1ZU5A

Crystal structure of ftsy from mycoplasma mycoides- space group h32
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
309
structure length
309
Chain Sequence
HPMEKAMLKSAFNFSKDIKKLSKKYKQADDEFFEELEDVLIQTDMGMKMVLKVSNLVRKKTKRDTSFENIKDALVESLYQAYTDNDWTNKKYRIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAGATQQLEEWIKTRLNNKVDLVKANKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKIIQQVEKSAPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLLAFDIDQYIVHLSSGFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords ftsY
publication title Conformational variability of the GTPase domain of the signal recognition particle receptor FtsY
pubmed doi rcsb
source organism Mycoplasma mycoides
total genus 115
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1zu5A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zu5A02
4QHTA 4XVRA 5GADl 2DYKA 4DSTA 4DCUA 1S8FA 2ZUDA 3RS0A 1P62B 2ZRPA 4Q19A 3FMFA 4NU0A 1S96A 2ZETA 4DLZA 4MRSA 4RD2A 3SJZA 2CNWD 4OQLA 3T5GA 3KX2A 2F1HA 1G5PA 1PLJA 3VX3A 1A1VA 1S0UA 4MRRA 1ODFA 3QF4B 4BASA 1D5CA 3AGPA 2KI5A 4PC2A 1SGWA 3LVRE 1XJQA 3M1IA 2FU5C 2HYDA 4ESHA 1XPOA 1KSFX 2HDNB 4ZDIA 1E96A 3MWJA 5SZJA 2ASEA 4A2QA 3UXMA 3T34A 3HPQA 2ZAMA 1E0AA 4Q4HB 4C0AC 1OH5A 2CVFA 1UDXA 1OLOA 2QT1A 2ZQ5A 4OI2A 4W5JA 1BS1A 4LV6A 2Z6VA 4MKIA 3ZD7A 1QG4A 2P67A 4EPYA 621PA 5JBQA 1ZM4A 2PJRA 1U94A 3VHLB 3WMEA 1GTVA 4LYHA 3OEHD 4FI3C 2X77A 1FW6A 2FFHA 4Q7LA 1VYVA 3FFAA 3MGCA 4EPRA 2WAXA 2H17A 1UBFA 1E32A 4IDOA 2IYWA 1W49A 1KK2A 1E2GA 4KHZA 1NVWQ 3QG1A 3RRYA 1Z0KA 1XTKA 1ZRHA 5IDVA 1QDEA 2C98A 3SYNA 5LD2C 2OAQ1 2N46A 1TPZA 1WP9A 2QP4A 5TMPA 3UG7A 2CK3D 5AJVB 4IRUB 4PSAA 2O8DA 2D06A 4KO8A 2GAOA 1CRPA 5FPTA 1IM2A 1VCIA 4V0OA 3ZQ6A 4BFYA 4PC1A 1PV4A 1OXUA 1IAQA 2J87A 3IIKA 5HTKA 2YINC 2BMEA 1G18A 1PUJA 3VR3A 4OJQA 4R98A 4B2IA 1FMLA 3KQUA 1FQJA 2ZJ2A 4OKSA 5AUQA 2PEYA 3X1XA 2JATA 4IOJA 3LVQE 3D6TB 5HZKA 2J0UB 5JHHB 1C4OA 4DLSA 1RC8A 2YJTD 1J8YF 2EFDB 1EESA 5FOSA 4AI6A 2P3SA 3V00A 3DKVA 4P3YA 4MGKR 4RFVA 5AJWA 2ZS7A 3KXKA 2WSSA 1FTNA 2OBMA 3CIOA 3X1ZA 4M9XA 1OXSC 5DI3B 1X86B 1Z0DA 3LFUA 2GK6A 1TTTA 2PT7A 4PHTA 1AK2A 2IT1A 4PQFA 4HAWA 4Q4HA 4XTRA 5A4JA 5KSYA 1N5KA 3FTQA 4JLMA 2ZRJA 3GJ4A 4PZYA 3PIRA 4EIWA 1KDTA 5IRCD 1C1YA 3E5HA 4DC9A 3H0KA 2XAUA 3FOZA 2RMKA 3C5CA 2D3WA 4B6FA 1OXVA 1T91A 4B32A 4GFDA 2YHSA 1OFUX 2QTFA 2W83A 4DUGA 1CF4A 3SN6A 3D3QA 4FMCF 4RY2A 1XZQA 3AVQA 3K9NA 5FOWA 3UWOA 1CLUA 1QHXA 1DAFA 1XCGB 3RC8A 4G5QA 2EFEB 1E0KA 1NLFA 1E9AA 2XSZD 4FCVA 3EC1A 2ZJ5A 5B30A 2BCJQ 1NKTA 3A36A 3P32A 2IXFA 4F38A 4A2WA 3W3ZB 3VKWA 4NDZA 3QPUA 3W34A 5AWFC 3AGQA 2AKAB 2KJQA 5C2JB 4KODA 4BRUA 1IN4A 4US1R 1X6VA 1P9NA 1L2TA 4GZLA 1S2MA 5AJZA 2FSIA 2IS4A 4LV5B 4F4JA 2O0HA 1WQ1R 4EPTA 2FV8A 3LLUA 5J4KA 3SQXA 3S1AA 2F6RA 1CR2A 2WBLC 3BB4A 4TMKA 2H16A 4Z54A 2ZI5A 4AWXA 4BEBA 1KDRA 5B64A 3QVVA 4LJYA 1SVMA 5UKDA 3A4NA 2VRWA 2V6JA 4GOKA 2GJ8A 2JASA 3I73A 2J0UA 3WNBA 4NONA 4BQSA 1NP6A 2OHFA 2BBTA 1EGAA 2QAJA 3THOA 2FJUA 2FPLA 3B1XA 2VO1A 5DHAA 1XTSA 3IILA 2ZROA 2YOFA 3LBNA 1P9WA 4CT5A 4DRZA 3D7MA 4IVPA 2XTZA 4WIAA 4B3FX 2E9SA 2KSQA 3WMFA 4JBYA 2RGEA 4ASUD 2ZPTX 3GLFB 1H8EA 1U0JA 1RRFA 4Q9KA 2B8WA 1YHNA 1XEXB 4A2PA 4MRPA 3TUIC 4EJSB 1ZM7A 1QHHB 1SZPA 2WMOB 4M22A 4URUR 1PUIA 3PEUA 3K0AB 1YJ5A 4KFUA 2RGCA 2KWIA 1CS4C 4OK5A 3W5JA 1E2EA 4HAXA 4P31A 3VR1A 1ZC4A 1TMKA 4WZBE 3UANA 4M1TA 1WBBA 3BB1A 1QRAA 3QQ5A 2NZ8A 2PT5A 5FUXA 1N2CE 1P7CA 1T0HB 3SFVA 4KITB 2G0NA 1DAHA 1T4GA 2GTPA 2W58A 3KUDA 2E87A 3R9XA 4N0EA 1SKYB 3TIFA 1JEDA 2WKPA 4TL6A 3JVUA 3NVAA 2CHGA 2QAGB 1KJYA 4ZCMA 3IEVA 1VHTA 2ZE6A 4HUQB 1ZCBA 4FCTA 4M4SA 4TTRA 3K09A 4Q4JA 1Z6GA 1YZNA 1T6NA 5TXGA 3QUSA 3KQKA 4KFSA 3QE0A 4QHSA 2LCFA 3QKRA 1C9KA 2W0MA 5SZIA 3OIUA 2V55B 2GESA 4Q03A 2ZI7A 4KVAA 3UMFA 3H4MA 1WGWA 3PEVA 1NF3A 3AF2A 4N0DA 2GBLA 1HEIA 2UZIR 1TADA 4DSUA 2OEPA 3LNCA 2GAAA 2YWEA 2RB4A 3C14C 5L3SB 1UDWA 4KV9A 5B58C 1S9DA 1E2JA 3PUVA 2HT6A 4EAQA 3ICQB 4U7DA 3KJHA 4A9AA 5FBLB 3TAUA 4ERNA 3FHTA 1XEFA 5TDHA 2AWOA 2QSZA 3LRPA 3GLFA 2R62A 3OAAA 4ZIRA 1XMSA 1XEXA 1ZC3A 1XD9A 2YWHA 4KBGA 5AJXA 5EXPA 4DBLC 2ZRLA 4M21A 2HXSA 4EJSA 4QC2A 1QHHA 4JLAA 1KDPA 2D2FA 3CH4B 4OHWA 5FOXA 2X2EA 4URZR 3U4QB 3K0AA 2A5JA 4C0QC 4UXIA 3H86A 2RAPA 2WWGA 3QVUA 2C78A 2C95A 4QBHA 4LHXA 2C2HA 3ZVLA 1ZUNB 3BGWA 3CZPA 4AYXA 4PHHA 1JJVA 1EG7A 4C0LA 2Z4RA 3U60B 4KFRA 1EFUA 1S3SA 2AFHE 2QAGA 4C0HA 5DN6D 1DBSA 4G3XA 3BE4A 4BLQA 3HYTA 4HLUC 1OV4A 4V02A 3EZ6A 4Q21A 1VG1A 1W36B 3THWB 1P2VA 1Z3IX 1FL9A 5E95A 4MRVA 4MH0R 4A8JB 3BOSA 1MH1A 2GCNA 2RGAA 2ZAOA 2O8BB 221PA 3W8RA 1BYUA 2FFBA 3T1QA 2J0VA 1N6KA 2QROA 4MUBA 2JLWA 3A1VA 1Z29A 4QOSA 4A0FA 1KI1A 1Z07A 2P65A 2Y8EA 1KK3A 3CZQA 5C1BA 1XEWX 2YV5A 4DB2A 1MT0A 1N0UA 4TMZA 3TAHA 1T8TA 2QE7D 4DCNA 2PCLA 5L3SA 2IHBA 4JLJA 3TH5A 4TT3A 3RVBA 3GLFE 1FQKA 4KXFB 4E22A 3ADCA 3B9QA 4BFVA 4L4UA 4DCTA 2VQSA 2GZAA 4DDUA 5JZVA 2FEMA 3VMFA 4NBSA 3QG5A 3LH5A 4LBZA 4EFNA 1O87A 1MO6A 1Z6TA 2JGNA 4DSOA 2WAYA 1Z6AA 2VP2A 3L2OB 4PHFA 1W4AA 2EFGA 2G1JA 4E5UA 1ZVQA 1IXZA 2F43B 3HJNA 4M9ZA 4BWYA 2CJWB 1KK0A 3DO6A 1T3LA 1ZJ6A 2BM1A 3OESA 1NMXA 4GMDA 1BIFA 1MO4A 4NYJQ 1NKSA 1XFAA 4ARZB 2VH5R 3A6PC 3L0IB 2O0KA 1N3BA 4Q01A 4BFWA 3R8CA 2P6NA 2A9KA 4LOAA 3ZIAD 1SKYE 2FPKA 1FTSA 1RRPA 4OHVA 4FMDB 2JJ2A 2X1VA 1LF5A 1XNJA 4AK9A 4YMSA 5HKKD 4Q1FA 1Y63A 1FOEB 2PZEA 2AN9A 4QKQA 4URWR 4H1UA 4NKRA 1P4SA 2AFIE 3CO5A 3AP3A 4MITA 4TMVA 3GFTA 1IXRC 3LA6A 2RGGA 4JBWA 4K81B 1ZIOA 1CJKC 2DFKB 3EZ9A 1DO2A 2B92A 4PHGA 2VHTA 4B71A 3CX6A 1ZD9A 1VPLA 3THWA 4ACAA 3ADKA 4A8JA 4FWTA 1G5RA 2ANBA 4TYQA 2O8BA 2PLRA 5FL7D 2ZRCA 4M1MA 1DG1G 4PO9A 4TZ0A 2FNAA 1OH8A 1Q57A 1KI8A 4ZCLA 3GLIB 4HDCA 4G01B 1X8LA 1IY0A 3EA5A 1U9IC 1KOFA 1E6CA 1NI3A 1GL9B 1OSNA 521PA 2ZI4A 1SHZA 2FX3A 2OSBA 4NL4H 1E0SA 2RGNA 1JI0A 2ZU6A 1KZGB 5JECA 4LK2A 1T0JB 1YR8A 4HAUA 1MRSA 3ADDA 2V7QD 3A4LA 2JLVA 2BWJA 4CEHB 5H68A 3FKSA 2BVNA 2BMJA 4BFZA 5FOTA 4V0LA 2XTMA 1AS0A 2ODEA 5CB8A 3LD9A 3QF7A 5FPSA 3REGA 3U44B 1T3SA 2J7PD 1J99A 4ILEA 5FR1A 2ZJAA 1KSGA 3X1YA 3HR7A 4GSYA 3W9YA 3CONA 1ZD1A 3Q3JB 2F43A 2Q9BA 4LJAA 5M04A 4YC7A 2RGDA 4V0MA 5DYIA 5JCZA 4NHOA 3PENA 4W7SA 4C4PA 2IX3A 2QRNA 2WPDD 3UKDA 2WTUA 2BDTA 1G3IA 5KSPA 2VP0A 4PZLA 5H8WA 4H9GA 1TF2A 1X1RA 1KSJA 1BMFA 4XTCS 1Q1ZA 2MSCB 1QVRA 3EC2A 5DYGA 5DI9A 3SDZA 2OO7A 3AUYA 1COWD 1CULC 4PC7A 1UKZA 2FSGA 3WNDA 4DJTA 4DLTA 1U8AA 4PAMA 5KSOA 3VR4A 1DS6A 3OEED 1NIPA 2VHCA 4B2PA 2ZSEA 2EYQA 1E9DA 2IA5A 2IEYA 2PMKA 1TUIA 5CIQA 2QA5A 4QG7A 2ONJA 3K70D 3RC3A 1GWNA 1OW3B 5BYKA 3IGFA 4B2LA 3HU3A 3ASYA 1G19A 4C7OB 1GVNB 1P75A 4NCNA 4UQOA 1HTWA 4EFLA 2XNDA 4GP6A 4NTZA 4EQ6B 1FP6A 1IONA 4XSHA 4IDQA 4ZO4A 4HAYA 4PPNA 2HUPA 5JWHA 1MV5A 1AS3A 2EFCB 3N2IA 4JS0A 2F55A 3T35A 3W6NA 3RRZA 3T15A 4M53A 4NYIQ 3BH0A 4Q9HA 3SJAA 4OK6A 3PV0A 2KBEA 1WMSA 1OHHA 1H8HD 2AK3A 4AURA 1HY3A 3KKOA 1S9HA 3I1FA 4WOPA 4S35A 4EPVA 3U44A 1QVAA 4C2TA 1XD2B 4UJ5A 1RVDA 4V0ME 1XTRA 3E1SA 4G1UC 5BWMA 5K8TA 2CEAA 1GRQA 3Q85A 5EP1A 1GITA 3FFBA 1KMHB 1CTQA 1XU4A 3TUJC 4Q1CA 4RFSA 1TNDA 5LD2B 3LW8A 4R71A 3FHCB 5K8UA 3Q7QA 4JL8A 4LHZA 3ASZA 4PO8A 4TYPA 4AG5A 1K5DA 4TLAA 4JIMA 4TMXA 1W5SA 2YC4C 4DZZA 2BEJA 2OE2A 3AH8A 4R2HA 2R6CA 2GILA 2OLJA 4QGAA 3SBEA 3N70A 5G40A 4HB4A 5LB4A 2BJWA 2OT3B 1ETUA 3TSOA 4P0TA 3KZ1E 3PFIA 4D4MA 2HLDD 5G3ZA 2ZRIA 1ZNZA 5CDFA 3LV8A 1KKLA 4EDHA 721PA 2JLZA 3ZS8A 1HH4A 3MWLA 1R5OA 4BZPA 1YQTA 1IOZA 2ORVA 3UMSA 1HT1E 1N0VC 4PQRA 4QL3A 2ZI9A 2ZRKA 1NRJB 1X8KA 4RSGA 2WJYA 2EWWA 2WSSD 4JLVA 4WAUA 1UM8A 2FGKA 4EQ6A 2GXAA 2IYQA 2WOOA 2DFLA 3AKDA 3WMGA 3AP1A 3B5JA 4M0LA 4QXAA 2BHRA 2O8CA 3GJ3A 1ONBA 3TW4A 4HLQB 4KYIB 2NPIA 4JSYA 4HDQB 1JB1A 4AY2A 1GKUB 3C8UA 2IYRA 1AKEA 1OB2A 1NVUQ 1IN7A 5DSZA 2V54A 3B13B 4DUGD 3EAQA 1Z28A 1HUQA 4ZCIA 1KI3A 2YKGA 3IPYA 1BO6A 1OYWA 3NBXX 2QN6A 3HP1A 1KMHA 2GF9A 4CT4B 5TVKA 1JQJC 3ZD6A 4L5BA 5KOYA 1G17A 3THXA 4FCWA 3AVXA 1G7CA 5ANRB 1E3MA 2G6BA 3MWKA 1W4BA 2FH5B 3CRVA 3ONWA 1U0LA 3L8ZA 4HB2A 4K8OA 3PJRA 1HV8A 4HEJA 3W3AA 4QM7A 2FE4A 1W0JA 4F92B 3RRMA 2TMKA 2GETA 2R2AA 1Z6XA 4EKDA 4C0BA 4M1OA 2GXUA 1ZYUA 3BBPA 5CDFE 1RZ3A 4DB4A 1FX0B 5FTJA 1W4CA 3WNCA 1YR7A 4U00A 4GPTA 1KJWA 4D0GA 1ELOA 1EFRA 2XZLA 4LCBA 4ZI3A 1G4AE 2GJ9A 3ICEA 4NCHA 3QENA 3K8YA 3CRMA 4JLOA 4JLPA 4B43A 1DADA 2OESA 4EFMA 2C03A 4GOXA 3ZZUA 4M1YA 1VG9B 4YXWA 1YZQA 3P26A 4XD7A 4PPFA 1NL3A 4KU4A 5JRJA 2QSYA 4I4LA 2DPXA 2P0EA 2OG2A 1U99A 3B1WA 3C7KA 1HQYE 3SEAA 4DLYA 1KIMA 1FFHA 4HB0A 3WXMA 3KB1A 2HJVA 2R65A 2PX3A 4TSFD 2D4HA 4CYMA 4NCKA 4O2LA 3KJGA 5FI1B 4D4JA 4B3XA 1LTQA 2G1KA 3WBJA 2ZRMA 1Z6YA 2DB3A 8OHMA 5G41A 5FTNA 4LHVA 4DT1B 1H65A 1L8QA 1XD8A 2AK2A 2IYUA 3CKLA 4X8MA 3RYTC 2I1VB 4US2R 3TGPA 4QGHA 1LW7A 1CJTC 2ZU0C 2ONKA 2CBZA 4HUTA 5JCPA 1OYYA 4B33A 1G8YA 1E1RA 2AL7A 1LY1A 2YNMA 2EW1A 2QTHA 1Q22A 1NJGA 6Q21A 2IYYA 3C16C 3P27A 1UBCA 1NY5A 5EUQB 4S2EA 1UBEA 4D80A 2ZE8A 3X1WA 3T61A 5CB6A 2XB4A 1K8RA 3BC1A 3S1AB 3R8FA 4D2IA 1G3RA 2HCBA 1XMVA 2GXQA 1JJ7A 3EZ2A 3H84A 3QI2A 4FIDA 4IOLA 3TQCA 3QXCA 4G5RA 4M9QA 3RABA 1XMIA 1KAOA 2ATXA 4JJKA 4TYNA 3VU9B 2ZRBA 1ZUIA 3WP0A 5BXQC 4C0KA 1Z08A 2H8KA 1MOZA 1FX0A 1E9EA 1NMYA 1XMJA 2H57A 1E2NA 4QM6A 3K70C 4LWZA 3NXSA 2OXRA 1ESNA 1NN3A 2QRZA 2QG6A 3K9LA 4LZZA 4A15A 5EE1A 3I8XA 1NJFA 1XTJA 3KFVA 1AKYA 2YVUA 1Z2CA 4HI0E 2VEDA 1UFQA 1CJUC 3TLXA 1DELA 4TQUS 3I72A 3CPJB 3THYB 2QPOA 4RD6A 3ZLJA 1D8TA 1GDDA 1Q1QA 1YZTA 2IS1A 5HPYB 3SS8A 5H1YA 3EPJA 3A1TA 3CW2A 3IHWA 3IO5A 2D74A 2ZRDA 1N5IA 3TVTA 1W48A 3SU8A 4II7A 4ESVA 1E69A 4P33A 3WHLA 2KBFA 2JLRA 1G20E 3ZDQA 1UAAA 1YR6A 3AVUA 2JDID 1IN8A 4C30A 4DT1A 3D31A 4Z8XA 3NKVA 4YLGA 1P73A 5LB2A 5IHPA 4R7ZA 3WYGA 4D81A 1L4YA 1KI2A 2ZRFA 2RH5A 2ZUCA 2IXEA 1LNZA 2VBCA 1OB5A 3QXXA 1B23P 5CK4A 3HU2A 4MYCA 1NLZA 3GJ0A 5SZKB 3GJ6A 4RCYA 4Q4JB 3C15C 3E70C 3B78A 3QPVA 4TL8A 2RCNA 2GZHA 1PLLA 3QKRB 5CK5A 4Q66C 4ZKEA 4PXAA 2J45A 3GJXC 4L9SA 4URXR 3ECCA 4BE7B 2QMUA 2QMEA 4MKFA 4U02A 3PUYA 3OIWA 3J81k 1J90A 2YYZA 3GEEA 5FTLA 2EFHB 1CRQA 2P6UA 3GLGB 4E09A 4B35A 1NBMA 2DHRA 2FZ4A 3VU9A 3I3SR 1KI6A 1R0WA 1XBTA 2QMHA 4LJ5A 1F60A 4OK3A 2CNWA 4QBIA 2OCAA 1JAHA 1B0UA 1DAMA 4JLKA 4QGGA 4B73A 2I3BA 2QORA 3RAPR 5KTYA 2A2ZA 2AX4A 2DR3A 5EXTA 2QQEA 4Q7MB 1SXJC 1VIYA 4ZIRB 1E2QA 3BFVA 1GIAA 2F7SA 3THYA 3KTAA 3HDTA 4Q7KA 4P4TA 3PUWA 5L3QA 2QGNA 5EP4A 3EPHA 2H1LA 4HLDA 4AKIA 5J4YA 1NVVR 4P32A 3QXSA 1R0XA 3B85A 3NEYA 3JZMA 2QM7A 1SKQA 2Q6TA 4M8NE 3DMNA 2C9YA 4BLPA 1DAKA 3OEHA 2F1IA 4Q4LA 2VYFA 1D2EA 5HE9A 3SOPA 1M7HA 2PH1A 4FD2A 3EZ7A 5EE0A 1GOTA 1RIFA 1EX7A 2A30A 3NC0C 4UNPA 4UXJA 2J0QA 3QEOA 2XJ4A 3I8SA 5CITA 1DARA 1UADA 2G9NA 4KBFA 4D4LA 3AVTA 2W6IA 4F91B 2JJ2D 4TQ9A 4A92A 3L0OA 2ANCA 1XJCA 1EXMA 1KK1A 1Y3AA 2VSFA 3BFXA 4TL7A 3NBFA 4WW0A 1ESMA 2PJZA 3BORA 1VG0B 3EWSA 4JLNA 2CK3A 4DKXA 3SE0A 2QI9C 3DZ8A 5KHOC 2ZR7A 1E2MA 1TL7C 1AJEA 3NEJA 4GBMA 2JJ1A 3EARA 3AF0A 4GZMA 2WKQA 4HLUA 5CJ2A 5CYPA 1NBME 3VR2A 1N6LA 1W36D 2WWXA 3AF3A 4BLTA 3W6OA 3CPHA 1RRCA 1TU3A 3GLGA 4Q1EA 1R8SA 4RD3A 1NLYA 3QSYA 3EPLA 4DLRA 4QGFA 4BFXA 4LC0A 2HYIC 3BH6A 3LX8A 5EQTA 3IO3A 5C4MA 2R8RA 3BWDD 2WMNB 2EVWX 4IDNA 1OKKD 2OBLA 4OQNA 2ECKA 2PZFA 3CNLA 3BB3A 4HZIA 421PA 2IF0A 1D2MA 2HT1A 1NSFA 1E9RA 4L16A 2A7QA 3DL0A 1F6BA 3B1ZA 4QJ4A 2LWIA 2OCPA 4Q1AA 3KL4A 5FL3A 1W5TA 2ZRNA 4DSNA 4M1SA 2NOAA 1S1CA 2RHMA 1F2TB 2CL7X 4WXRA 2E1RA 2IUTA 2QT0A 2BBOA 1GL7A 5DH9A 4ZV4A 1CR1A 5J4VA 3KQLA 3CNOA 2W6JD 1GNQA 2NTYC 5KPJA 3SBDA 4TTPA 2K5UA 1PJRA 2B7CA 4JZKA 1U0HC 2V8OA 5TV2A 2GK7A 1KO4A 4WA7A 3I62A 1I4DD 2WJHA 4DDVA 3MCAA 3EWAA 1E2FA 2VP6A 2V1UA 2XGJA 2REXB 3AKYA 1E4VA 3R9IA 2FN4A 1II9A 4F4IA 2ZI6A 4IFBA 4PX9A 4BECA 3GP8A 1M6NA 4IVRA 1CR4A 1TEVA 3F0TA 3C5HA 1TQ4A 5IK2D 1WA5A 1ZCAA 3LBIA 2V6IA 4NYMR 3PR1A 4ZPXA 2GJAA 4IHQA 1UKYA 4DXAA 5JI2E 3UPUA 2VA8A 4XOIA 3E2IA 4ZI2A 3WYAA 1F3OA 4B44A 3O8DA 4LRWA 4EPXA 3H1TA 3GLGE 1FNMA 5AUPB 3AVWA 5KNCA 2G3YA 1KY3A 1UEIA 2IXGA 4OQXA 4IDHA 3CUEF 4DEYA 5DIFA 4BGDA 5EXXA 5C18A 5FPYA 4POAA 2IUSA 1G64A 1U9IA 4OHXA 3HU1A 2IYSA 3MMPA 1RRGA 3B2EA 4OHZA 2VP9A 4AKEA 4N1AA 4IXMA 3U7GA 5B57C 3SI7A 5KDDA 1GNRA 2Q3FA 2BBSA 5KNDA 1CU1A 2GA8A 1P2UA 2QGZA 4QBFA 1CJMA 3IUYA 2J0SA 2ZYWX 3DPUA 3IPXA 3SHFA 4ASUA 2B21A 3H2YA 3HPRA 2IYLD 2GDJA 1Z83A 3OE7D 1F2TA 2CVHA 3NHAA 1VIAA 4KJZA 4Z1MD 1JPNA 3R9WA 2JLUA 4A0RA 1M8PA 3ADBA 1AA9A 2XOKD 1FMJA 4TTQA 2D7DA 4WZ6A 1XDBA 4RD1A 1E1QD 2JLSA 821PA 3PEYA 4C3ZA 4B74A 3FE2A 3FWYA 3UMRA 1GSIA 4D0NA 3NBYC 5AUOB 3A1UA 2R6DA 3P20A 3Q72A 2DFTA 2HEIA 4I1UA 1KKMA 2OCBA 2OFXA 2J41A 2XX3A 4UNNA 4D82A 3O47A 121PA 4JVLA 2P5SA 5D3MA 1G16A 1NVXQ 3PQCA 5E7JA 1Q44A 4QJ3A 2PCJA 1QHYA 2C96A 3SQWA 3QKUA 4B75A 1P2TA 2XEXA 4PAOA 3RS7A 4MUAA 4BLRA 1Q12A 5GJBA 5KYKA 2JJ8A 3TKLA 1KO5A 1P3JA 1A2BA 2VP5A 3Q9LA 3TR5A 5FTKA 3TQFA 5JMTA 3ZH9B 4PSVA 1YRBA 3CF6R 1GNPA 1VYTA 2QU8A 5CM9C 4MDFA 1YZGA 4YONB 1KNXA 4B76A 1ZUHA 2CE2X 1NY6A 3R7WB 2WJJA 1JQLB 2Q9CA 3IQXA 2I4IA 3SNHA 4DIDA 1OIVA 4DVGA 3T1TA 2BJVA 4DWJA 2ZIAA 4CGZA 3SYLA 2NO9A 3FVQA 1KSHA 1EWQA 1JR3A 2WJVA 2FF7A 1N6IA 3UWKA 1TF5A 3NH9A 4O3MA 1JECA 1DE0A 2Q3HA 1E9FA 2GCOB 5F9HA 3BS4A 2AD5A 4HATA 1VKJA 1AZTA 2AWNA 1NN5A 2R44A 2O5VA 3RDPA 2YZ2A 3RHFA 3RS3A 2FMXA 1Z22A 4DLXA 4DCSA 1DPFA 2GVDC 4Q4AB 3OFND 4CRWB 2OCYC 1E9BA 1GZSA 3OF5A 4LV8B 4QRHA 5FUWA 1AZSC 2F9MA 4Q1BA 5CYOA 1I4LD 1W2HA 2JIZA 2Q21A 3K9GA 2FFAA 3NHBA 2NPFA 3U3OA 2AHOA 4RFSB 4Q9LA 4XVQA 4M1WA 4X8LA 3RS5A 2GHIA 4O2RA 2NO1A 1SVLA 5J5CA 1G291 2JA1A 4B47A 3PVSA 5K8LA 5CJPA 2R9VA 3HWSA 1EFCA 4LX0A 2A5GA 1VMAA 1SVKA 4UXHA 4L9WA 2IF2A 1VCMA 2A78A 2OILA 3LBHA 4IVQA 1JNYA 2BIFA 2OM2A 1NG1A 2V9PA 2VHJA 5CLLA 3FDIA 3VFDA 1Q20A 1E79A 4WVFA 5BN4A 2JLXA 1XCPA 3FGNA 2FSHA 2Z4SA 5DN6A 4L8GA 5E7MA 4Q9JA 1QG2A 1IBRA 1DAIA 1G6HA 2YOHA 4PC6A 3P4YA 5TB5A 1W36C 5A5GA 3MWYW 3A4MA 3K53A 4LUCA 1ZNWA 1LB1B 1IJEA 5HCIA 1FUKA 4B6EA 1MRNA 3C4JA 3GMTA 4MA4A 4Z8YA 1VCNA 3MD0A 3AP2A 3R7WA 1JR3E 3GCGA 4LHYA 5E7IA 4I1VA 1I2MA 2BBWA 3NDPA 2ORIA 2GJSA 3LXRA 3VX4A 4QJ5A 4OQFA 1EX6A 2O8CB 4B3CA 1GRNA 2RKOA 2NGRA 4IOMA 4JL5A 3DMDA 1QZXA 3MG9A 1Z63A 2VTKA 2GEDA 5K8IA 5FI0B 2R6GA 5EZ5A 3NWJA 3MFYA 2GCOA 3VNVA 4Z51A 2JAQA 2ZJYA 1LS1A 1G7SA 3N2EA 4OHYA 3QBVA 4FMDF 3U3MA 3GFPA 1G3MA 1P5ZB 4E03A 3AF1A 3LQRA 4FXPA 2REBA 1R10A 4Q4AA 3KKQA 4L15A 5J4HA 4OL0A 3KDSE 4YMTA 2ZREA 3BERA 2KE5A 3LQQA 1GFIA 4MYHA 2FG5A 3UG6A 1S4QA 1BH2A 1ZW6A 1J70A 4JLBA 4HSEA 3THXB 1QHSA 2P6RA 3MJHA 2NIPA 5H70A 2XZPA 1G6OA 4CVNA 2IUUA 2VF7A 4YMUA 2ZJBA 3LY5A 1Z47A 2EQBA 3W5IA 2UKDA 1KJZA 1DOAA 4PAQA 4MDEA 1E94E 4MGIR 1A7JA 2IEZA 3PUXA 4MRNA 1IJFA 3TRFA 4IJMA 4ON9A 3K0FB 3ZIAA 4Q47A 5HKKA 1RPZA 4KI0A 1VG8A 2W2TA 4ABYA 1KNQA 5A0FA 1VYUA 3L82B 1XZPA 4NZYA 1ZNXA 4W9MC 1EFHA 4RCZA 3TR0A 5FOUA 2CLSA 1NNEA 4XIGS 4XH9B 4GMXA 1ZIPA 5JFGA 1G7RA 5AJYA 3IEUA 2DFNA 3U7HB 4DCVA 4GRAA 4C0JA 1SULA 4V03A 2X8AA 4JVSB 1VHLA 1UPTA 5HCNA 4BLOA 5FBRB 1M2OB 3K70B 1DVRA 2DBYA 4RZ3A 4AD8A 1OF1A 2ERXA 4NE2A 1IQPA 1NIJA 5FL7A 1OPXA 3BJIC 4BZQA 4IW3B 1G9XA 2EU8A 5FPKA 5J40A 1PZNA 1ZMXA 2MMGA 1Z0IA 5KO2A 3VKHA 2WIBA 1GG2A 1YKSA 2OAP1 4YQFA 2FOLA 5JEEA 2OZEA 3GD7A 4BRWA 3QKSA 4PR0A 3G5UA 4XSGA 1A4RA 1VECA 2AR7A 3L43A 1R4AA 2V7QA 4WXPA 1P72A 2C9OA 3B60A 5KDLA 3K0CC 2FGJA 1LFDB 2JCSA 2W0SA 4GL2A 1E0JA 4GNKA 2NO7A 2WWFA 1Z2AA 2FEOA 2H92A 1U90A 2CXXA 3N5CA 5DHFA 4BPBA 4TYWA 3MAAC 4AKGA 1S3GA 3TBKA 4JSTA 1HA3A 3F3YA 4A0GA 2C04A 3NC1C 3TK1A 3U3JA 4B3BA 1W7AA 2GZDA 4LHWA 4NYJR 3TNFA 1XRJA 2ODNA 3MSXA 1N25A 5BYJA 4KCGA 3EASA 2IWRA 2DWPA 2VSXA 1Q3HA 2ZR0A 2CDNA 4QHYA 3K0FA 4Q18A 4AYTA 5FFMA 4I99A 1XXHB 5TY0A 2O8EB 1IN5A 2G0TA 2ZSFA 1YZKA 1IN6A 5FTMA 4FMCB 4CIDA 3CWQA 4ITRC 3G82C 1GM5A 2AXPA 1YZLA 2BV3A 2IYXA 2W2VA 3P4XA 1JXOA 5JLJA 3QPWA 3FB4A 1R0YA 3VTKA 2PL3A 1A5TA 3AM1A 1N5JA 3B1YA 1L7VC 3X2SA 1GAJA 1NBMD 3FYHA 1RE0A 2A3RA 3OEEA 2J5XA 1KYIA 4A0HA 3EIQA 3CH5A 4B3GA 3LO5A 3GQBA 1HURA 3AV0B 4A1FA 2QP3A 5BN5A 2D7CA 4CEJB 3U7FB 5F9FA 3AVOA 1II8B 1G3QA 3GEIA 2J46A 4NPHA 5L3VA 3M6AA 4B34A 1M1YE 3TJZA 2OV2A 4G5GA 1SXJB 1P60A 1H8ED 1OIWA 1P61B 1XWIA 1US8A 1RJ9B 2OFOA 3IBYA 1NMZA 1TQ2A 3ND9A 2JEOA 2XB2A 5E3HA 1N6NA 5AUNB 4KSBA 1E2DA 1Q1BA 1WXQA 2ZRGA 1DAGA 5JI3E 3CRQA 2NZJA 1G5TA 2BOVA 1VCOA 2WM9B 3DM9B 4FW9A 4KLNA 1ZM9A 5FBWB 2L0XA 1UKVY 1KHTA 2V3CC 1XTQA 2JLQA 1ZINA 1CBUA 5BQ5A 2ZJ8A 3B82A 1NG9A 4LJ7A 3LLMA 1QHNA 2DWOA 1KI9A 1H8HA 3ZZTA 3O8BA 4CEIA 3GJ5A 3GPLA 1AGRA 1W0KA 4Q00A 2ZEJA 4IEEA 1D9XA 1KO7A 3EIHA 3U5ZB 1D2NA 3C41J 3ZVRA 1XF9A 4KFTA 1VTKA 5DLQC 4LYJA 3LXXA 3FMOB 3MJRA 1ZD8A 1ZU4A 4BLSA 5GJVC 2BCGY 1ZM3A 1XPRA 2V1XA 3REFA 1T9HA 2W6ID 3ZZ0A 1QHGA 1E2IA 2G83A 3BRWD 5EP3A 1IY1A 5KUTA 2N1BA 4RKEA 4JMPA 4LJ8A 3A37A 1UF9A 1XXHA 2KB0A 1NN0A 2O8EA 1XTIA 5C4GB 4NYMQ 3T06B 2IW3A 2CE7A 3A8TA 1KI6B 4JKYA 4ZDKA 4A36A 3OIYA 4GT1A 3DDCA 1AN0A 2JJ1D 2ODWA 1SVSA 2Q9AA 5GVRA 2BMDA 4YMVA 1JALA 4H1VA 4HAVA 3AKCA 1HYQA 5EE5B 2ZE5A 1N6RA 4BEJA 3PUZA 2GXSA 2BKUA 1JXMA 4YDHB 1X8JA 2HLDA 1UEJA 1GP2A 1K6MA 1RKBA 3WHKA 2QUZA 1QHIA 3NH6A 3W8NA 1MR3F 4LBWA 4P4SB 4UNRA 1MO3A 1XJ0A 4JT4A 3SYKA 4EPWA 1WB9A 3KTAB 2FZLA 1VDZA 4TLBA 1W1WA 4CEJA 3CR7A 5L3QB 1II8A 3MUFA 3QF4A 3M4YA 5L8VA 3VHXA 4YMWA 2ZSAA 4A6XA 1SXJA 4TLCA 4BFTA 3ZS9A 3R20A 4V0KA 1RJ9A 1WRBA 3OAAD 4URVR 2SHKA 4HLCA 2W00A 1GKIA 5JWOA 1TQDA 2HF9A 1W2GA 3M0EA 3T1VA 1XP8A 4NYIR 3KJEA 4Q9IA 1XCMA 1BOFA 1Z5ZA 3RLFA 1A2KC 2IC5A 1IXSB 3L0SA 1TX4B 3QKTA 1AQUA 2ORWA 5GJWC 1M7GA 1DG3A 2OLKA 2BM0A 4CF7A 4JLDA 3TVDA 4DDTA 1ZAKA 4TYYA 2C8VA 4RZ2A 2FFQA 4CZ2A 4LI0A 3B6EA 3KJIA 2ZJZA 1FNNA 1AS2A 2GRJA 3GLHB 3WRXC 1G8HA 3CBQA 2PZGA 4FWIB 2WVJA 1XXHE 4M2LA 2GEUA 3NIBA 2ZYTX 1GILA 1KTVA 5FBQB 5JWRA 3JZAA 1OH7A 1R6BX 4JKIA 5JS8A 2C99A 2QMOA 1D9ZA 4PQYA 3WBKA 4NP6A 1Q1EA 3OZXA 3UK6A 3EA0A 5JEDA 2UZ3A 3A1SA 4CW7A 2LKCA 4PPQA 1Q0UA 4KLZA 3EX7C 1SVIA 4RJLA 5GVSA 4MGZR 2P5TB 2WSMA 3EW9A 3A58B 5F98A 1E9CA 1E9SA 2CCGA 4V0NA 1LVGA 2MSEB 2J3EA 2A5YB 4AC9A 2O8FB 3PXGA 4P4SA 3U3RA 1R5NA 1W44A 2IWHA 4U5XA 4TT3D 3I92A 4BUJA 1SXJE 3Q7PA 2PEZA 4X8HA 1U81A 2W2XA 1TEXA 2WJIA 2BC9A 3EPKA 1K5GA 1G21E 1M34E 3AEZA 3SHWA 2D62A 3EXAA 5DI3A 4DHEA 2V4ZA 4IEIA 1JBKA 1KO1A 4N3NA 4D26A 1G4UR 2XITA 1EFTA 1KI7A 5DGXA 4TSFA 1GUAA 1G8PA 2FPMA 4JVNA 4F93B 3EZFA 1CJVC 1Q21A 5TARA 4GP7A 1KMQA 1OFHA 3K9HA 1AIPA 2PLFA 4LC1A 1KDOA 4OYHA 3KQHA 2QEQA 4JJZA 3NTUA 5D3QA 2MSDB 2XNSA 2IS2A 2XJ9A 3QIAA 4QNRA 1X3SA 1V43A 1RW4A 2C5LA 3KFXA 2J7KA 3GLHA 2WWHA 1UBGA 4A4DA 4KYUA 4M9SA 2ZR9A 1MO5A 2WWIA 4TMTA 2ZSBA 3KXLA 4K46A 3B8HA 3D8BA 1W4RA 2X19A 1KI4A 5KPDA 3KUCA 3WYFA 4IXNA 3DHWC 1DO0A 2CL6X 3UIEA 1G7TA 2JLYA 1W47A 3SC3A 2OBNA 2CL0X 3CWZA 3I5YA 1AQYA 2QBYB 4FINA 2NQ2C 2IHYA 1HT2E 3QBTA 4BFSA 3ZGXA 1LS6A 4HZUB 2HV8A 3IIJA 4JT2A 3VNUA 5EP2A 2RHDA 2O8FA 4PC3A 4W5WA 1TQ6A 1JR3D 3FKSD 3TSWA 4LPSA 3U7EB 4LYFA 2DCUA 4QNMA 2WICA 3RWOA 4O25A 4R9UC 2YOGA 3VR6A 3FHOA 1EWRA 1Z8FA 1QF9A 4J0QA 4KSCA 2VL7A 3VAAA 4LBVA 1ZU5A 2H18A 2O52A 2VHQA 4IKEA 2GEVA 5DE3A 4JYBA 2NO0A 1NN1A 4G5OA 3WRYC 3F8TA 1WCV1 4JL6A 3U6BA 3PEWA 5DNYB 3K0EA 2JIZD 1V5WA 1AM4D 4FN5A 3VQTA 1E4YA 4TLDA 4YDSA 2HCJB 3KKPA 5FH9A 3KXIA 1J8MF 1ZP6A 2JDIA 3AQ4A 1E2HA 2J1LA 5D3MB 2XSZA 2WJGA 3T5DA 4BFUA 1U98A 5HZHA 3GLHE 1BMFD 4NCIA 3NBZC 1E2PA 1FPMA 3L0PA 3NG1A 4NCJA 2VSOA 1P2SA 4UNSA 3QEJA 1OIXA 4A6PA 4C9BA 3U61B 2ZVPX 3K09C 4OI1A 4LBYA 4G0NA 2WWYA 4URYR 1I2DA 5JS7A 1E79D 2RGXA 4I81A 3O8RA 2OFWA 1SHKA 2A5DA 5DISB 1JAIA 4HDOB 1G1MA 4HUQA 4TL9A 5IF9A 2IYTA 2NMVA 4MGYR 1UKEA 3ZJYA 1M7BA 4Q1DA 3LW7A 4FMBB 1TUEA 1KGDA 2GBLC 2YWGA 2Z5FA 2QBYA 2XNDD 4TWZA 1EK0A 3AVPA 5BW8A 1CP2A 1XPUA 1KZ7B 4IDPA 2BKEA 2HF8A 4NH0A 4HZUA 4PZZA 4GDFA 2GF0A 1N6PA 2CMKA 1OFTA 3B9PA 4JBXA 1ZNYA 2ZI3A 4PSKA 3RS2A 2H7VA 4I1OA 4IFEA 4LPKA 3V4RA 3GJ8A 2AD1A 2WV9A 2VHUA 1OHHD 5AK0A 3P1JA 1FP7A 2DWQA 3IQWA 3UATA 5IT5A 4M1KA 4RZXA 1R7RA 2F3RA 2ZUBA 5CIWA 2QENA 3Q5DA 3DVLA 1II0A 4W5HA 4EJSC 4XWAA 2HXYA 3B7GA 2VLIA 4GI7A 4R2IA 4WZAE 5LDDC 2NG1A 3V4FA 5JSZB 1U8ZA 5F3WB 4PANA 2QTVB 3O8CA 3CX8A 3FKQA 3A1WA 4BZXA 5EE3A 3TSZA 3U2QA 4EUNA 2PX0A 4D0LB 3DEFA 2A5FA 2I1QA 4TZ6A 2EYUA 3GJ7A 1YVDA 5LPNA 1RYHA 3U4QA 2GVZC 3RNLA 4TLEA 4HB3A 2ZS8A 3BH7A 4OJKA 3EG5A 3CNNA 2QAGC 5ELXA 1R5BA 4RVCA 2QL6A 3CB4A 3TUZC 2RGBA 2D2EA 2ZE7A 2ZRHA 1I4TD 4Y0VA 3OIVA 5J47A 3EIEA 4OI4A 4C2UA 1IY2A 2HJGA 3GEHA 3TMKA 1IHUA 2F3TA 1SVWA 2YC2C 3V9PA 5BN3A 3KB2A 2ZVQX 2GCPA 3TW8B 4JYCA 2R6AA 2QY9A 1N0WA 3LDAA 3W90A 1CIPA 1WDTA 1J2JA 5EE9A 1PLKA 2NO6A 1TF7A 1N6HA 2GNOA 2UVQA 2FDCA 2PMDA 2QPAA 5JHGB 1W46A 2F1JA 4O0MA 1M74A 2X2FA 1E98A 4LJ6A 3DOEA 2F1RA 3LWNA 1F48A 5FUYA 2BEKA 3CR8A 1AGPA 5HR5A 5FUVA 3ZQJA 3CPEA 5GJCA 5CM8B 2P2LA 1OKKA 2ZXUA 1TAGA 1DTSA 2XTNA 2ERYA 3SR0A 2G77B 4XVUA 3SJCA 5KSZA 4F7WA 1HQCA 4D25A 4US0R 1T5IA 1Z0AA 2IBMA 1DAEA 2Q3MA 5FPHA 2OXCA 4DLWA 1HE1C 4TQAA 5JSZA 1ZM2A 3ETLA 1OT3A 2W6JA 1E2LA 2LKDA 3HYRA 4RZUA 5DO9A 3SZRA 1RFLA 3QJYA 3X1DA 1FUUA 1JEEA 2CCJA 5CLQA 3DKPA 1ANKA 3Q5EA 3SFZA 1OFIA 2H5EA 2J9RA 3GFOA 3IDQA 3AVYA 1P6XA 2ZSDA 2J59A 2ZRAA 1X1SA 5EJEA 4XJXA 3T1OA 2Z0MA 2CJWA 2QQ0A 3I61A 2QP9X 1TU4A 1ZBDA 1E99A 2B8TA 4ARZA 3RSOA 4AKHA 2O0JA 2AKYA 1W0JD 2EWVA 5P21A 2C9CA 2CLCX 3DZDA 5IK2A 2B6HA 1XEWY 2VF8A 3BXZA 4RKFA 3QXHA 4QBGB 2VP4A 1KAGA 2GJKA 4MYTA 3QY0A 4AIIA 4I1SA 2WZQA 2WKRA 1F2UB 2AXNA 4B3DA 3IIMA 4A8JC 1EFRD 1JR6A 2VPPA 2IK8A 4KAXA 2IYVA 4HAZA 3L8YA 4ZDJA 4TMWA 3RSLA 2ZM5A 3MLEA 1P9RA 2CCKA 2DY1A 5G53C 2VIIA 2Z83A 4ZKDA 3KQNA 5HE8A 4YXWD 1G3UA 1LV7A 4JVMA 4XD7D 2G88A 2QZ4A 3CF0A 3AKEA 3QKSB 3LAWA 2RGNC 4MKHA 4LJ4A 5EUMA 2WIAA 3CLVA 1OE0A 1UJ2A 1FZQA 2QE7A 5E4FA 3I5XA 3GLIA 2YWFA 1D6JA 3W6PA 4E07A 3DM5A 4Y0AA 4IOKA 2ZTSA 3Q8XB 1U8YA 5SZHB 1RYFA 1KO8A 1GKYA 3FMPB 3FPAA 1G8GA 1G8FA 1T3HA 5FR2A 4A82A 5KNBA 4CEHA 1J7KA 3CRRA 3FMIA 2CHQA 2Q0HA 5AR1A 3K0CA 4LSGA 1PVOA 1YE8A 2IL1A 2FSFA 2PBRA 3BK7A 3PITA 3ZYCA 4D4KA 2XXAB 3BD9A 3OE7A 1DEKA 3SJBA 5C46F 2XZOA 4OQMA 1E1RD 2CHVA 3G0HA 3AVVA 4Z1MA 1WE2A 2ZITA 1W0KD 5FBVB 1R2QA 1MABB 2XOKA 1R0ZA 4LGMA 2ZJOA 2QPTA 1CR0A 1E2KA 1E1QA 1XX6A 1N5LA 3MRSA 3PG5A 3ZVMA 1R8QA 1S1MA 2QM8A 3IKJA 4XWKA 1OJLA 4Q5IA 2F9LA 2FA9A 1F5NA 4MKGA 1OXTA 1Z0FA 4MYUA 5F2EA 5L3RA 1OH6A 4DLVA 2QNRA 3AB3A 1XB2A 2WWWA 3ND8A 1Z06A 5B2ZA 4ZDWA 4LYAA 4UNQA 4D6PA 1JPJA 4UKDA 2IS6A 3BFKA 3DOFA 2C77A 3WP1B 1F2UA 1QBKC 3F5FA 1Z0JA 3NDBB 4ACBA 3JVVA 4DDWA 4TN1A 1O3YA 2ZYVX 4DEXA 5G3YA 2ZANA 4LDJA 4CDGA 3K1JA 5EZ6B 4PTLA 1T5LA 2IYZA 4MQBA 1YR9A 1US8B 3WY9A 3U6KA 3PCRB 5FOVA 3CX7A 2REOA 1SVOA 4Q7JB 3CRW1 3GLIE 1CXZA 3RWMB 3QNUA 1L4UA 2BMFA 2ZS9A 2ZYUX 4C0SA 3U3KA 4F4CA 3RRNA 4WBSA 5JRZA 1CKEA 3KKNA 4PPGA 2GWHA 5JJIA 4AG6A 4C7OA 5JJLA 3T12A 2GKSA 4G5SA 1SXJD 3BIFA 2ODBA 3VKGA 3IHLA 4GOJA 5KDOA 3ZVNA 4X8OA 1WBDA 1BYIA 2CLDX 3B1VA 3CM0A 3TE6A 1BKDR 4CEIB 2WHXA 1CEEA 4DIEA 1NVVQ 4DLUA 1YZUA 4OBEA 4P4UA 2J7PA 3KKMA 4KVGA 4LY6A 1WF3A 2FWRA 1YU9A 3OFNA 4RD0A 3AUXA 4AYWA 1A82A 2MMCA 2XXAA 3I4LA 1NSTA 3AF4A 3BAFA 4OI0A 4LJ9A 4NMMA 4Q48A 2WOJA 2R6FA 3RS4A 4UJ3A 2WPDA 4Q02A 2OUKA 2ATVA 1YRAA 1SQ5A 1XD2A 1MABA 4PFSA 1MKYA 3LX5A 3HR8A 3I32A 3QXJA 4HYYA 5LBIA 1KY2A 1Q3TA 5KU1A 3IBGA 2N42A 3OHMA 3VR5A 5EXSA 4B48A 4XWOA 4PO1A 3CF2A 2O8DB 2Z43A 3K0SA 1N6OA 1U2RA 2B7BA 3QOFA 1LF0A 4RD4A 3RANA 5J4LA 5JJKA 1GRRA 1OXXK 1COWA 1HE8B 1G41A 1T8UA 1GL6A 4QFMA
chains in the Genus database with same CATH superfamily
4UZSA 1BS2A 1KS2A 2GARA 1P62B 1Z7Qc 2WB7A 4HQ6A 4YMHA 1X94A 3IPAA 1QFJA 5DLJA 4GZ6A 1SUIA 2DWUA 4D8UA 2A92A 2X5OA 2WRZA 4CMEA 1XPOA 4MW4A 3UXMA 3HPQA 2IHKA 4KVZA 4TN5A 5KTNA 5AOCA 1GFSA 3AFGA 4MKIA 1ZM4A 2BLNA 3SVZA 1RKEB 2HNKA 5BYAA 2Q3JA 3WA7A 2CJFA 3DGFC 3KPWA 1XTKA 5KYYB 1QDEA 3SYNA 1N2CB 5COFA 1BU5A 3INYA 2N46A 4BYMA 2D06A 5B3JA 2GAOA 2BEUA 4L02A 4PC1A 3LO8A 1OWPA 3V1LA 5EJ9A 4K9MA 3VR3A 1R00A 1EE2A 1LDBA 3AUKA 5DDIP 5E1MA 3C3DA 1XROA 2IT1A 5KSYA 4BNLA 2ZRJA 1P7ZA 2NO5A 3ZC3A 4ISCA 2O9XA 1J00A 2IEIA 3OEOA 3Q9NA 5CLIA 2APJA 4JYZA 3USCS 3U8PA 3IAM6 4CN9A 1FFEA 2PAFA 1NKTA 3W3ZB 3AGQA 1PR4A 6AT1A 1X6VA 1L2TA 1Y37A 4LV5B 4RA9B 3L8CA 4X1YA 4U5QA 5LP6A 3T9OA 5J4KA 4TMKA 3A06A 4GBED 3N75A 3VTFA 5ITWA 1TIKA 3A4NA 1YFZA 3DAFA 4AWBA 3WNBA 3TG8A 4YJFB 4IVPA 2IPXA 5D3ZA 1H8EA 1U0JA 4WZAB 1C0LA 4UEWA 1ZN8A 1MT3A 4P86A 4K6MA 1NJ2A 1QHHB 1SZPA 3C3PA 5KHAA 1UZAA 3RIXA 3PPIA 5D7BA 5AC4A 4LDZA 3BHMA 3ZWNA 2C94A 5C5EA 4P9NA 1P7CA 4KITB 3CF4A 3CMMA 2R8PA 2RH8A 2C2OA 4ZCMA 4HUQB 5L9AA 1EQAA 3PNBA 3AHDA 5AJTA 4INAA 3D0OA 3OD1A 5FFNA 2V55B 2COEA 1MEEA 3AU8A 1V4BA 3FJ1A 4JQSA 3PF8A 5C7YA 2RB4A 3PVZA 1QAOA 5B1EA 3TQTA 2DT5A 4A9AA 3TAUA 4DJ9A 3AOEA 3O4GA 3DOUA 1XD9A 2HXSA 3JATB 1DKNA 3AIIA 2ZB7A 4QBHA 3QX7A 4RQAA 3R09A 3OOYA 4CI9A 1QP8A 2AFHE 3D6AA 2NU6B 1OV4A 2OPHA 3HUDA 4KDFA 5IWAB 2QVBA 4GPD1 3T7CA 221PA 3T1QA 1SO8A 2QRVA 3AERB 3I6MA 3H16A 3ND7A 3F46A 2FEPA 4H7DA 4P2BA 5DGCA 1GCGA 1YZCA 4QODA 3BHIA 1YQUA 2I7VA 4U6SA 3LH5A 3OTGA 1WKCA 4EG4A 1SPBS 5FB3A 4HNUA 2G1JA 2QNLA 5AO9A 1XHFA 1OBHA 1XFAA 2FPKA 3GAAA 1XNJA 3WGJA 2II6A 3GN2A 3STWA 4IJJA 4BNXA 4JBWA 4K81B 4L3VA 1HDOA 2J6HA 3FJOA 1D6SA 2FR8C 4Q3CA 4PO9A 2VS1A 4MULA 2CNDA 1U9IC 1MJHA 521PA 3RS8A 1WHSB 2ZB3A 3RK1A 3Q6MA 1JKXA 1KYVA 2NSHA 2Z2JA 5JP7A 4R9NA 2V7QD 3A4LA 1H1LB 1EX1A 4XM1A 3BF8A 2V9CA 5DP2A 4U2EA 4H6VA 1KOJA 3HUUA 2LIPA 2ZJAA 4DLAA 5B3SC 5IAKA 1QWSA 3OZEA 2BR3A 5KOIA 4WLUA 4MV4A 4Q93A 4OOEA 2RGDA 1IPHA 3BAZA 3D59A 1W87A 1KSJA 5G0WA 3UENA 3HNOA 1O95A 5JH7B 3MFQA 4EZIA 2X8JA 1QVRA 5DYGA 5DI9A 4YUVA 1JG2A 1NU7D 3KVRA 1JN0A 3OEED 2VHCA 4B2PA 2A6EF 2EYQA 3GF4A 5CIQA 3A3NA 1UZMA 1Z7EA 4N0PA 2B5WA 3G9XA 1P75A 2A0FA 4W6ZA 1NZFA 3QLTA 4GP6A 1IONA 5IYZA 4C6TB 4D8VA 4J7CA 1UINA 4OK6A 1RXCA 3H87A 2EJCA 1WY5A 3FBGA 1HY3A 3KTOA 3FYCA 1XTVA 3O6VA 1HM5A 3V4VB 5EP1A 3E5NA 4NOLA 3NB0A 1K1EA 3LW8A 1OW6A 2PZ8A 1YVPA 1XZKA 1Y3HA 2IIQA 4G85A 4HB4A 3PCTA 4KWTA 1U3DA 4WERA 5IH3A 3IUPA 2BGNA 1HDEA 2NZXA 4XDYA 2HIMA 1R5OA 4DV0B 1XSEA 2XLCA 1EB8A 2P3QA 2IYQA 3U4GA 4RWEA 1ODKA 4ZEXA 1VDMA 1E3WA 2YL7A 1AKEA 2VLBA 4F9FA 1Z28A 4ZU6X 1RMTA 4QXPA 1T6UA 1YCFA 2FQWA 4FKZA 1G17A 1TFRA 4V1CA 4NTAA 1W4BA 1U2EA 4FB5A 1HV8A 3FCOA 4WBXC 5CXUA 4LDNA 4AX4A 1ECBA 1MVOA 1U4SA 1KJWA 2XZLA 3QH4A 4YWQA 3CRMA 3VO1A 1DADA 3NDRA 1SXGA 4OLFA 3IP6A 4ZZ2A 1BMQA 2FWNA 2XWJI 2QSYA 3RUIA 3PXBA 3B1WA 4GM0A 4IJ6A 3F74A 2PX3A 4XGRA 3KJGA 4BTLA 3B36A 3KJXA 3RYTC 2I5PO 5GM1A 2I1VB 1CGNA 2FUCA 2PQ2A 4ZEMA 1EDEA 3HY3A 5K09A 1J9GA 3E7PA 5JSKA 3T61A 4MVJG 1MZPA 1HPLA 4D2IA 3UH1A 4EYKA 4W7HA 2GX6A 2IEDA 4MNTA 3TQCA 5FWNA 5IJZA 3LY8A 1AKVA 4TYNA 1SCUA 1Q7CA 3HBFA 3RQGA 3C4VA 3NT4A 3NXSA 2QRZA 4DMHA 1PQYA 3LCJA 3HK2A 3H5RA 3ZLJA 3NLLA 3HCDA 3HB0A 2ZZNA 4X1OA 3UGTA 2KGOA 4MUKA 1CGOA 3WHNA 2YW2A 4R7ZA 3EF3A 3KKLA 3ZKAA 4IX1A 4HFJA 5SZKB 1B8PA 2RCNA 4UAUA 4AP5A 1PLLA 4JE9A 4ZICA 4OUKX 1UXIA 4MKFA 4OBBA 3NNSA 4NBTA 3RQFA 3MRVA 1H9TA 4KGZA 2NT4A 1F60A 2XHZA 3PNOA 4GMGA 3NYJA 1HMYA 3C24A 1QNLA 2WVOA 3ESYA 1SXJC 2ZBEA 2IOYA 3L4JA 1CZUA 1TT5A 4Q7KA 3MQFA 4H16A 2H1LA 1PZGA 3JU3A 1NVVR 5E3AA 2WG2A 3U7RA 1B3BA 1D2EA 3SOPA 3UT6A 2XJ4A 5HVNA 4TQ9A 5EJ5A 4QPCA 3NBFA 4DZRA 5ALVA 4JJEA 3G5MA 4TKVB 2KQ9A 5CIVA 1AJEA 3Q7IA 2WKQA 4RTRA 5HP4A 4G7HF 1QOZA 4N18A 2X0DA 2LBPA 4IDNA 5FLYA 4BKUA 1H66A 4OQNA 1K2VN 2E0IA 5DEOA 1NSFA 1ZESA 2LWIA 1BQEA 4FEAA 4WXRA 5F1YA 4G0HA 4AY3A 4P7JA 5D00A 5THQA 3DBHB 3I62A 5F52A 4FUTA 4FC6A 5FCLA 3L05A 4BNUA 4GOOD 4JTCB 1WA5A 4D56A 1QONA 1MQ8B 4J0CA 5JI2E 3FGZA 3HDVA 2Q1TA 1FNMA 4CQJA 4O4JA 1LDMA 3ER8A 2FGYA 4ZO7A 5HFNA 3Q4GA 4YFYA 5KNDA 1D1TA 1S2OA 3E3LA 1VPVA 3IPXA 4ZGGA 3I34X 1GUBA 2CVHA 2JLUA 2PXXA 2RIPA 2NXWA 3HMQA 5CFOA 1P0QA 3EVCA 2X8JB 3B12A 3C3EA 1P33A 4FSHA 1G16A 3JQ8A 3Q15C 3NMIA 3OQJA 4B75A 3RJZA 1XA0A 2LUOA 4QLAA 3BD8A 3HVJA 2P1RA 3CF6R 4CLHA 2Q1WA 2BHNA 3TX6A 2VWHA 4FW8A 3K0KA 3TULA 5E1DA 3SNHA 4W5RA 1OIVA 1OXBA 1QQ6A 3FVQA 4LWOA 2ISQA 3VO8A 1E9FA 3KC2A 1AZTA 3FSJX 1RXIA 3E9YA 2FZ5A 5KB3A 4BRZA 2HA4A 1WCYA 1I4LD 4KOAA 4J7UA 4XDGA 2EV9A 3HCWA 1NJSA 1SN7A 2ZSUA 3ORQA 1EFCA 4QG3A 4YT2A 2XECA 1SB9A 1JZSA 1ZFNA 4JC5A 4E5PA 4X93A 3NBAA 4ZT5A 1GYPA 3RNOA 2JIBA 2QYTA 1BRMA 3CYFA 2YQYA 1DWPA 2QUHA 1TDJA 4EATA 5A4KA 1A8HA 3MWYW 3F7OA 1QIKA 2L17A 3TW8A 5K6TA 4EJFA 1J22A 3VX4A 2NGRA 5JCOC 3HACA 5IBPA 2DECA 5EZ5A 1KQPA 3A2LA 3PNMA 4DMGA 1NW8A 4R6WA 2JPDA 1FA9A 1B1CA 1HQKA 2H2IA 3DP9A 1QHSA 1Y8QB 3KR1A 4WCDA 2CC2A 2JS7A 1RKCA 3HL0A 3I0MA 1AZLA 1DV1A 2H2GA 5IEBA 5AGFA 2PSJA 4OMFG 4CUKA 2R8BA 1S5PA 3KQPA 2PKQO 4UEQA 2CFRA 3CZRA 4RZ3A 3RQSA 4JW1A 4AD8A 4I36A 2YHAA 4BZQA 5J40A 2HSJA 2ZUEA 2ISSD 4N54A 1V6CA 2QQFA 2BI4A 3RBZA 2DKFA 4GNKA 1EK5A 4BPBA 4ZVRA 4L0CA 3JQRA 3TBKA 1PR9A 3F3YA 2GZDA 2Q6LA 3OPQA 2X5NA 4BGVA 5JROA 3AG1C 1IZMA 4V0QA 1SCUB 3VJKA 3P9PA 3EGXA 2BL4A 3DEAA 1R0YA 1KE2A 3DFFA 1HYEA 3VZQA 1UMCA 4LKOA 3EIQA 3L8IA 1EFAA 2D7CA 1O1YA 2B25A 2OAEA 3MGGA 4MKXA 1TQ2A 5I9SA 5JCXA 4KSBA 1DAGA 4MUEA 2F8TA 4NBVA 4DA6A 3EB9A 3OZFA 4M0PA 1P1HA 1W0KA 1KO7A 4NZPA 4D57A 1VTKA 3LXXA 2OP1A 1XMXA 1ZD8A 4JA0A 5B1BC 3GL9A 1T6IA 3IB3A 2I1WA 3WDLA 5B5SA 3PQFA 4ZDKA 2HA3A 4XE5A 3C87A 1SVSA 4KXQA 3PUZA 2MSKA 2I2WA 1FFSA 3WNZA 4RTJA 1CUBA 1MMNA 2AJCA 4JT4A 1M1NB 3UNXA 3FOPA 5EIWA 2V0CA 3M4YA 5JALA 1FXWF 1K0UA 4HLCA 5JWOA 1GPH1 4OAPA 1J33A 1TX4B 3SZUA 1DG3A 4G78A 5J2UB 4RZ2A 3WNVA 2J9UA 2YJ4A 1SR8A 1PFYA 1UXOA 3MUEA 5G0SA 1SOMA 2EBWA 3WLJA 4N49A 1WIWA 2WY2D 5EJIA 2LD4A 5JBNA 2YJ5A 2FXIA 2OC4A 1NT2A 3TD7A 1LRKA 4V0NA 3PXGA 1H05A 3JXEA 2VAWA 1GZVA 3LHFA 4XEFA 3JTLO 4ZU3A 5A6BD 2D62A 3ENNA 2PUBA 1XRRA 4D0SA 5DGXA 1LBSA 5IDQA 1NOKA 5IZCC 1P8JA 2PRYA 4ARCA 5F77A 1MMFB 3OP4A 4FUQA 1R6VA 2CHFA 4YRTA 2MYPA 3KPHA 3KXLA 3IT0A 4ALIA 3BCRA 2Y0BA 1Y6JA 4O4JB 1E6WA 3RVSA 4R51A 2O6LA 3UIEA 3D6FA 4KQGA 4MI3A 4QEKA 3OECA 2OBNA 1AQYA 4Z4HA 2I80A 1WETA 4LMPA 1C80A 3AHIA 1U8CB 1EA7A 2O8FA 1W1UA 2KJGA 4M1EA 5H81A 3T3IA 1ST2A 2C3PA 2V98A 5J23A 1QYIA 3LL4A 5C3MA 1AGYA 4X00A 4YJ3A 5AYVA 4EY6A 3WRYC 3BFJA 1E2BA 3KKPA 3AQ4A 4G0WA 3ESRA 2BTOA 3TEJA 3U1BA 3L0PA 3LC7O 4URYR 3O26A 3PGJA 3FR7A 4F4DA 1ZK3A 3VYSB 2HF8A 2CL5A 4F8JA 2B0HA 1DGQA 1RAGA 3B9PA 2PRIA 1EA5A 2ZI3A 4JBXA 4I1OA 3KNZA 3H11A 2R0QC 4IIFA 3VGPA 2O8NA 4FX5A 4KQEA 4GEGA 4Y1GA 1FPQA 4YMLA 4X61A 4XEHA 4R2IA 2F22A 1JE1A 2VSNA 4WXEA 2G40A 3LM8A 4YPFA 1HZJA 2ZS8A 3FTPA 5ELXA 4D7AA 3HXQA 2PNOA 5J47A 4C2UA 4TTJA 1QKJA 2WVNA 16PKA 3CZAA 1JG7A 2GCPA 3TW8B 5AI4A 5EE9A 2NSLA 1OR3A 4LJ6A 3AUFA 4AFNA 1MTZA 4JBNA 1POWA 4JGBA 2NUPA 1F8XA 1YVEI 1MIOB 2ZT7A 3ZHVA 1SUSA 5CFRA 4D25A 1X42A 3G88A 2VZ9A 2A1IA 1W93A 1GPAA 2CCJA 3DKPA 2QYHA 3IDQA 3X2FA 3JVEA 2W11A 1X1SA 2W6NA 4MVJD 2OZVA 1LU9A 1YQEA 1ADFA 4PINA 1Q0TA 1DC4A 1H2BA 3LC0A 4K03A 5HIIA 3VXKA 3UJ9A 1U1CA 2DUWA 4J4TA 2BY4A 3OM9A 3OHPA 4MKHA 4V39A 2WSLA 2YRXA 3GH1A 3WAGA 2CBGA 3C3JA 1R18A 1YH3A 2RSLA 1U8YA 3T3EA 1CP3A 1T3HA 2IKSA 4MLCA 3BD7A 3PITA 3OE7A 4UBJA 2XZOA 5E0OA 4G6ZA 4B4WA 1RMYA 4E32A 3G4XA 5LSAA 2YV4A 3HBJA 2ZJOA 4MKGA 4EJ2A 2XMCA 1ZD5A 3EGXB 2C0CA 3OCCA 4LYAA 4D6PA 2PPVA 3S2ZA 1UMCB 2G63A 4Z9XA 3D2BA 3CGGA 3H17A 1DXYA 3WY9A 3MJFA 3PCRB 4HAOA 3TXXA 1MHTA 3CN7A 3B71A 2GWHA 2FP4A 2IV2X 4OYRA 1SXJD 3IHLA 3WLTA 2CLDX 3TE6A 2P9YA 3P9SA 1N3IA 4P4UA 2VPZA 2ZDQA 4EA6A 2FZGA 3QEMB 2ECFA 4YRJA 4UDYX 4ZREA 3AF4A 1B6RA 4AL4A 3RC7A 5KU1A 1HMDA 4OA5A 3OHMA 4DCMA 1GZ6A 2B7BA 2DYRC 4PS1A 3P5BA 5BQ3A 5HJEA 3EULA 9ATCA 5EKTA 3ONVA 3SVTA 4DSTA 4C4XA 2PL9A 5D5QA 1WZNA 3R0VA 1NOIA 4OQDA 1ODFA 4REMA 2KI5A 3M1IA 3WAJA 1FJXA 3FOOA 2J9GA 1OH5A 1SA0A 2B8EA 1JP7A 4P6VF 5KCZA 3ZE9A 3EUAA 5TPWA 1GTVA 2GN4A 4Q7LA 3FFAA 1Q7RA 1OGJA 3AZPA 5JNSA 4R05A 3WGOA 3WWEA 3VDNB 1W49A 1G20A 4GZ5A 4BQPA 2WF7A 3VNBA 2C5SA 2HLHA 1ULTA 2OHVA 1K3UB 3G9QA 3FYUA 3EXEB 1PUJA 2A94A 2Q8QA 1ADYA 3FKJA 4OJQA 4ZO9A 3S1LA 2WQ6A 4Z0TA 4AJOA 4HH4A 1X92A 1Y0BA 1DMSA 3JZFA 4MS2A 3LFUA 3I2GA 1TTTA 2WWTA 3FTQA 2JK0A 1RXWA 3AMVA 4XX0B 4MV6A 1EQ1A 4QVKA 4I6JA 2I2AA 4DUGA 2PT9A 3TTSA 3K9NA 3TQOA 2V26A 3VDQA 2QTCA 2EP7A 1G5IA 4G5QA 1O77A 2DUMA 2ZJ5A 4PQEA 2BCJQ 2ZIVB 4PYRA 1BR4A 1ORYA 3NRJA 3QXGA 2PS1A 3W5SA 4DJDC 4GZLA 2FSIA 3WGLA 5AP9A 4EPTA 3SQXA 3I9OA 2H16A 4JD5A 2VK4A 1P4JA 1RJGA 4GOKA 3WYBA 1DWQA 3ACBA 5IFKA 1DWOA 3BSSA 3QE2A 1XZ8A 4ZVKA 1I2AA 1XTSA 4JAVC 4C0XA 3C8ZA 4WIAA 4YJ3B 5AJUA 4X65B 2Q7DA 1RZVA 1DO8A 1Y7LA 3BXEA 4YBRA 2D59A 5B1HA 1WV0A 3VNSA 2GTPA 5K3OA 3KUDA 2WWRA 3KKKA 4YN0B 3UQYS 2OB1A 2H4FA 4DTIA 5CB4F 4C5BA 1JIJA 4FNGA 1Z6GA 2V8BA 2VXOA 2G1AA 3QE0A 2QZSA 4TMYA 4Q03A 5JSLA 2NXJA 1SD2A 1FSSA 3OZTA 1NF3A 2HPVA 3LNCA 2GAAA 2QS9A 3PXDA 4H59A 4EAQA 3W04A 5FBLB 1IPFA 1XJWA 3U0VA 3BWBA 2XKBA 1O9GA 4KO2S 1SUEA 1QYXA 3IV7A 4BEMJ 4RIFA 4ZYXA 1N8SA 3DHNA 1MA3A 3Q0EA 1ABEA 2WF9A 4ONEA 1A9XB 1JJVA 2ZYAA 2WF6A 2IQIA 2B78A 2GWWA 4G3XA 3BE4A 4CQMD 4HH0A 1TEZA 2AXQA 3V8PA 2SKEA 1N6KA 2D5RB 2NUPB 4KFCA 1JFLA 2Y8EA 1PK7A 2WT4A 1E6UA 1T8TA 3W1EA 3UA3A 3E15A 4E22A 3ZWOA 4PZ0A 1X1BA 3LBAA 4EFNA 4NCBA 2H1OA 2HV7A 2C2WA 2ST1A 4UTOA 1NMXA 3RR2A 3DUFA 5T7BA 1Y1QA 4WSOA 4RM2A 4C4AA 3KD3A 4OHVA 2Q7RA 1ZUNA 2JJ2A 4CLOB 3GODA 3GYBA 2PZEA 2JAWA 3QWAA 4HNTA 1XYGA 4NKRA 1L7EA 1MNAA 2ATCA 5EWLA 1GD1O 5KQSA 3ICOA 2B92A 1CUDA 3BQ9A 3A32A 3IUMA 5H9WA 5E2IA 1QQTA 3L92A 2G9ZA 4HDCA 3IPRA 1E6CA 4IIHA 2XL6A 3L0BA 5A2QA 5T8KC 4FLEA 4X95A 4BRSA 1T3SA 3AWIA 2KM1A 3HR7A 3W9YA 3HGMA 3OOWA 3ZDEA 1SU4A 4YIKA 4YC7A 3CEMA 4JSRA 2MT9A 3FVRA 1TVCA 1KU0A 1W6UA 3UKDA 2WTUA 1G3IA 1GZHB 2VDPB 1IWPB 1X1RA 1FS4A 5F9MA 2X7HA 2R7OA 3IEMA 5IAGA 3ZHUA 3VR4A 1AF4A 1NIPA 3M8KA 3WIVA 3H19A 4NULA 3E3OA 5K9ZA 3NYWA 3HU3A 1ITZA 4JI3B 4WCFB 3N6XA 1CS0A 2ECPA 4C3OB 2NV6A 2F55A 1D4AA 1WASA 2NXNA 2VJKA 1O97D 1H8HD 2AK3A 4L8FA 4RL4A 2O57A 2ZBVA 3W4YA 5DW3A 3VYWA 1TA4A 3LT4A 3BMNB 3JRNA 4TMXA 4P3OA 3HJUA 5FWXA 1CX9B 3KPVA 1E5VA 3C6MA 3PLNA 2OZPA 4AO8A 3ZWYA 2QTRA 2I71A 5DIZA 2CV0A 1Z74A 1H0KA 3G2IA 3MWLA 4BZPA 4NCXA 1A8SA 4QL3A 1I7LA 3RKOF 3K1YA 2VYQA 2NPIA 2JL1A 5DM1A 3PRKE 2VH2A 1G20B 3UWMA 4Z3DA 1ZSNA 1MH9A 1E6EA 2GF9A 1JQJC 4K0RA 2AQIA 1FDIA 4HDKA 4EKNB 3TSYA 4I55B 3WLPA 1XNHA 3HO6A 4DR2B 1RCFA 2R2AA 2HGZA 1G5HA 4IIYA 2V7PA 4CQNA 2B8JA 4B87A 4ZI3A 3V6LA 5FA6A 5T64A 5EPOA 3AG4C 1Z35A 4JLPA 4B43A 2C03A 4Z7QB 4M1YA 2YYAA 1OV6A 4S1VA 1N2GA 1VI2A 3V4ZA 1SC4A 3PQ4A 2XHEA 1KIMA 3WWPA 5ALOA 5FI1B 4PYJA 4US2R 1VLTA 3R3VA 1KEUA 2HL6A 8AT1A 1AEPA 1JXAA 1ZHYA 3GNLA 1O0BA 3L6BA 4WFKA 4MW5A 4IOLA 2WKSA 2XCUA 3GG9A 2ZRBA 4LTMA 4GPIB 4C0KA 1XVUA 4G5YA 4QM6A 4LWZA 4FGWA 1NJFA 4UUPA 1OCEA 1QLJA 3JD3A 4CKWA 5EEGA 1RI5A 3A9WA 2X0CA 3T95A 4FYPA 5KYWB 4C7BA 4Q6WA 1XL0A 2IS1A 3ZQYA 4QDZA 5E4JA 3EE6A 3EC7A 3WLKX 3WHLA 2ZIXB 2ZT6A 3DLBA 1YR6A 2XQVA 1N0IA 2VTBB 4WJKB 1X80A 3W4IA 1TI7A 2X2PA 4XQ0A 5LB2A 4W1RA 2C5EA 2ZRFA 3ESZA 5EPUA 1OB5A 1V9LA 1J39A 3KD2A 3GJ0A 4RCYA 2FSPA 3E70C 1NATA 4Y9UA 4ZEWA 4KE9A 1JLHA 4NZZA 2QXUA 4PZAA 1U1DA 1CFJA 2X6QA 2YYZA 4E09A 3I1IA 2CNWA 2Y76A 2Y4OA 3HLYA 1TZJA 4ZV9A 4BIIA 3RAPR 4GKKB 1C1XA 1W5EA 3HDTA 2WT9A 3HSKA 2BFDA 3IVXA 3NEYA 2ZOSA 2JCXA 4HJRA 2F1IA 1MXHA 5IPFA 5HE9A 3HZOA 4OXRA 2EGGA 1AKTA 2OO5A 2VSFA 1CR6A 4E4TA 2CK3A 2QI9C 1NBME 1QR2A 2UAGA 1GCAA 5AI8A 1TU3A 4Q1EA 4Z9YA 1M6TA 1ZI6A 4QGFA 2M1ZA 2O6HA 2HYIC 4L57A 3E8MA 3IO3A 2WMNB 1QTNA 1X7ZA 3ER9A 5CYFA 1QX4A 4FEGA 4PRLA 4CV2A 2QT0A 1HZZA 2W6JD 2VDQB 2Q4EA 1U0HC 4AMBA 1T01A 3KUKA 2P3OA 4BV8A 1T3TA 4ZZIA 1II9A 2H5LA 3ATPA 3GLTA 2Y0CA 4B7AA 2O3QA 2C59A 1IJBA 2VA8A 2C5BA 1GN9A 1DCKA 3PCXA 3WYAA 4D46A 1JG1A 3OT5A 3CUEF 1DRWA 1N1MA 2LE0A 5C18A 3B6IA 5FPYA 2XE7A 1EVEA 4FDTA 4POAA 2IUSA 3QVTA 1G5ZA 1BR1A 1DZIA 1J1IA 1GRVA 3ABQB 3SR3A 5IKMA 1LDNA 4KH0A 3CLTC 3NGXA 3RVDA 2GA8A 1P2UA 1QH9A 4QBFA 4FFBA 3LU1A 1R74A 3C4QA 3SHFA 3GAZA 1ENZA 4Z1MD 4A0RA 2XOKD 4JI5B 4TTQA 3OZIA 4CR8A 1V6AA 2QVCA 3HG7A 3AR2A 2BFEA 2OFXA 4WJ0A 2FWAA 2P1DA 1NVXQ 1NR7A 3OE1A 1MX1A 1P2TA 4PAOA 5CPFA 4KAAA 4RH1A 5KJ1A 3TNYA 3WLOA 3ZY5A 2R84A 3LX4A 4BN0A 4HNSA 4MDFA 1ZD2P 3FZGA 5AVTA 1CS0B 1XDWA 5AKHA 4DVGA 5AESA 4E2ZA 2QX4A 1H5UA 3VGJA 4QPJC 5K05A 1CUAA 1Y5IA 1A8QA 2GCOB 3GLRA 1NN5A 2FK7A 2R7XA 5JXGA 4F04A 3OF5A 1GZSA 2AS0A 2G9VA 1VJ1A 2PGLA 1P1RA 2NPFA 2XUKA 3ZGVA 2GHIA 1UEXC 3GY0A 5AFSA 4QYIB 3JARB 2R1UA 1UAGA 3ITFA 1T8RA 3TK0A 1B74A 3NASA 5HM6A 1Z5UA 1I6WA 5IDWA 2OM2A 2BUAA 5L45A 4F96A 4W63A 4WVFA 1QO9A 3OI7A 3KAQA 3F47A 1Y9ZA 1YZVA 2E4AA 1Z5PA 3FHJA 3L4SO 3GGGA 1I2MA 1H0SA 2HKVA 4JYAB 4OHFA 4KYVA 4QUEA 2BZGA 4LJRA 1LM3B 5K3FB 3VNVA 1DDIA 4TUYF 1F8YA 3GFPA 1P5ZB 3RQEA 2I29A 4FXPA 5HKLA 4UCXA 2DY0A 1XNQB 2FW0A 5AW3A 4YMTA 3BERA 3DVQX 4Q7QA 2JAHA 3M6MD 3MJHA 1B0ZA 1QV9A 4Q6BA 1YB5A 5DVZA 3NMJA 3S27A 1UMBA 3RODA 4ABYA 1VYUA 4NZYA 4G09A 1NNEA 1ZIPA 1LI5A 4FONA 3M9XA 4LF5B 2EW8A 2BFFB 1EZ4A 3BJIC 1M54A 2O2GA 1YKSA 4HH1A 2OECA 2VYNA 1A9TA 1DC8A 5B2EA 5K7SA 3OOHA 1TQHA 2R03A 5GAJA 3RK4A 4Z3OA 3TK1A 1G9SA 1M83A 4Y8VA 4A5SA 3QVGA 2ZXRA 1IATA 1GY8A 4MQUA 5JNWA 4FFPA 3KPYA 5GQSA 2C54A 2ASRA 2FPSA 5EUCA 4EMSA 1GM5A 2WTNA 1PJCA 2FPPA 3N3AC 4CKWB 2A3RA 3AY3A 2CSUA 4LFAB 4FI3F 2VP3A 3AVOA 3B2NA 1N78A 1EFVB 2W2KA 4G5GA 4C1NA 2PO7A 3PGMA 1XG5A 5F5LA 4CKEA 1X80B 1Z68A 2JLQA 4EX7A 1YB2A 2YFQA 3LLMA 3ZZTA 3LCMA 4O4LF 1D9XA 3EIHA 2UUIA 3REFA 5KI6A 1XKQA 1JHAA 4L95C 5L7TA 2CE7A 3D8UA 4CS7A 1B1AA 4HNGA 4H1VA 4F46A 3B7PA 1CCWA 4BEJA 3MTJA 4Z53A 3AR6A 1QHIA 3QWIA 1MO3A 4TLCA 2HRCA 3M0EA 3DWEX 4Q9IA 3FDJA 1T9ZA 4HEA1 1WN0A 4MHOA 4EGSA 3AJAA 3STXA 5LVAA 4MV9A 2I91A 4W8KA 1YJGA 2ZJZA 4P9FA 5DEIA 4EHIA 4KR2A 2GF2A 2QD2A 4DG8A 3JX9A 1KTVA 1QV6A 5HQ3A 3W8DA 3MINA 3EA0A 4MEBA 1JAYA 5HRUA 3WLNA 5B12A 3VZRA 1X7ZB 2DAPA 4MGZR 4ZVUA 5CB4A 2HJWA 3STHA 1IEWA 5EJFA 3RIYA 3D3WA 1CERA 5B7GA 1KI7A 1JS1X 3OO1A 1GUAA 5HJ7A 1GGQA 1Q21A 3S8YA 1GZ7A 4P1ZA 2AHRA 1QZZA 3BDVA 2J31A 1GG5A 4MR7A 2BGIA 3X43A 3O95A 4CKBA 2J7KA 5JUWA 3O2SB 2JBAA 1X2EA 1NFOA 1DO0A 4RUKA 1G7TA 3SC3A 4Y2TA 3KYJB 1UWLA 3H3FA 3K4HA 3VNUA 3WKCA 1SURA 5DM0A 2PLAA 4LPSA 3UXHA 2JFPA 3ZHYA 1TFKB 3LFTA 1WD7A 2JJMA 4PK4A 2VHQA 2GEVA 1RKVA 3I76A 4DRIB 3LS0A 5ITSA 3G0GA 2P79A 2PUTA 2JFXA 1SEPA 4TLDA 2BFEB 3Q6NA 1FP1D 4E2WA 3T5DA 5JCJA 2G8NA 3C3CA 3Q7EA 1PT5A 2FMKA 1CUEA 1Z4QA 4EVSA 1JMYA 4YUXA 1SUDA 1I4EB 4EBJA 3R23A 2PS0A 1L4BA 1OW8A 1M6VA 1EGQA 1U2SA 2GBLC 1WB5A 2QBYA 2Z5FA 2IV7A 2WUWE 1EK0A 3GI1A 1ZVKA 5GOZA 4NH0A 2B8NA 4KUHA 1ZOIA 3PI6A 3I9V1 1I36A 4IUBS 1K66A 1XVIA 3QMPA 5EHGA 4HYQA 2ISCA 2YXBA 4MDHA 1NU8A 3IJEB 1V3QE 2I1QA 2X3FA 3U81A 4B8YA 2WTMA 1DEOA 3BH7A 3EG5A 1G5QA 5A9TA 3EEYA 4OI4A 4MJ3A 3A26A 2WHRA 1L1EA 1NMEA 2OV4A 3HKDA 1L1RA 3OG9A 2WA1A 3AF6A 2IXAA 4Y2UA 2P0AA 2BR5A 5LZ8A 1MVNA 3R6LA 2B9EA 3GA7A 4JLWA 1L5HA 2ZBDA 2IDZA 3D5EA 1VL5A 1K7SN 5JZSA 2C2BA 2HJHA 2XYHA 1F17A 4OSPA 1HOXA 4XB2A 2WVAA 1JEEA 2H5EA 3GFOA 3ZXXA 1QIHA 1ZL2A 4BMXA 5JADA 4ND3A 5L6LB 2Y3BA 2B8TA 4FGUA 3CIFA 4LWPA 2AKYA 4UUAA 1H6GA 4RKFA 3R75A 1PDWA 3QY0A 3DAYA 3O4HA 4UASA 3ZWCA 2R6HA 3H2JA 3W2EA 1RHUA 4KAXA 1PNRA 4ZDJA 5IJ0B 4JU8A 4QDOA 4MINA 2Z83A 3C2QA 1LV7A 4JVMA 3AKEA 5I8PA 3NWOA 3CLVA 1PGQA 2QE7A 1VE1A 1XQYA 2QNIA 2YUTA 1CYDA 4Y0AA 4IOKA 1W52X 3QE4A 1A50B 5BWCA 2PX6A 1DIRA 5KNBA 1YE8A 5ELLA 3VV2A 4XR4A 1I0IA 2X0NA 3SX2A 3CUWA 3RUPA 2ZITA 5CH5A 2QIOA 2WUEA 1OJLA 5F35A 4FGJA 1B73A 1ZRSA 2Q9UA 2CNBA 3IUBA 4UNQA 3FIJA 3I12A 3A11A 1TIPA 4YCBA 4BMCA 1Z8HA 3PFFA 4MQBA 2IPOA 3HB9A 2FB9A 2XSEA 3RIGA 1EIZA 2WJ6A 3FB1A 2LK4A 4E1AA 5D87A 4F4CA 3U3KA 2O5EA 3EBLA 4V2UA 1KPGA 3DEIA 2J3KA 2P9FA 4O08A 3NR2A 6YASA 5EHQA 4TRNA 1WG8A 3AI2A 1GPYA 4RD0A 3Q1LA 2HDOA 1JH9A 2VOEA 2VHVA 1NSTA 4Q48A 3DBVO 2D5LA 3QFTA 4RKQA 3CKMA 4PGAA 3ORYA 1OCOC 5EYPA 3JRWA 2BF4A 1T25A 3A9RA 1FFTC 3STVA 1LF0A 2WL8A 2BEUB 4OSOA 1GL6A 4BTEA 4PHCA 4U9EA 2YXNA 1ORSC 2RHCA 3OPNA 3FMFA 4MRSA 5CXXA 1A1VA 2FUNB 3DXJF 5EESA 4CR7A 1D5CA 4Y9RA 1VGQA 3KEGA 4KQCA 2C3OA 3KZMA 3ZWPA 4JOBA 2IFTA 4KE6A 1NC1A 2R48A 5LQMA 4E1BA 4Z49A 5KYGA 1VYVA 4LA4A 2H17A 3ZR4B 4H6XA 4JC7A 3D6JA 1HKHA 4IQFA 3D5TA 5C32A 1ZQ9A 3GFSA 3S84A 1I9GA 1X7XA 2YWRA 1PV4A 4X1YB 5LP6B 4LECA 4U5BE 5BOVA 2V45A 2IYOA 4N3AA 5H59A 4NG4A 5KS2A 3X1XA 1CY2A 1CWUA 3N6RA 3V00A 1XZDA 1JVSA 3OT4A 3Q9UA 3D3WB 3PWTA 3W5CA 3VAZA 3AR4A 2B5VA 2E6KA 3F6CA 4HAWA 4XTRA 4LQCA 1MV8A 3GJ4A 3CLTD 5L0JA 3TLKA 2Z1MA 3DTVD 3T7EA 4MR7B 2P9HA 1QB7A 4TV8F 2AR9A 2JAUA 4IWYA 4D41A 2XH8A 4YAFA 3W34A 3TEMA 3W2VA 1S2MA 4FD3A 3ES9A 2QUIA 1GYRA 3I04M 3OLVA 4N03A 5EVJA 2X9NA 4Y1EA 5FKJA 3G8DA 2V6JA 1B26A 2JASA 4ENSA 3OOEA 2E9SA 1CDDA 2WILA 4GLLA 4K9OA 1PR5A 4RDAA 2H4WA 3D8SA 3VA7A 1WUIS 3HJAA 4I4TF 4CHTA 2OQ2A 1WMBA 3VR1A 3A4IA 2AMFA 3UANA 4DZTA 2H4ZA 4KREA 1XHLA 3WB9A 1CQWA 1T6ZA 3JALA 4U2GA 1KJYA 2NZUG 3X2QC 3O84A 4PS0A 2VJAA 1YZNA 3NEPX 5TXGA 2B1IA 4QEDA 4CL2A 2QRVB 4J2OA 4GL4A 3OMXA 3UMFA 4WHMA 1NX6A 4AZTA 2OYSA 4KNVA 1PAUA 1KHHA 3G7UA 2FZKA 3ERCA 1YB4A 4Y6PA 3EGWA 4OHUA 3VNAA 3C1AA 1P4RA 4DCPA 2RGRA 2OYCA 3Q87B 5HRCA 5C4IA 1XMSA 1XEXA 5F3RA 1T4MA 4JLAA 1HL7A 4OHWA 5DCLA 4HG2A 4IXTA 4LHXA 3OUUA 1LC0A 2HMVA 3GZTB 5EFZA 3RIHA 1NFNA 2A1DD 3MC1A 1IEXA 3F5DA 4E5DA 4I44A 2X2OA 4JJ4A 2AG5A 2CEKA 3OU7A 2Q62A 5T6BA 1JPUA 3SQNA 3SX4A 3E5MA 2QROA 4HX5A 2R96A 1Q16A 1JYFA 3ZTZA 4LC9A 4ZGBA 3H2GA 3OLXA 3MJVA 3GLFE 2J48A 1GADO 2QQGA 3MTDA 3F1KA 4G97A 4M9ZA 4OQPA 1XNGA 1O58A 5K0GA 4LOAA 1RRPA 1JSLA 2RI6A 2G5GX 3RIPA 2VJDA 5F33A 2G07A 5T1DB 1LKXA 4WRRA