3NYMA

The crystal structure of functionally unknown protein from neisseria meningitidis mc58
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
118
Chain Sequence
AMETLNDIKILINVGLYQGFDLTDPKVSEEVNHETANMWIDYTSDGNWDNEFKEDLNFLDYMEVCQLALNDNFIASNSLFMAMIYAGNLSLIFDSIKTDISTLLSAEYKKNSFSWPSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
publication title The crystal structure of functionally unknown protein from Neisseria meningitidis MC58
rcsb
source organism Neisseria meningitidis serogroup b
total genus 35
structure length 118
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1000 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3nymA00
3NYMA
chains in the Genus database with same CATH superfamily
1Z23A 3G50A 1QKRA 2OKUA 3GEHA 5KYUB 3JYYA 4Z9HA 4JCHA 1LI5A 3LESA 4EWCA 1V74B 4GEHA 2L6HA 5L0CA 2A0UA 3MYFA 3ITFA 4I1OB 4JJGA 3M79A 2OJQA 3UNGC 1YVIA 4KNWA 2B0JA 5A69A 3E70C 2A1DD 1VYIA 1YLMA 2DI3A 2L7AA 3AG2C 3MFNA 4OD5A 3U8VA 4BJ6C 4ONSA 5EGYA 5BUOA 3T4RA 1BR1A 1FNTc 1ZU4A 4CS9A 1D1CA 2Q3TA 4AE4B 3V7OA 2IXNA 3AGUA 2YLGA 3RH3A 3QVYA 1TQGA 3ABLC 1R4TA 2NPUA 3KPHA 2QE9A 2H7BA 4MVUA 4IAQA 3EG9A 3IPMO 5TJ5E 1Q0KA 5T1DB 4KI2A 2P1AA 3WG7C 1PV3A 2ZXPA 3LJBA 3TJ6A 2W45A 1VK5A 4A2NB 2M64A 4KNVA 4DVYP 3A9CA 4NTBA 3ZQYA 4JZAA 4MQ9F 1A7EA 1OW6A 1U6HA 5DS4A 3S84A 3JCUQ 4LDQA 1JAFA 3C7JA 3EH1A 4PR9A 3W4YA 4EIYA 4Q4ZF 3SP1A 4Z9IA 4EUKB 1NZEA 3EHNA 2XL4A 3NKDA 5T3WA 4EBJA 2NUPA 4ZLDA 3TK0A 1CPQA 1T01A 1XZQA 2YKZA 3GORA 4GYTA 1I4YA 4IGGA 4ULVA 1MMDA 3TOMA 2DYRC 2HMZA 3U8PA 4CS8A 4JC7A 3V5ZA 1MMAA 4O6YA 2HJ3A 3IQ5A 3RQGA 4AK9A 2HMQA 5KYNA 1OCCC 2CDQA 2IXOA 1VYKA 1LS4A 1FAPB 2J9WA 4MTOA 3JSZA 3US6A 2EIJC 1B68A 2GA0A 1EQ1A 4AL1A 1GM5A 4QI0A 1A7VA 4J7YA 1JMWA 1C17M 3QZCA 2PF4E 4WABA 2Y3DA 1ZHXA 2XLWA 4MVZA 3V5XA 1SR2A 5T3TA 1ST6A 3EG9B 5D91A 2XSEA 2ETSA 2XLMA 3H2VA 5L0GA 2Y3GA 3MBGA 4E17A 3WODF 3GODA 2QLAA 3AG1C 4NTFA 3SXMA 1IZMA 2CNWA 3M15A 3JTLO 3HNIA 2R7XA 3O10A 4BG0A 5HV9A 1LM3B 4KBLA 1ZHWA 1NSGB 4E7ZA 3AGTA 2A69F 2X0CA 4BJ1A 4EHPA 2QNLA 1D1AA 4IWBA 4BEJA 3AG4C 2EPMX 1NFOA 2HV6A 1ZU5A 1ZHTA 1K40A 2O9XA 3CZ6A 4PJLA 5FCLA 2LCHA 4AL0A 1WTYA 1Q0FA 4XEFA 3W8IA 3GM3A 2QY9A 3HKKA 4I1MA 3DE8A 4QI2A 5L0HA 2HS5A 4JTAB 2YWAA 1OW7A 4EBKA 1N1CA 2KQ9A 3UGPA 3FAJA 3PDMP 3J06A 2ZD9A 1HE9A 4N6CA 3ZTMA 4YK5A 5DQTA 3EHMA 2JPUA 3MX3A 2HSQA 1LE4A 3NMJA 4E0HA 3ZVRA 2YVKA 2ZXOA 1Q0GA 4LLEA 2R7SA 3RVZA 4OIOF 1M2VA 2A68F 2P7VA 3AQCA 2EPOA 5F5FA 5FZTA 4P9TA 4A4AA 5JP7A 1ORSC 3ASOC 3L0IA 2R05A 3M4CA 4JURI 1ZHZA 1SMYF 4DJ9A 3O6XA 5KYUA 5BQHA 2QTVA 5A6BD 2FFHA 4BJTA 1Z63A 3Q6MA 1LE2A 2WVOA 1W2WA 1LI7A 2KSFA 4U5EE 1MNEA 2YZSA 4XWJA 3N2ZB 3U3BA 2L9JA 4C3EA 2R25A 4ZLCA 2R9RB 2XM4A 3OWTA 2ZXRA 3C8GA 2G3VA 3FAPB 3DZAA 3OA1A 3QVZA 4ULWA 5JS5A 5A6JA 3B0VC 1E84A 5F28E 1MMGA 3NMIA 2YHSA 2WZLA 4U9DA 3UMHA 4J30B 2WVQA 4FX5A 1HMDA 1EI7A 1OCZC 2J7PA 3IHUA 3TQOA 4K7BA 4EBBA 3DM9B 4LLCA 2CW0F 4CS9C 4DBQA 4G7ZF 1T9KA 2WZGA 3KYJA 3IQTA 2Y69C 5E33A 3VRCA 4X0RA 3UR3C 5JT4A 1FR0A 1OQCA 2KW3C 4ANJA 4JJFA 3FXHA 4E18A 5E3AA 2WL8A 3U2LA 3B29A 1GQAA 2IXMA 2R7UA 1JPNA 1M2VB 2WB7A 3DMDA 1TWHA 4NCQA 4DRJB 2FAPB 4MW8A 1FFTC 4CIPA 2XL8A 1ORJA 1TWGA 4OIRF 2R7WA 3EFOA 5JSLA 3SNHA 5CIVA 1VOMA 2OQMA 1QZXA 2AP3A 4ER9A 3A11A 4MTFA 3ZG1A 1G8XA 1RXQA 3NMKA 4G7OF 2L6FA 2J46A 3AQBA 4XPYA 4YL0A 2EIKC 1TFKB 3TD7A 4XLPF 5B1AC 1YZCA 3RF3A 3C8GB 1Z5ZA 2KK1A 3ZC4A 3UGOA 1PD1A 2OCCC 4JTDB 1H6GA 2OU6A 4CS8C 4KC9A 2AVKA 5CI8A 1YA7O 4FESA 4G7HF 4C3BA 1JRAA 2HUJA 1ZW3A 5EHHA 2PP4A 1CGOA 1PD0A 3I5PA 3K1IA 3CEXA 1C02A 2W4BA 4IARA 2YLDA 1A7DA 4HFFB 1I4ZA 2Q00A 3VAYA 2XRHA 3QTHA 1MMNA 4WJ0A 5L0IA 2IYLD 2DYSC 2VCCA 3L8JA 2H7OA 2XM0A 4E0IA 1YJGA 3S9OA 2IBFA 3NKEA 4JIOA 2DGJA 5KYYA 2PNOA 4R32A 3TULA 4NQFA 3FDQA 1QQ3A 4MVSA 3K7DA 1OKKD 2J0WA 3LNRA 2Q9CA 3CSKA 1JPJA 3IQCA 1GGQA 3EFOB 4JEAA 2EILC 3TOLA 2WVNA 3I4UA 1L7CA 4YT8A 1ZHYA 1Z6AA 2Q7RA 4IJJA 2B0HA 3JZ0A 4MVMA 1E2XA 2GFHA 3V5YA 1M56C 2AWCA 1VTMP 4YT2A 3EPVA 1RCPA 1TKNA 2FGYA 1JOGA 4JRZA 3X1OA 1YARO 3BRJA 1M57C 3LEOA 4GQHA 2L81A 2W4MA 4U5DE 4MS2A 5BQIA 1RMVA 4WGYA 3S29A 3HNKA 3KMIA 3B71A 5AC5A 1OW8A 4JE9A 1K04A 3HNLA 4XQ1A 3C62A 4OD4A 3VF0A 1OXBA 2LK4A 2YL1A 1XWJA 1DOWA 1H7IA 5A6KA 2P61A 5KYYB 1O87A 4U5FE 3U3FA 2H7VC 2HZ8A 5DQZA 4PK4A 4WGZA 3RYLA 2NSGA 3W2WA 4DOZA 2HKVA 3VYWA 3NRHA 1WATA 1T6IA 2YRFA 3DAGA 1Q0DA 2NG1A 2PX3A 2M4EA 2C03A 4J7TA 3RQFA 1ZW2A 5L0JA 4YL3A 1OCOC 3ATPA 4I3MA 1IW7F 2KJGA 4BJ5C 4G78A 1UG7A 3OEOA 1WOLA 3NYMA 5A6AA 1G5ZA 2JD3A 5JUAA 1EA8A 1OR2A 2Q4FA 1FTSA 5AC4A 3RFYA 1HY5A 1Y4CA 4IB4A 2Y39A 2G3KA 4JVSA 3U9JA 3U9MA 4OIQF 5GPGB 1AVOB 2VB6A 4LACB 3NG1A 4H54A 5B1BC 1E86A 3POVA 3DD7A 4PJJA 3ECSA 4NC3A 4JW1A 4EKWA 4PJMA 3KKBA 4Z9JA 2XLVA 2LFDA 1S05A 1RJ9A 2CYDA 1RKCA 1ZZPA 2EPNA 1NFNA 1ZYRF 3ABMC 5D92A 3B0UX 4BEMJ 3W8HA 3RQEA 1C03A 3SXYA 4BJ5A 2I8BA 2J9UA 4PJNA 4N4WA 1NU9C 1XZPA 3FMSA 4XPXA 1TR2A 5A6BA 1O3UA 1TWCA 3NYJA 2XLHA 4OIPF 3GEIA 1D0ZA 1YA9A 2OEXA 2AWYA 3EJNA 4M63A 2EPKX 3T6JA 3X2QC 3ZIBA 4O6NA 3DE9A 5JLIA 1NLXA 3ZQVA 2HSBA 4I44A 4D4XA 2RSEB 2IOQA 1R5ID 1HW1A 3GWNA 4CSAA 1YDIA 3WHNA 4YWQA 3DJNB 3NYLA 4IAOA 4CS7A 1BBHA 2LQGA 4NTAA 3RVYA 4L6RA 1HMOA 3K1IC 3SXKA 2YLIA 4PFOA 1V4AA 1RKEB 3K66A 4HFKB 4RD9A 1LPEA 2GAQA 4U5GA 3DJUB 1YAUO 2MYSA 1ZVZA 3O55A 3N0TA 3NDBB 3AOUA 4FWVA 5JVEA 4PFPA 1RJ9B 4C7OB 3DXJF 3L34A 5L3VA 1Z7Qc 3K33A 1D0YA 2PBEA 4BPMA 1YYXA 2YQYA 3I5QA 3LUTB 3LLIA 3R2PA 3S0XA 4D4NA 4K1OA 5COMA 4FAPB 3B0PA 3CQZA 3C8ZA 1CGME 3HNJA 2WZFA 1Q0MA 4LDKA 1UFBA 3BEHA 5E3CA 4P9FA 3G4XA 2HFIA 3LEVA 2VC9A 2R7QA 4U9EA 1OR3A 3L1MA 3LS1A 3QMKA 5F5HA 1E85A 4MW3A 3SEOA 4C3DA 3L8IA 1DOVA 4H4KC 4CJGA 3T6GB 2C04A 3QW1A 2RD9A 3E9VA 4CBEA 2E87A 5COFA 1LIHA 3SZRA 1KNYA 1M2OA 2R7OA 3H2UA 2PFDA 4MVOA 4QDLA 3GWLA 3EGDA 2VASA 1WN0A 3DAFA 3DKAA 2EIMC 5COGA 1VMAA 2PX0A 3KYIA 2CGEA 3WAQA 2R7VA 1KU2A 2Y3HA 3KL4A 3SYNA 2LD6A 5B3SC 1M6TA 4YT5A 3RW0A 3HTKC 4DRHB 3R7CA 3GM2A 1L3PA 2G62A 2HJMA 2R7RA 1OKKA 4AX2A 3Q7GA 2Y3BA 3EZIA 1E83A 5L0FA 4LDRA 5KYWA 2VCAA 3B9QA 3CAXA 2YEVA 4U5CE 4RBNA 1F1MA 2XS8A 2OOCA 3LNMB 3U2MA 3UMKA 1CPRA 2EPLX 5B3IA 5HSWA 1WWPA 2XLDA 4JCZA 1VLTA 2XXAB 2J9BA 3M4BA 3JRTA 4N06A 2D5RB 2A0BA 1LKXA 2ASRA 4CX9A 2P0NA 3Q6NA 1BR2A 3U5SA 4XPWA 2R7TA 2IM8A 3EQLF 2HV7A 4DRIB 1T5OA 3FOPA 3HLZA 1SZIA 2J8WA 2YL3A 4MVQA 3S27A 1CGNA 3AG3C 4XEVA 3AJMA 4U5BE 4BJ6A 1G4WR 2Q9BA 1OCRC 3EGDB 1FMVA 4YT4A 2OG2A 2NUTA 2A6EF 2A6HF 4CDAA 2VH3A 2EINC 2TMVP 1GS9A 1D0XA 1BR4A 1S7ZA 2J45A 1HE1A 1O5HA 1FFHA 2MHRA 2MWQA 4DVZA 2XLOA 3IEEA 2CCYA 1LS1A 3QW0A 3H65A 1Y6DA 3RKOF 1T6QA 5KYWB 3T9OA 2P6VA 1U0BB 2V3CC 3PHF2 4HEAJ 1YYJA 2CNWD 2LFFA 5E2QA 5K0IA 1JR8A 1SF8A 2YL0A 3F46A 1K05A 1TWAA 3KH2A 1H9GA 3LLKA 3PMRA 4DBRA 1MQVA 1J8MF 3F47A 4W8PA 5BQGA 2OJED 1QPUA 1YZAA 3Q7LA 4JTCB 2QUPA 2GDCA 4MTGA 4B6IA 4CSAC 4Q5SF 2R03A 4LERA 1RKEA 1V55C 3EZHA 1OXKA 1J8YF 2KGOA 4XTKA 3K6BA 4OINF 4IRUA 4JKVA 2Q9AA 1NU7D 1D1BA 3ABKC 3EGXA 2NUPB 2XL6A 4CDVA 4G0HA 1QLEC 2LSEA 2ZXWC 3C63A 1U89A 3JYHA 3O39A 4CJOA 5L3QA 3SXZA 4C7OA 1NG1A 3N24A 4F4BA 1A0BA 3UMIA 2NUTB 5EK0A 4YN0B 3TJ5A 2AU5A 3VM6A 3S28A 1APCA 2VCBA 4XEKA 3DI5A 4O7GA 3W2VA 2J0XA 4CIHA 4N6HA 4Q7CA 5DS6A 1WGWA 4K0DA 5KYXA 1LVKA 1NBBA 1WASA 2KNHA 5DS5A 4HE8D 3LAYA 1PCXA 3PCVA 4RDAA 1AUEA 2W9YA 3ZSUA 2V26A 2X51A 2XLEA 1TFOB 1Z3IX 3C18A 2F22A 2NSFA 3EH2A 1V54C 2KC3A 2KYHA 3FVYA 4YJWA 1BZ4A 4UDVA 2LP4A 2DB4A 2D4UA 3DWWA 3T6BA 4U5HA 2I15A 2R02A 2ZPAA 4E7SA 5AGFA 3C8GD 3ZTZA 4NY3A 3DM5A 1ORYA 3MYIA 1MNDA 2L6GA 3EGXB 3JRMO 4YL1A 2BE5F 3GM1A 1QSPA 3IQ6A 3MLGA 4W8KA 5DVWA 4XLNF 3ZDLA 3S90A 1KTMA 2J7PD 3LS0A 1A41A 2H8AA 4CDYA 3U0CA 3K1HA 2UUHA 5JRAA 4JEBA 4PACA 4AE4A 2UUIA 2BL2A 1HW2A 3FHDA 1H9TA 3GEEA 3FOOA 2LIGA 2BC5A 4J32B 4P6IC 5KYXB 1SYQA 3JSEO 3M1CB 1BDJB 3JT1A 4O6MA 5DLJA 3ASNC 5IY5C 4MVRA 2XXAA 1QVXA 256BA 2OEVA 1T6UA 2YL7A 3HJCA 1VB5A 2J9VA 1AEPA 1I5NA 1VLSA 2JX0A 2XS1A 4MNDA 2GWWA 4O79A 3GANA 5L0DA 3RIPA 2IXPA 1FMWA 1G4US 3ZWIA 5CI9A 2ICWG 2Z15A 4DXWA 1EKYA 3G4ZA
chains in the Genus database with same CATH topology
1Z23A 5KYUB 4JCHA 3LESA 4EWCA 4GEHA 4I1OB 4JJGA 3ITFA 3UNGC 4KNWA 2B0JA 3E70C 2A1DD 1VYIA 3AG2C 4OD5A 4BJ6C 5EGYA 5BUOA 3T4RA 1BR1A 1ZU4A 4CS9A 1D1CA 2Q3TA 4AE4B 3V7OA 2IXNA 3RH3A 3ABLC 2H7BA 3EG9A 4KI2A 5T1DB 3WG7C 2ZXPA 3LJBA 2W45A 1VK5A 4A2NB 4KNVA 4DVYP 4JZAA 4MQ9F 5DS4A 3JCUQ 3EH1A 4Q4ZF 3SP1A 1NZEA 3EHNA 2XL4A 3NKDA 5T3WA 4ZLDA 2NUPA 4GYTA 1MMDA 2DYRC 4CS8A 1MMAA 4O6YA 4AK9A 5KYNA 3S0XA 1OCCC 2CDQA 2IXOA 1VYKA 2J9WA 3JSZA 2EIJC 4QI0A 3QZCA 2PF4E 2Y3DA 1ZHXA 5T3TA 1ST6A 3EG9B 5D91A 2XSEA 2Y3GA 3WODF 3GODA 3AG1C 1IZMA 2CNWA 2R7XA 4BG0A 4KBLA 1ZHWA 4E7ZA 2A69F 4BJ1A 1D1AA 4IWBA 4BEJA 3AG4C 2HV6A 1ZU5A 1ZHTA 2O9XA 3CZ6A 4PJLA 5FCLA 3W8IA 2QY9A 4I1MA 4QI2A 1N1CA 2KQ9A 3UGPA 3FAJA 5DQTA 3EHMA 3MX3A 3ZVRA 2ZXOA 4LLEA 2R7SA 4OIOF 1M2VA 2A68F 2P7VA 3AQCA 5F5FA 3ASOC 3L0IA 4JURI 1ZHZA 1SMYF 3O6XA 5KYUA 1Z63A 2QTVA 2FFHA 4BJTA 3Q6MA 2WVOA 1W2WA 4U5EE 1MNEA 2YZSA 4XWJA 3N2ZB 2L9JA 4C3EA 4ZLCA 3OWTA 2ZXRA 3OA1A 2G3VA 3DZAA 4ULWA 3B0VC 1MMGA 2YHSA 2WZLA 3UMHA 4J30B 2WVQA 4FX5A 1OCZC 2J7PA 4K7BA 4EBBA 3DM9B 4LLCA 2CW0F 4CS9C 4DBQA 4G7ZF 2WZGA 2Y69C 5E33A 4X0RA 3UR3C 2KW3C 4ANJA 4JJFA 5E3AA 2WL8A 2IXMA 2R7UA 1JPNA 1M2VB 2WB7A 3DMDA 1TWHA 1FFTC 1TWGA 4OIRF 2R7WA 3EFOA 3SNHA 1VOMA 1QZXA 3ZG1A 1G8XA 4G7OF 2J46A 3AQBA 4XLPF 3TD7A 2EIKC 5B1AC 3ZC4A 1Z5ZA 3UGOA 1PD1A 2OCCC 4CS8C 4KC9A 5CI8A 4FESA 4G7HF 4C3BA 5EHHA 2PP4A 1PD0A 3I5PA 2W4BA 3VAYA 4HFFB 2XRHA 1MMNA 4WJ0A 2IYLD 2DYSC 2H7OA 3NKEA 2DGJA 5KYYA 3FDQA 3K7DA 1OKKD 3LNRA 2J0WA 2Q9CA 3CSKA 1JPJA 3EFOB 2EILC 2WVNA 3I4UA 4YT8A 1ZHYA 1Z6AA 4IJJA 2GFHA 1M56C 4YT2A 3EPVA 1TKNA 2FGYA 3X1OA 1M57C 2L81A 2W4MA 4U5DE 3S29A 3KMIA 4OD4A 5KYYB 1O87A 4U5FE 2H7VC 4PK4A 3RYLA 3W2WA 4DOZA 3VYWA 3NRHA 3DAGA 2NG1A 2PX3A 2M4EA 2C03A 1OCOC 4I3MA 1IW7F 2KJGA 4BJ5C 3OEOA 3NYMA 2JD3A 1FTSA 3RFYA 2Y39A 2G3KA 4JVSA 4OIQF 2VB6A 4LACB 3NG1A 5B1BC 3POVA 3DD7A 4PJJA 3ECSA 4JW1A 4PJMA 3KKBA 1RJ9A 1ZYRF 3ABMC 5D92A 3B0UX 3W8HA 4BJ5A 2I8BA 2J9UA 4PJNA 1NU9C 1TR2A 1TWCA 3NYJA 4OIPF 1D0ZA 3EJNA 4M63A 3T6JA 3ZIBA 3X2QC 4O6NA 4I44A 2IOQA 4CSAA 4YWQA 3DJNB 3NYLA 4IAOA 4CS7A 3K1IC 4PFOA 3K66A 4HFKB 4RD9A 4U5GA 3DJUB 2MYSA 3N0TA 3NDBB 4FWVA 4PFPA 1RJ9B 4C7OB 3DXJF 3L34A 5L3VA 3K33A 1D0YA 3I5QA 3LLIA 3B0PA 3CQZA 2WZFA 5E3CA 3LEVA 2R7QA 3LS1A 5F5HA 3QMKA 3SEOA 4C3DA 4H4KC 2C04A 3E9VA 4CBEA 2E87A 3SZRA 1M2OA 2R7OA 2PFDA 4QDLA 3EGDA 2VASA 3DAFA 2EIMC 2R7VA 1VMAA 2PX0A 2CGEA 1KU2A 2Y3HA 3KL4A 3SYNA 5B3SC 4YT5A 3HTKC 2R7RA 2G62A 1OKKA 4AX2A 3Q7GA 2Y3BA 3EZIA 5KYWA 3B9QA 4U5CE 2YEVA 4RBNA 3UMKA 5HSWA 2XXAB 3JRTA 4N06A 2D5RB 1LKXA 3Q6NA 1BR2A 2R7TA 3EQLF 2HV7A 3HLZA 1SZIA 3S27A 3AG3C 4U5BE 4BJ6A 2Q9BA 1OCRC 3EGDB 1FMVA 4YT4A 2OG2A 2NUTA 2A6EF 2A6HF 2VH3A 2EINC 1D0XA 1BR4A 1S7ZA 2J45A 1O5HA 1FFHA 2MWQA 4DVZA 3IEEA 1LS1A 3H65A 3RKOF 5KYWB 2P6VA 2V3CC 3PHF2 4HEAJ 2CNWD 5E2QA 1SF8A 3F46A 3KH2A 3LLKA 1TWAA 3PMRA 4DBRA 1J8MF 3F47A 4CSAC 4B6IA 3Q7LA 4Q5SF 4LERA 1V55C 3EZHA 1J8YF 2KGOA 4XTKA 3K6BA 4OINF 4IRUA 2Q9AA 1NU7D 1D1BA 3ABKC 3EGXA 2NUPB 4G0HA 1QLEC 2LSEA 2ZXWC 3JYHA 3O39A 5L3QA 4C7OA 1NG1A 3N24A 4F4BA 3UMIA 2NUTB 4YN0B 3S28A 3W2VA 4O7GA 4CIHA 2J0XA 4Q7CA 5DS6A 1WGWA 4K0DA 5KYXA 1LVKA 2KNHA 5DS5A 4HE8D 3LAYA 1PCXA 4RDAA 2W9YA 3ZSUA 2V26A 2X51A 1Z3IX 3EH2A 1V54C 3FVYA 4YJWA 3T6BA 4U5HA 2ZPAA 4E7SA 4NY3A 3DM5A 1MNDA 3EGXB 2BE5F 4W8KA 4XLNF 3MLGA 5DVWA 2J7PD 3LS0A 3K1HA 4AE4A 3FHDA 4J32B 4P6IC 5KYXB 3M1CB 3JT1A 4O6MA 5DLJA 3ASNC 5IY5C 2XXAA 3HJCA 2J9VA 4MNDA 4O79A 3GANA 3RIPA 2IXPA 1FMWA 5CI9A 2Z15A 5DQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NYM A; 
#chains in the Genus database with same CATH topology
 1Z23 A;  3G50 A;  1QKR A;  2OKU A;  3GEH A;  5KYU B;  3JYY A;  4Z9H A;  4JCH A;  1LI5 A;  3LES A;  4EWC A;  1V74 B;  4GEH A;  2L6H A;  5L0C A;  2A0U A;  3MYF A;  3ITF A;  4I1O B;  4JJG A;  3M79 A;  2OJQ A;  3UNG C;  1YVI A;  4KNW A;  2B0J A;  5A69 A;  3E70 C;  2A1D D;  1VYI A;  1YLM A;  2DI3 A;  2L7A A;  3AG2 C;  3MFN A;  4OD5 A;  3U8V A;  4BJ6 C;  4ONS A;  5EGY A;  5BUO A;  3T4R A;  1BR1 A;  1FNT c;  1ZU4 A;  4CS9 A;  1D1C A;  2Q3T A;  4AE4 B;  3V7O A;  2IXN A;  3AGU A;  2YLG A;  3RH3 A;  3QVY A;  1TQG A;  3ABL C;  1R4T A;  2NPU A;  3KPH A;  2QE9 A;  2H7B A;  4MVU A;  4IAQ A;  3EG9 A;  3IPM O;  5TJ5 E;  1Q0K A;  5T1D B;  4KI2 A;  2P1A A;  3WG7 C;  1PV3 A;  2ZXP A;  3LJB A;  3TJ6 A;  2W45 A;  1VK5 A;  4A2N B;  2M64 A;  4KNV A;  4DVY P;  3A9C A;  4NTB A;  3ZQY A;  4JZA A;  4MQ9 F;  1A7E A;  1OW6 A;  1U6H A;  5DS4 A;  3S84 A;  3JCU Q;  4LDQ A;  1JAF A;  3C7J A;  3EH1 A;  4PR9 A;  3W4Y A;  4EIY A;  4Q4Z F;  3SP1 A;  4Z9I A;  4EUK B;  1NZE A;  3EHN A;  2XL4 A;  3NKD A;  5T3W A;  4EBJ A;  2NUP A;  4ZLD A;  3TK0 A;  1CPQ A;  1T01 A;  1XZQ A;  2YKZ A;  3GOR A;  4GYT A;  1I4Y A;  4IGG A;  4ULV A;  1MMD A;  3TOM A;  2DYR C;  2HMZ A;  3U8P A;  4CS8 A;  4JC7 A;  3V5Z A;  1MMA A;  4O6Y A;  2HJ3 A;  3IQ5 A;  3RQG A;  4AK9 A;  2HMQ A;  5KYN A;  1OCC C;  2CDQ A;  2IXO A;  1VYK A;  1LS4 A;  1FAP B;  2J9W A;  4MTO A;  3JSZ A;  3US6 A;  2EIJ C;  1B68 A;  2GA0 A;  1EQ1 A;  4AL1 A;  1GM5 A;  4QI0 A;  1A7V A;  4J7Y A;  1JMW A;  1C17 M;  3QZC A;  2PF4 E;  4WAB A;  2Y3D A;  1ZHX A;  2XLW A;  4MVZ A;  3V5X A;  1SR2 A;  5T3T A;  1ST6 A;  3EG9 B;  5D91 A;  2XSE A;  2ETS A;  2XLM A;  3H2V A;  5L0G A;  2Y3G A;  3MBG A;  4E17 A;  3WOD F;  3GOD A;  2QLA A;  3AG1 C;  4NTF A;  3SXM A;  1IZM A;  2CNW A;  3M15 A;  3JTL O;  3HNI A;  2R7X A;  3O10 A;  4BG0 A;  5HV9 A;  1LM3 B;  4KBL A;  1ZHW A;  1NSG B;  4E7Z A;  3AGT A;  2A69 F;  2X0C A;  4BJ1 A;  4EHP A;  2QNL A;  1D1A A;  4IWB A;  4BEJ A;  3AG4 C;  2EPM X;  1NFO A;  2HV6 A;  1ZU5 A;  1ZHT A;  1K40 A;  2O9X A;  3CZ6 A;  4PJL A;  5FCL A;  2LCH A;  4AL0 A;  1WTY A;  1Q0F A;  4XEF A;  3W8I A;  3GM3 A;  2QY9 A;  3HKK A;  4I1M A;  3DE8 A;  4QI2 A;  5L0H A;  2HS5 A;  4JTA B;  2YWA A;  1OW7 A;  4EBK A;  1N1C A;  2KQ9 A;  3UGP A;  3FAJ A;  3PDM P;  3J06 A;  2ZD9 A;  1HE9 A;  4N6C A;  3ZTM A;  4YK5 A;  5DQT A;  3EHM A;  2JPU A;  3MX3 A;  2HSQ A;  1LE4 A;  3NMJ A;  4E0H A;  3ZVR A;  2YVK A;  2ZXO A;  1Q0G A;  4LLE A;  2R7S A;  3RVZ A;  4OIO F;  1M2V A;  2A68 F;  2P7V A;  3AQC A;  2EPO A;  5F5F A;  5FZT A;  4P9T A;  4A4A A;  5JP7 A;  1ORS C;  3ASO C;  3L0I A;  2R05 A;  3M4C A;  4JUR I;  1ZHZ A;  1SMY F;  4DJ9 A;  3O6X A;  5KYU A;  5BQH A;  2QTV A;  5A6B D;  2FFH A;  4BJT A;  1Z63 A;  3Q6M A;  1LE2 A;  2WVO A;  1W2W A;  1LI7 A;  2KSF A;  4U5E E;  1MNE A;  2YZS A;  4XWJ A;  3N2Z B;  3U3B A;  2L9J A;  4C3E A;  2R25 A;  4ZLC A;  2R9R B;  2XM4 A;  3OWT A;  2ZXR A;  3C8G A;  2G3V A;  3FAP B;  3DZA A;  3OA1 A;  3QVZ A;  4ULW A;  5JS5 A;  5A6J A;  3B0V C;  1E84 A;  5F28 E;  1MMG A;  3NMI A;  2YHS A;  2WZL A;  4U9D A;  3UMH A;  4J30 B;  2WVQ A;  4FX5 A;  1HMD A;  1EI7 A;  1OCZ C;  2J7P A;  3IHU A;  3TQO A;  4K7B A;  4EBB A;  3DM9 B;  4LLC A;  2CW0 F;  4CS9 C;  4DBQ A;  4G7Z F;  1T9K A;  2WZG A;  3KYJ A;  3IQT A;  2Y69 C;  5E33 A;  3VRC A;  4X0R A;  3UR3 C;  5JT4 A;  1FR0 A;  1OQC A;  2KW3 C;  4ANJ A;  4JJF A;  3FXH A;  4E18 A;  5E3A A;  2WL8 A;  3U2L A;  3B29 A;  1GQA A;  2IXM A;  2R7U A;  1JPN A;  1M2V B;  2WB7 A;  3DMD A;  1TWH A;  4NCQ A;  4DRJ B;  2FAP B;  4MW8 A;  1FFT C;  4CIP A;  2XL8 A;  1ORJ A;  1TWG A;  4OIR F;  2R7W A;  3EFO A;  5JSL A;  3SNH A;  5CIV A;  1VOM A;  2OQM A;  1QZX A;  2AP3 A;  4ER9 A;  3A11 A;  4MTF A;  3ZG1 A;  1G8X A;  1RXQ A;  3NMK A;  4G7O F;  2L6F A;  2J46 A;  3AQB A;  4XPY A;  4YL0 A;  2EIK C;  1TFK B;  3TD7 A;  4XLP F;  5B1A C;  1YZC A;  3RF3 A;  3C8G B;  1Z5Z A;  2KK1 A;  3ZC4 A;  3UGO A;  1PD1 A;  2OCC C;  4JTD B;  1H6G A;  2OU6 A;  4CS8 C;  4KC9 A;  2AVK A;  5CI8 A;  1YA7 O;  4FES A;  4G7H F;  4C3B A;  1JRA A;  2HUJ A;  1ZW3 A;  5EHH A;  2PP4 A;  1CGO A;  1PD0 A;  3I5P A;  3K1I A;  3CEX A;  1C02 A;  2W4B A;  4IAR A;  2YLD A;  1A7D A;  4HFF B;  1I4Z A;  2Q00 A;  3VAY A;  2XRH A;  3QTH A;  1MMN A;  4WJ0 A;  5L0I A;  2IYL D;  2DYS C;  2VCC A;  3L8J A;  2H7O A;  2XM0 A;  4E0I A;  1YJG A;  3S9O A;  2IBF A;  3NKE A;  4JIO A;  2DGJ A;  5KYY A;  2PNO A;  4R32 A;  3TUL A;  4NQF A;  3FDQ A;  1QQ3 A;  4MVS A;  3K7D A;  1OKK D;  2J0W A;  3LNR A;  2Q9C A;  3CSK A;  1JPJ A;  3IQC A;  1GGQ A;  3EFO B;  4JEA A;  2EIL C;  3TOL A;  2WVN A;  3I4U A;  1L7C A;  4YT8 A;  1ZHY A;  1Z6A A;  2Q7R A;  4IJJ A;  2B0H A;  3JZ0 A;  4MVM A;  1E2X A;  2GFH A;  3V5Y A;  1M56 C;  2AWC A;  1VTM P;  4YT2 A;  3EPV A;  1RCP A;  1TKN A;  2FGY A;  1JOG A;  4JRZ A;  3X1O A;  1YAR O;  3BRJ A;  1M57 C;  3LEO A;  4GQH A;  2L81 A;  2W4M A;  4U5D E;  4MS2 A;  5BQI A;  1RMV A;  4WGY A;  3S29 A;  3HNK A;  3KMI A;  3B71 A;  5AC5 A;  1OW8 A;  4JE9 A;  1K04 A;  3HNL A;  4XQ1 A;  3C62 A;  4OD4 A;  3VF0 A;  1OXB A;  2LK4 A;  2YL1 A;  1XWJ A;  1DOW A;  1H7I A;  5A6K A;  2P61 A;  5KYY B;  1O87 A;  4U5F E;  3U3F A;  2H7V C;  2HZ8 A;  5DQZ A;  4PK4 A;  4WGZ A;  3RYL A;  2NSG A;  3W2W A;  4DOZ A;  2HKV A;  3VYW A;  3NRH A;  1WAT A;  1T6I A;  2YRF A;  3DAG A;  1Q0D A;  2NG1 A;  2PX3 A;  2M4E A;  2C03 A;  4J7T A;  3RQF A;  1ZW2 A;  5L0J A;  4YL3 A;  1OCO C;  3ATP A;  4I3M A;  1IW7 F;  2KJG A;  4BJ5 C;  4G78 A;  1UG7 A;  3OEO A;  1WOL A;  3NYM A;  5A6A A;  1G5Z A;  2JD3 A;  5JUA A;  1EA8 A;  1OR2 A;  2Q4F A;  1FTS A;  5AC4 A;  3RFY A;  1HY5 A;  1Y4C A;  4IB4 A;  2Y39 A;  2G3K A;  4JVS A;  3U9J A;  3U9M A;  4OIQ F;  5GPG B;  1AVO B;  2VB6 A;  4LAC B;  3NG1 A;  4H54 A;  5B1B C;  1E86 A;  3POV A;  3DD7 A;  4PJJ A;  3ECS A;  4NC3 A;  4JW1 A;  4EKW A;  4PJM A;  3KKB A;  4Z9J A;  2XLV A;  2LFD A;  1S05 A;  1RJ9 A;  2CYD A;  1RKC A;  1ZZP A;  2EPN A;  1NFN A;  1ZYR F;  3ABM C;  5D92 A;  3B0U X;  4BEM J;  3W8H A;  3RQE A;  1C03 A;  3SXY A;  4BJ5 A;  2I8B A;  2J9U A;  4PJN A;  4N4W A;  1NU9 C;  1XZP A;  3FMS A;  4XPX A;  1TR2 A;  5A6B A;  1O3U A;  1TWC A;  3NYJ A;  2XLH A;  4OIP F;  3GEI A;  1D0Z A;  1YA9 A;  2OEX A;  2AWY A;  3EJN A;  4M63 A;  2EPK X;  3T6J A;  3X2Q C;  3ZIB A;  4O6N A;  3DE9 A;  5JLI A;  1NLX A;  3ZQV A;  2HSB A;  4I44 A;  4D4X A;  2RSE B;  2IOQ A;  1R5I D;  1HW1 A;  3GWN A;  4CSA A;  1YDI A;  3WHN A;  4YWQ A;  3DJN B;  3NYL A;  4IAO A;  4CS7 A;  1BBH A;  2LQG A;  4NTA A;  3RVY A;  4L6R A;  1HMO A;  3K1I C;  3SXK A;  2YLI A;  4PFO A;  1V4A A;  1RKE B;  3K66 A;  4HFK B;  4RD9 A;  1LPE A;  2GAQ A;  4U5G A;  3DJU B;  1YAU O;  2MYS A;  1ZVZ A;  3O55 A;  3N0T A;  3NDB B;  3AOU A;  4FWV A;  5JVE A;  4PFP A;  1RJ9 B;  4C7O B;  3DXJ F;  3L34 A;  5L3V A;  1Z7Q c;  3K33 A;  1D0Y A;  2PBE A;  4BPM A;  1YYX A;  2YQY A;  3I5Q A;  3LUT B;  3LLI A;  3R2P A;  3S0X A;  4D4N A;  4K1O A;  5COM A;  4FAP B;  3B0P A;  3CQZ A;  3C8Z A;  1CGM E;  3HNJ A;  2WZF A;  1Q0M A;  4LDK A;  1UFB A;  3BEH A;  5E3C A;  4P9F A;  3G4X A;  2HFI A;  3LEV A;  2VC9 A;  2R7Q A;  4U9E A;  1OR3 A;  3L1M A;  3LS1 A;  3QMK A;  5F5H A;  1E85 A;  4MW3 A;  3SEO A;  4C3D A;  3L8I A;  1DOV A;  4H4K C;  4CJG A;  3T6G B;  2C04 A;  3QW1 A;  2RD9 A;  3E9V A;  4CBE A;  2E87 A;  5COF A;  1LIH A;  3SZR A;  1KNY A;  1M2O A;  2R7O A;  3H2U A;  2PFD A;  4MVO A;  4QDL A;  3GWL A;  3EGD A;  2VAS A;  1WN0 A;  3DAF A;  3DKA A;  2EIM C;  5COG A;  1VMA A;  2PX0 A;  3KYI A;  2CGE A;  3WAQ A;  2R7V A;  1KU2 A;  2Y3H A;  3KL4 A;  3SYN A;  2LD6 A;  5B3S C;  1M6T A;  4YT5 A;  3RW0 A;  3HTK C;  4DRH B;  3R7C A;  3GM2 A;  1L3P A;  2G62 A;  2HJM A;  2R7R A;  1OKK A;  4AX2 A;  3Q7G A;  2Y3B A;  3EZI A;  1E83 A;  5L0F A;  4LDR A;  5KYW A;  2VCA A;  3B9Q A;  3CAX A;  2YEV A;  4U5C E;  4RBN A;  1F1M A;  2XS8 A;  2OOC A;  3LNM B;  3U2M A;  3UMK A;  1CPR A;  2EPL X;  5B3I A;  5HSW A;  1WWP A;  2XLD A;  4JCZ A;  1VLT A;  2XXA B;  2J9B A;  3M4B A;  3JRT A;  4N06 A;  2D5R B;  2A0B A;  1LKX A;  2ASR A;  4CX9 A;  2P0N A;  3Q6N A;  1BR2 A;  3U5S A;  4XPW A;  2R7T A;  2IM8 A;  3EQL F;  2HV7 A;  4DRI B;  1T5O A;  3FOP A;  3HLZ A;  1SZI A;  2J8W A;  2YL3 A;  4MVQ A;  3S27 A;  1CGN A;  3AG3 C;  4XEV A;  3AJM A;  4U5B E;  4BJ6 A;  1G4W R;  2Q9B A;  1OCR C;  3EGD B;  1FMV A;  4YT4 A;  2OG2 A;  2NUT A;  2A6E F;  2A6H F;  4CDA A;  2VH3 A;  2EIN C;  2TMV P;  1GS9 A;  1D0X A;  1BR4 A;  1S7Z A;  2J45 A;  1HE1 A;  1O5H A;  1FFH A;  2MHR A;  2MWQ A;  4DVZ A;  2XLO A;  3IEE A;  2CCY A;  1LS1 A;  3QW0 A;  3H65 A;  1Y6D A;  3RKO F;  1T6Q A;  5KYW B;  3T9O A;  2P6V A;  1U0B B;  2V3C C;  3PHF 2;  4HEA J;  1YYJ A;  2CNW D;  2LFF A;  5E2Q A;  5K0I A;  1JR8 A;  1SF8 A;  2YL0 A;  3F46 A;  1K05 A;  1TWA A;  3KH2 A;  1H9G A;  3LLK A;  3PMR A;  4DBR A;  1MQV A;  1J8M F;  3F47 A;  4W8P A;  5BQG A;  2OJE D;  1QPU A;  1YZA A;  3Q7L A;  4JTC B;  2QUP A;  2GDC A;  4MTG A;  4B6I A;  4CSA C;  4Q5S F;  2R03 A;  4LER A;  1RKE A;  1V55 C;  3EZH A;  1OXK A;  1J8Y F;  2KGO A;  4XTK A;  3K6B A;  4OIN F;  4IRU A;  4JKV A;  2Q9A A;  1NU7 D;  1D1B A;  3ABK C;  3EGX A;  2NUP B;  2XL6 A;  4CDV A;  4G0H A;  1QLE C;  2LSE A;  2ZXW C;  3C63 A;  1U89 A;  3JYH A;  3O39 A;  4CJO A;  5L3Q A;  3SXZ A;  4C7O A;  1NG1 A;  3N24 A;  4F4B A;  1A0B A;  3UMI A;  2NUT B;  5EK0 A;  4YN0 B;  3TJ5 A;  2AU5 A;  3VM6 A;  3S28 A;  1APC A;  2VCB A;  4XEK A;  3DI5 A;  4O7G A;  3W2V A;  2J0X A;  4CIH A;  4N6H A;  4Q7C A;  5DS6 A;  1WGW A;  4K0D A;  5KYX A;  1LVK A;  1NBB A;  1WAS A;  2KNH A;  5DS5 A;  4HE8 D;  3LAY A;  1PCX A;  3PCV A;  4RDA A;  1AUE A;  2W9Y A;  3ZSU A;  2V26 A;  2X51 A;  2XLE A;  1TFO B;  1Z3I X;  3C18 A;  2F22 A;  2NSF A;  3EH2 A;  1V54 C;  2KC3 A;  2KYH A;  3FVY A;  4YJW A;  1BZ4 A;  4UDV A;  2LP4 A;  2DB4 A;  2D4U A;  3DWW A;  3T6B A;  4U5H A;  2I15 A;  2R02 A;  2ZPA A;  4E7S A;  5AGF A;  3C8G D;  3ZTZ A;  4NY3 A;  3DM5 A;  1ORY A;  3MYI A;  1MND A;  2L6G A;  3EGX B;  3JRM O;  4YL1 A;  2BE5 F;  3GM1 A;  1QSP A;  3IQ6 A;  3MLG A;  4W8K A;  5DVW A;  4XLN F;  3ZDL A;  3S90 A;  1KTM A;  2J7P D;  3LS0 A;  1A41 A;  2H8A A;  4CDY A;  3U0C A;  3K1H A;  2UUH A;  5JRA A;  4JEB A;  4PAC A;  4AE4 A;  2UUI A;  2BL2 A;  1HW2 A;  3FHD A;  1H9T A;  3GEE A;  3FOO A;  2LIG A;  2BC5 A;  4J32 B;  4P6I C;  5KYX B;  1SYQ A;  3JSE O;  3M1C B;  1BDJ B;  3JT1 A;  4O6M A;  5DLJ A;  3ASN C;  5IY5 C;  4MVR A;  2XXA A;  1QVX A;  256B A;  2OEV A;  1T6U A;  2YL7 A;  3HJC A;  1VB5 A;  2J9V A;  1AEP A;  1I5N A;  1VLS A;  2JX0 A;  2XS1 A;  4MND A;  2GWW A;  4O79 A;  3GAN A;  5L0D A;  3RIP A;  2IXP A;  1FMW A;  1G4U S;  3ZWI A;  5CI9 A;  2ICW G;  2Z15 A;  4DXW A;  1EKY A;  3G4Z A; 
#chains in the Genus database with same CATH homology
 1Z23 A;  5KYU B;  4JCH A;  3LES A;  4EWC A;  4GEH A;  4I1O B;  4JJG A;  3ITF A;  3UNG C;  4KNW A;  2B0J A;  3E70 C;  2A1D D;  1VYI A;  3AG2 C;  4OD5 A;  4BJ6 C;  5EGY A;  5BUO A;  3T4R A;  1BR1 A;  1ZU4 A;  4CS9 A;  1D1C A;  2Q3T A;  4AE4 B;  3V7O A;  2IXN A;  3RH3 A;  3ABL C;  2H7B A;  3EG9 A;  4KI2 A;  5T1D B;  3WG7 C;  2ZXP A;  3LJB A;  2W45 A;  1VK5 A;  4A2N B;  4KNV A;  4DVY P;  4JZA A;  4MQ9 F;  5DS4 A;  3JCU Q;  3EH1 A;  4Q4Z F;  3SP1 A;  1NZE A;  3EHN A;  2XL4 A;  3NKD A;  5T3W A;  4ZLD A;  2NUP A;  4GYT A;  1MMD A;  2DYR C;  4CS8 A;  1MMA A;  4O6Y A;  4AK9 A;  5KYN A;  3S0X A;  1OCC C;  2CDQ A;  2IXO A;  1VYK A;  2J9W A;  3JSZ A;  2EIJ C;  4QI0 A;  3QZC A;  2PF4 E;  2Y3D A;  1ZHX A;  5T3T A;  1ST6 A;  3EG9 B;  5D91 A;  2XSE A;  2Y3G A;  3WOD F;  3GOD A;  3AG1 C;  1IZM A;  2CNW A;  2R7X A;  4BG0 A;  4KBL A;  1ZHW A;  4E7Z A;  2A69 F;  4BJ1 A;  1D1A A;  4IWB A;  4BEJ A;  3AG4 C;  2HV6 A;  1ZU5 A;  1ZHT A;  2O9X A;  3CZ6 A;  4PJL A;  5FCL A;  3W8I A;  2QY9 A;  4I1M A;  4QI2 A;  1N1C A;  2KQ9 A;  3UGP A;  3FAJ A;  5DQT A;  3EHM A;  3MX3 A;  3ZVR A;  2ZXO A;  4LLE A;  2R7S A;  4OIO F;  1M2V A;  2A68 F;  2P7V A;  3AQC A;  5F5F A;  3ASO C;  3L0I A;  4JUR I;  1ZHZ A;  1SMY F;  3O6X A;  5KYU A;  1Z63 A;  2QTV A;  2FFH A;  4BJT A;  3Q6M A;  2WVO A;  1W2W A;  4U5E E;  1MNE A;  2YZS A;  4XWJ A;  3N2Z B;  2L9J A;  4C3E A;  4ZLC A;  3OWT A;  2ZXR A;  3OA1 A;  2G3V A;  3DZA A;  4ULW A;  3B0V C;  1MMG A;  2YHS A;  2WZL A;  3UMH A;  4J30 B;  2WVQ A;  4FX5 A;  1OCZ C;  2J7P A;  4K7B A;  4EBB A;  3DM9 B;  4LLC A;  2CW0 F;  4CS9 C;  4DBQ A;  4G7Z F;  2WZG A;  2Y69 C;  5E33 A;  4X0R A;  3UR3 C;  2KW3 C;  4ANJ A;  4JJF A;  5E3A A;  2WL8 A;  2IXM A;  2R7U A;  1JPN A;  1M2V B;  2WB7 A;  3DMD A;  1TWH A;  1FFT C;  1TWG A;  4OIR F;  2R7W A;  3EFO A;  3SNH A;  1VOM A;  1QZX A;  3ZG1 A;  1G8X A;  4G7O F;  2J46 A;  3AQB A;  4XLP F;  3TD7 A;  2EIK C;  5B1A C;  3ZC4 A;  1Z5Z A;  3UGO A;  1PD1 A;  2OCC C;  4CS8 C;  4KC9 A;  5CI8 A;  4FES A;  4G7H F;  4C3B A;  5EHH A;  2PP4 A;  1PD0 A;  3I5P A;  2W4B A;  3VAY A;  4HFF B;  2XRH A;  1MMN A;  4WJ0 A;  2IYL D;  2DYS C;  2H7O A;  3NKE A;  2DGJ A;  5KYY A;  3FDQ A;  3K7D A;  1OKK D;  3LNR A;  2J0W A;  2Q9C A;  3CSK A;  1JPJ A;  3EFO B;  2EIL C;  2WVN A;  3I4U A;  4YT8 A;  1ZHY A;  1Z6A A;  4IJJ A;  2GFH A;  1M56 C;  4YT2 A;  3EPV A;  1TKN A;  2FGY A;  3X1O A;  1M57 C;  2L81 A;  2W4M A;  4U5D E;  3S29 A;  3KMI A;  4OD4 A;  5KYY B;  1O87 A;  4U5F E;  2H7V C;  4PK4 A;  3RYL A;  3W2W A;  4DOZ A;  3VYW A;  3NRH A;  3DAG A;  2NG1 A;  2PX3 A;  2M4E A;  2C03 A;  1OCO C;  4I3M A;  1IW7 F;  2KJG A;  4BJ5 C;  3OEO A;  3NYM A;  2JD3 A;  1FTS A;  3RFY A;  2Y39 A;  2G3K A;  4JVS A;  4OIQ F;  2VB6 A;  4LAC B;  3NG1 A;  5B1B C;  3POV A;  3DD7 A;  4PJJ A;  3ECS A;  4JW1 A;  4PJM A;  3KKB A;  1RJ9 A;  1ZYR F;  3ABM C;  5D92 A;  3B0U X;  3W8H A;  4BJ5 A;  2I8B A;  2J9U A;  4PJN A;  1NU9 C;  1TR2 A;  1TWC A;  3NYJ A;  4OIP F;  1D0Z A;  3EJN A;  4M63 A;  3T6J A;  3ZIB A;  3X2Q C;  4O6N A;  4I44 A;  2IOQ A;  4CSA A;  4YWQ A;  3DJN B;  3NYL A;  4IAO A;  4CS7 A;  3K1I C;  4PFO A;  3K66 A;  4HFK B;  4RD9 A;  4U5G A;  3DJU B;  2MYS A;  3N0T A;  3NDB B;  4FWV A;  4PFP A;  1RJ9 B;  4C7O B;  3DXJ F;  3L34 A;  5L3V A;  3K33 A;  1D0Y A;  3I5Q A;  3LLI A;  3B0P A;  3CQZ A;  2WZF A;  5E3C A;  3LEV A;  2R7Q A;  3LS1 A;  5F5H A;  3QMK A;  3SEO A;  4C3D A;  4H4K C;  2C04 A;  3E9V A;  4CBE A;  2E87 A;  3SZR A;  1M2O A;  2R7O A;  2PFD A;  4QDL A;  3EGD A;  2VAS A;  3DAF A;  2EIM C;  2R7V A;  1VMA A;  2PX0 A;  2CGE A;  1KU2 A;  2Y3H A;  3KL4 A;  3SYN A;  5B3S C;  4YT5 A;  3HTK C;  2R7R A;  2G62 A;  1OKK A;  4AX2 A;  3Q7G A;  2Y3B A;  3EZI A;  5KYW A;  3B9Q A;  4U5C E;  2YEV A;  4RBN A;  3UMK A;  5HSW A;  2XXA B;  3JRT A;  4N06 A;  2D5R B;  1LKX A;  3Q6N A;  1BR2 A;  2R7T A;  3EQL F;  2HV7 A;  3HLZ A;  1SZI A;  3S27 A;  3AG3 C;  4U5B E;  4BJ6 A;  2Q9B A;  1OCR C;  3EGD B;  1FMV A;  4YT4 A;  2OG2 A;  2NUT A;  2A6E F;  2A6H F;  2VH3 A;  2EIN C;  1D0X A;  1BR4 A;  1S7Z A;  2J45 A;  1O5H A;  1FFH A;  2MWQ A;  4DVZ A;  3IEE A;  1LS1 A;  3H65 A;  3RKO F;  5KYW B;  2P6V A;  2V3C C;  3PHF 2;  4HEA J;  2CNW D;  5E2Q A;  1SF8 A;  3F46 A;  3KH2 A;  3LLK A;  1TWA A;  3PMR A;  4DBR A;  1J8M F;  3F47 A;  4CSA C;  4B6I A;  3Q7L A;  4Q5S F;  4LER A;  1V55 C;  3EZH A;  1J8Y F;  2KGO A;  4XTK A;  3K6B A;  4OIN F;  4IRU A;  2Q9A A;  1NU7 D;  1D1B A;  3ABK C;  3EGX A;  2NUP B;  4G0H A;  1QLE C;  2LSE A;  2ZXW C;  3JYH A;  3O39 A;  5L3Q A;  4C7O A;  1NG1 A;  3N24 A;  4F4B A;  3UMI A;  2NUT B;  4YN0 B;  3S28 A;  3W2V A;  4O7G A;  4CIH A;  2J0X A;  4Q7C A;  5DS6 A;  1WGW A;  4K0D A;  5KYX A;  1LVK A;  2KNH A;  5DS5 A;  4HE8 D;  3LAY A;  1PCX A;  4RDA A;  2W9Y A;  3ZSU A;  2V26 A;  2X51 A;  1Z3I X;  3EH2 A;  1V54 C;  3FVY A;  4YJW A;  3T6B A;  4U5H A;  2ZPA A;  4E7S A;  4NY3 A;  3DM5 A;  1MND A;  3EGX B;  2BE5 F;  4W8K A;  4XLN F;  3MLG A;  5DVW A;  2J7P D;  3LS0 A;  3K1H A;  4AE4 A;  3FHD A;  4J32 B;  4P6I C;  5KYX B;  3M1C B;  3JT1 A;  4O6M A;  5DLJ A;  3ASN C;  5IY5 C;  2XXA A;  3HJC A;  2J9V A;  4MND A;  4O79 A;  3GAN A;  3RIP A;  2IXP A;  1FMW A;  5CI9 A;  2Z15 A;  5DQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...