1ZU5A

Crystal structure of ftsy from mycoplasma mycoides- space group h32
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
309
structure length
309
Chain Sequence
HPMEKAMLKSAFNFSKDIKKLSKKYKQADDEFFEELEDVLIQTDMGMKMVLKVSNLVRKKTKRDTSFENIKDALVESLYQAYTDNDWTNKKYRIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAGATQQLEEWIKTRLNNKVDLVKANKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKIIQQVEKSAPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLLAFDIDQYIVHLSSGFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ftsY
publication title Conformational variability of the GTPase domain of the signal recognition particle receptor FtsY
pubmed doi rcsb
source organism Mycoplasma mycoides
molecule tags Protein transport
total genus 115
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1zu5A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zu5A02
5JZVA 1YE8A 1T3HA 3KX2A 4OI2A 4BECA 4EIWA 4MYUA 4NCNA 3QKRB 2GJSA 4DC9A 4G5SA 3I32A 1ZNYA 4V0KA 4D4JA 2JCSA 2FPMA 1KKMA 1QHIA 4BZXA 3LLUA 2V3CC 1NBMA 2ZRCA 3SYNA 1Z3IX 1U98A 1GL7A 4JLDA 1P62B 4JZKA 1E69A 3ZS9A 1Q22A 1NN3A 4NCJA 2IYWA 2QBYB 3LBNA 2WJJA 4US2R 2BBTA 2AN9A 2IL1A 2NTYC 2NGRA 4AD8A 2VSXA 3AKYA 2GCOB 2PJRA 4JJZA 4BQSA 2P65A 1ANKA 2DHRA 4HDCA 4GNKA 2FFQA 1TPZA 4FMBB 3FE2A 2A3RA 3AKEA 3GLFB 3BWDD 4B3BA 2QGNA 1GVNB 4AURA 1CRPA 2FZLA 4V02A 4OHYA 1G64A 3NBZC 1P9RA 1IOZA 2QM8A 1W44A 5F98A 1P3JA 1T5LA 3LV8A 3PR1A 5KDOA 4R9UC 3B78A 4KI0A 4Z8XA 1RRGA 3QENA 3S1AA 2GNOA 2EU8A 421PA 2YZ2A 1KDRA 2DFKB 4TYWA 1C9KA 4GBMA 2ATXA 3AF2A 2FFHA 4DSNA 5LPNA 3EC1A 4FMCF 1PLKA 1O87A 4L9WA 4NCKA 1G19A 1VTKA 2N42A 5KUTA 2BMJA 2XNSA 4OK6A 1KJWA 4PZYA 4C7OB 4QGGA 3LQRA 5EUMA 3TVDA 2R65A 3U3RA 2IUTA 1DAMA 2R6FA 2Q3MA 5JI3E 1T5IA 5FBRB 2VQSA 2DWQA 1CULC 4KJZA 1TEXA 1UF9A 2GXAA 1PVOA 4JL6A 1NLZA 4A92A 4BZQA 2H18A 4ZDKA 2YOGA 3SI7A 2IHYA 2FPLA 2F1IA 1UBGA 3AV0B 1G8FA 4FXPA 3K0FB 5FI0B 1GFIA 3QG5A 3K70B 2XB2A 1VHLA 2PLRA 2G83A 2D7CA 3T5DA 2QEQA 2IYLD 4LYAA 3CH4B 2QROA 2QAGC 4DLRA 1LF5A 3IIMA 4HSEA 3CR8A 3QNUA 4CEIB 2HXSA 4GOKA 3TKLA 2V7QD 1NJFA 2DWOA 1F5NA 2OXCA 2X77A 3TAUA 2GF0A 2JLSA 1W0KD 1S4QA 1VKJA 1CR0A 4KO8A 5L3VA 4V0ME 5L3SA 1KJZA 3ZH9B 4M9SA 1DO2A 1ZP6A 2A9KA 1J2JA 2GBLA 1XXHB 4NYJR 4C0JA 1R4AA 3MGCA 4HUQA 3UATA 5K8IA 1G3RA 4JVSB 5DI3A 3AM1A 1Q12A 1X1RA 4G5OA 3P1JA 4RFVA 3C8UA 1TAGA 1W0JD 4BZPA 1RYFA 2BKEA 5EE9A 3OE7A 5CDFE 5BWMA 3RS5A 3SEAA 1KI1A 2FGJA 3GMTA 1RFLA 2X8AA 2IYSA 3E1SA 1KGDA 3ZQJA 3GLHA 3V00A 3WHKA 1ODFA 2GK6A 1JJ7A 3AVPA 1UPTA 4UNSA 3RRMA 1K8RA 1OXVA 2ZAOA 4M1OA 4BFTA 5KPJA 4GL2A 4QHTA 3CBQA 2FMXA 2GA8A 2W0SA 2ZE8A 4RSGA 2QE7D 2PZGA 1DAEA 4QNMA 5JRZA 5IK2A 1EFHA 1Z2CA 1O3YA 3NHBA 4PO8A 1E2JA 2J87A 4DKXA 1NLFA 4KITB 3U4QA 1BOFA 3DVLA 1IXZA 1BKDR 4DLZA 3BH0A 1TF5A 2PX0A 1E1RD 4J0QA 5TARA 1IJEA 1Z28A 2DFTA 2Z0MA 1XTSA 3K70D 4B32A 3D6TB 1E9EA 2REOA 2OCPA 3RS2A 5KSPA 4LJ6A 3Q72A 2XJ9A 4LJ9A 5FFMA 4B2IA 4D6PA 2WKRA 5G3YA 1UJ2A 2AD5A 4Q4LA 4TL7A 5CK5A 2X1VA 2JAQA 1CRQA 1R2QA 2PT5A 1CS4C 2W2TA 4W5WA 5JMTA 5CYOA 5ELXA 3LFUA 1XD2A 1YR6A 1OHHA 4RKEA 3ZVLA 2OBLA 3TUIC 5JLJA 4TTRA 1E4YA 4ZDJA 5CB8A 3EX7C 1KSGA 2C99A 1JQLB 5IF9A 4CEJA 2YWFA 1KO5A 1OIWA 1AS3A 4NU0A 3E2IA 2PH1A 2ODWA 1N6NA 3W5JA 5J4HA 2FH5B 1YR8A 3LVRE 3F3YA 2O8DA 2QAJA 1NY6A 2EFHB 1D8TA 3FDIA 2NPFA 1XTIA 1NI3A 3AVXA 2OFWA 4A2PA 4V03A 4LV8B 4B2LA 1GNRA 2W6JD 3NC1C 3K0AB 4H9GA 1JB1A 2BM0A 1SVMA 2WIBA 4GSYA 2HF8A 2GKSA 4N3NA 3TNFA 3JZMA 4LHYA 4A2WA 1E2DA 4BFSA 4M8NE 1XWIA 1UKEA 2WPDA 3VQTA 4ASUA 1AA9A 4M22A 2HF9A 1B23P 2VP5A 4C30A 3WBJA 2ZE6A 2QPAA 3EZ7A 1ZU4A 1KO1A 3GFTA 2AXPA 2ZRGA 2GETA 4ITRC 5FOVA 1KNQA 3BERA 3CLVA 5DO9A 1XMSA 4TMZA 2B8TA 2WAYA 4Q01A 2MMCA 2BMFA 2IUSA 4PPNA 5H1YA 4MRSA 3K0CC 5FBQB 3U6KA 4PTLA 4Y0VA 2AWNA 4A8JB 1H8HD 2H17A 4OI4A 3UG7A 1W36C 1MABA 5DIFA 1HQCA 1U9IC 4IOJA 1LV7A 4BLPA 3C15C 3VR5A 1KDOA 3AKDA 4D4KA 2RAPA 1WA5A 4PXAA 1ZIOA 4I1SA 3DZ8A 1COWD 1P75A 3SHWA 1JR6A 2ANCA 2WMOB 1OV4A 2WJGA 4LJ4A 3WY9A 3DO6A 4OYHA 5IT5A 1Z0FA 1VMAA 2E1RA 1G5RA 2PCJA 2CBZA 3IILA 1Z8FA 4CYMA 4DEXA 3W6OA 1XEFA 4KYIB 4DHEA 1XPUA 2VHJA 1RE0A 4MRVA 3QF4A 3TUJC 2QMUA 2ZR0A 5KTYA 4TMTA 2FJUA 3WNCA 1VCMA 5J4VA 1GKIA 1ZM4A 4ZCLA 3W90A 3T15A 5DGXA 2E9SA 3HR7A 2QRNA 4QL3A 2ZJOA 4UNQA 3KZ1E 1FQKA 3U3JA 1BS1A 3LLMA 2GJ8A 1Z2AA 4IDOA 1ZCBA 2BBOA 2O8FB 3TAHA 4JBXA 3R8FA 1XNJA 3A58B 5A4JA 1XTJA 1TADA 3WYAA 3RYTC 5JHGB 4DLSA 1Q21A 5EP4A 4WZBE 2J46A 1P61B 1NY5A 3KQUA 3GFOA 1NG1A 3I8XA 4HZIA 5LB2A 2CK3D 1E32A 2WZQA 5G53C 1KI8A 4FCTA 2HDNB 2CL0X 2P6UA 4N0DA 6Q21A 4G5RA 3I62A 4D0LB 4HI0E 4Q7JB 1VPLA 3BC1A 4P0TA 3RS3A 1FZQA 2G88A 4O2RA 1PUIA 3AVYA 1VG9B 4JLPA 2Q21A 2ZPTX 3QG1A 3EWAA 3CRMA 1R7RA 3D31A 4Z1MA 3KXKA 4E22A 4AC9A 1XPOA 2D06A 1DAHA 1GILA 3WP0A 2WJVA 2Q3HA 3A1SA 2IS4A 1KI7A 2DPXA 2F9LA 2A5JA 2YWEA 2Z4RA 1A5TA 3HP1A 2IBMA 1W1WA 4TLDA 4PHTA 2AL7A 3A1WA 4B3DA 2GCOA 1N6KA 3AP1A 3SN6A 1RJ9A 1Z83A 1NIPA 1XRJA 2C2HA 4EJSC 4K46A 4PC3A 2ZU6A 4DVGA 1VIAA 2W6ID 1L4YA 2A30A 3SYLA 2O0KA 2OBMA 2V7QA 2ZRDA 2QU8A 3LNCA 4P4SA 3RAPR 5EZ5A 2ASEA 5B2ZA 4RD4A 1ZM2A 4IDQA 3WXMA 1E2MA 4PSKA 3QEJA 4QJ4A 4Q1FA 1TL7C 3OEHD 4F4CA 4M1SA 2AFIE 4KSBA 4XJXA 4Q18A 2ZRPA 1G7RA 1N5IA 3TK1A 3O8RA 2F3RA 3UMRA 3UK6A 3AUYA 2G6BA 3NXSA 5K8LA 2GBLC 4BLRA 2PMKA 4YC7A 1W0JA 2AR7A 3DM5A 2ZSEA 3GCGA 5L3RA 4Q48A 3CRQA 2WVJA 2FEMA 221PA 2FFBA 2HUPA 3KTAB 4IVRA 3EPJA 1GNPA 5DISB 2B8WA 2QSYA 4BFVA 5A0FA 2CCGA 2GXSA 3I72A 4DDTA 4IVPA 1E6CA 4G01B 2R2AA 4Q4JA 4RY2A 4YDSA 1II9A 3VFDA 3CF2A 4Z51A 1VIYA 4HDQB 2RHMA 3K09C 3EZFA 3CPJB 1E79D 3AVOA 2GXQA 4KLZA 2IA5A 4AG5A 4HLUA 1TMKA 4EPXA 2WSSD 5FTLA 3AUXA 4ZIRA 2VA8A 1TQ6A 2HEIA 1QG4A 4OHZA 5KDLA 2DFLA 3RHFA 1E1RA 2WWYA 4LPSA 2QZ4A 3P4YA 4WZ6A 3NHAA 3PQCA 1YR9A 2JA1A 2KI5A 1XTQA 4LJ8A 4DCUA 1Z0IA 1JAIA 2R6AA 3W34A 3X1DA 1KJYA 2GWHA 4CEHB 2JGNA 1NSFA 4XWKA 1Z6TA 1G4UR 2WJYA 4I99A 1CTQA 1Z29A 3U44A 2ZJ2A 1FMLA 2CCKA 2EW1A 3BB1A 5HKKD 1XXHA 5AR1A 5BXQC 4MUAA 4Q7LA 2VP2A 3A4LA 4LK2A 1DAIA 1KY2A 3NBYC 2Q6TA 3W8NA 4NYMQ 2FG5A 1OF1A 2HLDA 4PPQA 1KSFX 3CPEA 5IDVA 4BE7B 1W4BA 1GDDA 2OSBA 3Q8XB 2KSQA 4U5XA 1GAJA 1UEJA 3MWYW 4KFUA 3TLXA 5K8TA 4E07A 3AGPA 4C9BA 2JIZA 2XSZD 2F6RA 2Q3FA 2JLQA 1GITA 4C0BA 4BEBA 2V9PA 3RC3A 5H8WA 1K5DA 4MA4A 5C4MA 1P5ZB 1SVLA 1TUEA 5E7MA 3QPUA 2L0XA 1E4VA 1ZMXA 2WOJA 5JHHB 5SZHB 2ONJA 2W6JA 1E2EA 2G0TA 3EC2A 2QP9X 1X1SA 2XGJA 4A82A 4Q1DA 3Q7PA 4JJKA 1KK1A 1XX6A 4TWZA 5E4FA 1EK0A 4ZI2A 4BRUA 4FCWA 2J5XA 4KBGA 1KNXA 1VECA 1S9DA 4PSVA 2P2LA 4AKGA 5JWRA 4D80A 1QHHB 1U0JA 3P4XA 3NIBA 3GLGE 3EIHA 3CR7A 3RDPA 4B74A 2GEDA 1DE0A 1KYIA 3A37A 3EASA 5C2JB 2PEYA 2QORA 3FMPB 3RS0A 2VP4A 3MRSA 3ZZTA 1FTSA 2D2FA 3FKSA 3L8YA 3AKCA 4NL4H 5EXSA 4D4MA 2J45A 3SJBA 1RC8A 1H8HA 5E3HA 1ZNXA 4BFYA 1E2NA 2PEZA 2QUZA 1KK3A 2R6CA 3SQXA 2CEAA 5H70A 2B7BA 1ESMA 4L9SA 3VU9A 5JJLA 1NN0A 4LV6A 4UNRA 5JWOA 4FN5A 3THWB 4GI7A 4ON9A 2R6GA 4L5BA 1SQ5A 3ZJYA 1SVKA 2ZSAA 3AVQA 3QOFA 1N25A 5FPKA 2P6RA 4HB4A 2ZU0C 4YONB 2Q9AA 1COWA 5G41A 5AWFC 3TSWA 4DXAA 3N5CA 2ZYTX 4QJ5A 2CHVA 2FV8A 2WICA 1FUKA 1VCOA 2O8BB 2I4IA 5DSZA 4KU4A 1ZNWA 3FMIA 1M6NA 1P2TA 3IUYA 2EQBA 1N6IA 2OAP1 2NPIA 2REXB 2ORIA 3MLEA 4RZXA 1JBKA 1XEXA 2ONKA 2Z43A 1BH2A 2F1JA 2EWVA 1GKYA 1YRBA 1RRPA 4EPWA 3T61A 3K0AA 5JWHA 5TV2A 2QMEA 1NKTA 3CIOA 4KLNA 1GRNA 2GVZC 3RNLA 5AUPB 2IS2A 4YXWD 3NKVA 2PJZA 2CE7A 4U00A 3TUZC 1GZSA 4PC7A 4RD0A 3T1QA 3TH5A 4NYJQ 1FOEB 3HU3A 2H7VA 3EIQA 1Q3HA 8OHMA 2NIPA 3ECCA 3MJRA 4KODA 4NHOA 4B71A 3PEVA 2YVUA 1FUUA 2CMKA 3THYA 1D2EA 5UKDA 3F8TA 2BKUA 2GCPA 2I1VB 4OQLA 4Q00A 5CK4A 2NO7A 3WNDA 1F6BA 1XU4A 1KO4A 3TVTA 3OIVA 4BFZA 3QKSB 3CM0A 3PUXA 3R7WA 2O8EB 4B48A 5HTKA 1GM5A 4AIIA 3EW9A 4R7ZA 5KSZA 4KV9A 3CO5A 2NG1A 3T12A 5KHOC 3VX3A 4ZCIA 4IJMA 1Q1BA 1HV8A 1AZTA 1XJQA 2CCJA 1GP2A 3W3ZB 1FNNA 3ZVNA 1Z06A 2IYYA 3X1WA 2JDID 4OK3A 3NDBB 5CM8B 5FTNA 1YZUA 5TVKA 5KO2A 1TF7A 1NLYA 4US1R 5D3QA 4LZZA 3REGA 3QQ5A 3MAAC 2GHIA 2SHKA 1GNQA 1N5JA 1JR3D 4JVNA 1SXJE 4DCSA 1ZCAA 4F38A 1IQPA 4AWXA 4B75A 5CJPA 2Z5FA 4BEJA 1Q20A 1U8AA 4JYCA 4ZO4A 2ZTSA 3KKMA 2RHDA 2O8CB 2OBNA 3ZLJA 4GRAA 1M74A 2WKQA 2J3EA 2G9NA 2W6IA 2QL6A 3LRPA 1G3MA 3PCRB 1HEIA 1Q0UA 2RGNC 1P60A 3VHLB 2P67A 2W00A 4YLGA 4WBSA 3QJYA 2Z6VA 2CNWA 3OEHA 4Q4AB 4IDHA 2ZRFA 4PZLA 4TSFD 1IN8A 2O8FA 4IOLA 3ZD6A 4M21A 2YC2C 1AKEA 2ZVPX 3B6EA 1GKUB 2RCNA 2ZYUX 2QGZA 3DPUA 4QGAA 2WWFA 5DHAA 5JSZB 2IYXA 4KFRA 5BYJA 5K8UA 1Q3TA 3CH5A 4MRNA 3RS4A 2F43B 4QGHA 2NO6A 1Q1ZA 2GJ9A 4G5GA 1G291 2ZRAA 4C0AC 2CL6X 5FPYA 4Q21A 1HE1C 1II8B 1E9CA 2NO1A 3JZAA 5H68A 1BYIA 5D3MB 2YOHA 2ZRNA 1ZVQA 1XEWY 3WMFA 5LD2C 4B76A 1YVDA 2GZDA 1RVDA 2IT1A 2FSIA 4OBEA 1GRQA 1E79A 2BMDA 2ZRHA 4OKSA 4R71A 1G8YA 4JBYA 3AVVA 4A2QA 4RFSA 5EE3A 2WSSA 3MSXA 2HYDA 5FBWB 2C03A 4EQ6A 1N6HA 1R5NA 2NZJA 2VRWA 3QIAA 2BJVA 5A5GA 4Q1CA 1CJKC 1DVRA 1P73A 1XMIA 4TLCA 5AJVB 3T1VA 5E95A 1JAHA 3QKTA 2EWWA 5CB6A 2WWIA 1FP6A 1QBKC 3IHWA 4G5QA 1IXRC 3LBIA 4DSUA 4MYHA 3RRYA 1ZM3A 2IYUA 4ERNA 2OHFA 2AD1A 4TQUS 3MMPA 1WB9A 2VSOA 4M1TA 3P27A 1CBUA 2F1HA 4OQFA 4IOKA 2WBLC 2WWWA 2X19A 2IEYA 2W83A 3CRW1 5HKKA 1ZRHA 4PO9A 4QHSA 3UIEA 1JPNA 5FL3A 4BRWA 4I1OA 1WRBA 3A4NA 5G40A 1T8TA 2C95A 1F48A 1EFRD 2IX3A 1AKYA 3W8RA 2D4HA 2Y8EA 2OLKA 5C4GB 1YR7A 1PZNA 1S8FA 2XSZA 2ORWA 3GLGB 4XOIA 4O3MA 4BFXA 3C5HA 3DOEA 5KU1A 4PAOA 5B64A 5FPTA 2WM9B 2ZJ8A 2OCYC 5DYGA 3KDSE 2ZM5A 2IK8A 1WQ1R 3LH5A 3KQNA 3JVUA 3D7MA 1KTVA 3MWLA 4HZUB 3GEHA 4CIDA 3HJNA 3MJHA 5FOTA 2W2VA 1IM2A 1C1YA 4LHVA 1G17A 5FI1B 2Q9CA 4GP6A 2OFOA 4OQMA 4UXJA 4D2IA 1OXXK 3TBKA 3T1OA 5FR2A 2J9RA 4C2UA 5EQTA 1T8UA 1ZYUA 1NBME 1E2HA 4JIMA 2ZI4A 2N46A 5TY0A 1ZBDA 2BBSA 2KB0A 3BFKA 2VO1A 4V0LA 1NVVR 1PLJA 2JASA 4GMXA 3GP8A 1G3UA 2TMKA 3MCAA 3T1TA 4ABYA 1DS6A 1Z47A 2WOOA 1T0JB 1XBTA 3EZ6A 4C0LA 1S3SA 2REBA 2ZSFA 1Y3AA 2ODEA 3BD9A 1KI6B 2QQEA 1XEWX 3LVQE 3A1TA 1W2GA 5KDDA 1DPFA 2LKDA 3K0EA 2IS6A 1HQYE 3QBVA 4QRHA 3IBYA 1UBCA 1SXJC 5KNCA 3R9WA 2C9YA 1WMSA 3PITA 1IN5A 1EGAA 1IN7A 2A5FA 5JJIA 3GLIB 3SOPA 3WMEA 3CW2A 1GIAA 4TL8A 4AKHA 1EX6A 2ZRBA 5LDDC 2EFDB 1KZGB 3VTKA 1M34E 2H92A 2JJ2D 1E3MA 3PG5A 2GJAA 1QZXA 4QHYA 2AX4A 4DT1B 3X1ZA 4JSYA 1UKVY 2O0HA 1LVGA 1TQ4A 4C0QC 4Q9JA 1UBFA 4ZDIA 3EPLA 1FFHA 2D74A 3OHMA 1M8PA 4JLNA 1S1CA 1V5WA 2ZI3A 4CF7A 1HTWA 4M9XA 4RZUA 2F55A 2VTKA 1EFTA 2QAGB 2XTMA 4JMPA 1U2RA 2JJ1A 1XFAA 4AKEA 1W2HA 3NDPA 2IS1A 4HAVA 1QVAA 1BO6A 1EFUA 1H65A 2VHCA 4PHHA 1JJVA 3Q5EA 2ZQ5A 4EFLA 2OT3B 4MKHA 3U3MA 3IEUA 1LFDB 1J7KA 2ZUBA 1US8B 1N6LA 4LPKA 4IW3B 2QSZA 2FSFA 1WGWA 1M7BA 2C9OA 2I1QA 5AJWA 3U7HB 2VHQA 2XX3A 4D81A 3CPHA 2VHUA 1OLOA 2AK3A 2DBYA 5KNDA 1OFHA 4IRUB 2GESA 1KMHA 3C5CA 3LX5A 3LBHA 5DE3A 3DKVA 3OAAD 1F2TB 2HCBA 3PV0A 4EPYA 3P20A 4CT4B 1OIXA 1QHNA 4A1FA 4IFEA 1JXOA 3K53A 1E2LA 3G5UA 1SULA 2ZRIA 3FOZA 4IDNA 1G18A 3RSOA 1GSIA 1NSTA 3AF1A 4RZ2A 4TYPA 4Q4HB 4P4TA 3U5ZB 3CNNA 4H1UA 4HAZA 4JLJA 4LUCA 1KI3A 1OT3A 3SU8A 2IWHA 4B6FA 1Z5ZA 3ASZA 2F9MA 1D9ZA 3IO5A 1BIFA 3GJ0A 3RC8A 1YZNA 3CUEF 3SS8A 1UAAA 3U7GA 1XTKA 1XCGB 3KKNA 4XSGA 5GVSA 1XMVA 5HR5A 3OIYA 5CIWA 4OI0A 2RGCA 1G20E 5L8VA 2IC5A 4ARZB 1E9AA 1P6XA 1SVWA 1JR3A 5FL7A 4ZKDA 1Z63A 2GEVA 4GZMA 1J90A 2VF7A 2CVHA 2QPOA 1D6JA 1GUAA 3KFVA 2GAAA 4B34A 4D82A 2LKCA 1N2CE 1P2UA 2V1XA 3Q85A 3QBTA 4ACAA 3OIUA 2IW3A 1GTVA 5BN5A 2J59A 5EP3A 3IIKA 4D25A 1YKSA 3DM9B 1D2MA 1YQTA 2NO9A 2GZHA 3GLHE 2C9CA 2BOVA 1W49A 2OE2A 1R0YA 3QEOA 4X8LA 3PUZA 2RKOA 1R8SA 1Z0JA 3RSLA 4R2HA 3ADKA 4PHGA 3WYGA 2IWRA 1IAQA 2N1BA 2C98A 1E98A 1Y63A 4TSFA 1Q57A 1TTTA 2XTZA 3FVQA 3GJXC 4XSHA 3WMGA 4LV5B 3KJEA 3GPLA 3PIRA 3ONWA 2A2ZA 4U7DA 2G77B 1HUQA 1XTRA 3IBGA 3QKSA 4NTZA 1E99A 4TZ0A 4FINA 4M0LA 1W5TA 1KKLA 2LCFA 2Q9BA 3KJHA 4WXPA 4Q19A 4JLAA 2R8RA 3UMFA 2J7PD 3WHLA 3BFVA 1HY3A 1JNYA 5L3QB 3IDQA 1Z0KA 3A1UA 1VHTA 2A5GA 1YU9A 4LSGA 5EJEA 3NTUA 5DI9A 2GK7A 2BWJA 4GMDA 3TE6A 3MWKA 1KO8A 1RIFA 2CL7X 2KJQA 4IHQA 3ICEA 1W48A 2ZSDA 4FMCB 1X86B 3U3KA 3B85A 2DY1A 3B60A 3WRYC 3AH8A 3IPXA 3UWOA 1R5BA 1MR3F 4A9AA 1UEIA 1T3SA 1Q1EA 1T9HA 3EAQA 4RZ3A 4B47A 2QNRA 1IXSB 2ANBA 1E9RA 1JI0A 2GXUA 4IVQA 3I8SA 4NPHA 3W5IA 5J5CA 3GEIA 5KOYA 1M7GA 4D0GA 3G0HA 1W36B 1ZINA 1T0HB 4DLWA 4EAQA 3TSOA 5E7IA 1AIPA 1FX0B 2ZIAA 3QI2A 2QT1A 4MYTA 3THXB 1BMFD 2EVWX 2GZAA 1HH4A 2XXAA 1DOAA 2WHXA 3C7KA 3QXJA 4TMWA 4DJTA 3PEWA 5SZKB 1KK0A 2QMOA 4BWYA 4TQAA 1G7CA 5C46F 1KAOA 4Q4AA 4D4LA 4B3GA 3QKRA 4UKDA 5FTJA 3I92A 3ZVRA 1EESA 4M2LA 1N0UA 2ZXUA 2BEKA 1OFIA 3EZ9A 2J0VA 2GCNA 5AJZA 3AGQA 4NDZA 5JSZA 3U7FB 1ZAKA 2O52A 2WKPA 2RGAA 2EFEB 4PHFA 3NVAA 2QBYA 2KWIA 1U0HC 1NMXA 1OW3B 2PZFA 1X6VA 3I1FA 3ZGXA 5BQ5A 1EWRA 4TN1A 4PPFA 2F7SA 4S2EA 521PA 1CKEA 4DRZA 2J1LA 3GLFA 3QSYA 4Q1BA 2QG6A 4HLDA 1HYQA 3HDTA 2GJKA 1OFTA 4PQFA 4WZAE 3U60B 5JRJA 4L16A 3EPHA 1MOZA 1Z08A 3SC3A 1CJUC 4MDEA 1MO5A 4KYUA 1W0KA 4JKIA 4DZZA 2ZRJA 4WW0A 3Q7QA 5TB5A 3ZZ0A 1W46A 4C4PA 2R62A 3IKJA 4BLTA 4QJ3A 1J8MF 2VPPA 4MGYR 2NZ8A 821PA 3V4FA 1MO3A 3UPUA 2EFGA 3S1AB 3B9QA 4QBGB 1A4RA 1QG2A 2XZOA 2KE5A 2C96A 1OB5A 5GJCA 1NRJB 1NF3A 4NYIQ 5FUXA 3ZYCA 1CXZA 1AJEA 4AYXA 2A5YB 4CT5A 1W36D 5B57C 2OCBA 2JLZA 2NOAA 3QE0A 4UQOA 3SJCA 3QVVA 3I3SR 4CW7A 2FEOA 3CNLA 1J70A 3B1ZA 4NCIA 3VR1A 5EZ6B 2QTFA 1TUIA 3DHWC 3KKOA 3K8YA 3B8HA 4C7OA 1OSNA 2D62A 3A8TA 4LBVA 1AK2A 1E2PA 1W4AA 3B7GA 2JJ2A 2ZJAA 1SGWA 4XTRA 5JJKA 3EG5A 5AJYA 1OH6A 1KHTA 4IOMA 3W6PA 3DL0A 3REFA 2E87A 2QE7A 2BCJQ 4BGDA 3NEJA 4F91B 1F3OA 2VP9A 3FMOB 5HCIA 4JL5A 3ADDA 1XZQA 4JBWA 1ZJ6A 4UJ5A 4EJSB 1X8JA 4NBSA 4W9MC 2Q0HA 5IHPA 3K0FA 1Z22A 4TMVA 2PLFA 2ZJBA 1S9HA 4MQBA 3VKGA 3IGFA 3SBDA 3Q9LA 4MRRA 4Q9KA 4CEIA 3AQ4A 2H1LA 3BB3A 3H1TA 1S2MA 3VNUA 1G6HA 2DWPA 3IQWA 5J4KA 1FMJA 5DHFA 5GJWC 4PQYA 4L15A 1UDXA 3LAWA 1P72A 5IRCD 1AQUA 3CX7A 4GOJA 3LDAA 3TQCA 4QM7A 2ZE7A 4HUQB 4LC0A 3OFND 3NC0C 3U6BA 1R6BX 3BJIC 4H1VA 3OAAA 1N0WA 3BH6A 4XD7D 3BBPA 4WOPA 2EYQA 1F2UB 1I4LD 4QBIA 5G3ZA 2PX3A 4GFDA 1WXQA 3B2EA 1LS6A 3F0TA 4LCBA 3A6PC 1EFCA 1N3BA 4HAUA 2YOFA 4A6XA 1AS0A 4U02A 4C0KA 4G1UC 1CP2A 3DMNA 2G3YA 4YMVA 3FPAA 4RKFA 3GLHB 1U94A 2I3BA 3GLIA 4MKGA 2GEUA 2ODNA 3NH6A 3SFVA 4JYBA 1FP7A 1XPRA 4DDVA 1G7SA 4KSCA 1SHZA 1KIMA 1G9XA 4LI0A 1P9NA 2MMGA 2QM7A 2AHOA 3QXCA 5FTKA 2OUKA 4RD6A 4B3XA 4AYWA 5F9FA 2BC9A 3U61B 2ZI7A 3TGPA 1YZQA 4FCVA 3U4QB 1Z6GA 2QAGA 3L2OB 2IYTA 1A82A 2PBRA 1NMZA 1F60A 4XIGS 5JS8A 1Z0DA 2OV2A 3BXZA 3QUSA 3CNOA 2H57A 4UXHA 1U99A 1FQJA 1T91A 2QENA 3THOA 3ADCA 2WSMA 4ESHA 2X2EA 3JVVA 1ZM9A 4PZZA 2GAOA 1EG7A 2QT0A 1TU3A 1U8YA 1OB2A 1OIVA 621PA 1BYUA 1OFUX 5HPYB 4RVCA 3ZD7A 1HT1E 4LYHA 1IY1A 1XD2B 4A0FA 1L4UA 1R10A 3QVUA 1LW7A 1WF3A 4BLSA 3AP2A 4POAA 4IEIA 1HE8B 1E9FA 1SKQA 1MRSA 4PO1A 4OHWA 2GVDC 1NIJA 2B6HA 4DIDA 3CWZA 721PA 4CEJB 3UWKA 3CX8A 3KB1A 4IXMA 4K81B 2J7PA 2J0SA 2O8DB 2WV9A 2CDNA 1RYHA 3BH7A 1UDWA 3FHOA 3QKUA 1WCV1 5LB4A 3IIJA 3RWOA 2JLUA 5E7JA 2P5SA 1MV5A 1XXHE 2CHQA 1G3IA 3BGWA 3SJAA 4HB3A 3AVTA 2IYVA 3NEYA 4PAQA 2YJTD 4D0NA 1Z6XA 2MSEB 1D2NA 3AVUA 1GOTA 3M1IA 2NQ2C 1E96A 4GP7A 2P6NA 3RWMB 5DLQC 2ZROA 1UADA 3PENA 3M0EA 5KSYA 3RANA 2FE4A 4BFWA 4EUNA 1CJVC 5JEDA 2CLCX 2KBEA 5BN4A 1ZU5A 2WAXA 5SZJA 2ZUCA 1DG3A 3TW4A 4OJKA 2IHBA 4TQ9A 4B33A 2FN4A 4QNRA 1A1VA 3X2SA 3TSZA 2AFHE 4B43A 3LQQA 4URZR 2J7KA 2CK3A 3V4RA 1QDEA 1Z6YA 3T06B 4ZV4A 4NP6A 2YWHA 3E5HA 4A8JA 2B7CA 2FSGA 1MABB 4QBFA 1G7TA 4PAMA 1XD9A 2IXGA 1G8PA 1LY1A 3LXXA 4HLCA 4JSTA 1NVUQ 2CJWB 3D8BA 3KUCA 4MKIA 5EP1A 2IF2A 1CR1A 2G1JA 3BE4A 3B9PA 3MD0A 1X3SA 2QMHA 3BAFA 5J4YA 3L0OA 1DELA 1PUJA 4NCHA 4Q9HA 4I81A 3BS4A 1WBBA 2ZI9A 5FOXA 4X8MA 1N5KA 3DEFA 1L8QA 4HUTA 3LXRA 4GT1A 2IXEA 3TR0A 4KFTA 2B21A 4G0NA 4NH0A 3CKLA 1OXTA 4Q47A 4HLQB 1ZD1A 3SBEA 5EUQB 3SE0A 1E94E 4BLQA 1U8ZA 3B13B 3B1XA 3X1XA 4HDOB 4IXNA 2UKDA 2ZRMA 1LTQA 1ZC3A 2HYIC 2D7DA 4ASUD 3KJIA 4UJ3A 2ZR9A 3EZ2A 3X1YA 5JBQA 4ZCMA 2ZS7A 5TMPA 3FMFA 4LOAA 4YMTA 3I5XA 3HPRA 1NL3A 2XJ4A 5EE1A 3IEVA 3L8ZA 4TYNA 1VYVA 2H16A 3N70A 4MITA 4TYYA 2XB4A 4HEJA 1MO4A 3LW7A 2F3TA 4TL6A 3AF4A 1P4SA 3KKPA 4BASA 1U9IA 5FUWA 1SVSA 4Q5IA 4EKDA 4EFMA 3VMFA 5EE0A 2ZANA 1G16A 3EPKA 3KFXA 1QRAA 2V6IA 2XZPA 3FTQA 3H86A 3CB4A 5CYPA 5F3WB 1EX7A 1IBRA 4NYMR 1ZM7A 1E0AA 2PCLA 1KOFA 4O2LA 5P21A 5FUYA 2GF9A 2ZJZA 4V0MA 2BJWA 3K9GA 1HURA 4P33A 5EP2A 1Q1QA 3PXGA 4RD2A 3WNBA 4Q66C 4LJAA 4HLUC 3GQBA 1CLUA 4ACBA 4F92B 5JEEA 1W4RA 2WWGA 4YMWA 3SQWA 4TTPA 4M1KA 5FTMA 5CDFA 4EPVA 2QPTA 1RJ9B 1RW4A 4A6PA 4Q7KA 1I2MA 4URUR 5AUQA 3ZIAD 3K70C 4Z54A 3CZQA 3ETLA 4P4SB 1E1QD 4G3XA 3UXMA 1NKSA 5TDHA 4DEYA 5GADl 3U7EB 4JL8A 2OLJA 2J0UB 3OFNA 2W58A 1FW6A 3TIFA 3ICQB 1S0UA 1ZD9A 4XD7A 1A2BA 2B92A 4K8OA 2DR3A 1AGRA 2CHGA 2GDJA 1FPMA 1YZKA 1SVOA 4IKEA 1I2DA 1NVWQ 4PX9A 4L4UA 5GVRA 5EXTA 1OE0A 3NWJA 3ZQ6A 2UZIR 3KTAA 5LD2B 4IDPA 1GL9B 4URXR 4B44A 1QHGA 2BIFA 2H8KA 4A0GA 1R0WA 3I73A 2MSCB 4Q02A 4Q4JB 5J40A 1G4AE 4MDFA 4NKRA 3I4LA 2ZYWX 4LWZA 1P7CA 1E9DA 3QXXA 2ZR7A 1NJGA 4EPTA 5CM9C 1XJ0A 2ZEJA 2ORVA 2XITA 4Z1MD 2CLDX 2X2FA 1TQ2A 1OXUA 1II0A 2P5TB 5FBVB 2JEOA 2FDCA 2VP0A 1G5PA 2ZJ5A 4FMDB 4ZIRB 1JALA 4ZDWA 5J4LA 1EWQA 3VNVA 2C5LA 2HT6A 4M9QA 3U2QA 3CZPA 3QXHA 3W9YA 4EJSA 4OJQA 2PZEA 1W47A 4P4UA 4B3CA 4FWIB 1P2SA 5CJ2A 1I4DD 3I61A 1P9WA 1OKKD 3HU1A 3ZS8A 1NVXQ 1T6NA 3SDZA 2YNMA 5EXPA 1A2KC 1XB2A 1IY0A 2ODBA 2RB4A 4TLEA 4DUGD 1U81A 2V55B 4NZYA 1VCNA 1WE2A 4CEHA 5FOSA 2OFXA 3NBFA 4KCGA 4MRPA 1YZTA 1KY3A 1D9XA 2VEDA 4TLBA 2FX3A 1SKYE 4MKFA 3BIFA 2MSDB 2HJVA 3V9PA 3U44B 3CRRA 4TZ6A 4DLVA 1JEDA 1UFQA 3N2EA 2NO0A 3BRWD 2UZ3A 4LYJA 3TMKA 3LD9A 3LY5A 4DB4A 2CE2X 3FFBA 2AKYA 2ZETA 5LBIA 1KDTA 2WMNB 1F2UA 2CLSA 2HT1A 2FWRA 2V54A 1YZGA 4TT3D 4JT2A 4RJLA 4I1VA 4OHXA 4F93B 3P32A 4WA7A 5FOUA 4LBZA 121PA 1XP8A 1VDZA 2GRJA 4BLOA 1XF9A 5KSOA 3K09A 3CF6R 3IHLA 4MGZR 4X8OA 5EXXA 4AKIA 3HU2A 3SZRA 1IJFA 2YYZA 2XNDD 5HE8A 5EE5B 4QKQA 5JCPA 3DOFA 3FKQA 3AF0A 5TXGA 1FL9A 1NG9A 1KSJA 4YXWA 3R9XA 4FW9A 4R98A 2AWOA 4M1YA 4QGFA 3FWYA 5FPHA 4XVQA 2ZITA 2C78A 1C4OA 2QA5A 4NMMA 1E0JA 1L2TA 1N6PA 4WAUA 4ESVA 1QHHA 3TR5A 3O47A 4M1WA 1IY2A 1G8HA 1OXSC 2R44A 1UKZA 1JEEA 1ESNA 3PUYA 1SXJB 1CJMA 2BMEA 3UKDA 1U0LA 1I4TD 2EFCB 2ZS8A 2IUUA 4A0HA 4XVUA 4LHXA 4E5UA 3NG1A 4AK9A 1DAKA 3EARA 5B58C 2R9VA 3KXLA 4LRWA 4CVNA 3OEED 4A36A 2VLIA 3KJGA 2VBCA 3GEEA 4LBWA 2JATA 4JVMA 2WWXA 3K9LA 4LGMA 2PT7A 2ZSBA 3VU9B 2OEPA 4A8JC 3THWA 3HPQA 2ZI6A 3W3AA 4HATA 2HLDD 2JDIA 3KB2A 4LJYA 3EXAA 3ND9A 2BHRA 3SYKA 1M7HA 4BFUA 3M6AA 3NBXX 4DCVA 1R5OA 1X8KA 4KVAA 1G3QA 1KI9A 1RRCA 4LJ7A 4LHWA 1G5TA 2O8BA 1T3LA 3VKHA 1LNZA 3GJ6A 2JIZD 3BK7A 4DSOA 3GFPA 4QC2A 2CVFA 3VR6A 2Z4SA 4JLOA 4ZKEA 4M1MA 1AZSC 3L0IB 2XOKD 1UBEA 3BFXA 3B1YA 5CITA 2RH5A 1XEXB 3UANA 3CRVA 1YJ5A 2HV8A 4BUJA 3MUFA 4PQRA 1VG0B 2OXRA 3R7WB 4HAYA 1V43A 2W0MA 3R9IA 1N6RA 1QHSA 2YC4C 5SZIA 1TF2A 4M9ZA 1ZIPA 4FD2A 1XD8A 2RGBA 4QFMA 4L8GA 3BORA 3GJ7A 3AF3A 1PJRA 4DLTA 1E2GA 3K1JA 2FPKA 4YQFA 3AEZA 2BEJA 4TMKA 3P26A 3THYB 4OQNA 4W5HA 1AN0A 4OK5A 4PC2A 4JT4A 1SXJD 1NMYA 3EIEA 3QPVA 3CX6A 3K9HA 2O8EA 3FKSD 1CIPA 2OZEA 2VP6A 4WVFA 4LBYA 1ONBA 4XWAA 5FUVA 3R20A 3H2YA 5JCZA 1W7AA 1WBDA 2IXFA 2QP3A 5DYIA 3VR2A 2V8OA 1G41A 1J8YF 5DNYB 3C41J 3ZZUA 2A7QA 1IN4A 1K6MA 2RGDA 1PV4A 5CLQA 2ZRKA 1HT2E 1TU4A 3SNHA 2CJWA 1NN1A 5FPSA 2IEZA 2OCAA 4URWR 4KFSA 1SVIA 4A15A 2QY9A 1EXMA 1ETUA 3KQHA 2OILA 5BN3A 3B1WA 5AK0A 4Q03A 2RMKA 2WWHA 3MWJA 4KBFA 5JFGA 2QRZA 3H4MA 2XEXA 4LJ5A 3LWNA 4TYQA 1E0SA 5M04A 2FZ4A 4PANA 2D3WA 4NE2A 3A4MA 1XMJA 3OIWA 1OJLA 2EYUA 4RD1A 4EFNA 2O8CA 4MGIR 3Q5DA 4P31A 4MH0R 3RRZA 2AXNA 1GG2A 3FB4A 4P32A 2V6JA 3F5FA 3ZIAA 4TMXA 1YRAA 1E1QA 1ELOA 1HA3A 3WRXC 1DBSA 1MH1A 1Q44A 4FWTA 1TEVA 4UXIA 1WDTA 4ZI3A 1TNDA 2J41A 1B0UA 5DH9A 1QF9A 4FIDA 1NP6A 2VYFA 5FBLB 2FOLA 1JR3E 5HCNA 3QPWA 2JLYA 2JLXA 2NMVA 2H5EA 3SHFA 2C04A 4CZ2A 4DLYA 4F4IA 4LC1A 3O8CA 1ZUNB 2P0EA 4QM6A 1EFRA 1RKBA 2A5DA 2YKGA 1E0KA 1VG8A 2ERXA 3ASYA 4EDHA 2FGKA 4YMUA 2GILA 2F43A 4HAWA 4DDUA 4HB0A 1N0VC 3IPYA 2W2XA 3O8DA 4DLXA 4P3YA 5AUNB 3PVSA 1JXMA 2WJHA 2ZVQX 1II8A 1XDBA 5FR1A 5D3MA 1VG1A 2WIAA 3H84A 3DMDA 4XH9B 4S35A 4OI1A 4B73A 1KI4A 4URVR 4US0R 5AUOB 1SKYB 3DDCA 1VYUA 3HYTA 4B6EA 5KNBA 4QXAA 4RFSB 3FGNA 1H8ED 1OH8A 3J81k 1S3GA 3RVBA 2KBFA 4RD3A 3B5JA 2LWIA 2RGEA 4LYFA 4DWJA 4EQ6B 4Q7MB 1R8QA 2ZJYA 1GL6A 3SJZA 1NN5A 5DN6D 1OKKA 1XCPA 1MO6A 1Z0AA 2RGGA 2IYZA 4DDWA 2JLWA 1DG1G 1AQYA 3KXIA 4PR0A 2BCGY 2RGNA 2QTVB 1G6OA 1QHXA 2VH5R 3N2IA 3FHCB 5HE9A 4DUGA 1XJCA 5JECA 1ZUIA 1TQDA 2VF8A 4GPTA 1IONA 4YMSA 3AB3A 3QXSA 1W4CA 1S1MA 1E2KA 1JPJA 5FH9A 1RPZA 4MGKR 3VAAA 2CNWD 1OYYA 2OESA 1G1MA 2F1RA 3BB4A 3U3OA 2DB3A 4CGZA 1AM4D 2J0UA 4ILEA 4JLMA 3C16C 4TTQA 4B3FX 3AVWA 2YINC 2ZUDA 4XTCS 1Z07A 1KZ7B 1N6OA 3TW8B 3T5GA 3K9NA 1ZD8A 2ZE5A 2O0JA 2ERYA 1NBMD 4TT3A 1KI2A 2ZI5A 1NNEA 3VR4A 1GWNA 1L7VC 1N5LA 2FA9A 3GLGA 5B30A 4URYR 3O8BA 2V4ZA 3GD7A 3T35A 3W6NA 4AI6A 4NONA 1SZPA 4PC6A 3LW8A 3IO3A 5F2EA 4A0RA 2XNDA 4XWOA 4KHZA 2ECKA 1LF0A 2G0NA 3PUWA 4HZUA 3M4YA 3RABA 3SFZA 1E2FA 1CU1A 3LO5A 1ZUHA 2WJIA 3ZDQA 1OH7A 3RLFA 3B1VA 1KAGA 1W5SA 2C8VA 1ZC4A 1CJTC 3MFYA 2OG2A 2AKAB 3OESA 1KDPA 3EWSA 2ZS9A 3CWQA 2HCJB 2IYRA 3OZXA 3DKPA 5L3SB 3FFAA 2VL7A 2ZYVX 4BPBA 1JQJC 3TRFA 1DARA 1MKYA 4DLUA 1MRNA 2D2EA 5DI3B 1CR4A 4D26A 1QVRA 3A36A 1E9BA 3ND8A 1R0ZA 2BM1A 3KUDA 1SHKA 4JLBA 2XTNA 4Q9LA 3C4JA 3FYHA 4IEEA 4Y0AA 1KI6A 1VYTA 5F9HA 2BV3A 4FI3C 4PFSA 2FF7A 4DCNA 3GLFE 3PEUA 3OEEA 4X8HA 4JVLA 4AY2A 4W5JA 3B82A 4CRWB 3MG9A 1J99A 2PMDA 5J47A 1AS2A 1IN6A 5CIQA 2YWGA 4LDJA 1KSHA 3LX8A 4DT1A 1KK2A 4DIEA 3TQFA 4GZLA 4C2TA 3D3QA 2CXXA 1T4GA 2XZLA 3BOSA 3NH9A 1VCIA 4LY6A 4F4JA 1OPXA 5FOWA 5ANRB 4MUBA 4Z8YA 3K0SA 1DEKA 1GRRA 4M53A 3GJ4A 4PPGA 2QN6A 2XOKA 4CDGA 4DSTA 4O0MA 2RGXA 1KMQA 4KAXA 3UG6A 3PFIA 2FSHA 4WXRA 4JKYA 1ZNZA 4M4SA 2VHTA 3HR8A 4QBHA 1US8A 4B35A 4N0EA 1ZW6A 1YHNA 2R6DA 4A4DA 2O5VA 1FTNA 2AK2A 1XZPA 4C0HA 3PUVA 1KMHB 1WP9A 1S96A 1U90A 3IQXA 1F2TA 1E2QA 3EA0A 3T34A 1DAGA 4DBLC 1M1YE 2BVNA 1M2OB 2YHSA 1SXJA 2FFAA 5BYKA 1DADA 5HZKA 3OE7D 1IHUA 2OAQ1 3CONA 4FMDF 2PL3A 3KQKA 3RS7A 1PLLA 1AGPA 4Q4HA 2Z83A 3QF7A 5CLLA 2QI9C 4W7SA 4Q1EA 5JI2E 2V1UA 4EPRA 4E03A 1R0XA 3WP1B 4AG6A 4R2IA 3EA5A 3G82C 3H0KA 1OYWA 4PSAA 1JECA 3VHXA 1CEEA 3ZVMA 2ATVA 3KL4A 5C1BA 2HXYA 3VR3A 3UMSA 4F7WA 1G8GA 4N1AA 5IK2D 4UNPA 3WYFA 1TX4B 4ARZA 3A1VA 1A7JA 3QY0A 2VSFA 4QG7A 4OQXA 1G21E 2UVQA 4OL0A 1NVVQ 2A78A 2IF0A 5KYKA 2JJ1D 1D5CA 1E2IA 3HYRA 3TJZA 1MT0A 4C3ZA 4WIAA 4LX0A 3AP3A 2QTHA 5AJXA 3GJ8A 3FHTA 3GLIE 4Q9IA 1K5GA 5GJVC 5BW8A 5HZHA 3WBKA 3DZDA 4IFBA 1BMFA 4OHVA 2IYQA 2ZREA 1P2VA 3L43A 3HWSA 2YV5A 4LHZA 4PC1A 3R8CA 1LS1A 3E70C 2JJ8A 1XCMA 2ZAMA 4GOXA 1OHHD 1Z6AA 4JLKA 2C77A 2G1KA 1DTSA 2DYKA 4NYIR 2BDTA 4E09A 2JLRA 1CR2A 2OO7A 3L0SA 3PJRA 2DCUA 1UM8A 3ADBA 2WTUA 1OH5A 4DB2A 1RZ3A 4O25A 1UKYA 3C14C 4KVGA 2FU5C 3PEYA 3CF0A 1RRFA 5L3QA 1KO7A 3QF4B 4V0NA 4JLVA 5KPDA 1X8LA 4RCYA 1E9SA 3KQLA 1CF4A 4I1UA 3VX4A 2JLVA 2J0QA 2K5UA 1QHYA 1DO0A 4HAXA 3LA6A 2P3SA 1H8EA 4XVRA 4HYYA 3RRNA 1DAFA 1FNMA 3KKQA 4HB2A 4Q1AA 2BBWA 4YDHB 4AYTA 3GJ3A 4GDFA 5FL7D 2WPDD 3OF5A 3I5YA 2XAUA 2ZRLA 4MYCA 4ZPXA 2HJGA 2OM2A 4B2PA 5C18A 4I4LA 5DN6A 3SR0A 3L82B 3Q3JB 3L0PA 2DFNA 2QP4A 3K0CA 4JS0A 4TL9A 4UNNA 4C0SA 4DCTA 5GJBA 2GTPA 4RCZA 2VIIA 2FNAA 4II7A 4QOSA 5JS7A 4V0OA 1FX0A 4TLAA 3THXA 1YZLA 3VKWA 3GJ5A 2QQ0A 4KXFB 1LB1B 2XXAB
chains in the Genus database with same CATH superfamily
5JZVA 3KX2A 4OI2A 4BECA 4RENA 1XK7A 3IULA 1YAUO 4ENTA 3I32A 3AF6A 2HK6A 3O8NA 4J91A 4ZYVA 4K9MA 1EK1A 3Q87B 1YONA 1KY4A 5IAGA 1BMDA 1LNQA 2WABA 4GNKA 2OQMA 1CRPA 3TG8A 4OHFA 4OHYA 3B52X 3UBTA 2OWEA 1P3JA 4A0SA 2PR2A 4JFAA 4NOLA 1KFEB 3M6IA 1U5AA 3E48A 1UODA 1O6FA 1QFZA 3FD8A 5KUTA 3DWIA 1JRAA 4PZYA 3G2MA 3LEOA 4E1AA 3KV1A 1MTZA 1LKZA 1V25A 3WK9A 4XEVA 1JG1A 2VRNA 1NXSA 4MTLA 5IUJC 1M1YB 1NHGA 3WK8A 3QWIA 2PLRA 1AUVA 1LF5A 2HXSA 5LZ8A 4HWKA 2JLSA 1VKJA 1DIRA 4L74A 3PR2B 1ZP6A 4F9TA 3DO8A 1CY0A 1XXHB 4C0JA 5THXA 5HIKA 1OBFO 4JVSB 3ORYA 3N6RA 5CDFE 1Y4SA 3WMWA 3GC6A 4DR1B 1X7XA 1FZTA 1YBHA 3HYNA 5ES3A 4QNMA 4HRYA 1K04A 2PBLA 1GZ7A 1IXZA 3WZ2A 1E7SA 4XGQA 5ICEA 4YRCA 3KQWA 1ENYA 2Z2YA 1W34A 2QLLA 4ARAA 4KLCA 2WKRA 2YFQA 1YDHA 2MSKA 5BRAA 5HIAA 1GPAA 3LPCA 3X2FA 5DLPA 5MFPA 5A3QA 2QWXA 1HMDA 4TTRA 4OJNA 2WAOA 3FPJA 1P9LA 5DTJA 1JHUA 3W2FA 3AL2A 4NBVA 2ZT8A 4LS3A 4Z3DA 1QPZA 3H9QA 2EQAA 2PL5A 1PT9A 2Y76A 3QPBA 4HNHA 4Y1FA 4R32A 3B6IA 2WPDA 3MQFA 1G2PA 3UMMA 4XE5A 3PL1A 4YVFA 2IUSA 3NIDB 3NJRA 1K9VF 3X1MA 1NUPA 1DC3A 2QR2A 1T6IA 1XPJA 3JZFA 1XJWA 4J94A 2IIQA 3LL7A 1L7RA 3F4LA 1WUTA 4QOJA 2CVPA 2FW7A 5AVYA 3WY9A 5IT5A 1QOZA 4EITA 4HDNB 1XTUA 2Q2OA 3IEIA 1M0TA 2UU9B 2ZJFA 2YDYA 3MJVA 1YJXA 2EPNA 1GKIA 1A69A 4XM2A 4FBLA 1OWMA 3IR5A 2ZJOA 2QY6A 3QZCA 4DMMA 2EBWA 3SM9A 2J46A 1VMIA 3V5YA 4AAYA 1VLHA 5JNTA 2PGIA 3ZDXB 2ORYA 3M6XA 1LJ8A 2COEA 2G88A 2Z5GA 4KZKA 1GT91 1SQ0A 4OSOA 3W5VA 1BAPA 1AH2A 1GILA 3LLIA 2AC4A 5HS6A 1XHEA 3WRWA 4L6IA 1MVNA 4PHTA 5COMA 2MSNA 2GCOA 5JIBA 2G8LA 1OI7A 3CEMA 5EHIA 2YNMC 3BZWA 3PQ5A 3QEJA 1C3OB 3PZBA 1PG5A 1BN7A 5HP4A 2HUPA 2H0RA 1TC2A 4LMPA 1ORVA 5GMOA 1I4EB 4BQIA 4G01B 4YDSA 3S2SA 2HSEA 1T2FA 4Z9BA 2Z9BA 1VIYA 4PGAA 1TMKA 1B0ZA 2UYCA 1ZCZA 2C2ZA 1GYQA 3MJFA 1H1TA 3RHFA 3LUTB 2H6EA 3L7MA 2HFIA 4PNEA 4NDAA 5CXSA 3HO1A 3UJ3X 3U40A 3TG2A 1DAIA 4KAAA 3Q8XB 2G36A 3UV6A 4QASA 4OUDA 2XSZD 5K3BA 4BEBA 3VA7A 2Q6LA 3HJUA 3PKJA 4FX5A 4JCZA 2QTGA 2X4LA 4RWZA 3UJCA 5EEHA 1L3PA 3WRVA 1Y82A 4Q1DA 1Z0UA 4LC9A 1KK1A 4R81A 4OFBA 4AO6A 1K6IA 3KSUA 2JEYA 3EASA 2NZUG 2RONA 2XCTB 1C7EA 3T8YA 1FTSA 1O1YA 4AT1A 3VF0A 5GAJA 2E0IA 2JAHA 3DMFA 4QLBA 4DVZA 3UMHA 4KE7A 4L5BA 3AVQA 1GQSA 4HB4A 1QO7A 1SNYA 1K63A 4RPGA 3ZWNA 3VVMA 3KV3O 1M6NA 1EDBA 2A35A 2NPIA 3P2YA 4EBJA 1KYYA 3VPGA 2XUGA 1CIVA 3HKDA 3K0AA 1TVCA 2QMEA 2J9ZB 1XAGA 3NX4A 5AUPB 3M4XA 1P3Y1 1NBOA 4J3NA 2O3QA 4NYJQ 4EF4A 4BBJA 4RV9A 3EIQA 2NLOA 4NBTA 4UD2A 2H29A 1OLUA 1IQUA 3TVTA 4BFZA 3JWEA 3KJFA 3TD2A 3T3OA 4XD2A 5THQA 1PVVA 5DMXA 3O3OB 2YVQA 4ONEA 4PICA 3KEQA 2GEJA 2VC2B 1ND5A 2Y99A 1LLUA 2C8JA 1I2CA 1LPPA 1DJLA 4UBIA 1V4VA 3OJLA 1DEXA 2GRUA 1R9MA 4YLGA 2CNWA 4IDHA 4H4CA 3L7AA 1MJ5A 2ZYUX 3A2MA 3DPUA 4J16A 2JCVA 5BYJA 1P1KA 4ZANA 3IFSA 2GJ9A 1WN0A 3ZWBA 1G291 4WN9A 4QO7A 5WRFA 5IM5A 2ZXFA 3PK0A 4O4LB 2R1VB 1Z36A 2H2FA 2NZJA 3FCYA 4HQLA 3ZWOA 4CV0A 3WFZA 3HVRA 5JMOA 2IEYA 3CRW1 4F3TA 1NJ5A 4S0ZA 3UAWA 1F8GA 4IIGA 3TQRA 1T5DX 4GWKA 3H2IA 4D4XA 4GPIB 3A26A 3LUGA 2VAVA 3QVOA 3MOIA 3GLGB 3QU5A 3DOEA 3O4HA 3JALA 2G7ZA 3HYSA 2BZ0A 2DHDA 4IG4A 1PEKE 2O50A 4TMFA 5IBQA 5EQTA 4YT8A 1T0PA 5BSTA 2DFVA 4G09A 1NVVR 4GAEA 1HDRA 5KYTA 3K0EA 3Q8KA 1HQYE 3QBVA 3NOVA 1GIAA 1X87A 1E3MA 2JJ2D 5A5FA 3ZCVA 1QZXA 4QHYA 5JT1A 1QF7A 4C0QC 1TQ4A 4ZDIA 2QZJA 1FW8A 5AOAA 3DBVO 2I71A 1HTWA 1WW2A 5AKJA 2B61A 1QVAA 4QYMA 4UHDA 4P54A 3MMSA 4FKZA 1I0ZA 3L6OO 1FVHA 2FSFA 3IQEA 3KDAA 4DMLA 1O6ZA 1OFHA 2PF4E 3HG7A 3JQEA 3LX5A 4HPWA 4IRUB 4E5YA 1KC3A 5LYJB 1VGVA 3KALA 4GKKB 2Z3ZA 2X13A 4Q4HB 2ECQA 4DWOA 3BWEA 2R7TA 3PKZA 1D9ZA 1BIFA 3P9SA 4IDEA 1Y8ZA 1U89A 2JH9A 1F9EA 3S9OA 2IC5A 4GZMA 4KJXA 2R00A 1AKMA 1LS4A 5GGXA 3I6YA 4XW2A 5EP3A 1U7UA 2OE2A 4X8LA 3R7AA 4BY9E 3E58A 2HJHA 4R2HA 4OXIA 1W5FA 3IV9A 1OQCA 1TU0A 2EL9A 4BO6A 5B36A 3ZJUA 2G77B 3PFWO 3TO5A 1SOUA 1PQYA 1HY3A 3DWGA 5F7XA 1VHTA 4MWSA 4NCAA 4IQFA 4BQQA 3JRWA 3QPAA 4LYYA 4QYIA 5T64A 3VV3A 1FNBA 4B17A 4Z1OA 1YTUA 1F6WA 3L06A 4RZ3A 2V7PA 3DL4A 3B3QA 1Z6QA 3HCRA 4R9VA 4OB6A 3SC4A 1L7NA 1AUEA 1A0BA 5C46F 1E6KA 4ZAZA 1EESA 5KYWB 3LYUA 1YB6A 5KX5B 4C22A 2VUUA 3NVAA 3LLCA 1Z18A 4M0FA 3VNAA 5EHGA 1R5JA 4PPFA 4R1OA 2F7SA 1U3DA 3U60B 4M54A 1SXIA 1UPXA 3A05A 4UUAA 1J8MF 3N24A 3UPUA 3ABQB 4JMLA 4MAMA 3M3DA 3I3SR 1IG0A 2GSWA 4NCIA 2XIQA 1C4KA 3EXEA 1PFGA 4EHNA 3STVA 2CV1A 3NEJA 1PBNA 3LQYA 2PWPA 2C7BA 3SBDA 1WDLA 2H2HA 3TEJA 3VPCA 2XD4A 3IQWA 4ME6A 1BEEA 3A9WA 3IUSA 3ASVA 1N7GA 3BH6A 3PDUA 1VRCA 5E3JA 2HRQA 1KKUA 3DDSA 2D0IA 4O4IA 5GPGB 4TTVA 2M6RA 1FP7A 1Q1AA 4D9NA 4GBED 4AYWA 3TGPA 2QAGA 1OR3A 5AKXA 3CVWA 3RTGA 1SOAA 4AE4A 1GPNA 4UXHA 4WERA 3SXZA 4ETWA 3S2YA 3ZHOA 3JVVA 2QT0A 2NWQA 2P77A 621PA 2V9ZA 1PNOA 1JFRA 1WF3A 3DFKA 4ZVVA 1GA1A 1E5DA 1MTOA 3AW9A 1VPVA 2CDNA 1UBNA 3FHOA 3DFFA 2CVQA 4BQRA 1XXHE 3D7SA 3SJAA 5IG2A 3OICA 3K1IA 4D0NA 3RVOA 2PUHA 5KSYA 2FE4A 5B4VA 5BN4A 2ZUCA 5ALIA 2P69A 2B5WA 2VDVE 5F1YA 1SCDA 2QN1A 1AZWA 3IUEA 4B43A 3E5HA 4KLRA 2GZ2A 5B37A 1NUQA 3GWNA 2D1TA 3SMVA 1TD9A 2D8AA 3DC2A 1DEHA 1IPEA 3UH0A 4UULA 1R4NB 2W7TA 3WQQA 3N1UA 3CRZA 2ZRMA 1LTQA 3I2JA 3PR3A 5B12A 3I3OA 2D7DA 2GPBA 4ANJA 3BGSA 1Y4ZA 3CISA 2ZS7A 1L3CA 1MO4A 4BASA 3WLFA 1OLXB 2Q4EA 2B5VA 4JHXA 2B8EA 1QRAA 3E27A 3RUCA 1OX4B 4HYQA 4NYMR 3NAZA 1E0AA 2CFOA 4PGFA 4C4TA 3A04A 4KTTE 4FDMA 5IVPA 2FWMX 3FOAA 4M0DA 2G17A 2Y3IA 1UJBA 1WHTA 1GCUA 4GRDA 4TLLB 3ZU3A 2OLJA 3OFJA 2OOKA 2GD6A 3SXJA 2F8SA 1PS9A 2YQ5A 4H31A 3BHJA 2HU8A 1GL9B 5CD9A 3PC8A 2PKCA 5DOZA 3JPYA 2FAXA 4A4AA 4QEDA 2FZWA 1ZN7A 2P5TB 5HOQA 2JEOA 2FDCA 3QVSA 4ZEMA 2HT6A 3U2QA 4C4OA 4OJQA 4CMIA 1AF7A 1V3QE 2C2OA 2RB4A 2CUNA 1EFPA 3KC2A 4K6FA 1P0MA 3TMKA 3C7AA 1JAXA 5TJ5E 1CEQA 1XP5A 4DIBA 5LIPA 1T6XA 5EXXA 3PDIB 5FLKA 2FG7C 3I01M 2XLBA 4EGSA 3TQIA 4MS3B 3P9YA 5FOQA 2Y9PB 1KSJA 5LDGA 1SH7A 4M1YA 2Y6UA 5K3FB 2VH1A 1M0EA 4RYDA 5A5DA 2IUUA 4EGJA 1UOQA 3C2QA 3VJRA 3JTMA 1IEVA 2H07A 3KJGA 2JATA 4J0HA 5AD1A 2QXTA 256BA 1ES9A 1B8UA 3MQ4A 3LGSA 3ZKAA 2I5PO 4XIIA 3IQTA 3TK0A 4BAZA 5EZSA 4UTVA 4IFTA 3UH1A 1D0YA 4GM4A 3L0IB 2BMWA 3WK5A 3L84A 1ZRMA 4L8GA 4IH4A 2D2VA 1YCDA 2PSFA 3DG9A 2XVYA 2BDUA 1NPDA 3QBEA 4PFKA 4ZGGA 3IKMB 2IEZA 1QS0A 3HHPA 1I5NA 4BPMA 2KM1A 2H8AA 5AK0A 2L6HA 2DU8A 4LJ5A 3WLSA 4ITUA 2D3WA 4UE3S 4MI9A 2FXVA 4NE2A 4F04A 4P2BA 2ZDGA 1NNI1 1YRAA 5DH9A 3ZVKA 2RHBA 4S2UA 2C0CA 2FR0A 4XYGA 1SYQA 1WVGA 4JWKA 1L5VA 4YI3A 2C1XA 2Q1TA 2WIAA 3O94A 4HOYA 3W1WA 1L5HA 4GMGA 4ZAVA 4L5CA 2NZWA 1P5HA 5KNBA 4WXYB 1ICEA 2O3TA 5JQGA 4BVLA 1M34B 3JZDA 1QSGA 5AHKA 5TMBA 4NMHA 1DG1G 1Q0HA 5JECA 4DUGA 1TQDA 2EX4A 1BEUB 3KHKA 1D0VA 1AC5A 2J0UA 3HKBA 4GLLA 1N6OA 3T5GA 2ZE5A 4TVKA 3ZUGA 4JURI 3C4QA 2VDRB 4A0RA 3SFZA 3PUWA 3M4YA 5IY5C 3M3HA 2VJDA 1A2OA 4RA9A 1CQPA 3B1VA 4I50B 4DLPA 3W2IA 5L3SB 1YI1A 4WNCA 4MW4A 2IYOA 1DARA 4TV8A 3O93A 5D7BA 5EHXA 2H63A 5KC9A 3TGLA 4CS8C 2HSJA 4M0KA 5F3RA 1U7DA 4P36A 1RI3A 2P3QA 1MP0A 5DASA 4W1QA 3O84A 2MYNA 5F21A 4C3OB 1N2BA 1T9KA 4KO2S 2G1PA 3N8HA 3H2UA 3QLEA 3S7TA 2QLNA 4X1IB 3V8EA 3IOBA 2W43A 4CKWB 1YHYA 2IY8A 4IILA 5MN5A 5ALZA 2B2XA 1Q74A 2PWAA 4UNIA 1GPWB 1DAGA 2YHSA 1SXJA 3O4FA 3NDJA 1D2HA 1O0CA 3KPVA 1R0XA 2CXNA 2FUKA 3G82C 5C1BA 2WHEA 2PGAA 4YUZA 4U3JA 1YFJA 3QPCA 1MG0A 4UNPA 3E05A 2AC7A 4RF2A 2LV8A 2IF0A 2Y69C 3FAKA 4R1UA 2P1AA 5ALOA 5HZHA 2PLNA 4H2DA 3JQQA 3RTBA 4GEGA 2ZREA 4YT2A 3LKDA 2GZSA 4U7PB 5B3JC 4OX9B 2FMKA 3WODF 2XLWA 2Y39A 2BDTA 4TZKA 4EG3A 1OC2A 2PD3A 1Q50A 1ISHA 2CJYA 2FRXA 4ICIA 4R5HA 4D57A 4IG9A 5KPDA 3Q3IA 1RXEA 1LTKA 1IDOA 4BC0A 2QUHA 4XVRA 2Q0SA 1IL0A 2R1TB 2QP4A 5GJBA 2AOXA 3VNRA 3HNOA 3LPNA 2CGEA 4MNTA 1G59A 1U8XX 3BBLA 2QN9A 2QZ9A 2FETA 4LY0A 2JCSA 2I7DA 2ATEA 4XRRA 3ZDZB 5BWNA 1W9HA 1VL1A 3Q3EA 4US2R 3QVZA 2AN9A 2VSXA 3EGCA 5IEBA 3KM0A 1NW5A 1XFDA 4B3BA 1WPXA 3HJGA 4Q05A 3AG5A 1MEJA 3IAS6 5F98A 1FJ2A 2XMDA 4EJFA 3UPTA 3AUKA 1ECBA 1H3EA 421PA 3VYVA 4BKUA 5CUQA 4NQZA 1G19A 5K3CA 1KJWA 2C5HA 4OSEA 3OQBA 2DLNA 2VYCA 4F3CA 3QMMA 4HGQA 4XSVA 1TEXA 4YFVA 3K72B 3EQ7A 5C51B 2GPNA 4MA0A 2CXHA 5K3EA 4RTSA 1G8FA 4CKCB 4PN3A 3GU3A 5KVVA 2G83A 4Q4CA 2QEQA 4RV4A 4UMDA 4Z4GA 4J07A 4X9XA 5CDHA 1GT6A 4MWBA 4LQ4A 3MGCA 3IP7A 3UATA 5DSTA 2K87A 4EY3A 5DI3A 1PYGA 3IEPA 1UXIA 2BKEA 4LJSA 2D0PB 4RADA 1TCCA 1OFVA 3QUQA 3IB3A 1HXHA 1TVMA 4YK5A 3HM2A 1UBMS 3ZLTA 1DAPA 5I8PA 4QHTA 2V45A 5JRZA 2P9EA 1EFHA 3DDUA 4NULA 1JSXA 4MVJA 4CN8A 2WUDA 1R6UA 1IJEA 2FPUA 1YR1A 4K0DA 2D7JA 3CUUA 1OPRA 4DADA 3C6ZA 5TJ9A 2YZKA 2RHJA 1CS4C 1GNTA 4AX4A 4Y3UA 5CYOA 4QSMA 1GU7A 2EIXA 1V9SA 4RKEA 4S3MA 4QXPA 3T4PA 4NARA 4I4TB 2XLHA 1N6NA 4DIUA 4M49A 4IIJB 2EFHB 1D8TA 1GFWA 1GZ5A 4NHEA 3AVXA 4YH1A 1MFPA 4Q9NA 4B2LA 2OZLA 2O5CA 1H22A 4IZ6A 2HDHA 3IT3A 1ID8A 2WIBA 1XZBA 3L4JA 4CPDA 1EUYA 1RZVA 4BNDB 4RTJA 3DDZX 1WNFA 1TCBA 2BMFA 2CWWA 2IH2A 2CXUA 4KUHA 2H2IA 1WVIA 4TXMA 5T3TA 4QELA 1AY0A 1UC4B 2CBZA 1NFFA 1PF7E 1NW4A 3TD6A 2HTEA 3L40A 1ZM4A 4UTXA 5DGXA 4DCGA 4WABA 4L7QA 4NBKA 3TAHA 3AFMA 1R9GA 2BEUA 5LP6B 1OWPA 3K9CA 2ZBQA 3GGDA 3C1TA 2PLWA 3T7KA 3PD7A 2G0AA 5IM4F 5KB3A 4JLPA 2Q21A 4HWPA 3CRMA 4PZDA 2IS4A 1R4MB 2F9LA 1HDEA 5EA2A 2ZYRA 1JF8A 1JFTA 2FRVA 4EJSC 4EA6A 5BUQA 2ZT5A 2C07A 4QPJC 4D42A 4IKOA 1GGFA 2W6ID 1L4YA 4RIHA 2R03A 3KHSA 3VOAA 5K0GA 4JIOA 3EBPA 3EGOA 5DRTA 4E12A 3G2KA 2PX2A 5J3JA 1RHMA 4ZHQF 2PUWA 1VHWA 2DFDA 3IMEA 3TWOA 1NGSA 3A3NA 1M2JA 4R8MA 1KL7A 3U48A 3E9ZA 1C7QA 3HA3A 4EPXA 2C31A 2C3YA 3M9XA 1U1FA 1D5WA 3FNRA 1OTHA 4MR7B 4HVTA 4GHWA 3ISJA 3FHDA 4RHCA 4B6SA 1C4WA 1IXKA 4OHRA 3AIIA 2JJQA 4EHIA 4WMLA 1FMLA 3AX6A 3EZXA 1TZ2A 1OA0A 1T43A 1JG7A 1I2ZA 3KKKA 5EFZA 5FB3A 2VYNA 4U1RA 1W25A 1JWLA 4KFUA 3U2LA 5CVUA 4E94A 1ORIA 3BAZA 3HACA 3ADOA 1EVZA 1ECLA 4EFDA 1U2PA 3EW7A 2VCYA 2EGUA 2W2PA 1Q7TA 5CB4B 4MLPA 3Q7PA 2XCOA 1S3FA 4LVUA 1K2VN 1ZJ5A 1X77A 1QHHB 3NIBA 4B74A 1SPBS 4IO1A 2O2ZA 2XWBF 3TLMA 4NL4H 3UMIA 3HA5A 2AMLA 4W7IA 5AQEA 4K9LA 3NIGB 3SFTA 4FYIA 3PIDA 4IJKA 2JGDB 3ZJYA 2AC2A 3TSWA 4TSRA 2B4QA 4MPPA 1LC3A 1E3WB 1GPBA 3O4RA 2D54A 1MJGM 5ICSA 3C8DA 1IK6A 1QGZA 4GYYA 4WKPA 2JGAA 1TJNA 1VLLA 5JANA 3NGLA 1K40A 3OT5A 5G0UA 5AOVA 4XYMA 1ILWA 3ECCA 4NHOA 3R9KA 1JAFA 3WNDA 3CM0A 5KTTA 1K88A 2YJ6A 2WJ6A 5F12A 3A6HA 2NO5A 3BFPA 1AT1A 4EHJA 1YZUA 5KO2A 1TF7A 4IRMA 2YZSA 4XFDA 4RVUA 3I9JA 5F76A 4BQNA 4F38A 4ZICA 3GFRA 4CR7A 4OQ4A 2O8CB 1L5NA 4RZQA 3MNFA 2R02A 3H6HA 2NSYA 1A7KA 1Q0UA 2AH5A 1SBTA 3F5SA 2UUIA 3BWMA 2ZRFA 4TSFD 5JXJA 2C2MA 4QBKA 3HV0A 2RC6A 2PO7A 4XQ9A 2RH8A 2H8GA 3QV1A 2WWFA 4DPMA 1Q1ZA 3L46A 3NYJA 1LIHA 1ZVQA 3GLVA 4OYLA 4MSUA 4RFSA 4NEQA 4KUGA 4C7XA 2BJVA 1CJKC 4LXYA 3T1VA 3PLNA 3QKTA 2PFDA 4UMVA 5EWJA 4KBLA 1V16B 3IQZA 3MMPA 1AVTA 5TQ2B 3LSTA 3O9VA 2Z8YA 5HKKA 4FPXA 3D6UA 3B3AA 5FL3A 3PPIA 4N65A 4ZOQI 1QYVA 2C95A 3CU5A 3FYDA 3GWGA 2BEVB 1YBAA 2PNFA 2WM9B 2B1IA 1E7WA 3JVUA 4AX8A 4MWCA 4B9EA 5FOTA 4HG2A 2HWXA 2Q9CA 2PKEA 1CK4A 2E48A 3ITDA 5FR2A 2YIDA 2O7SA 3INRA 5E7QA 1ZYUA 3WKDA 5KAPA 4QOEA 3BFKA 3DMTA 1ULBA 5EIAA 1USVA 4S1NA 1QYXA 4FIZA 1T0JB 3RYIB 5E0OA 4P86A 1JTEA 3QVGA 3PITA 3OLYA 4TPKA 3SOPA 1KGSA 5HTOA 4AKHA 4MUHA 1M34E 1WB5A 3GARA 4UU7A 2VDPB 2IY9A 3HJAA 4MS4A 1XNHA 2ZXWC 1TR2A 4O2BB 3GFBA 5D5HA 1EFTA 5KYGA 1O77A 3V48A 1DO8A 1TW2A 4PHHA 1JJVA 1Z5WA 5AC4A 1S8AA 1F51E 1LFDB 1YLMA 1J00A 3GP3A 4IW3B 1DCKA 1K97A 4J90A 4MZXA 2DZDA 1M6HA 2GESA 3RV3A 1IBMB 3BEHA 5DWQA 3WLAA 3EHMA 3K53A 1E2LA 3NP9A 2A6PA 3SSMA 1IEXA 2WRZA 1Z5ZA 1L1RA 5CG1A 2YIMA 4CCYA 1URPA 2I0FA 3CUEF 2ROQA 3R5KA 3H3JA 1YDWA 1O2DA 3OIYA 3T7IA 5L8VA 2OMEA 4ARZB 3COVA 4ZV9A 4ZKDA 4HTFB 5CVCA 4ZZ2A 1N2CE 1NW3A 1BQ3A 3TZBA 4MHTA 2RKOA 5BT9A 2Y1LA 3W7AA 2IWRA 1GTMA 1YZ3A 2DEUA 2GBCA 2WI8A 2YQZA 2ZZNA 4FINA 3P9XA 4JTDB 3WHLA 3A1UA 3KJZA 4XX0B 3RSHA 4QFDA 4CCWA 4HD8A 1NFRA 2D1YA 4W1PA 4JASB 4R9NA 1RYZA 2ZSKA 3BVPA 1R5BA 2C88A 3D2LA 3WGJA 1WQ4A 2QNRA 5IU6A 4PBSA 2GXUA 3W5UA 4IVQA 5JAUA 4HNTA 1KH2A 1MCZA 5D01A 5CNMA 3PEWA 2QMOA 2Y1KA 1KAOA 1YA7O 4G1MB 5I9MA 2V3WA 4MVCA 2J0VA 3HFRA 2KWIA 2DPGA 4XWYA 1QV9A 1YQUA 1FSPA 1A9OA 521PA 4UOQA 1GZVA 4JRZA 3BMNA 2QG6A 1IZ8A 1MOZA 3O0TA 3OCZA 4OU4A 1NUSA 4PWZA 1NU9C 3CX4A 4EMSA 4YWJA 1KS2A 2CXTA 3WSWA 2EBUA 4AYXA 4MPJA 1E3SA 4FS3A 3TMYA 1U3WA 1WR8A 5EZ6B 1P2FA 1T3TA 3NTVA 5JCXA 2QE7A 3JASB 1C3JA 1LBEA 2VP9A 3AZPA 2OJQA 4H0CA 5BW4A 5AW4A 3CMMA 1HE3A 4MRRA 1H7IA 2CL5A 5KWJA 1QRUA 4LZAA 3UAOA 4REOA 1DUSA 3H1GA 4EX6A 3INTA 1YZCA 4ND5A 1R6BX 2P6VA 3JD1A 3NYRA 2C5BA 1P1HA 2A0XA 2EYQA 4B82A 2WPNA 4ZYWA 2YN2A 3RRFA 3OZSA 1YNSA 3PUIA 4ZJYA 1PR9A 2L9JA 5KBYA 1P4JA 1IWOA 4NG5A 1VIDA 1Y1PA 1ZL2A 1FE8A 2FN7A 3L2OB 3DZAA 4PBRA 5KQPA 1K27A 4MDHA 4XIGS 1QQAA 4HK4A 4JEMA 3THOA 1WX1A 2OK7A 1GDTA 4UTZA 3TI7A 1OB2A 4C20A 3KVYA 1NZEA 3DE7X 4RVCA 1BCSB 1R10A 2F00A 5DJ5A 9ABPA 3RJMA 5ESXA 2PTHA 4AQYB 4GWLA 1F0YA 4BNYA 1M66A 5KWSA 5T4BA 2QUIA 4W8KA 1QDLB 3TTSA 5E7JA 4MI6A 2CHQA 1H2RS 1Z37A 2C7QA 3M1IA 4LY3A 2NQ2C 4JX9A 3ZNPA 1E96A 4LOJA 1NJ6A 3RM3A 1ZU5A 3VPHA 1AOXA 2FN4A 2PJUA 3LY8A 2AFHE 4K28A 2J32A 1E3QA 3ZHXA 4P7FA 3I76A 2AVKA 2RFLA 3OU7A 2CDBA 1I32A 2CSXA 3ZV4A 4B3RB 2QK4A 4B7ZA 3WLPA 1E94E 1O8BA 1TRHA 3X1XA 3GYGA 1WXHA 2AV6A 2ZRQA 2VDQB 3MJCA 2P1DA 4TYNA 1WABA 3LW7A 3AF4A 1T24A 2M1ZA 4Q6BA 1EJBA 1A71A 3FPCA 4DYVA 2PZLA 2BJWA 1HURA 5C3UA 3CZ9A 5NLLA 5K9ZA 2WW8A 2C4WA 3CT6A 4YMWA 5KNDH 2PX4A 4M1KA 3KYJB 4A6PA 3W9UA 2WB4A 3MINA 4N7RA 1RHUA 1E1QD 3J81A 4LW8A 3E5MA 4C3BA 1A2BA 4YRZA 4PX9A 5JNWA 4ZQEA 3HY6A 3T5TA 2WFAA 1OWLA 4FE7A 4WADA 1GPDG 2DFPA 3I73A 4NKRA 2ENUA 2ZR7A 4YAFA 4BNHA 2OPBA 4IVNA 4ZDWA 4ZGWA 1B2RA 1T6NA 3CZCA 2BKXA 1FLDA 4FOSA 1U81A 2H1RA 1EJ0A 5ARDA 3VTAA 4O1HA 3RRXA 3DLIA 4G1VA 5LBIA 4P5EA 4W8GA 5FNZA 3P71T 2ILTA 4I1VA 4UBLA 1XP8A 3E4DA 5LOVA 3FF1A 4ZAFA 5J2TA 1LD3A 1P1RA 3H5LA 4PW0A 4JBIA 3ZDRA 2XB9A 4EKYA 1TLTA 2VQ6A 3H2SA 4RGQA 1TZJA 2Y4NA 1ZJ4A 2H2DA 1B2LA 4NMMA 1ZIXA 4XM1A 4MRMA 2YYAA 1NJ1A 1CDEA 3H18A 3PUYA 1CJMA 4MHOA 4BRSA 3NMUF 3SQMA 3A11A 1XDDA 5B58C 1ONOA 3KXLA 2VLIA 4LGMA 3KPHA 3IIIA 1M7HA 1B68A 1KI9A 1YTLA 2O8BA 1UOEA 1LNZA 2WYUA 3BK7A 4OXQA 1CWUA 1WCIB 5IABA 1QXSA 2A57A 1Z7BA 3K96A 3OY7A 1PE0A 2IP1A 3P2IA 2HV8A 4YPFA 5JSKA 4E5NA 2HRZA 2RGBA 3RQSA 4RKYA 1H23A 2HPVA 3CJQA 1M8GA 5FADA 4EQZA 2C4HA 1WMBA 5FUVA 2I1WA 2LE0A 5JCZA 4Z4IA 4PF1A 2V8OA 2W22A 1PV4A 3QH4A 1TU4A 3PP8A 1ZHFA 3N8KA 2QY9A 3DLBA 2OILA 4OINF 1G4WR 1QE0A 3MYRA 4JJ7A 4ZO8A 5M04A 3GWLA 4RD1A 4B6RA 4GI2A 1R0LA 4JTCB 2G5GX 1AURA 3FCCA 2E5FA 4X90A 3UJAA 4FWTA 2CNBA 1YF3A 3ELDA 2H5EA 4D9JA 1NSGB 2XM4A 3AHJA 2YKGA 4YMUA 3CYFA 3LBFA 2BPOA 3TEMA 2B1GA 2OBXA 1NFNA 3LF2A 3K35A 3MBGA 5EMLA 4YHHB 3PE4A 3AR8A 1LRKA 1SR2A 2PX6A 1PWXA 1AUPA 3MERA 5TPZD 4EQ6B 3WVNA 1KOJA 3O82A 3C24A 5LQMA 1Z2DA 2RGGA 2IYZA 1AQYA 1SUPA 3L6BA 4FM9A 1R6VA 2GM5A 3SYRA 3R7DA 1W4CA 3H17A 1E2KA 3EFOA 3B89A 3N7AA 4OBBA 3AJEA 4Y2HA 2G5PA 1ODIA 4I1OB 4LQCA 1Z07A 3HXMA 2B69A 2FA9A 2FJ0A 3C1UA 2AIRA 3HZRA 3FFTA 4HADA 1TZCA 4HQ0A 3E8MA 2DQKA 2IYRA 3HUTA 5AVJA 4F2GA 3RUDA 1RCTE 1LVKA 4O4LF 3BL8A 4JLBA 3VU3A 2IU0A 2HX1A 4NRDA 1ZVZA 3LP5A 4B5KA 1CZKA 1G8MA 2JFGA 4KOAA 1X7WA 4XWJA 1G5FA 3SIWA 1FYVA 1A2QA 1I6KA 5G1NA 1WDWB 3DE8A 2DKOA 1N5DA 4MUBA 3H9BA 1FSSA 2RKWA 3D6AA 2WZDA 1PRYA 3D8UA 4PPGA 4DSTA 3RHZA 3M79A 4ZTZB 4MV3A 1IHDA 2VJMA 3H13A 1J7JA 1SRQA 2O5VA 5JASA 5BR1A 3AHHA 2J9YB 2AF4C 4XKJA 3FBWA 4KDEA 5FA6A 4ZJUA 1Y4CA 3CONA 2X86A 1I5OA 2VBFA 5DTRA 3JQAA 3TXXA 4E03A 4C07A 3KPUA 3NRCA 3IDOA 2K7FA 4AULA 1VMEA 3W8EA 4E18A 2GA0A 3VMMA 1RBZA 1RI1A 3NVKI 4OXKA 3EK2A 1K5GA 1RRKA 3DEAA 1VYHA 2BM9A 2IYQA 3RARA 3BXHA 1DQRA 2YN4A 1OH5A 2FQQA 4DB2A 1MZVA 3PEYA 8MHTA 5LYJF 3VX4A 4OD0A 4F21A 4JQCA 5E9JA 1RBMA 3GCWA 4ZPXA 2FYTA 3E9EA 3OF3A 4G81A 3B7WA 3JQ9C 3UHPA 4TLAA 2XUQA 1DKLA 4ARCA 4KXFB 1EVYA 4A5SA 2XXAB 1W8IA 1NX9A 1WEHA 5LXTB 3TIGA 4X60A 3BDAA 3W4IA 1T0BA 4C4ZA 3ELBA 1EUDB 3DQZA 5AW5A 3IHTA 4RE5A 1Y5IA 1ESEA 1A50B 3PX2A 1CQJA 4DYDA 2BP7B 2FUEA 4ZXFA 1UMDA 2AN1A 2E21A 4G0PA 5K6TA 4FAPB 4YV2A 3T5CA 1Q0LA 2YZ2A 2YJNA 5JLAA 4TYWA 2RJNA 2OQ2A 3ABZA 4BX0A 3OQJA 1SUAA 4URHA 1GTZA 1MOQA 3VO9A 2W5UA 4Y6OA 2KYHA 3Q12A 5BQHA 2E5LB 4EDFA 3QUTA 2IHYA 5HX7A 1DEAA 1ZJYA 4AJKA 1ECJA 5EIXA 3K0FB 4H54A 4UDNA 4GOKA 4IQ0A 4JK3A 4DA0A 3BK1A 5PNTA 1KJZA 4EY6A 1C2YA 4NYJR 3UJ8A 3ESZA 3TTUA 2QZSA 4RFVA 4ZQFA 5JUAA 4XPYA 2X8WA 1ZFNA 1MA0A 5I4CA 5DW0A 1ODFA 1HDXA 1JJ7A 3NKEA 1JIUA 3EH1A 1NM5A 3ZGLA 3B6JA 4JW1A 1C3XA 1UZNA 2DFTA 1BE0A 5ALRA 1QRSA 4LJ6A 5C7LO 1QZ3A 5G3YA 5AT1A 2AG0A 2IOQA 2LSEA 2PSSA 1SCUB 2PFGA 1YR6A 2UVDA 3D5TA 3ZTTA 5JDCA 4IDAA 2CB0A 1V4BA 1WF6A 3VSDA 1ZISA 3FWKA 4II3A 3IRVA 2OCDA 2QAJA 5H0IA 1NI3A 2XDQA 2QXYA 4X95A 3I1IA 2W6JD 4H9GA 1QG0A 1KQOA 2WTEA 1H94A 4YJ2A 4ASUA 4W5TA 2R5WA 4X6LA 3EXIB 3N2KA 3GFTA 3RFXA 2CKDA 3I12A 4ITRC 3UAXA 3V2UA 5DO9A 3S0XA 1XMSA 3EC7A 5FBQB 3DHNA 4OLBA 1E89A 2A1TR 3R0IA 1MB9A 1U9IC 4DMFA 2GPAA 4YRTA 3CX3A 2F8MA 4D4KA 4U63A 1RYDA 4I1SA 3O5AA 2R86A 4F12A 1YUMA 1R16A 3DO6A 4EP1A 1Z8FA 2P1RA 3M9LA 2I62A 3JTEA 3R0XA 3TUJC 4W8HA 1QQ7A 3O7WA 1VCMA 2HSWA 2C5EA 1YFZA 4U4AA 3S3TA 1S05A 2I3ZA 2OCCC 4GZ3A 1X42A 5F1PA 1XNJA 1PL0A 2NVUA 3I04M 1E59A 3RYTC 2MTBA 5EP4A 1P61B 3OLZA 3TLZA 2G8NA 6Q21A 1X7ZA 1FR0A 1I1HA 1JX6A 1U3UA 4IJ6A 4Y6PA 3OIGA 5CXQA 1AHHA 3O6XA 5DBGA 2FLVA 2Y3HA 3D3KA 3ABKC 4WESB 2JLCA 3LNTA 2AJ8A 3AP1A 2C2HA 3IX7A 3DMPA 5AK4A 3AG1C 1NJSA 4RPJA 2D5IA 5HYVA 4Q1FA 3IE0A 2ZRPA 5DM60 3BRWA 4TZTA 4WL0A 3UMRA 3UK6A 2V7UA 1TKBA 1D7AA 2XM0A 3GCGA 2WVJA 3VU1A 3FLBA 2CNKA 2ESRA 2WJAA 3PWTA 1RBYA 5H3HA 1I7QB 2GK4A 2GXSA 3BREA 3AETA 1Z2EA 3TBFA 1U7XA 3LESA 4KLAA 3FF4A 4AW9A 4JY7A 4DBRA 3MTEA 1CQIB 2VA8A 1X1DA 1WZNA 3GDFA 2BRUA 2C61A 2REQB 4I3GA 2HL6A 4D4GA 2ZD9A 3T5MA 2HR1A 1GSAA 1JAIA 2HQRA 3Q0TA 5HQJA 1ZVKA 1PJSA 3VOSA 1Y81A 3U44A 1H9CA 3AOEC 5IVDA 4D9BA 2HLDA 5IDVA 3ABLC 4FYMA 4ZVUA 4N06A 2IRWA 4PNPA 4LQLA 5E6SB 4JHLA 1QIJA 1P18A 5HFAA 2JNWA