3I0MA 4DHEA 3D9QX 3ROGA 4LSMA 1TUGA 3HZRA 1Y4UA 2J48A 4E13A 2PZKA 2JDID 1P4SA 4FWIB 3BXOA 1Z6GA 3OQHA 4J4TA 1KBOA 1E6MA 4CFYA 1RAHA 4Q4HA 4Y2SA 4RHFA 1VSBA 1CNEA 3PSHA 3ID6C 1GXSB 2LSEA 3DCNA 2XTMA 3DULA 5DHPA 1WZIA 4F3CA 5C1OA 1MX5A 2VOJA 4PQGA 2GPAA 2XE8A 1V2GA 4CEIB 1TECE 4NJEB 4BO5A 5M29A 3CTMA 1V54C 4OHPA 4DCPA 3TMYA 1DIRA 3SZMA 1A72A 1JRAA 1Z15A 2O8BB 3N28A 4JLPA 3UYLA 1H2EA 3ETCA 1DMRA 1V16B 4H35A 3F47A 3VC2A 2QE6A 1QFXA 4LRQA 1WZCA 4L76A 5IARA 5A6AA 3L8JA 2FMIA 1B6TA 3MLGA 4L3OA 2G08A 1NRIA 2HV8A 1OF1A 4OK3A 3UJBA 1FRFS 4PQYA 2H52A 2I2FA 1DELA 3BGIA 4U7GA 3AVWA 4MQEB 2VNJA 5AJHA 5EUCA 2ZCUA 4LZWA 3EYWA 1ZW3A 2IEBA 2YRXA 1X7XB 1HF3A 3OU7A 2FN9A 2ZSBA 4BYMA 1DXHA 1MJNA 1JU4A 4F4FA 1ADCA 1T5HX 4QAQA 5KDOA 5CCBA 1YQ9A 3MLEA 4OFWA 2B82A 3C74A 1CK4A 1RWOA 2GYYA 5GM1A 4MVMA 1KI8A 4N6NA 3IDFA 5F77A 2QMUA 4FZ5A 4PSUA 3VRHA 3IQ6A 1MA0A 2FRXA 1G98A 2GRJA 5B53A 2AYZA 1T1EA 1JIIA 3OWXA 4RSMA 2YW2A 3CS3A 4Q01A 3DLHA 2VHCA 4LCJA 3PE3A 3U7RA 5DCWA 2AFIA 3G9TA 4Q7QA 3OZVA 1KMIY 1XLUA 3VPCA 3OEWA 5FNVA 5DK4A 4ZVNA 1AS3A 4CMKA 5AUQA 3D6VA 2ZG6A 2DU8A 3T3HA 4IQGA 1ENOA 5GPGB 3HFGA 4A27A 4CIAA 4C3BA 4HQ6A 4CWAA 5JVEA 4EUFA 2WIAA 4YL1A 5CTJA 5JFOA 1EUDB 2PY6A 1WG8A 1Q1GA 3EPRA 2ZVPX 1H6BA 1C7JA 4KDRA 1U6IA 1QH1A 1T8WA 1TAGA 3ZYZA 3KZKA 4BRZA 5DBIA 3GRVA 4AYWA 1KH3A 4Y6SA 1ZRNA 2F6RA 2YVAA 4U2BA 3WLPA 3V8EA 5FTMA 1C0PA 4MWBA 2HK8A 2O2YA 3KYIB 4TXJA 5C2JB 5IANA 1CVRA 3ZW7A 4I3MA 2WMNB 3EA5A 3H2GA 3NVAA 1GL6A 1IBSA 1MO4A 4FK8A 3A6LA 1VBNA 3ZDXB 3R7FA 4A8JA 3JVUA 3WL3A 3B0VC 3PTZA 1XMSA 2OQMA 2W22A 3D6FA 1F12A 4GYKA 2XCTB 4E5NA 2C0PA 3NMKA 3H5NA 1MIOB 4IXNA 5TR9A 2BMVA 1UC9A 4M0PA 2BGWA 5BSVA 4RCYA 4O1MA 2WTUA 2I6GA 4MZXA 1AKWA 3QXJA 4RMNA 2R6ZA 2C1EA 1EXWA 3RRZA 4WHMA 4OB6A 3PWTA 3GEIA 4NOJA 2GB4A 2WW8A 1KNYA 5BPFA 3LA8A 5IC6A 1N5JA 3RJ9A 3WL7A 4J0IA 4E4YA 2C2MA 3EXIB 4FCTA 5EKTA 4BASA 5FTLA 1JIQA 5DM1A 1AHNA 5ALZA 1YS1X 1MTOA 4G1FA 3EMVA 4F06A 4RJJA 4OATA 2PXHA 3KDPA 5D7BA 4UZEA 1V41E 4JJ8A 4L1KA 3HM2A 5FPHA 5ENVA 1J06A 1HNWB 3CAXA 5I5GA 3M7IA 1L8LA 1QGYA 1U1IA 5EE0A 2GPJA 4RF5A 2A6PA 1AQNA 2H07A 2XPCA 1ISGA 2BHTA 4UE2A 2BFEA 3HQ4O 3JWEA 2O14A 1XU9A 2YOGA 5IBPA 1RPTA 4E2ZA 3ERCA 3FNGA 4MW2A 1UP4A 3CLUC 4WVLA 2V58A 3LRXA 5CA1A 4GXRA 3JZDA 3TB4A 5DYYA 4ZALA 6PFKA 1T5LA 4G5OA 3JQ8B 5C8YF 4O59O 3EXHA 1E89A 3U6BA 3K6BA 5CNMA 1VGRA 4G86A 5COAA 1WPXA 4ZVKA 1HKHA 1NR7A 2RH4A 2LCQA 2HKIA 4DTCA 5LM3A 4FEGA 2ZDQA 3DNPA 1V4BA 2WZLA 2R7MA 4K7BA 2WJ3A 5K6RA 3K70B 3GJ0A 4Y0VA 1TF2A 3HXMA 1INLA 4KQCA 4R8MA 4KITB 5DNDA 1T6UA 5HE8A 1FW6A 1XZHA 2XNDD 4TL9A 1UP6A 2Y66A 2HB6A 1EEHA 4HDOB 1JEYB 2EW2A 3I3SR 4RORA 3EA4A 4LHEA 3ER6A 3TPFA 3R41A 3U7QA 3NC4A 4MB2A 3G2HA 4ZP1A 2WWIA 2X77A 4OHCA 3GXBA 3WNBA 3BC1A 3J06A 3C7JA 2G40A 2JZCA 2FPMA 1A04A 2J9FA 4MQ6A 3R5SA 2O3JA 4TTJA 1LLDA 3TD9A 3WSVA 3TOLA 2XVMA 2AI2A 2NIPA 1PFKA 3X2EA 3Q9UA 3HCNA 4PGGA 3BB3A 4NYMQ 2B8EA 1N9KA 2GTIA 5DNEA 1ZN8A 3I04M 5JNVA 2IHVA 2FEMA 3FAPB 2A1UB 4ENSA 3RG8A 1NQOA 4IXTA 4PJNA 3IEPA 2GK3A 4NCJA 1M5UA 5KTKA 4RM3A 1ZRSA 1J1IA 4G9BA 3N24A 4WXMA 3UC5A 3EIQA 5DT2A 2CL5A 1US8A 5I51A 5AI6A 4YRKA 3ROEA 2ID7A 1ZM4A 3SYNA 2GHTA 3EARA 13PKA 3KQNA 2AFVA 3TVDA 3H1FA 3EY4A 1DV2A 1PZFA 1XKXA 4MIKA 1P62B 3TQFA 3ZQ4A 4PSAA 3AUTA 2HA6A 5ENZA 1HDZA 3NUZA 3ESZA 4B6SA 1A3CA 5IVIA 1RFLA 3GEGA 1ZFNA 4LV8B 1XNHA 1FL9A 2OJED 2NW6A 4TT3D 1JZSA 2G70A 4JKVA 4E0BA 4GOKA 3KH2A 4CQMD 2OCAA 4O6VA 3GBSA 4IGFA 3VYUB 4Q37A 3X3HA 3DFKA 1E1MA 3C6BA 2M98A 2EILC 2VDQB 4IGIA 4FX5A 3C5EA 2B3TA 1I5OA 4O6NA 2Q46A 2Q50A 3SICE 2VHZA 4N18A 4DCCA 4XUDA 2XRHA 2P77A 2XVAA 1GZ5A 5T3YA 4REQA 2X2PA 1QTQA 4JVNA 5KYUB 3BWYA 2XITA 2YXEA 1ISPA 3L4BA 3T1HB 3REOA 2ZFUA 3BMXA 3STTA 3OSUA 4LHZA 3EZ9A 2WAOA 2AUMA 3F90A 1KIAA 1LRKA 3NHRA 5FOVA 4OSPA 1KMHA 2H5IA 5H83A 1NF3A 5IYZB 1D0YA 5H81A 3DHEA 1SGWA 4B83A 3T4PA 4OHVA 4QKQA 2IOQA 2EBWA 1QPBA 4E11A 4C6RA 3MBKA 3O83A 3AVOA 5K01A 5KOYA 5EZYF 1UKAA 3AHJA 4XGRA 3AF2A 4IIUA 2BJHA 4W5WA 6YASA 3GRZA 3UGKA 4GH5A 3U61B 2CMGA 3GUHA 3FYTA 3V97A 2J6IA 3DTVD 3SBEA 3FWZA 2GAIA 2DEUA 2BVNA 2IZ1A 1A7VA 1EB9A 256BA 1ZC3A 3U3JA 1PS0A 3HWSA 3PLRA 5EUBA 4FNOA 5EJIA 4BLWA 4GLJA 1Q7RA 4H6VA 1M2NA 2DPHA 1RD4A 2QLMA 1I3OA 1JHZA 2BZGA 3NEJA 3ICEA 4UFNA 3L7CA 4OEHA 2JIZD 1V8OA 2MT9A 5DZSA 3VHLB 3I2JA 3CPJB 2ZATA 4XIGS 1NXPA 4XJSA 1Z62A 4KPYA 4A6DA 5CR9A 3O92A 3OIWA 4G26A 3JAWB 4D9KA 5KCZA 2QK4A 2EPLX 1L7DA 2WDPA 3UTDA 3K9NA 2A3RA 4O25A 1JHMA 2JCBA 3RRJA 3LIIA 1JKJA 4G5RA 5FYDA 2Q41A 4QOFA 2YMQA 2WUDA 4IO1A 4G3XA 1RVV1 2B9EA 3TR5A 1MABA 1IPHA 3SU8A 3CKMA 5E6RA 1HMDA 5DGXA 1ZVVA 3D4NA 1C3OB 3GD5A 4LFAB 4NCQA 1O87A 5FLYA 5ER9A 3NTRA 3AFHA 1A5ZA 5BMVF 2R7OA 2FLKA 2HC9A 1N32B 1EWQA 1W85B 1N7IA 2LCFA 2W6ID 4R2JA 3T3MB 4LXHA 2CUZA 2WSLA 3PNLA 4DA9A 3R2PA 2I2WA 3ZLUA 1Q57A 1T36A 1NZEA 4ZEXA 4CMIA 1KI2A 3OAAA 1QHYA 2AQIA 3FG9A 1KYVA 1ZD2P 4CODB 1UBKS 1XTUA 1D2CA 5LN1A 3PNSA 5LA6F 2NO5A 3MJ4A 2NZ8A 4R54A 3IUNA 1M6HA 4BO1A 4F04A 4XWKA 4MKIA 4BGIA 2Q8PA 1X1EA 4QUIA 2YFQA 2PJRA 2IHBA 3E3NA 2IOYA 2Q4EA 4UM9B 3SEQA 2VRBA 2FFRA 4GM4A 3JALA 2G5GX 2VFAA 3LA6A 3F4KA 4U5QA 2GJ9A 2OB2A 2ZQ5A 3QXHA 1LSJA 4R0VA 2BEWA 1F4VA 2XMCA 2CDRA 1MGPA 3KSZO 1JXQA 1R2QA 4CIBA 2E6KA 1P1FA 3WICA 1ABEA 1O9HA 3PXAA 3OIUA 1BXGB 1U7ZA 5KX5A 4KOAA 4MP6A 1O4VA 4FHDA 4B44A 1IWBB 1EA7A 4M9UA 5CK4A 1NYTA 3VDRA 5AM0A 3L8ZA 5IFKA 4A92A 4X8LA 2Z6UA 2GLXA 3ORQA 4UAUA 1CEYA 3DPIA 3RBVA 3PEFA 2X9NA 3CF4A 3OLZA 4BJ5C 3FR8A 4P35A 1KFCB 3F6YA 3ZDDA 2GLUA 4OF4A 5IN4A 3OC6A 1Y6RA 3A6HA 1GCIA 2IDMA 1BN6A 3EF0A 1JPUA 1V1RB 1K40A 2RKBA 1TQ4A 2O7VA 3LVFO 4N82A 2DVMA 4FHFA 4ZOCA 3QKUA 3URKA 3VKUA 1A5AB 4GOLD 3PD7A 3HYTA 2BFDA 5LQNA 3WLNA 3VNAA 3CKLA 3IMFA 3OHMA 4D56A 1Z8NA 4N9QA 3TG2A 3U16A 1Y81A 1KDTA 1IHOA 2J07A 4PZYA 4AY3A 3Q8MA 1LSOA 2C61A 4EX7A 2QRMA 3HN6A 1KF0A 4KWHA 4W7HA 3AGTA 4BVFA 2AEMA 2PCJA 1ADJA 4ZCSA 1I6KA 1VG9B 3UB2A 2P4SA 3VMMA 1MFZA 1NV9A 1WPRA 5DWVA