3NYMA

The crystal structure of functionally unknown protein from neisseria meningitidis mc58
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
118
Chain Sequence
AMETLNDIKILINVGLYQGFDLTDPKVSEEVNHETANMWIDYTSDGNWDNEFKEDLNFLDYMEVCQLALNDNFIASNSLFMAMIYAGNLSLIFDSIKTDISTLLSAEYKKNSFSWPSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title The crystal structure of functionally unknown protein from Neisseria meningitidis MC58
rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Structural genomics, unknown function
total genus 35
structure length 118
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1000 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3nymA00
3NYMA
chains in the Genus database with same CATH superfamily
3SYNA 1WN0A 5BQHA 2PX0A 5FCLA 3K33A 4HFKB 2LCHA 2LP4A 4MVUA 2IXNA 3TK0A 3ZWIA 1NG1A 3LEOA 4BEJA 4EIYA 3CEXA 2F22A 4N06A 3V5XA 4CS8A 4GQHA 3HJCA 3MFNA 4EBKA 3Q6MA 3GEIA 2YQYA 1LI7A 3C8GB 4E0IA 4U5DE 2MHRA 4NY3A 3VYWA 3DM9B 3NKEA 4AE4A 1ZHZA 3GM3A 4CIPA 5A6KA 3O6XA 2XLWA 4K7BA 5B3SC 1Q0FA 3B0PA 2L9JA 3HTKC 2A69F 1BR4A 2YEVA 4IAOA 1PD0A 4YL0A 5AC4A 4XQ1A 3QMKA 2WZLA 3DE8A 3U0CA 2NUPB 1ZYRF 1OKKD 2L6GA 1OR3A 3DJUB 3MLGA 4CJOA 2VB6A 2CNWD 3GORA 4KNVA 2QE9A 3Q7LA 2YL7A 1NBBA 2XS1A 3I5QA 4GYTA 4PK4A 4CS9A 4QI2A 1A7EA 1YVIA 2GAQA 3EG9B 4YL1A 3AG2C 4DJ9A 5JUAA 5L0GA 3EH1A 4PFPA 1JAFA 4MVQA 4MVRA 2FFHA 4OD4A 1OCZC 3NMKA 1HE1A 2OG2A 4MW8A 1F1MA 3OA1A 5A69A 1YDIA 4U9DA 3U8VA 4D4XA 4PJJA 5KYYA 5KYUB 2OU6A 4YJWA 4OINF 3K1IC 1CPQA 3B71A 3W8IA 1OCRC 3UNGC 1CGOA 3C63A 4XEVA 5KYWB 1OCOC 4J32B 4OD5A 4I1OB 1HW1A 5DQTA 2R7SA 4IAQA 4JTDB 4ZLDA 1WGWA 4E0HA 1EQ1A 1RJ9A 4KC9A 2IM8A 4U5HA 3G50A 3H2UA 2R7OA 4YL3A 1NU7D 3EFOA 5COMA 256BA 1BZ4A 2B0HA 1V55C 2NPUA 4MVMA 3X2QC 3W2WA 5L0JA 4KI2A 1KTMA 2HV6A 2ZXRA 1QLEC 3S27A 2G62A 4I1MA 1MNEA 4MS2A 1U89A 1OKKA 3L34A 3B9QA 2CNWA 4UDVA 3EPVA 5B1BC 3S9OA 2C04A 4JKVA 2EPNA 5A6JA 5K0IA 2Y39A 1E83A 5L0FA 2UUIA 4BJ1A 2R7RA 1ORSC 1TWAA 2OKUA 3PCVA 2W4BA 2YL1A 1QZXA 3T6BA 4O7GA 2BC5A 3SXKA 2M64A 1TKNA 4XLNF 3RVZA 5F5HA 3M4BA 1RKEB 4EHPA 1Y6DA 5E2QA 1EKYA 3PHF2 3S84A 5T3WA 2AP3A 3GM1A 1D1CA 4OIQF 4WJ0A 2RSEB 4H4KC 3K1HA 2LD6A 3K7DA 1OW7A 2J7PD 1T01A 4A2NB 5L0CA 3V7OA 2R7UA 3B29A 3SXYA 4EKWA 5DS6A 2TMVP 3ZC4A 1O87A 1WASA 3DM5A 3HNIA 3LUTB 4WABA 3M79A 1Z6AA 2HJ3A 3NYLA 2R7VA 3DMDA 3ITFA 3JSZA 3LEVA 2ZXOA 3AQBA 3MYIA 4LLCA 2AWYA 5COGA 2WVQA 2W4MA 2VC9A 3LLKA 2A1DD 4BJ5A 4ER9A 2G3KA 3UR3C 3N0TA 4BJ6C 3EGXB 1A7DA 3ABKC 4JEAA 1C02A 1L7CA 3RQGA 2H7VC 4G7OF 2P61A 2CW0F 3L8JA 1U0BB 4XPYA 3S90A 4G7HF 1OQCA 3EGXA 4LDQA 4C3EA 1I4ZA 2EPKX 2NSFA 1ZW3A 2V26A 2X0CA 2B0JA 1Q0GA 1JRAA 4NCQA 4EBBA 5IY5C 4CSAA 3DWWA 3C8GD 3G4ZA 3V5ZA 2YKZA 2CYDA 3NMJA 2VH3A 3UMKA 1VLSA 2ZXPA 4H54A 4BJ5C 1HY5A 2KC3A 3JZ0A 3S28A 1YAUO 1ST6A 1A41A 4CDVA 2L81A 3HKKA 3M4CA 4ULWA 1HMDA 1QQ3A 2JPUA 2YWAA 3RIPA 2YVKA 1GS9A 2J7PA 4YN0B 2OEVA 5E3AA 5B1AC 3ZDLA 3AQCA 4C7OB 2WZGA 2Q4FA 5T3TA 1VK5A 2MWQA 1M2VA 2EILC 2PX3A 4JC7A 4J7YA 1ORJA 2HSBA 4YT4A 3H65A 3TULA 1VMAA 2J9WA 3IQTA 3S29A 3BRJA 1HW2A 4C3DA 2HSQA 4OIOF 1D0XA 2Q9BA 4IWBA 1E85A 2L7AA 5DQZA 3NG1A 4DOZA 4MNDA 4BEMJ 2YZSA 3ZIBA 1FFHA 2R05A 1WOLA 4PFOA 5DVWA 3ZVRA 2XLHA 1OR2A 3ZTZA 3S0XA 3U2MA 5DS4A 2R7QA 3B0VC 1LPEA 2Q9AA 4YWQA 3H2VA 1AVOB 2ZXWC 3M1CB 5AC5A 1A0BA 5JS5A 1ZU5A 2EIKC 4XEFA 4J7TA 1YZCA 2YRFA 1K40A 1LM3B 1JR8A 3KH2A 3WODF 5JVEA 1CGME 4EWCA 3EQLF 1MNDA 4YT5A 3C8GA 5BUOA 2NG1A 3HNKA 1R4TA 4RDAA 1QKRA 1RXQA 3A9CA 2I8BA 3ABLC 2DYSC 2JD3A 1Z3IX 2Q7RA 3TJ6A 4YT2A 3EJNA 4O6YA 4FX5A 4K1OA 4B6IA 3FDQA 4FESA 1D0ZA 4CS8C 1OXKA 1JPJA 3QVZA 4XWJA 3EZHA 2NUPA 1T9KA 5A6BD 3EH2A 4QDLA 4BJTA 1SMYF 4JJGA 5HV9A 1LE2A 1FTSA 2HKVA 4ANJA 1T5OA 1TQGA 3OEOA 3EG9A 1U6HA 1YYXA 3N24A 2H7BA 4HEAJ 1YA7O 2PFDA 2YLGA 3F47A 3PDMP 3R7CA 1OW8A 1GQAA 2EPMX 3C8ZA 4R32A 5L3QA 4I3MA 3GM2A 4DBRA 4EUKB 4X0RA 3ATPA 3EZIA 1ZHYA 2BE5F 3I5PA 5KYUA 2C03A 4AL1A 2Y3GA 3VAYA 2XLEA 1KU2A 4CS9C 2ICWG 1LE4A 2R02A 2XSEA 1LKXA 2J9UA 3EGDB 3FAJA 4XPWA 2HV7A 4LLEA 5EGYA 2Y3HA 2ASRA 5EK0A 1OCCC 1FMVA 4GEHA 4CIHA 4PJLA 3VF0A 5KYWA 2DI3A 1G4US 1TR2A 4MTGA 3UGPA 4QI0A 3WHNA 4WGZA 2W9YA 2A6HF 4KNWA 3JSEO 3LS1A 2IXOA 2QUPA 1CPRA 1Z7Qc 1E84A 4F4BA 4ONSA 5COFA 3KPHA 1SYQA 3LS0A 3U8PA 5KYXB 3QVYA 1FNTc 3E9VA 4O6NA 1O3UA 2YHSA 3FAPB 3LAYA 3JRTA 3WG7C 1S05A 3TQOA 4FWVA 2CCYA 3W4YA 1ZW2A 5A6BA 1JMWA 3LESA 2XM0A 4A4AA 4DXWA 4AK9A 2KK1A 3SNHA 3IEEA 2JX0A 3POVA 4E7ZA 3UGOA 4JE9A 2XLDA 3JYYA 4MTOA 1RCPA 3RKOF 2LIGA 3NKDA 1MMGA 4JCHA 3RF3A 1H6GA 1QSPA 2Q00A 2XLMA 1M57C 3OWTA 4XTKA 4DRHB 5A6AA 1BDJB 5AGFA 3TJ5A 4HE8D 2VCCA 1RKEA 3O55A 2XM4A 2ZD9A 3IQ6A 2GWWA 2NSGA 2ETSA 1M2OA 2HMZA 3AG1C 3DXJF 3RYLA 1FFTC 3T9OA 4DRJB 4NTAA 5GPGB 1H9GA 4HFFB 2E87A 4XPXA 3UMHA 2G3VA 1GM5A 2LK4A 3HNLA 2VCBA 3ZQVA 4Q4ZF 1LS4A 3J06A 2WL8A 3DAFA 4O79A 1M6TA 3QZCA 5L0DA 5JT4A 4NTFA 4MVSA 3DZAA 2KSFA 1XZQA 3R2PA 4AL0A 4CS7A 1ZVZA 3U3FA 4NQFA 1YLMA 1A7VA 3AGUA 4MW3A 1D0YA 5JRAA 1C17M 5EHHA 1IZMA 3RH3A 4PJNA 5B3IA 2YL0A 1T6UA 2XXAB 1VB5A 3JYHA 3SXZA 3U9MA 1WATA 3T6JA 1C03A 2OQMA 2XL6A 4Z9HA 3KYJA 2OJQA 1OXBA 2EPLX 1M56C 3M15A 4Q7CA 4DRIB 1VLTA 2J9BA 1ZZPA 3LJBA 1LS1A 2R7XA 1WWPA 3L8IA 4P6IC 2Q9CA 3F46A 1IW7F 3MYFA 2OCCC 1S7ZA 3A11A 4CX9A 2QNLA 3DI5A 4NC3A 3UMIA 2HUJA 2VCAA 4JTAB 4CSAC 1DOVA 1VOMA 2IXMA 2PP4A 3EHNA 2A68F 1ZHXA 3GWLA 3VRCA 1V54C 5D91A 4CDYA 1HMOA 3LNRA 4E17A 1SF8A 2XLOA 4C7OA 1FAPB 1PV3A 2J0WA 1J8YF 4JVSA 2Z15A 3CSKA 4Z9IA 1G5ZA 1KNYA 1MMAA 2LFDA 2UUHA 3DE9A 2HMQA 3KMIA 4U5EE 5JLIA 3NDBB 3Q6NA 5BQGA 3WAQA 1UG7A 3JCUQ 3LNMB 3GEHA 3RFYA 3AOUA 4P9TA 2J46A 2YLDA 3US6A 2X51A 3U3BA 2IYLD 2KW3C 1LVKA 1EI7A 1W2WA 3C7JA 1PCXA 3QTHA 4N4WA 4WGYA 2AWCA 3FVYA 3GWNA 5CI8A 4CDAA 4U5BE 2D4UA 2QTVA 1VTMP 2PF4E 2R25A 3MX3A 2WVOA 3KYIA 1EA8A 2L6HA 2AU5A 2CGEA 2PNOA 1NLXA 3CAXA 3ECSA 5F5FA 1Z23A 2LFFA 2GA0A 3GEEA 4U5CE 4D4NA 4G7ZF 1L3PA 4I44A 4IB4A 4RD9A 2LQGA 5DS5A 3NRHA 1NU9C 2EINC 1TWCA 3TD7A 4BG0A 1Q0DA 3KKBA 5L3VA 1APCA 1G8XA 3AGTA 3DD7A 1O5HA 4AE4B 3NYMA 2LSEA 3T4RA 1FMWA 3X1OA 2I15A 3C62A 4G0HA 1I5NA 2DB4A 2OEXA 3CZ6A 1ZHWA 3FHDA 4C3BA 1Z5ZA 4DVYP 5CI9A 4MVOA 4FAPB 2P0NA 3V5YA 1NFNA 2V3CC 5JSLA 2Y3DA 3QW1A 4ULVA 3K66A 3T6GB 2R7TA 2KJGA 3CQZA 4IJJA 3K1IA 3JRMO 4XLPF 2D5RB 3GODA 2KYHA 2IOQA 3IHUA 1JOGA 1XZPA 2A0BA 2Y3BA 3EGDA 3LLIA 1MMNA 4OIRF 3BEHA 4CBEA 3QW0A 1E86A 5KYYB 3ZG1A 2VASA 1LI5A 4LDRA 1CGNA 4YT8A 2WZFA 1FR0A 3FOOA 1R5ID 3AG4C 1NZEA 4JCZA 3IPMO 1UFBA 1TFKB 4CJGA 3W2VA 1E2XA 1BBHA 5E3CA 4OIPF 3RQEA 2P6VA 1WTYA 3K6BA 1N1CA 2XS8A 5T1DB 5JP7A 2KGOA 5KYXA 3GANA 3W8HA 1RJ9B 4JIOA 2O9XA 1RKCA 2FAPB 1H7IA 3O39A 3EFOB 1OW6A 4RBNA 4LACB 2WB7A 5DLJA 5L0HA 2BL2A 2R03A 4ZLCA 1SZIA 2AVKA 2CDQA 1B68A 5TJ5E 3ASNC 1RMVA 3KL4A 3N2ZB 3TOLA 3NYJA 1TFOB 2H8AA 4IRUA 2R7WA 3FOPA 3ZQYA 1YYJA 3RW0A 2IXPA 4W8KA 1YARO 4JRZA 3RVYA 1LIHA 4Z9JA 2J8WA 1BR2A 3O10A 2M4EA 1PD1A 1SR2A 1V4AA 5HSWA 2IBFA 4U5FE 2A6EF 4NTBA 3L1MA 2Y69C 1BR1A 3ABMC 2GDCA 2J0XA 4PJMA 3SP1A 3HNJA 1V74B 5F28E 2J9VA 4U5GA 3U9JA 4DBQA 3JT1A 2WVNA 1DOWA 1YA9A 2GFHA 1MMDA 4BJ6A 1Q0MA 3FXHA 2OJED 3SXMA 5E33A 5KYNA 2DGJA 2OOCA 2XL4A 5BQIA 3Q7GA 2HFIA 2YL3A 2RD9A 3AJMA 4AX2A 2KNHA 1K05A 1QVXA 2QY9A 3IQ5A 1TWGA 4LERA 4PACA 3TOMA 2XXAA 4LDKA 2EPOA 3U5SA 4Q5SF 3IQCA 2J45A 1QPUA 2XRHA 3FMSA 4MTFA 3E70C 4O6MA 5L0IA 3B0UX 1K04A 1NFOA 4P9FA 1XWJA 1VYIA 1Y4CA 1VYKA 1AEPA 2KQ9A 1NSGB 5FZTA 4EBJA 2QLAA 1D1BA 2XL8A 4K0DA 3HLZA 4PR9A 3DKAA 4DVZA 4IARA 3JTLO 1JPNA 3U2LA 2L6FA 4W8PA 1H9TA 2H7OA 1ORYA 4N6HA 3AG3C 3RQFA 2Q3TA 3PMRA 4IGGA 1AUEA 3ZTMA 3ZSUA 3I4UA 4BPMA 4JJFA 1J8MF 1YJGA 1GGQA 1YZAA 2HS5A 4JZAA 1G4WR 2A0UA 4JEBA 1T6IA 2DYRC 2HJMA 3MBGA 4JURI 4XEKA 3SZRA 4M63A 1ZHTA 3VM6A 4E18A 3DJNB 3L0IA 1HE9A 1Q0KA 3DAGA 3G4XA 4U9EA 2EIMC 4YK5A 2NUTB 3EHMA 2P7VA 4JW1A 3ASOC 4G78A 4KBLA 4E7SA 2FGYA 5CIVA 4MQ9F 2XLVA 1I4YA 2NUTA 1M2VB 3SEOA 2YLIA 1TWHA 2PBEA 2MYSA 4MVZA 4JTCB 1Z63A 2W45A 2HZ8A 4N6CA 1ZU4A 2ZPAA 4L6RA 1T6QA 1D1AA 5D92A 3C18A 2EIJC 4J30B 2R9RB 2P1AA 3NMIA 1MQVA
chains in the Genus database with same CATH topology
3SYNA 5FCLA 2PX0A 3K33A 4HFKB 4BEJA 2IXNA 5B3SC 1NG1A 4N06A 4CS8A 3HJCA 3Q6MA 4U5DE 4NY3A 4AE4A 3VYWA 3DM9B 3NKEA 1ZHZA 3O6XA 4K7BA 3B0PA 3HTKC 2L9JA 2A69F 1BR4A 2YEVA 4IAOA 1PD0A 3QMKA 2WZLA 2NUPB 1ZYRF 1OKKD 3DJUB 3MLGA 2VB6A 2CNWD 4KNVA 3Q7LA 4PK4A 4CS9A 4GYTA 3I5QA 4QI2A 3EG9B 3AG2C 3EH1A 4PFPA 2FFHA 4OD4A 1OCZC 2OG2A 3OA1A 5KYYA 5KYUB 4PJJA 4YJWA 4OINF 3K1IC 3W8IA 1OCRC 3UNGC 5KYWB 1OCOC 4J32B 4OD5A 4I1OB 5DQTA 2R7SA 4ZLDA 1WGWA 1RJ9A 4KC9A 4U5HA 2R7OA 1NU7D 3EFOA 3X2QC 1V55C 3W2WA 4KI2A 2HV6A 2ZXRA 1QLEC 3S27A 2G62A 4I1MA 1MNEA 1OKKA 3L34A 3B9QA 2CNWA 3EPVA 5B1BC 3POVA 2C04A 2Y39A 4BJ1A 2R7RA 1TWAA 2W4BA 1QZXA 3T6BA 4O7GA 1TKNA 4XLNF 5F5HA 5E2QA 3PHF2 5T3WA 1D1CA 4OIQF 4WJ0A 4H4KC 3K1HA 3K7DA 2J7PD 4A2NB 3V7OA 2R7UA 5DS6A 3ZC4A 1O87A 3DM5A 1Z6AA 3NYLA 2R7VA 3DMDA 3ITFA 3JSZA 3LEVA 2ZXOA 3AQBA 4LLCA 2WVQA 2W4MA 3LLKA 2A1DD 4BJ5A 2G3KA 3UR3C 3N0TA 4BJ6C 3EGXB 3ABKC 2H7VC 4G7OF 2CW0F 4G7HF 3EGXA 4C3EA 2V26A 2B0JA 4EBBA 5IY5C 4CSAA 2VH3A 3UMKA 2ZXPA 4BJ5C 3S28A 1ST6A 2L81A 4ULWA 3RIPA 2J7PA 4YN0B 5E3AA 5B1AC 3AQCA 4C7OB 2WZGA 5T3TA 1VK5A 2MWQA 1M2VA 2EILC 2PX3A 4YT4A 3B0UX 3H65A 1VMAA 2J9WA 3S29A 4OIOF 4C3DA 1D0XA 2Q9BA 4IWBA 5DQZA 3NG1A 4DOZA 4MNDA 2YZSA 3ZIBA 1FFHA 4PFOA 5DVWA 3ZVRA 3S0XA 5DS4A 2R7QA 3B0VC 2Q9AA 4YWQA 2ZXWC 3M1CB 5L3QA 1ZU5A 2EIKC 3KH2A 3WODF 4EWCA 3EQLF 1MNDA 4YT5A 5BUOA 2NG1A 4RDAA 2I8BA 3ABLC 2DYSC 2JD3A 1Z3IX 4YT2A 3EJNA 4O6YA 4FX5A 4B6IA 3FDQA 4FESA 1D0ZA 4CS8C 1JPJA 4XWJA 3EZHA 2NUPA 3EH2A 4QDLA 4BJTA 1SMYF 4JJGA 1FTSA 4ANJA 3OEOA 3EG9A 3N24A 4HEAJ 2H7BA 2PFDA 3F47A 4I3MA 4DBRA 4X0RA 3EZIA 1ZHYA 2BE5F 3I5PA 5KYUA 2C03A 2Y3GA 4CS9C 1KU2A 2XSEA 3EGDB 1LKXA 2J9UA 3FAJA 2HV7A 4LLEA 5EGYA 2Y3HA 1OCCC 1FMVA 4GEHA 4CIHA 4PJLA 5KYWA 1TR2A 3UGPA 4QI0A 2W9YA 2A6HF 4KNWA 3LS1A 2IXOA 4F4BA 3LS0A 5KYXB 3E9VA 4O6NA 2YHSA 3LAYA 3JRTA 3WG7C 4FWVA 3LESA 4AK9A 3SNHA 3IEEA 4E7ZA 3UGOA 3RKOF 3NKDA 1MMGA 4JCHA 1M57C 3OWTA 4XTKA 4HE8D 3AG1C 1M2OA 3DXJF 3RYLA 1FFTC 4HFFB 2E87A 3UMHA 2G3VA 4Q4ZF 2WL8A 3DAFA 4O79A 3QZCA 3DZAA 4CS7A 1D0YA 5EHHA 1IZMA 3RH3A 4PJNA 2XXAB 3JYHA 3T6JA 1M56C 4Q7CA 3LJBA 1LS1A 2R7XA 4P6IC 2Q9CA 3F46A 1IW7F 2OCCC 1S7ZA 3UMIA 4CSAC 1VOMA 2IXMA 2PP4A 3EHNA 2A68F 1ZHXA 1V54C 5D91A 3LNRA 1SF8A 4C7OA 2J0WA 1J8YF 4JVSA 2Z15A 3CSKA 1MMAA 3NDBB 3KMIA 4U5EE 3Q6NA 3JCUQ 3RFYA 2J46A 2X51A 2IYLD 2KW3C 1LVKA 1W2WA 1PCXA 3FVYA 5CI8A 4U5BE 2QTVA 2PF4E 3MX3A 2WVOA 2CGEA 3ECSA 5F5FA 1Z23A 4G7ZF 4U5CE 4I44A 4RD9A 5DS5A 3NRHA 1NU9C 2EINC 1TWCA 3TD7A 4BG0A 3KKBA 5L3VA 1G8XA 3DD7A 1O5HA 4AE4B 3NYMA 2LSEA 3T4RA 1FMWA 3X1OA 4G0HA 3FHDA 4C3BA 3CZ6A 1ZHWA 1Z5ZA 4DVYP 5CI9A 2V3CC 2Y3DA 2R7TA 3K66A 2KJGA 3CQZA 4IJJA 4XLPF 2D5RB 3GODA 2IOQA 3EGDA 2Y3BA 3LLIA 1MMNA 4OIRF 4CBEA 5KYYB 3ZG1A 2VASA 4YT8A 2WZFA 3AG4C 1NZEA 3W2VA 5E3CA 4OIPF 2P6VA 3K6BA 1N1CA 5T1DB 2KGOA 5KYXA 3GANA 3W8HA 1RJ9B 2O9XA 3O39A 3EFOB 4RBNA 5DLJA 4LACB 2WB7A 4ZLCA 1SZIA 2CDQA 3ASNC 3KL4A 3N2ZB 3NYJA 4IRUA 2R7WA 2IXPA 4W8KA 1BR2A 2M4EA 1PD1A 5HSWA 4U5FE 2A6EF 2Y69C 1BR1A 3ABMC 2J0XA 4PJMA 3SP1A 2J9VA 4U5GA 4DBQA 3JT1A 2WVNA 2GFHA 1MMDA 4BJ6A 5KYNA 5E33A 2DGJA 2XL4A 3Q7GA 4AX2A 2KNHA 2QY9A 2XXAA 4LERA 1TWGA 4Q5SF 2J45A 2XRHA 4O6MA 3E70C 1VYIA 1VYKA 2KQ9A 1D1BA 4K0DA 3HLZA 4DVZA 1JPNA 2H7OA 3AG3C 2Q3TA 3PMRA 3ZSUA 3I4UA 4JJFA 1J8MF 3VAYA 4JZAA 4JURI 2DYRC 3SZRA 4M63A 1ZHTA 3DJNB 3L0IA 3DAGA 2EIMC 2NUTB 3EHMA 2P7VA 4JW1A 3ASOC 4E7SA 4KBLA 2FGYA 4MQ9F 2NUTA 1M2VB 3SEOA 1TWHA 2MYSA 1Z63A 2W45A 1ZU4A 2ZPAA 1D1AA 5D92A 2EIJC 4J30B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NYM A; 
#chains in the Genus database with same CATH topology
 3SYN A;  1WN0 A;  5BQH A;  2PX0 A;  5FCL A;  3K33 A;  4HFK B;  2LCH A;  2LP4 A;  4MVU A;  2IXN A;  3TK0 A;  3ZWI A;  1NG1 A;  3LEO A;  4BEJ A;  4EIY A;  3CEX A;  2F22 A;  4N06 A;  3V5X A;  4CS8 A;  4GQH A;  3HJC A;  3MFN A;  4EBK A;  3Q6M A;  3GEI A;  2YQY A;  1LI7 A;  3C8G B;  4E0I A;  4U5D E;  2MHR A;  4NY3 A;  3VYW A;  3DM9 B;  3NKE A;  4AE4 A;  1ZHZ A;  3GM3 A;  4CIP A;  5A6K A;  3O6X A;  2XLW A;  4K7B A;  5B3S C;  1Q0F A;  3B0P A;  2L9J A;  3HTK C;  2A69 F;  1BR4 A;  2YEV A;  4IAO A;  1PD0 A;  4YL0 A;  5AC4 A;  4XQ1 A;  3QMK A;  2WZL A;  3DE8 A;  3U0C A;  2NUP B;  1ZYR F;  1OKK D;  2L6G A;  1OR3 A;  3DJU B;  3MLG A;  4CJO A;  2VB6 A;  2CNW D;  3GOR A;  4KNV A;  2QE9 A;  3Q7L A;  2YL7 A;  1NBB A;  2XS1 A;  3I5Q A;  4GYT A;  4PK4 A;  4CS9 A;  4QI2 A;  1A7E A;  1YVI A;  2GAQ A;  3EG9 B;  4YL1 A;  3AG2 C;  4DJ9 A;  5JUA A;  5L0G A;  3EH1 A;  4PFP A;  1JAF A;  4MVQ A;  4MVR A;  2FFH A;  4OD4 A;  1OCZ C;  3NMK A;  1HE1 A;  2OG2 A;  4MW8 A;  1F1M A;  3OA1 A;  5A69 A;  1YDI A;  4U9D A;  3U8V A;  4D4X A;  4PJJ A;  5KYY A;  5KYU B;  2OU6 A;  4YJW A;  4OIN F;  3K1I C;  1CPQ A;  3B71 A;  3W8I A;  1OCR C;  3UNG C;  1CGO A;  3C63 A;  4XEV A;  5KYW B;  1OCO C;  4J32 B;  4OD5 A;  4I1O B;  1HW1 A;  5DQT A;  2R7S A;  4IAQ A;  4JTD B;  4ZLD A;  1WGW A;  4E0H A;  1EQ1 A;  1RJ9 A;  4KC9 A;  2IM8 A;  4U5H A;  3G50 A;  3H2U A;  2R7O A;  4YL3 A;  1NU7 D;  3EFO A;  5COM A;  256B A;  1BZ4 A;  2B0H A;  1V55 C;  2NPU A;  4MVM A;  3X2Q C;  3W2W A;  5L0J A;  4KI2 A;  1KTM A;  2HV6 A;  2ZXR A;  1QLE C;  3S27 A;  2G62 A;  4I1M A;  1MNE A;  4MS2 A;  1U89 A;  1OKK A;  3L34 A;  3B9Q A;  2CNW A;  4UDV A;  3EPV A;  5B1B C;  3S9O A;  2C04 A;  4JKV A;  2EPN A;  5A6J A;  5K0I A;  2Y39 A;  1E83 A;  5L0F A;  2UUI A;  4BJ1 A;  2R7R A;  1ORS C;  1TWA A;  2OKU A;  3PCV A;  2W4B A;  2YL1 A;  1QZX A;  3T6B A;  4O7G A;  2BC5 A;  3SXK A;  2M64 A;  1TKN A;  4XLN F;  3RVZ A;  5F5H A;  3M4B A;  1RKE B;  4EHP A;  1Y6D A;  5E2Q A;  1EKY A;  3PHF 2;  3S84 A;  5T3W A;  2AP3 A;  3GM1 A;  1D1C A;  4OIQ F;  4WJ0 A;  2RSE B;  4H4K C;  3K1H A;  2LD6 A;  3K7D A;  1OW7 A;  2J7P D;  1T01 A;  4A2N B;  5L0C A;  3V7O A;  2R7U A;  3B29 A;  3SXY A;  4EKW A;  5DS6 A;  2TMV P;  3ZC4 A;  1O87 A;  1WAS A;  3DM5 A;  3HNI A;  3LUT B;  4WAB A;  3M79 A;  1Z6A A;  2HJ3 A;  3NYL A;  2R7V A;  3DMD A;  3ITF A;  3JSZ A;  3LEV A;  2ZXO A;  3AQB A;  3MYI A;  4LLC A;  2AWY A;  5COG A;  2WVQ A;  2W4M A;  2VC9 A;  3LLK A;  2A1D D;  4BJ5 A;  4ER9 A;  2G3K A;  3UR3 C;  3N0T A;  4BJ6 C;  3EGX B;  1A7D A;  3ABK C;  4JEA A;  1C02 A;  1L7C A;  3RQG A;  2H7V C;  4G7O F;  2P61 A;  2CW0 F;  3L8J A;  1U0B B;  4XPY A;  3S90 A;  4G7H F;  1OQC A;  3EGX A;  4LDQ A;  4C3E A;  1I4Z A;  2EPK X;  2NSF A;  1ZW3 A;  2V26 A;  2X0C A;  2B0J A;  1Q0G A;  1JRA A;  4NCQ A;  4EBB A;  5IY5 C;  4CSA A;  3DWW A;  3C8G D;  3G4Z A;  3V5Z A;  2YKZ A;  2CYD A;  3NMJ A;  2VH3 A;  3UMK A;  1VLS A;  2ZXP A;  4H54 A;  4BJ5 C;  1HY5 A;  2KC3 A;  3JZ0 A;  3S28 A;  1YAU O;  1ST6 A;  1A41 A;  4CDV A;  2L81 A;  3HKK A;  3M4C A;  4ULW A;  1HMD A;  1QQ3 A;  2JPU A;  2YWA A;  3RIP A;  2YVK A;  1GS9 A;  2J7P A;  4YN0 B;  2OEV A;  5E3A A;  5B1A C;  3ZDL A;  3AQC A;  4C7O B;  2WZG A;  2Q4F A;  5T3T A;  1VK5 A;  2MWQ A;  1M2V A;  2EIL C;  2PX3 A;  4JC7 A;  4J7Y A;  1ORJ A;  2HSB A;  4YT4 A;  3H65 A;  3TUL A;  1VMA A;  2J9W A;  3IQT A;  3S29 A;  3BRJ A;  1HW2 A;  4C3D A;  2HSQ A;  4OIO F;  1D0X A;  2Q9B A;  4IWB A;  1E85 A;  2L7A A;  5DQZ A;  3NG1 A;  4DOZ A;  4MND A;  4BEM J;  2YZS A;  3ZIB A;  1FFH A;  2R05 A;  1WOL A;  4PFO A;  5DVW A;  3ZVR A;  2XLH A;  1OR2 A;  3ZTZ A;  3S0X A;  3U2M A;  5DS4 A;  2R7Q A;  3B0V C;  1LPE A;  2Q9A A;  4YWQ A;  3H2V A;  1AVO B;  2ZXW C;  3M1C B;  5AC5 A;  1A0B A;  5JS5 A;  1ZU5 A;  2EIK C;  4XEF A;  4J7T A;  1YZC A;  2YRF A;  1K40 A;  1LM3 B;  1JR8 A;  3KH2 A;  3WOD F;  5JVE A;  1CGM E;  4EWC A;  3EQL F;  1MND A;  4YT5 A;  3C8G A;  5BUO A;  2NG1 A;  3HNK A;  1R4T A;  4RDA A;  1QKR A;  1RXQ A;  3A9C A;  2I8B A;  3ABL C;  2DYS C;  2JD3 A;  1Z3I X;  2Q7R A;  3TJ6 A;  4YT2 A;  3EJN A;  4O6Y A;  4FX5 A;  4K1O A;  4B6I A;  3FDQ A;  4FES A;  1D0Z A;  4CS8 C;  1OXK A;  1JPJ A;  3QVZ A;  4XWJ A;  3EZH A;  2NUP A;  1T9K A;  5A6B D;  3EH2 A;  4QDL A;  4BJT A;  1SMY F;  4JJG A;  5HV9 A;  1LE2 A;  1FTS A;  2HKV A;  4ANJ A;  1T5O A;  1TQG A;  3OEO A;  3EG9 A;  1U6H A;  1YYX A;  3N24 A;  2H7B A;  4HEA J;  1YA7 O;  2PFD A;  2YLG A;  3F47 A;  3PDM P;  3R7C A;  1OW8 A;  1GQA A;  2EPM X;  3C8Z A;  4R32 A;  5L3Q A;  4I3M A;  3GM2 A;  4DBR A;  4EUK B;  4X0R A;  3ATP A;  3EZI A;  1ZHY A;  2BE5 F;  3I5P A;  5KYU A;  2C03 A;  4AL1 A;  2Y3G A;  3VAY A;  2XLE A;  1KU2 A;  4CS9 C;  2ICW G;  1LE4 A;  2R02 A;  2XSE A;  1LKX A;  2J9U A;  3EGD B;  3FAJ A;  4XPW A;  2HV7 A;  4LLE A;  5EGY A;  2Y3H A;  2ASR A;  5EK0 A;  1OCC C;  1FMV A;  4GEH A;  4CIH A;  4PJL A;  3VF0 A;  5KYW A;  2DI3 A;  1G4U S;  1TR2 A;  4MTG A;  3UGP A;  4QI0 A;  3WHN A;  4WGZ A;  2W9Y A;  2A6H F;  4KNW A;  3JSE O;  3LS1 A;  2IXO A;  2QUP A;  1CPR A;  1Z7Q c;  1E84 A;  4F4B A;  4ONS A;  5COF A;  3KPH A;  1SYQ A;  3LS0 A;  3U8P A;  5KYX B;  3QVY A;  1FNT c;  3E9V A;  4O6N A;  1O3U A;  2YHS A;  3FAP B;  3LAY A;  3JRT A;  3WG7 C;  1S05 A;  3TQO A;  4FWV A;  2CCY A;  3W4Y A;  1ZW2 A;  5A6B A;  1JMW A;  3LES A;  2XM0 A;  4A4A A;  4DXW A;  4AK9 A;  2KK1 A;  3SNH A;  3IEE A;  2JX0 A;  3POV A;  4E7Z A;  3UGO A;  4JE9 A;  2XLD A;  3JYY A;  4MTO A;  1RCP A;  3RKO F;  2LIG A;  3NKD A;  1MMG A;  4JCH A;  3RF3 A;  1H6G A;  1QSP A;  2Q00 A;  2XLM A;  1M57 C;  3OWT A;  4XTK A;  4DRH B;  5A6A A;  1BDJ B;  5AGF A;  3TJ5 A;  4HE8 D;  2VCC A;  1RKE A;  3O55 A;  2XM4 A;  2ZD9 A;  3IQ6 A;  2GWW A;  2NSG A;  2ETS A;  1M2O A;  2HMZ A;  3AG1 C;  3DXJ F;  3RYL A;  1FFT C;  3T9O A;  4DRJ B;  4NTA A;  5GPG B;  1H9G A;  4HFF B;  2E87 A;  4XPX A;  3UMH A;  2G3V A;  1GM5 A;  2LK4 A;  3HNL A;  2VCB A;  3ZQV A;  4Q4Z F;  1LS4 A;  3J06 A;  2WL8 A;  3DAF A;  4O79 A;  1M6T A;  3QZC A;  5L0D A;  5JT4 A;  4NTF A;  4MVS A;  3DZA A;  2KSF A;  1XZQ A;  3R2P A;  4AL0 A;  4CS7 A;  1ZVZ A;  3U3F A;  4NQF A;  1YLM A;  1A7V A;  3AGU A;  4MW3 A;  1D0Y A;  5JRA A;  1C17 M;  5EHH A;  1IZM A;  3RH3 A;  4PJN A;  5B3I A;  2YL0 A;  1T6U A;  2XXA B;  1VB5 A;  3JYH A;  3SXZ A;  3U9M A;  1WAT A;  3T6J A;  1C03 A;  2OQM A;  2XL6 A;  4Z9H A;  3KYJ A;  2OJQ A;  1OXB A;  2EPL X;  1M56 C;  3M15 A;  4Q7C A;  4DRI B;  1VLT A;  2J9B A;  1ZZP A;  3LJB A;  1LS1 A;  2R7X A;  1WWP A;  3L8I A;  4P6I C;  2Q9C A;  3F46 A;  1IW7 F;  3MYF A;  2OCC C;  1S7Z A;  3A11 A;  4CX9 A;  2QNL A;  3DI5 A;  4NC3 A;  3UMI A;  2HUJ A;  2VCA A;  4JTA B;  4CSA C;  1DOV A;  1VOM A;  2IXM A;  2PP4 A;  3EHN A;  2A68 F;  1ZHX A;  3GWL A;  3VRC A;  1V54 C;  5D91 A;  4CDY A;  1HMO A;  3LNR A;  4E17 A;  1SF8 A;  2XLO A;  4C7O A;  1FAP B;  1PV3 A;  2J0W A;  1J8Y F;  4JVS A;  2Z15 A;  3CSK A;  4Z9I A;  1G5Z A;  1KNY A;  1MMA A;  2LFD A;  2UUH A;  3DE9 A;  2HMQ A;  3KMI A;  4U5E E;  5JLI A;  3NDB B;  3Q6N A;  5BQG A;  3WAQ A;  1UG7 A;  3JCU Q;  3LNM B;  3GEH A;  3RFY A;  3AOU A;  4P9T A;  2J46 A;  2YLD A;  3US6 A;  2X51 A;  3U3B A;  2IYL D;  2KW3 C;  1LVK A;  1EI7 A;  1W2W A;  3C7J A;  1PCX A;  3QTH A;  4N4W A;  4WGY A;  2AWC A;  3FVY A;  3GWN A;  5CI8 A;  4CDA A;  4U5B E;  2D4U A;  2QTV A;  1VTM P;  2PF4 E;  2R25 A;  3MX3 A;  2WVO A;  3KYI A;  1EA8 A;  2L6H A;  2AU5 A;  2CGE A;  2PNO A;  1NLX A;  3CAX A;  3ECS A;  5F5F A;  1Z23 A;  2LFF A;  2GA0 A;  3GEE A;  4U5C E;  4D4N A;  4G7Z F;  1L3P A;  4I44 A;  4IB4 A;  4RD9 A;  2LQG A;  5DS5 A;  3NRH A;  1NU9 C;  2EIN C;  1TWC A;  3TD7 A;  4BG0 A;  1Q0D A;  3KKB A;  5L3V A;  1APC A;  1G8X A;  3AGT A;  3DD7 A;  1O5H A;  4AE4 B;  3NYM A;  2LSE A;  3T4R A;  1FMW A;  3X1O A;  2I15 A;  3C62 A;  4G0H A;  1I5N A;  2DB4 A;  2OEX A;  3CZ6 A;  1ZHW A;  3FHD A;  4C3B A;  1Z5Z A;  4DVY P;  5CI9 A;  4MVO A;  4FAP B;  2P0N A;  3V5Y A;  1NFN A;  2V3C C;  5JSL A;  2Y3D A;  3QW1 A;  4ULV A;  3K66 A;  3T6G B;  2R7T A;  2KJG A;  3CQZ A;  4IJJ A;  3K1I A;  3JRM O;  4XLP F;  2D5R B;  3GOD A;  2KYH A;  2IOQ A;  3IHU A;  1JOG A;  1XZP A;  2A0B A;  2Y3B A;  3EGD A;  3LLI A;  1MMN A;  4OIR F;  3BEH A;  4CBE A;  3QW0 A;  1E86 A;  5KYY B;  3ZG1 A;  2VAS A;  1LI5 A;  4LDR A;  1CGN A;  4YT8 A;  2WZF A;  1FR0 A;  3FOO A;  1R5I D;  3AG4 C;  1NZE A;  4JCZ A;  3IPM O;  1UFB A;  1TFK B;  4CJG A;  3W2V A;  1E2X A;  1BBH A;  5E3C A;  4OIP F;  3RQE A;  2P6V A;  1WTY A;  3K6B A;  1N1C A;  2XS8 A;  5T1D B;  5JP7 A;  2KGO A;  5KYX A;  3GAN A;  3W8H A;  1RJ9 B;  4JIO A;  2O9X A;  1RKC A;  2FAP B;  1H7I A;  3O39 A;  3EFO B;  1OW6 A;  4RBN A;  4LAC B;  2WB7 A;  5DLJ A;  5L0H A;  2BL2 A;  2R03 A;  4ZLC A;  1SZI A;  2AVK A;  2CDQ A;  1B68 A;  5TJ5 E;  3ASN C;  1RMV A;  3KL4 A;  3N2Z B;  3TOL A;  3NYJ A;  1TFO B;  2H8A A;  4IRU A;  2R7W A;  3FOP A;  3ZQY A;  1YYJ A;  3RW0 A;  2IXP A;  4W8K A;  1YAR O;  4JRZ A;  3RVY A;  1LIH A;  4Z9J A;  2J8W A;  1BR2 A;  3O10 A;  2M4E A;  1PD1 A;  1SR2 A;  1V4A A;  5HSW A;  2IBF A;  4U5F E;  2A6E F;  4NTB A;  3L1M A;  2Y69 C;  1BR1 A;  3ABM C;  2GDC A;  2J0X A;  4PJM A;  3SP1 A;  3HNJ A;  1V74 B;  5F28 E;  2J9V A;  4U5G A;  3U9J A;  4DBQ A;  3JT1 A;  2WVN A;  1DOW A;  1YA9 A;  2GFH A;  1MMD A;  4BJ6 A;  1Q0M A;  3FXH A;  2OJE D;  3SXM A;  5E33 A;  5KYN A;  2DGJ A;  2OOC A;  2XL4 A;  5BQI A;  3Q7G A;  2HFI A;  2YL3 A;  2RD9 A;  3AJM A;  4AX2 A;  2KNH A;  1K05 A;  1QVX A;  2QY9 A;  3IQ5 A;  1TWG A;  4LER A;  4PAC A;  3TOM A;  2XXA A;  4LDK A;  2EPO A;  3U5S A;  4Q5S F;  3IQC A;  2J45 A;  1QPU A;  2XRH A;  3FMS A;  4MTF A;  3E70 C;  4O6M A;  5L0I A;  3B0U X;  1K04 A;  1NFO A;  4P9F A;  1XWJ A;  1VYI A;  1Y4C A;  1VYK A;  1AEP A;  2KQ9 A;  1NSG B;  5FZT A;  4EBJ A;  2QLA A;  1D1B A;  2XL8 A;  4K0D A;  3HLZ A;  4PR9 A;  3DKA A;  4DVZ A;  4IAR A;  3JTL O;  1JPN A;  3U2L A;  2L6F A;  4W8P A;  1H9T A;  2H7O A;  1ORY A;  4N6H A;  3AG3 C;  3RQF A;  2Q3T A;  3PMR A;  4IGG A;  1AUE A;  3ZTM A;  3ZSU A;  3I4U A;  4BPM A;  4JJF A;  1J8M F;  1YJG A;  1GGQ A;  1YZA A;  2HS5 A;  4JZA A;  1G4W R;  2A0U A;  4JEB A;  1T6I A;  2DYR C;  2HJM A;  3MBG A;  4JUR I;  4XEK A;  3SZR A;  4M63 A;  1ZHT A;  3VM6 A;  4E18 A;  3DJN B;  3L0I A;  1HE9 A;  1Q0K A;  3DAG A;  3G4X A;  4U9E A;  2EIM C;  4YK5 A;  2NUT B;  3EHM A;  2P7V A;  4JW1 A;  3ASO C;  4G78 A;  4KBL A;  4E7S A;  2FGY A;  5CIV A;  4MQ9 F;  2XLV A;  1I4Y A;  2NUT A;  1M2V B;  3SEO A;  2YLI A;  1TWH A;  2PBE A;  2MYS A;  4MVZ A;  4JTC B;  1Z63 A;  2W45 A;  2HZ8 A;  4N6C A;  1ZU4 A;  2ZPA A;  4L6R A;  1T6Q A;  1D1A A;  5D92 A;  3C18 A;  2EIJ C;  4J30 B;  2R9R B;  2P1A A;  3NMI A;  1MQV A; 
#chains in the Genus database with same CATH homology
 3SYN A;  5FCL A;  2PX0 A;  3K33 A;  4HFK B;  4BEJ A;  2IXN A;  5B3S C;  1NG1 A;  4N06 A;  4CS8 A;  3HJC A;  3Q6M A;  4U5D E;  4NY3 A;  4AE4 A;  3VYW A;  3DM9 B;  3NKE A;  1ZHZ A;  3O6X A;  4K7B A;  3B0P A;  3HTK C;  2L9J A;  2A69 F;  1BR4 A;  2YEV A;  4IAO A;  1PD0 A;  3QMK A;  2WZL A;  2NUP B;  1ZYR F;  1OKK D;  3DJU B;  3MLG A;  2VB6 A;  2CNW D;  4KNV A;  3Q7L A;  4PK4 A;  4CS9 A;  4GYT A;  3I5Q A;  4QI2 A;  3EG9 B;  3AG2 C;  3EH1 A;  4PFP A;  2FFH A;  4OD4 A;  1OCZ C;  2OG2 A;  3OA1 A;  5KYY A;  5KYU B;  4PJJ A;  4YJW A;  4OIN F;  3K1I C;  3W8I A;  1OCR C;  3UNG C;  5KYW B;  1OCO C;  4J32 B;  4OD5 A;  4I1O B;  5DQT A;  2R7S A;  4ZLD A;  1WGW A;  1RJ9 A;  4KC9 A;  4U5H A;  2R7O A;  1NU7 D;  3EFO A;  3X2Q C;  1V55 C;  3W2W A;  4KI2 A;  2HV6 A;  2ZXR A;  1QLE C;  3S27 A;  2G62 A;  4I1M A;  1MNE A;  1OKK A;  3L34 A;  3B9Q A;  2CNW A;  3EPV A;  5B1B C;  3POV A;  2C04 A;  2Y39 A;  4BJ1 A;  2R7R A;  1TWA A;  2W4B A;  1QZX A;  3T6B A;  4O7G A;  1TKN A;  4XLN F;  5F5H A;  5E2Q A;  3PHF 2;  5T3W A;  1D1C A;  4OIQ F;  4WJ0 A;  4H4K C;  3K1H A;  3K7D A;  2J7P D;  4A2N B;  3V7O A;  2R7U A;  5DS6 A;  3ZC4 A;  1O87 A;  3DM5 A;  1Z6A A;  3NYL A;  2R7V A;  3DMD A;  3ITF A;  3JSZ A;  3LEV A;  2ZXO A;  3AQB A;  4LLC A;  2WVQ A;  2W4M A;  3LLK A;  2A1D D;  4BJ5 A;  2G3K A;  3UR3 C;  3N0T A;  4BJ6 C;  3EGX B;  3ABK C;  2H7V C;  4G7O F;  2CW0 F;  4G7H F;  3EGX A;  4C3E A;  2V26 A;  2B0J A;  4EBB A;  5IY5 C;  4CSA A;  2VH3 A;  3UMK A;  2ZXP A;  4BJ5 C;  3S28 A;  1ST6 A;  2L81 A;  4ULW A;  3RIP A;  2J7P A;  4YN0 B;  5E3A A;  5B1A C;  3AQC A;  4C7O B;  2WZG A;  5T3T A;  1VK5 A;  2MWQ A;  1M2V A;  2EIL C;  2PX3 A;  4YT4 A;  3B0U X;  3H65 A;  1VMA A;  2J9W A;  3S29 A;  4OIO F;  4C3D A;  1D0X A;  2Q9B A;  4IWB A;  5DQZ A;  3NG1 A;  4DOZ A;  4MND A;  2YZS A;  3ZIB A;  1FFH A;  4PFO A;  5DVW A;  3ZVR A;  3S0X A;  5DS4 A;  2R7Q A;  3B0V C;  2Q9A A;  4YWQ A;  2ZXW C;  3M1C B;  5L3Q A;  1ZU5 A;  2EIK C;  3KH2 A;  3WOD F;  4EWC A;  3EQL F;  1MND A;  4YT5 A;  5BUO A;  2NG1 A;  4RDA A;  2I8B A;  3ABL C;  2DYS C;  2JD3 A;  1Z3I X;  4YT2 A;  3EJN A;  4O6Y A;  4FX5 A;  4B6I A;  3FDQ A;  4FES A;  1D0Z A;  4CS8 C;  1JPJ A;  4XWJ A;  3EZH A;  2NUP A;  3EH2 A;  4QDL A;  4BJT A;  1SMY F;  4JJG A;  1FTS A;  4ANJ A;  3OEO A;  3EG9 A;  3N24 A;  4HEA J;  2H7B A;  2PFD A;  3F47 A;  4I3M A;  4DBR A;  4X0R A;  3EZI A;  1ZHY A;  2BE5 F;  3I5P A;  5KYU A;  2C03 A;  2Y3G A;  4CS9 C;  1KU2 A;  2XSE A;  3EGD B;  1LKX A;  2J9U A;  3FAJ A;  2HV7 A;  4LLE A;  5EGY A;  2Y3H A;  1OCC C;  1FMV A;  4GEH A;  4CIH A;  4PJL A;  5KYW A;  1TR2 A;  3UGP A;  4QI0 A;  2W9Y A;  2A6H F;  4KNW A;  3LS1 A;  2IXO A;  4F4B A;  3LS0 A;  5KYX B;  3E9V A;  4O6N A;  2YHS A;  3LAY A;  3JRT A;  3WG7 C;  4FWV A;  3LES A;  4AK9 A;  3SNH A;  3IEE A;  4E7Z A;  3UGO A;  3RKO F;  3NKD A;  1MMG A;  4JCH A;  1M57 C;  3OWT A;  4XTK A;  4HE8 D;  3AG1 C;  1M2O A;  3DXJ F;  3RYL A;  1FFT C;  4HFF B;  2E87 A;  3UMH A;  2G3V A;  4Q4Z F;  2WL8 A;  3DAF A;  4O79 A;  3QZC A;  3DZA A;  4CS7 A;  1D0Y A;  5EHH A;  1IZM A;  3RH3 A;  4PJN A;  2XXA B;  3JYH A;  3T6J A;  1M56 C;  4Q7C A;  3LJB A;  1LS1 A;  2R7X A;  4P6I C;  2Q9C A;  3F46 A;  1IW7 F;  2OCC C;  1S7Z A;  3UMI A;  4CSA C;  1VOM A;  2IXM A;  2PP4 A;  3EHN A;  2A68 F;  1ZHX A;  1V54 C;  5D91 A;  3LNR A;  1SF8 A;  4C7O A;  2J0W A;  1J8Y F;  4JVS A;  2Z15 A;  3CSK A;  1MMA A;  3NDB B;  3KMI A;  4U5E E;  3Q6N A;  3JCU Q;  3RFY A;  2J46 A;  2X51 A;  2IYL D;  2KW3 C;  1LVK A;  1W2W A;  1PCX A;  3FVY A;  5CI8 A;  4U5B E;  2QTV A;  2PF4 E;  3MX3 A;  2WVO A;  2CGE A;  3ECS A;  5F5F A;  1Z23 A;  4G7Z F;  4U5C E;  4I44 A;  4RD9 A;  5DS5 A;  3NRH A;  1NU9 C;  2EIN C;  1TWC A;  3TD7 A;  4BG0 A;  3KKB A;  5L3V A;  1G8X A;  3DD7 A;  1O5H A;  4AE4 B;  3NYM A;  2LSE A;  3T4R A;  1FMW A;  3X1O A;  4G0H A;  3FHD A;  4C3B A;  3CZ6 A;  1ZHW A;  1Z5Z A;  4DVY P;  5CI9 A;  2V3C C;  2Y3D A;  2R7T A;  3K66 A;  2KJG A;  3CQZ A;  4IJJ A;  4XLP F;  2D5R B;  3GOD A;  2IOQ A;  3EGD A;  2Y3B A;  3LLI A;  1MMN A;  4OIR F;  4CBE A;  5KYY B;  3ZG1 A;  2VAS A;  4YT8 A;  2WZF A;  3AG4 C;  1NZE A;  3W2V A;  5E3C A;  4OIP F;  2P6V A;  3K6B A;  1N1C A;  5T1D B;  2KGO A;  5KYX A;  3GAN A;  3W8H A;  1RJ9 B;  2O9X A;  3O39 A;  3EFO B;  4RBN A;  5DLJ A;  4LAC B;  2WB7 A;  4ZLC A;  1SZI A;  2CDQ A;  3ASN C;  3KL4 A;  3N2Z B;  3NYJ A;  4IRU A;  2R7W A;  2IXP A;  4W8K A;  1BR2 A;  2M4E A;  1PD1 A;  5HSW A;  4U5F E;  2A6E F;  2Y69 C;  1BR1 A;  3ABM C;  2J0X A;  4PJM A;  3SP1 A;  2J9V A;  4U5G A;  4DBQ A;  3JT1 A;  2WVN A;  2GFH A;  1MMD A;  4BJ6 A;  5KYN A;  5E33 A;  2DGJ A;  2XL4 A;  3Q7G A;  4AX2 A;  2KNH A;  2QY9 A;  2XXA A;  4LER A;  1TWG A;  4Q5S F;  2J45 A;  2XRH A;  4O6M A;  3E70 C;  1VYI A;  1VYK A;  2KQ9 A;  1D1B A;  4K0D A;  3HLZ A;  4DVZ A;  1JPN A;  2H7O A;  3AG3 C;  2Q3T A;  3PMR A;  3ZSU A;  3I4U A;  4JJF A;  1J8M F;  3VAY A;  4JZA A;  4JUR I;  2DYR C;  3SZR A;  4M63 A;  1ZHT A;  3DJN B;  3L0I A;  3DAG A;  2EIM C;  2NUT B;  3EHM A;  2P7V A;  4JW1 A;  3ASO C;  4E7S A;  4KBL A;  2FGY A;  4MQ9 F;  2NUT A;  1M2V B;  3SEO A;  1TWH A;  2MYS A;  1Z63 A;  2W45 A;  1ZU4 A;  2ZPA A;  1D1A A;  5D92 A;  2EIJ C;  4J30 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...