3NYMA

The crystal structure of functionally unknown protein from neisseria meningitidis mc58
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
118
Chain Sequence
AMETLNDIKILINVGLYQGFDLTDPKVSEEVNHETANMWIDYTSDGNWDNEFKEDLNFLDYMEVCQLALNDNFIASNSLFMAMIYAGNLSLIFDSIKTDISTLLSAEYKKNSFSWPSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title The crystal structure of functionally unknown protein from Neisseria meningitidis MC58
rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Structural genomics, unknown function
total genus 35
structure length 118
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1000 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3nymA00
3NYMA
chains in the Genus database with same CATH superfamily
4NTAA 1EI7A 1Q0KA 3ITFA 2NSGA 4H4KC 5JP7A 3SEOA 2WVOA 2MYSA 4D4NA 1AVOB 1IW7F 1I4YA 3OEOA 3QMKA 2R25A 4Z9IA 1A7EA 1T6IA 3BEHA 3RF3A 2AVKA 4Q5SF 2EPLX 2L9JA 3GEHA 4O6MA 4YL1A 4PJLA 2IXMA 2J0WA 2TMVP 1Y4CA 1O5HA 4P9FA 4XEFA 1JR8A 1JOGA 2H7BA 2HV6A 3LAYA 4LLEA 2WL8A 5E33A 2YL0A 3AGTA 3DWWA 1G4WR 1LKXA 1QLEC 2HMQA 3IHUA 3S27A 2CYDA 5BUOA 2R7QA 2HZ8A 3PDMP 1YYXA 3NMIA 4G7HF 3HNLA 1H9TA 2IBFA 2I8BA 3JYHA 1HW1A 3RH3A 4MVZA 4PFOA 1D1AA 4PJJA 2J45A 3E70C 5FZTA 1HW2A 1WATA 2EPNA 1ZYRF 2WVQA 2XS8A 3PMRA 4JTAB 3JTLO 3S28A 5COFA 1FMWA 2A6HF 3V5YA 1FFTC 5A6KA 1JRAA 3EZHA 3MFNA 1APCA 2R7VA 1M2VB 2W45A 4JURI 4G78A 3RQEA 4CDVA 4O7GA 3SXYA 3LNMB 3L0IA 4LERA 4BEJA 2DI3A 1LM3B 1OCOC 3JYYA 4LDQA 5B3SC 4MQ9F 1Z7Qc 2OJQA 2QUPA 2YL7A 4BJ1A 2P61A 4LDRA 3NDBB 1HE1A 2A68F 2ZXRA 4EKWA 3AG3C 3M15A 1VLTA 1RXQA 1CGNA 4RD9A 1YVIA 1SMYF 4IGGA 1LS4A 1Q0FA 2Q9AA 4BEMJ 4JCHA 1OXKA 4EUKB 1T01A 3LS1A 2Z15A 2KNHA 1CGME 2VC9A 3GM2A 4C3DA 3EPVA 3UR3C 2DGJA 5A6JA 2ASRA 2LSEA 3LLIA 3RVYA 4I3MA 2QLAA 2Q4FA 5D92A 5CI9A 4YT5A 3ASNC 4AX2A 1EQ1A 1YAUO 3NYLA 1Z6AA 3G4XA 1BR4A 1L7CA 1Z63A 1TWCA 2YZSA 4OIPF 5A6BA 2XXAA 4PR9A 2KJGA 2R7OA 2XL4A 4ZLCA 2GA0A 2KSFA 2ZXWC 1RCPA 1BR2A 1LE2A 4CIHA 4W8KA 1L3PA 3HNJA 4FX5A 4WABA 5GPGB 1G5ZA 3EZIA 1C17M 2L6FA 2FAPB 3KKBA 5CIVA 2AU5A 4N4WA 2ETSA 3GANA 2XXAB 2BE5F 3HNKA 1JPNA 1M6TA 1OCCC 2UUHA 3PCVA 2RD9A 3SP1A 1M56C 4L6RA 5JT4A 4N6CA 3DE8A 3ZDLA 4CS9A 4IB4A 4YT4A 4ZLDA 1MQVA 1PV3A 1YDIA 2VH3A 3DD7A 4K7BA 4FESA 5T3TA 1TFOB 4I44A 2J9UA 1RMVA 1MMGA 3FVYA 4UDVA 1VTMP 4P9TA 1Z3IX 1V55C 4Z9JA 3S84A 4E17A 3AJMA 3I5PA 4QDLA 1E84A 2OCCC 2LCHA 1FAPB 3K1IA 4U5EE 3ZTZA 4AL0A 5BQHA 5JS5A 3S9OA 5JVEA 2XL6A 3S0XA 1A0BA 5AGFA 3QW1A 4U5BE 2HSQA 4JJGA 2FFHA 3N0TA 2R7UA 2QY9A 1MMNA 1WASA 1U0BB 1T6UA 1S05A 1M2OA 3M79A 5JSLA 1BDJB 3FXHA 1WTYA 1H9GA 2OKUA 3CZ6A 2HJ3A 3C63A 3FHDA 3M4CA 3G4ZA 3WG7C 3LESA 5L0JA 4O79A 2WZFA 2Q00A 3OWTA 2LK4A 5E3CA 4OIRF 4OINF 2YRFA 1UFBA 3DAGA 1ORSC 3EH2A 3TJ5A 2KW3C 3SXMA 1G8XA 2Y3BA 4MVRA 1OR3A 2ZPAA 3L1MA 2J7PD 2L7AA 4ANJA 5BQGA 5AC4A 1Q0MA 2C03A 1DOWA 2LQGA 3FDQA 5A6AA 2LP4A 3Q7LA 3VM6A 3L8JA 2J9WA 3RVZA 2Y3HA 4WGYA 4HEAJ 2D4UA 3H65A 4U5HA 2OG2A 5F28E 4JRZA 4MNDA 3US6A 2XLEA 3GWNA 1A41A 2O9XA 3ABKC 5B1AC 1VB5A 1QQ3A 3NYJA 4OIQF 1G4US 1V4AA 3W8HA 1LVKA 4J32B 3W2VA 2MHRA 2XM0A 2IXOA 3EGXA 1QKRA 4IRUA 3LEVA 1LPEA 2Q3TA 4IAOA 2GAQA 1U89A 2H7OA 1I5NA 1ZHWA 2NUPA 3IQ5A 3U8PA 4EBKA 4DOZA 2XLDA 3FAJA 3HTKC 1MNDA 4F4BA 4OIOF 3EGXB 4NC3A 3AG4C 5A6BD 3F46A 4DBRA 3U2MA 4XLNF 3U8VA 3NG1A 2A0BA 3BRJA 4JE9A 2NUPB 3M4BA 1ZVZA 1CPQA 3LJBA 4U9DA 4DVYP 4GQHA 4EBBA 5JUAA 3DKAA 3HLZA 4MS2A 1D1CA 4XTKA 4ER9A 3JCUQ 4E0HA 5DS5A 1VK5A 1RKCA 3JSZA 1NZEA 2LFDA 3O10A 2R02A 1LI7A 3KYIA 2A69F 3FOPA 3GM3A 3ZWIA 3RQFA 1VOMA 4C7OA 3GWLA 4U5DE 2J7PA 3NMJA 4HFFB 3UMKA 4QI2A 3T4RA 4YT2A 2J46A 5T3WA 3KYJA 1CGOA 1OR2A 3ZQVA 2W4MA 1NBBA 3JRMO 1FTSA 3DI5A 3DE9A 4E0IA 1E85A 4E7SA 4C7OB 1PD0A 4BJ6A 1ST6A 1H7IA 4MVOA 4MW8A 2PFDA 3AGUA 3SNHA 4P6IC 3WHNA 1RJ9A 2IM8A 2ZXPA 1VYKA 1XZQA 3O39A 3ZVRA 4CDYA 2YHSA 3L34A 4NTBA 3CEXA 1QSPA 2IXNA 2EIJC 2G62A 4J30B 3C8ZA 4PACA 4BPMA 3AQCA 2XLVA 4XPYA 3RKOF 4U5CE 5L0GA 2HS5A 3JSEO 2MWQA 4CDAA 1VYIA 4EBJA 4CIPA 3VF0A 4C3EA 1RJ9B 1OCRC 2EPOA 3QVZA 2R7SA 2YQYA 4XLPF 1HY5A 3K6BA 4N06A 5L0HA 3F47A 4YN0B 4CSAA 5F5FA 1OCZC 5KYNA 4B6IA 2Y39A 3N2ZB 1YA9A 4JTCB 2C04A 2EPKX 3WAQA 2PX0A 2JX0A 4CBEA 4MVSA 1ZW2A 3JT1A 2W9YA 2DYSC 2HV7A 2Q9BA 1H6GA 3HNIA 2YL1A 3B29A 4KNWA 5DQZA 1U6HA 3QVYA 2M64A 2OEXA 3W2WA 3ZG1A 5FCLA 1C02A 3IEEA 3T6JA 4OD5A 4A2NB 2CNWD 4W8PA 3J06A 4KBLA 2X51A 2UUIA 3C8GA 5T1DB 1QVXA 3JZ0A 4WGZA 3Q6NA 5CI8A 3RQGA 4DJ9A 1B68A 2B0JA 3NYMA 4O6NA 1FR0A 2PP4A 2NUTA 2E87A 4Q7CA 4DBQA 3TULA 2YLGA 5L3QA 5KYUA 4JEAA 4G7ZF 5EHHA 1YA7O 3ZSUA 4JW1A 3EHMA 1E2XA 1NU9C 2YKZA 3AQBA 3O55A 2DB4A 3KL4A 2YLIA 4JKVA 3A11A 4PJMA 5KYYA 1R4TA 2NUTB 2BL2A 1IZMA 3U3BA 3VYWA 3QZCA 1GS9A 4XQ1A 2P6VA 5KYUB 1XWJA 2J9BA 2VCBA 2DYRC 1LE4A 2WB7A 4K0DA 2AP3A 4RBNA 4U9EA 3GEEA 3S29A 2L6HA 3G50A 4R32A 5F5HA 5KYYB 1D0XA 3GEIA 2D5RB 3EFOA 3UGPA 2GDCA 1K05A 5A69A 1WGWA 3L8IA 1TKNA 3MYIA 1LIHA 1ZZPA 2PX3A 3RFYA 4BJTA 4DRIB 2QNLA 256BA 1JPJA 2PBEA 3U5SA 1NG1A 1BZ4A 1Z5ZA 4MTGA 5D91A 3K1HA 4CS8A 4LDKA 3DZAA 3B0VC 3EFOB 3QW0A 3IQ6A 2R05A 3T9OA 3ZTMA 1EKYA 2HFIA 1ZU5A 1KU2A 4XWJA 1NU7D 4IAQA 2KYHA 2XLHA 4MVMA 4ONSA 4IARA 4AE4A 3MYFA 4EWCA 2KC3A 2R7XA 5KYWA 4XPXA 4E7ZA 5DLJA 3POVA 2H7VC 5JLIA 4CS7A 2VCCA 2CNWA 4LACB 3SZRA 4BG0A 1HMOA 2VASA 1C03A 1KTMA 3U2LA 2OQMA 1JAFA 4DRJB 3EQLF 1J8MF 1Q0GA 5HV9A 5KYWB 3TK0A 3DM9B 1O87A 3Q6MA 1ZHXA 4M63A 4EIYA 4MVUA 3V5ZA 4AK9A 1XZPA 2R7TA 4LLCA 3ZC4A 5HSWA 3ECSA 3I4UA 4PK4A 5K0IA 1E86A 4NCQA 1OW7A 2H8AA 2KQ9A 5IY5C 1ZHYA 2EIKC 3MLGA 1TQGA 1BBHA 3RIPA 3EG9A 1NLXA 4HE8D 1TFKB 2YWAA 1D0ZA 1JMWA 1ZU4A 4JVSA 4Q4ZF 3MBGA 2F22A 1HMDA 3DAFA 3K33A 2EIMC 1MNEA 2PNOA 3C7JA 4U5FE 5B3IA 1WWPA 2JD3A 4X0RA 1SR2A 1VLSA 2L6GA 2WZLA 4RDAA 4XEVA 5L0CA 1TWAA 3EHNA 4YJWA 4NY3A 3FAPB 3EG9B 1MMAA 3NMKA 3W8IA 4CS9C 1I4ZA 4KNVA 4E18A 2IYLD 3IQCA 3OA1A 4BJ5C 2YLDA 5JRAA 3RW0A 1TWHA 1R5ID 3C8GD 3T6GB 3B9QA 4I1OB 3QTHA 5DQTA 3UMHA 3K66A 4D4XA 3SXZA 2LFFA 2AWYA 3AG2C 1CPRA 3ABMC 3K1IC 4JZAA 1YZCA 1VMAA 4XPWA 3X1OA 2A6EF 1MMDA 4YWQA 1A7DA 3N24A 3LS0A 2G3KA 2NSFA 1S7ZA 1T6QA 3H2VA 1LS1A 1O3UA 1D1BA 1AEPA 1DOVA 2EINC 3TJ6A 2GWWA 2HJMA 2HKVA 5KYXA 2W4BA 4N6HA 2HMZA 1M2VA 3U3FA 3M1CB 2VB6A 3R2PA 5L0DA 3KPHA 4JJFA 4PJNA 3S90A 3GORA 2P1AA 4FWVA 4Z9HA 5B1BC 5KYXB 1PCXA 2M4EA 1T9KA 2QTVA 3E9VA 1ZW3A 2X0CA 3TOLA 3ZQYA 2V26A 1FNTc 4YK5A 2ICWG 1OW8A 3I5QA 4I1MA 3DJUB 1QPUA 4CX9A 2PF4E 4G0HA 1HE9A 3H2UA 3ATPA 2XL8A 4MVQA 3IPMO 4JTDB 2IOQA 3O6XA 3TQOA 1V74B 2EILC 2HSBA 2KK1A 2OEVA 2P7VA 1SF8A 2KGOA 2L81A 1QZXA 2XLMA 4ULWA 2LD6A 2ZXOA 4IWBA 4DXWA 1V54C 4CJGA 2J8WA 1OKKD 1YLMA 1YARO 2CW0F 2EPMX 2Y3DA 3KH2A 2Q7RA 3TOMA 3SXKA 3U9MA 4KI2A 1NSGB 3B0PA 4H54A 5EK0A 1GM5A 1GQAA 2OJED 3GODA 4XEKA 2RSEB 3Q7GA 4MTFA 1ZHTA 2ZD9A 4YL3A 5E2QA 3UMIA 4CJOA 1OQCA 1GGQA 2A0UA 3WODF 1T5OA 2G3VA 2XS1A 4IJJA 5DS6A 2R7WA 1YJGA 3DJNB 3C8GB 3CQZA 1A7VA 3DM5A 2XLOA 2XLWA 3FMSA 3HKKA 4K1OA 3UNGC 1FMVA 4DRHB 3JRTA 2WZGA 3LLKA 2QE9A 5L0IA 2XRHA 3CAXA 3ZIBA 4KC9A 1F1MA 2CDQA 3AOUA 5TJ5E 2R7RA 3C18A 2Y69C 2CCYA 2R03A 1YZAA 4OD4A 2HUJA 4HFKB 2WVNA 2NG1A 3KMIA 2AWCA 2YEVA 4MW3A 1ORYA 4FAPB 3UGOA 1YYJA 3B71A 3CSKA 5EGYA 4BJ5A 2A1DD 4NTFA 4A4AA 3FOOA 3LNRA 5BQIA 2YL3A 3DXJF 1UG7A 1K04A 2Y3GA 1LI5A 4YL0A 1J8YF 3R7CA 2CGEA 3ABLC 3MX3A 4C3BA 1AUEA 3VAYA 5COGA 3ASOC 5COMA 3GM1A 4AL1A 2XM4A 3LUTB 4BJ6C 4YT8A 1NFNA 2I15A 2XSEA 3LEOA 4WJ0A 3TD7A 4CS8C 3NKEA 4JC7A 4EHPA 1PD1A 5E3AA 3DMDA 4J7YA 1KNYA 3PHF2 1OKKA 1EA8A 1RKEA 1Y6DA 2FGYA 3C62A 3RYLA 2GFHA 5L0FA 1K40A 2LIGA 3NKDA 2V3CC 4PFPA 1TWGA 4DVZA 5L3VA 2YVKA 2OU6A 4O6YA 1TR2A 4AE4B 1D0YA 3EH1A 1ZHZA 5AC5A 4CSAC 1RKEB 4GEHA 1NFOA 3V5XA 1SZIA 2VCAA 2J0XA 3X2QC 4QI0A 3T6BA 2Q9CA 1WOLA 1Q0DA 2J9VA 5DVWA 4J7TA 3VRCA 4G7OF 2B0HA 3EGDA 3EJNA 1OW6A 2R9RB 4ULVA 1M57C 3IQTA 1Z23A 2NPUA 2IXPA 1FFHA 2P0NA 3NRHA 2BC5A 4JCZA 1ORJA 1OXBA 4GYTA 4JEBA 4MTOA 4NQFA 1W2WA 1SYQA 3K7DA 3A9CA 1N1CA 3HJCA 4U5GA 3SYNA 2OOCA 3V7OA 3U9JA 1E83A 1WN0A 3EGDB 3AG1C 5DS4A 3U0CA 2JPUA 1BR1A 4JIOA 3W4YA 3B0UX
chains in the Genus database with same CATH topology
3ITFA 4H4KC 3SEOA 2WVOA 2MYSA 1IW7F 3OEOA 3QMKA 4Q5SF 2L9JA 4O6MA 4PJLA 2IXMA 2J0WA 1O5HA 2HV6A 3LAYA 2H7BA 4LLEA 5E33A 2WL8A 1LKXA 1QLEC 3S27A 5BUOA 4G7HF 2R7QA 2I8BA 3JYHA 3RH3A 4PFOA 1D1AA 4PJJA 2J45A 3E70C 1ZYRF 2WVQA 3PMRA 3S28A 1FMWA 2A6HF 1FFTC 3EZHA 2R7VA 1M2VB 2W45A 4JURI 4O7GA 4BEJA 3L0IA 4LERA 5B3SC 1OCOC 4MQ9F 4BJ1A 3NDBB 2A68F 2ZXRA 3AG3C 4RD9A 1SMYF 2Q9AA 4JCHA 3LS1A 2Z15A 2KNHA 4C3DA 3EPVA 3UR3C 2DGJA 2LSEA 3LLIA 4I3MA 5D92A 5CI9A 3ASNC 4AX2A 3NYLA 1Z6AA 1BR4A 1Z63A 1TWCA 2YZSA 4OIPF 2XXAA 2KJGA 2R7OA 2XL4A 4ZLCA 2ZXWC 1BR2A 4CIHA 4W8KA 4FX5A 3EZIA 3KKBA 2XXAB 3GANA 2BE5F 1JPNA 1OCCC 3SP1A 1M56C 4CS9A 4YT4A 4ZLDA 3DD7A 2VH3A 4K7BA 4FESA 5T3TA 4I44A 2J9UA 1MMGA 3FVYA 1Z3IX 1V55C 3I5PA 4QDLA 2OCCC 4U5EE 3S0XA 4U5BE 4JJGA 2FFHA 3N0TA 2R7UA 2QY9A 1MMNA 1M2OA 3FHDA 3CZ6A 3WG7C 3LESA 4O79A 2WZFA 3OWTA 5E3CA 4OIRF 4OINF 3DAGA 3EH2A 2KW3C 1G8XA 2Y3BA 2ZPAA 2J7PD 4ANJA 2C03A 3FDQA 3Q7LA 2J9WA 2Y3HA 4HEAJ 3H65A 4U5HA 2OG2A 4MNDA 2O9XA 3ABKC 5B1AC 4OIQF 3NYJA 3W8HA 1LVKA 4J32B 3W2VA 2IXOA 3EGXA 4IRUA 3LEVA 2Q3TA 4IAOA 2H7OA 2NUPA 1ZHWA 4DOZA 3FAJA 3HTKC 1MNDA 4F4BA 4OIOF 3EGXB 3AG4C 3F46A 4DBRA 4XLNF 4A2NB 3NG1A 2NUPB 3LJBA 4DVYP 4EBBA 3HLZA 1D1CA 4XTKA 5DS5A 3JCUQ 1VK5A 3JSZA 1NZEA 2A69F 4C7OA 1VOMA 4U5DE 2J7PA 4HFFB 3UMKA 3T4RA 4YT2A 2J46A 5T3WA 2W4MA 1FTSA 4E7SA 4C7OB 1PD0A 4BJ6A 1ST6A 3SNHA 2PFDA 4P6IC 3ZVRA 1RJ9A 3O39A 2ZXPA 1VYKA 2YHSA 3L34A 4CS8A 4J30B 2IXNA 2EIJC 2G62A 3AQCA 3RKOF 4U5CE 2MWQA 1VYIA 4C3EA 1RJ9B 1OCRC 2R7SA 4XLPF 3K6BA 4N06A 5F5FA 3F47A 4YN0B 4CSAA 1OCZC 5KYNA 4B6IA 2Y39A 3N2ZB 2C04A 2PX0A 4CBEA 3JT1A 2W9YA 2DYSC 2HV7A 2Q9BA 4KNWA 5DQZA 3W2WA 3ZG1A 5FCLA 3IEEA 3T6JA 4OD5A 2CNWD 4KBLA 2X51A 5T1DB 5CI8A 3Q6NA 2B0JA 4O6NA 3NYMA 2PP4A 2NUTA 2E87A 4Q7CA 4DBQA 5L3QA 5KYUA 4G7ZF 5EHHA 3ZSUA 4JW1A 3EHMA 1NU9C 3AQBA 3KL4A 4PJMA 5KYYA 2NUTB 1IZMA 3VYWA 3QZCA 3B0VC 5KYUB 2P6VA 4QI2A 2WB7A 4RBNA 2DYRC 4K0DA 3S29A 5F5HA 5KYYB 1D0XA 2D5RB 3EFOA 3UGPA 1WGWA 1TKNA 3RFYA 2PX3A 4BJTA 1JPJA 1NG1A 1Z5ZA 5D91A 3K1HA 3DZAA 3EFOB 1ZU5A 1KU2A 4XWJA 1NU7D 4AE4A 4EWCA 2R7XA 5KYWA 4E7ZA 5DLJA 3POVA 2H7VC 4CS7A 4BG0A 2CNWA 4LACB 3SZRA 2VASA 3EQLF 1J8MF 5KYWB 3DM9B 1O87A 3Q6MA 1ZHXA 4M63A 4AK9A 2R7TA 4LLCA 3ZC4A 5HSWA 3ECSA 3I4UA 4PK4A 2KQ9A 5IY5C 1ZHYA 2EIKC 3MLGA 3RIPA 3EG9A 4HE8D 1D0ZA 4JVSA 1ZU4A 4Q4ZF 3DAFA 3K33A 1MNEA 2EIMC 4U5FE 2JD3A 4X0RA 2WZLA 4RDAA 1TWAA 3EHNA 4YJWA 4NY3A 3EG9B 1MMAA 3W8IA 4CS9C 4KNVA 2IYLD 3OA1A 4BJ5C 1TWHA 3B9QA 4I1OB 5DQTA 3UMHA 3K66A 3AG2C 3ABMC 3K1IC 4JZAA 3X1OA 1VMAA 2A6EF 1MMDA 4YWQA 3N24A 3LS0A 2G3KA 1S7ZA 1LS1A 1D1BA 2EINC 5KYXA 2W4BA 1M2VA 3M1CB 2VB6A 4JJFA 4PJNA 4FWVA 5B1BC 5KYXB 1PCXA 2M4EA 2QTVA 3E9VA 2V26A 3I5QA 4I1MA 3DJUB 2PF4E 4G0HA 2IOQA 3O6XA 2EILC 2P7VA 1SF8A 2KGOA 2L81A 1QZXA 4ULWA 4IWBA 2ZXOA 1V54C 1OKKD 2CW0F 2Y3DA 3KH2A 4KI2A 3B0PA 3GODA 3Q7GA 5E2QA 1ZHTA 3UMIA 3WODF 2G3VA 5DS6A 4IJJA 2R7WA 3DJNB 3CQZA 3DM5A 3UNGC 1FMVA 3JRTA 2WZGA 3LLKA 2XRHA 3ZIBA 4KC9A 2CDQA 2R7RA 2Y69C 4OD4A 4HFKB 2WVNA 2NG1A 3KMIA 2YEVA 3UGOA 3CSKA 5EGYA 4BJ5A 2A1DD 3LNRA 3DXJF 2Y3GA 1J8YF 2CGEA 3ABLC 3MX3A 4C3BA 3VAYA 3ASOC 4BJ6C 4YT8A 2XSEA 4WJ0A 3TD7A 4CS8C 3NKEA 1PD1A 5E3AA 3DMDA 3PHF2 1OKKA 2FGYA 3RYLA 2GFHA 3NKDA 2V3CC 4PFPA 1TWGA 4DVZA 5L3VA 4O6YA 1TR2A 4AE4B 1D0YA 3EH1A 1ZHZA 4CSAC 4GEHA 1SZIA 2J0XA 3X2QC 4QI0A 3T6BA 2Q9CA 2J9VA 5DVWA 4G7OF 3EGDA 3EJNA 1M57C 1Z23A 2IXPA 3NRHA 1FFHA 4YT5A 4GYTA 3SYNA 1W2WA 3K7DA 3HJCA 1N1CA 4U5GA 3V7OA 3EGDB 3AG1C 5DS4A 1BR1A 3B0UX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NYM A; 
#chains in the Genus database with same CATH topology
 4NTA A;  1EI7 A;  1Q0K A;  3ITF A;  2NSG A;  4H4K C;  5JP7 A;  3SEO A;  2WVO A;  2MYS A;  4D4N A;  1AVO B;  1IW7 F;  1I4Y A;  3OEO A;  3QMK A;  2R25 A;  4Z9I A;  1A7E A;  1T6I A;  3BEH A;  3RF3 A;  2AVK A;  4Q5S F;  2EPL X;  2L9J A;  3GEH A;  4O6M A;  4YL1 A;  4PJL A;  2IXM A;  2J0W A;  2TMV P;  1Y4C A;  1O5H A;  4P9F A;  4XEF A;  1JR8 A;  1JOG A;  2H7B A;  2HV6 A;  3LAY A;  4LLE A;  2WL8 A;  5E33 A;  2YL0 A;  3AGT A;  3DWW A;  1G4W R;  1LKX A;  1QLE C;  2HMQ A;  3IHU A;  3S27 A;  2CYD A;  5BUO A;  2R7Q A;  2HZ8 A;  3PDM P;  1YYX A;  3NMI A;  4G7H F;  3HNL A;  1H9T A;  2IBF A;  2I8B A;  3JYH A;  1HW1 A;  3RH3 A;  4MVZ A;  4PFO A;  1D1A A;  4PJJ A;  2J45 A;  3E70 C;  5FZT A;  1HW2 A;  1WAT A;  2EPN A;  1ZYR F;  2WVQ A;  2XS8 A;  3PMR A;  4JTA B;  3JTL O;  3S28 A;  5COF A;  1FMW A;  2A6H F;  3V5Y A;  1FFT C;  5A6K A;  1JRA A;  3EZH A;  3MFN A;  1APC A;  2R7V A;  1M2V B;  2W45 A;  4JUR I;  4G78 A;  3RQE A;  4CDV A;  4O7G A;  3SXY A;  3LNM B;  3L0I A;  4LER A;  4BEJ A;  2DI3 A;  1LM3 B;  1OCO C;  3JYY A;  4LDQ A;  5B3S C;  4MQ9 F;  1Z7Q c;  2OJQ A;  2QUP A;  2YL7 A;  4BJ1 A;  2P61 A;  4LDR A;  3NDB B;  1HE1 A;  2A68 F;  2ZXR A;  4EKW A;  3AG3 C;  3M15 A;  1VLT A;  1RXQ A;  1CGN A;  4RD9 A;  1YVI A;  1SMY F;  4IGG A;  1LS4 A;  1Q0F A;  2Q9A A;  4BEM J;  4JCH A;  1OXK A;  4EUK B;  1T01 A;  3LS1 A;  2Z15 A;  2KNH A;  1CGM E;  2VC9 A;  3GM2 A;  4C3D A;  3EPV A;  3UR3 C;  2DGJ A;  5A6J A;  2ASR A;  2LSE A;  3LLI A;  3RVY A;  4I3M A;  2QLA A;  2Q4F A;  5D92 A;  5CI9 A;  4YT5 A;  3ASN C;  4AX2 A;  1EQ1 A;  1YAU O;  3NYL A;  1Z6A A;  3G4X A;  1BR4 A;  1L7C A;  1Z63 A;  1TWC A;  2YZS A;  4OIP F;  5A6B A;  2XXA A;  4PR9 A;  2KJG A;  2R7O A;  2XL4 A;  4ZLC A;  2GA0 A;  2KSF A;  2ZXW C;  1RCP A;  1BR2 A;  1LE2 A;  4CIH A;  4W8K A;  1L3P A;  3HNJ A;  4FX5 A;  4WAB A;  5GPG B;  1G5Z A;  3EZI A;  1C17 M;  2L6F A;  2FAP B;  3KKB A;  5CIV A;  2AU5 A;  4N4W A;  2ETS A;  3GAN A;  2XXA B;  2BE5 F;  3HNK A;  1JPN A;  1M6T A;  1OCC C;  2UUH A;  3PCV A;  2RD9 A;  3SP1 A;  1M56 C;  4L6R A;  5JT4 A;  4N6C A;  3DE8 A;  3ZDL A;  4CS9 A;  4IB4 A;  4YT4 A;  4ZLD A;  1MQV A;  1PV3 A;  1YDI A;  2VH3 A;  3DD7 A;  4K7B A;  4FES A;  5T3T A;  1TFO B;  4I44 A;  2J9U A;  1RMV A;  1MMG A;  3FVY A;  4UDV A;  1VTM P;  4P9T A;  1Z3I X;  1V55 C;  4Z9J A;  3S84 A;  4E17 A;  3AJM A;  3I5P A;  4QDL A;  1E84 A;  2OCC C;  2LCH A;  1FAP B;  3K1I A;  4U5E E;  3ZTZ A;  4AL0 A;  5BQH A;  5JS5 A;  3S9O A;  5JVE A;  2XL6 A;  3S0X A;  1A0B A;  5AGF A;  3QW1 A;  4U5B E;  2HSQ A;  4JJG A;  2FFH A;  3N0T A;  2R7U A;  2QY9 A;  1MMN A;  1WAS A;  1U0B B;  1T6U A;  1S05 A;  1M2O A;  3M79 A;  5JSL A;  1BDJ B;  3FXH A;  1WTY A;  1H9G A;  2OKU A;  3CZ6 A;  2HJ3 A;  3C63 A;  3FHD A;  3M4C A;  3G4Z A;  3WG7 C;  3LES A;  5L0J A;  4O79 A;  2WZF A;  2Q00 A;  3OWT A;  2LK4 A;  5E3C A;  4OIR F;  4OIN F;  2YRF A;  1UFB A;  3DAG A;  1ORS C;  3EH2 A;  3TJ5 A;  2KW3 C;  3SXM A;  1G8X A;  2Y3B A;  4MVR A;  1OR3 A;  2ZPA A;  3L1M A;  2J7P D;  2L7A A;  4ANJ A;  5BQG A;  5AC4 A;  1Q0M A;  2C03 A;  1DOW A;  2LQG A;  3FDQ A;  5A6A A;  2LP4 A;  3Q7L A;  3VM6 A;  3L8J A;  2J9W A;  3RVZ A;  2Y3H A;  4WGY A;  4HEA J;  2D4U A;  3H65 A;  4U5H A;  2OG2 A;  5F28 E;  4JRZ A;  4MND A;  3US6 A;  2XLE A;  3GWN A;  1A41 A;  2O9X A;  3ABK C;  5B1A C;  1VB5 A;  1QQ3 A;  3NYJ A;  4OIQ F;  1G4U S;  1V4A A;  3W8H A;  1LVK A;  4J32 B;  3W2V A;  2MHR A;  2XM0 A;  2IXO A;  3EGX A;  1QKR A;  4IRU A;  3LEV A;  1LPE A;  2Q3T A;  4IAO A;  2GAQ A;  1U89 A;  2H7O A;  1I5N A;  1ZHW A;  2NUP A;  3IQ5 A;  3U8P A;  4EBK A;  4DOZ A;  2XLD A;  3FAJ A;  3HTK C;  1MND A;  4F4B A;  4OIO F;  3EGX B;  4NC3 A;  3AG4 C;  5A6B D;  3F46 A;  4DBR A;  3U2M A;  4XLN F;  3U8V A;  3NG1 A;  2A0B A;  3BRJ A;  4JE9 A;  2NUP B;  3M4B A;  1ZVZ A;  1CPQ A;  3LJB A;  4U9D A;  4DVY P;  4GQH A;  4EBB A;  5JUA A;  3DKA A;  3HLZ A;  4MS2 A;  1D1C A;  4XTK A;  4ER9 A;  3JCU Q;  4E0H A;  5DS5 A;  1VK5 A;  1RKC A;  3JSZ A;  1NZE A;  2LFD A;  3O10 A;  2R02 A;  1LI7 A;  3KYI A;  2A69 F;  3FOP A;  3GM3 A;  3ZWI A;  3RQF A;  1VOM A;  4C7O A;  3GWL A;  4U5D E;  2J7P A;  3NMJ A;  4HFF B;  3UMK A;  4QI2 A;  3T4R A;  4YT2 A;  2J46 A;  5T3W A;  3KYJ A;  1CGO A;  1OR2 A;  3ZQV A;  2W4M A;  1NBB A;  3JRM O;  1FTS A;  3DI5 A;  3DE9 A;  4E0I A;  1E85 A;  4E7S A;  4C7O B;  1PD0 A;  4BJ6 A;  1ST6 A;  1H7I A;  4MVO A;  4MW8 A;  2PFD A;  3AGU A;  3SNH A;  4P6I C;  3WHN A;  1RJ9 A;  2IM8 A;  2ZXP A;  1VYK A;  1XZQ A;  3O39 A;  3ZVR A;  4CDY A;  2YHS A;  3L34 A;  4NTB A;  3CEX A;  1QSP A;  2IXN A;  2EIJ C;  2G62 A;  4J30 B;  3C8Z A;  4PAC A;  4BPM A;  3AQC A;  2XLV A;  4XPY A;  3RKO F;  4U5C E;  5L0G A;  2HS5 A;  3JSE O;  2MWQ A;  4CDA A;  1VYI A;  4EBJ A;  4CIP A;  3VF0 A;  4C3E A;  1RJ9 B;  1OCR C;  2EPO A;  3QVZ A;  2R7S A;  2YQY A;  4XLP F;  1HY5 A;  3K6B A;  4N06 A;  5L0H A;  3F47 A;  4YN0 B;  4CSA A;  5F5F A;  1OCZ C;  5KYN A;  4B6I A;  2Y39 A;  3N2Z B;  1YA9 A;  4JTC B;  2C04 A;  2EPK X;  3WAQ A;  2PX0 A;  2JX0 A;  4CBE A;  4MVS A;  1ZW2 A;  3JT1 A;  2W9Y A;  2DYS C;  2HV7 A;  2Q9B A;  1H6G A;  3HNI A;  2YL1 A;  3B29 A;  4KNW A;  5DQZ A;  1U6H A;  3QVY A;  2M64 A;  2OEX A;  3W2W A;  3ZG1 A;  5FCL A;  1C02 A;  3IEE A;  3T6J A;  4OD5 A;  4A2N B;  2CNW D;  4W8P A;  3J06 A;  4KBL A;  2X51 A;  2UUI A;  3C8G A;  5T1D B;  1QVX A;  3JZ0 A;  4WGZ A;  3Q6N A;  5CI8 A;  3RQG A;  4DJ9 A;  1B68 A;  2B0J A;  3NYM A;  4O6N A;  1FR0 A;  2PP4 A;  2NUT A;  2E87 A;  4Q7C A;  4DBQ A;  3TUL A;  2YLG A;  5L3Q A;  5KYU A;  4JEA A;  4G7Z F;  5EHH A;  1YA7 O;  3ZSU A;  4JW1 A;  3EHM A;  1E2X A;  1NU9 C;  2YKZ A;  3AQB A;  3O55 A;  2DB4 A;  3KL4 A;  2YLI A;  4JKV A;  3A11 A;  4PJM A;  5KYY A;  1R4T A;  2NUT B;  2BL2 A;  1IZM A;  3U3B A;  3VYW A;  3QZC A;  1GS9 A;  4XQ1 A;  2P6V A;  5KYU B;  1XWJ A;  2J9B A;  2VCB A;  2DYR C;  1LE4 A;  2WB7 A;  4K0D A;  2AP3 A;  4RBN A;  4U9E A;  3GEE A;  3S29 A;  2L6H A;  3G50 A;  4R32 A;  5F5H A;  5KYY B;  1D0X A;  3GEI A;  2D5R B;  3EFO A;  3UGP A;  2GDC A;  1K05 A;  5A69 A;  1WGW A;  3L8I A;  1TKN A;  3MYI A;  1LIH A;  1ZZP A;  2PX3 A;  3RFY A;  4BJT A;  4DRI B;  2QNL A;  256B A;  1JPJ A;  2PBE A;  3U5S A;  1NG1 A;  1BZ4 A;  1Z5Z A;  4MTG A;  5D91 A;  3K1H A;  4CS8 A;  4LDK A;  3DZA A;  3B0V C;  3EFO B;  3QW0 A;  3IQ6 A;  2R05 A;  3T9O A;  3ZTM A;  1EKY A;  2HFI A;  1ZU5 A;  1KU2 A;  4XWJ A;  1NU7 D;  4IAQ A;  2KYH A;  2XLH A;  4MVM A;  4ONS A;  4IAR A;  4AE4 A;  3MYF A;  4EWC A;  2KC3 A;  2R7X A;  5KYW A;  4XPX A;  4E7Z A;  5DLJ A;  3POV A;  2H7V C;  5JLI A;  4CS7 A;  2VCC A;  2CNW A;  4LAC B;  3SZR A;  4BG0 A;  1HMO A;  2VAS A;  1C03 A;  1KTM A;  3U2L A;  2OQM A;  1JAF A;  4DRJ B;  3EQL F;  1J8M F;  1Q0G A;  5HV9 A;  5KYW B;  3TK0 A;  3DM9 B;  1O87 A;  3Q6M A;  1ZHX A;  4M63 A;  4EIY A;  4MVU A;  3V5Z A;  4AK9 A;  1XZP A;  2R7T A;  4LLC A;  3ZC4 A;  5HSW A;  3ECS A;  3I4U A;  4PK4 A;  5K0I A;  1E86 A;  4NCQ A;  1OW7 A;  2H8A A;  2KQ9 A;  5IY5 C;  1ZHY A;  2EIK C;  3MLG A;  1TQG A;  1BBH A;  3RIP A;  3EG9 A;  1NLX A;  4HE8 D;  1TFK B;  2YWA A;  1D0Z A;  1JMW A;  1ZU4 A;  4JVS A;  4Q4Z F;  3MBG A;  2F22 A;  1HMD A;  3DAF A;  3K33 A;  2EIM C;  1MNE A;  2PNO A;  3C7J A;  4U5F E;  5B3I A;  1WWP A;  2JD3 A;  4X0R A;  1SR2 A;  1VLS A;  2L6G A;  2WZL A;  4RDA A;  4XEV A;  5L0C A;  1TWA A;  3EHN A;  4YJW A;  4NY3 A;  3FAP B;  3EG9 B;  1MMA A;  3NMK A;  3W8I A;  4CS9 C;  1I4Z A;  4KNV A;  4E18 A;  2IYL D;  3IQC A;  3OA1 A;  4BJ5 C;  2YLD A;  5JRA A;  3RW0 A;  1TWH A;  1R5I D;  3C8G D;  3T6G B;  3B9Q A;  4I1O B;  3QTH A;  5DQT A;  3UMH A;  3K66 A;  4D4X A;  3SXZ A;  2LFF A;  2AWY A;  3AG2 C;  1CPR A;  3ABM C;  3K1I C;  4JZA A;  1YZC A;  1VMA A;  4XPW A;  3X1O A;  2A6E F;  1MMD A;  4YWQ A;  1A7D A;  3N24 A;  3LS0 A;  2G3K A;  2NSF A;  1S7Z A;  1T6Q A;  3H2V A;  1LS1 A;  1O3U A;  1D1B A;  1AEP A;  1DOV A;  2EIN C;  3TJ6 A;  2GWW A;  2HJM A;  2HKV A;  5KYX A;  2W4B A;  4N6H A;  2HMZ A;  1M2V A;  3U3F A;  3M1C B;  2VB6 A;  3R2P A;  5L0D A;  3KPH A;  4JJF A;  4PJN A;  3S90 A;  3GOR A;  2P1A A;  4FWV A;  4Z9H A;  5B1B C;  5KYX B;  1PCX A;  2M4E A;  1T9K A;  2QTV A;  3E9V A;  1ZW3 A;  2X0C A;  3TOL A;  3ZQY A;  2V26 A;  1FNT c;  4YK5 A;  2ICW G;  1OW8 A;  3I5Q A;  4I1M A;  3DJU B;  1QPU A;  4CX9 A;  2PF4 E;  4G0H A;  1HE9 A;  3H2U A;  3ATP A;  2XL8 A;  4MVQ A;  3IPM O;  4JTD B;  2IOQ A;  3O6X A;  3TQO A;  1V74 B;  2EIL C;  2HSB A;  2KK1 A;  2OEV A;  2P7V A;  1SF8 A;  2KGO A;  2L81 A;  1QZX A;  2XLM A;  4ULW A;  2LD6 A;  2ZXO A;  4IWB A;  4DXW A;  1V54 C;  4CJG A;  2J8W A;  1OKK D;  1YLM A;  1YAR O;  2CW0 F;  2EPM X;  2Y3D A;  3KH2 A;  2Q7R A;  3TOM A;  3SXK A;  3U9M A;  4KI2 A;  1NSG B;  3B0P A;  4H54 A;  5EK0 A;  1GM5 A;  1GQA A;  2OJE D;  3GOD A;  4XEK A;  2RSE B;  3Q7G A;  4MTF A;  1ZHT A;  2ZD9 A;  4YL3 A;  5E2Q A;  3UMI A;  4CJO A;  1OQC A;  1GGQ A;  2A0U A;  3WOD F;  1T5O A;  2G3V A;  2XS1 A;  4IJJ A;  5DS6 A;  2R7W A;  1YJG A;  3DJN B;  3C8G B;  3CQZ A;  1A7V A;  3DM5 A;  2XLO A;  2XLW A;  3FMS A;  3HKK A;  4K1O A;  3UNG C;  1FMV A;  4DRH B;  3JRT A;  2WZG A;  3LLK A;  2QE9 A;  5L0I A;  2XRH A;  3CAX A;  3ZIB A;  4KC9 A;  1F1M A;  2CDQ A;  3AOU A;  5TJ5 E;  2R7R A;  3C18 A;  2Y69 C;  2CCY A;  2R03 A;  1YZA A;  4OD4 A;  2HUJ A;  4HFK B;  2WVN A;  2NG1 A;  3KMI A;  2AWC A;  2YEV A;  4MW3 A;  1ORY A;  4FAP B;  3UGO A;  1YYJ A;  3B71 A;  3CSK A;  5EGY A;  4BJ5 A;  2A1D D;  4NTF A;  4A4A A;  3FOO A;  3LNR A;  5BQI A;  2YL3 A;  3DXJ F;  1UG7 A;  1K04 A;  2Y3G A;  1LI5 A;  4YL0 A;  1J8Y F;  3R7C A;  2CGE A;  3ABL C;  3MX3 A;  4C3B A;  1AUE A;  3VAY A;  5COG A;  3ASO C;  5COM A;  3GM1 A;  4AL1 A;  2XM4 A;  3LUT B;  4BJ6 C;  4YT8 A;  1NFN A;  2I15 A;  2XSE A;  3LEO A;  4WJ0 A;  3TD7 A;  4CS8 C;  3NKE A;  4JC7 A;  4EHP A;  1PD1 A;  5E3A A;  3DMD A;  4J7Y A;  1KNY A;  3PHF 2;  1OKK A;  1EA8 A;  1RKE A;  1Y6D A;  2FGY A;  3C62 A;  3RYL A;  2GFH A;  5L0F A;  1K40 A;  2LIG A;  3NKD A;  2V3C C;  4PFP A;  1TWG A;  4DVZ A;  5L3V A;  2YVK A;  2OU6 A;  4O6Y A;  1TR2 A;  4AE4 B;  1D0Y A;  3EH1 A;  1ZHZ A;  5AC5 A;  4CSA C;  1RKE B;  4GEH A;  1NFO A;  3V5X A;  1SZI A;  2VCA A;  2J0X A;  3X2Q C;  4QI0 A;  3T6B A;  2Q9C A;  1WOL A;  1Q0D A;  2J9V A;  5DVW A;  4J7T A;  3VRC A;  4G7O F;  2B0H A;  3EGD A;  3EJN A;  1OW6 A;  2R9R B;  4ULV A;  1M57 C;  3IQT A;  1Z23 A;  2NPU A;  2IXP A;  1FFH A;  2P0N A;  3NRH A;  2BC5 A;  4JCZ A;  1ORJ A;  1OXB A;  4GYT A;  4JEB A;  4MTO A;  4NQF A;  1W2W A;  1SYQ A;  3K7D A;  3A9C A;  1N1C A;  3HJC A;  4U5G A;  3SYN A;  2OOC A;  3V7O A;  3U9J A;  1E83 A;  1WN0 A;  3EGD B;  3AG1 C;  5DS4 A;  3U0C A;  2JPU A;  1BR1 A;  4JIO A;  3W4Y A;  3B0U X; 
#chains in the Genus database with same CATH homology
 3ITF A;  4H4K C;  3SEO A;  2WVO A;  2MYS A;  1IW7 F;  3OEO A;  3QMK A;  4Q5S F;  2L9J A;  4O6M A;  4PJL A;  2IXM A;  2J0W A;  1O5H A;  2HV6 A;  3LAY A;  2H7B A;  4LLE A;  5E33 A;  2WL8 A;  1LKX A;  1QLE C;  3S27 A;  5BUO A;  4G7H F;  2R7Q A;  2I8B A;  3JYH A;  3RH3 A;  4PFO A;  1D1A A;  4PJJ A;  2J45 A;  3E70 C;  1ZYR F;  2WVQ A;  3PMR A;  3S28 A;  1FMW A;  2A6H F;  1FFT C;  3EZH A;  2R7V A;  1M2V B;  2W45 A;  4JUR I;  4O7G A;  4BEJ A;  3L0I A;  4LER A;  5B3S C;  1OCO C;  4MQ9 F;  4BJ1 A;  3NDB B;  2A68 F;  2ZXR A;  3AG3 C;  4RD9 A;  1SMY F;  2Q9A A;  4JCH A;  3LS1 A;  2Z15 A;  2KNH A;  4C3D A;  3EPV A;  3UR3 C;  2DGJ A;  2LSE A;  3LLI A;  4I3M A;  5D92 A;  5CI9 A;  3ASN C;  4AX2 A;  3NYL A;  1Z6A A;  1BR4 A;  1Z63 A;  1TWC A;  2YZS A;  4OIP F;  2XXA A;  2KJG A;  2R7O A;  2XL4 A;  4ZLC A;  2ZXW C;  1BR2 A;  4CIH A;  4W8K A;  4FX5 A;  3EZI A;  3KKB A;  2XXA B;  3GAN A;  2BE5 F;  1JPN A;  1OCC C;  3SP1 A;  1M56 C;  4CS9 A;  4YT4 A;  4ZLD A;  3DD7 A;  2VH3 A;  4K7B A;  4FES A;  5T3T A;  4I44 A;  2J9U A;  1MMG A;  3FVY A;  1Z3I X;  1V55 C;  3I5P A;  4QDL A;  2OCC C;  4U5E E;  3S0X A;  4U5B E;  4JJG A;  2FFH A;  3N0T A;  2R7U A;  2QY9 A;  1MMN A;  1M2O A;  3FHD A;  3CZ6 A;  3WG7 C;  3LES A;  4O79 A;  2WZF A;  3OWT A;  5E3C A;  4OIR F;  4OIN F;  3DAG A;  3EH2 A;  2KW3 C;  1G8X A;  2Y3B A;  2ZPA A;  2J7P D;  4ANJ A;  2C03 A;  3FDQ A;  3Q7L A;  2J9W A;  2Y3H A;  4HEA J;  3H65 A;  4U5H A;  2OG2 A;  4MND A;  2O9X A;  3ABK C;  5B1A C;  4OIQ F;  3NYJ A;  3W8H A;  1LVK A;  4J32 B;  3W2V A;  2IXO A;  3EGX A;  4IRU A;  3LEV A;  2Q3T A;  4IAO A;  2H7O A;  2NUP A;  1ZHW A;  4DOZ A;  3FAJ A;  3HTK C;  1MND A;  4F4B A;  4OIO F;  3EGX B;  3AG4 C;  3F46 A;  4DBR A;  4XLN F;  4A2N B;  3NG1 A;  2NUP B;  3LJB A;  4DVY P;  4EBB A;  3HLZ A;  1D1C A;  4XTK A;  5DS5 A;  3JCU Q;  1VK5 A;  3JSZ A;  1NZE A;  2A69 F;  4C7O A;  1VOM A;  4U5D E;  2J7P A;  4HFF B;  3UMK A;  3T4R A;  4YT2 A;  2J46 A;  5T3W A;  2W4M A;  1FTS A;  4E7S A;  4C7O B;  1PD0 A;  4BJ6 A;  1ST6 A;  3SNH A;  2PFD A;  4P6I C;  3ZVR A;  1RJ9 A;  3O39 A;  2ZXP A;  1VYK A;  2YHS A;  3L34 A;  4CS8 A;  4J30 B;  2IXN A;  2EIJ C;  2G62 A;  3AQC A;  3RKO F;  4U5C E;  2MWQ A;  1VYI A;  4C3E A;  1RJ9 B;  1OCR C;  2R7S A;  4XLP F;  3K6B A;  4N06 A;  5F5F A;  3F47 A;  4YN0 B;  4CSA A;  1OCZ C;  5KYN A;  4B6I A;  2Y39 A;  3N2Z B;  2C04 A;  2PX0 A;  4CBE A;  3JT1 A;  2W9Y A;  2DYS C;  2HV7 A;  2Q9B A;  4KNW A;  5DQZ A;  3W2W A;  3ZG1 A;  5FCL A;  3IEE A;  3T6J A;  4OD5 A;  2CNW D;  4KBL A;  2X51 A;  5T1D B;  5CI8 A;  3Q6N A;  2B0J A;  4O6N A;  3NYM A;  2PP4 A;  2NUT A;  2E87 A;  4Q7C A;  4DBQ A;  5L3Q A;  5KYU A;  4G7Z F;  5EHH A;  3ZSU A;  4JW1 A;  3EHM A;  1NU9 C;  3AQB A;  3KL4 A;  4PJM A;  5KYY A;  2NUT B;  1IZM A;  3VYW A;  3QZC A;  3B0V C;  5KYU B;  2P6V A;  4QI2 A;  2WB7 A;  4RBN A;  2DYR C;  4K0D A;  3S29 A;  5F5H A;  5KYY B;  1D0X A;  2D5R B;  3EFO A;  3UGP A;  1WGW A;  1TKN A;  3RFY A;  2PX3 A;  4BJT A;  1JPJ A;  1NG1 A;  1Z5Z A;  5D91 A;  3K1H A;  3DZA A;  3EFO B;  1ZU5 A;  1KU2 A;  4XWJ A;  1NU7 D;  4AE4 A;  4EWC A;  2R7X A;  5KYW A;  4E7Z A;  5DLJ A;  3POV A;  2H7V C;  4CS7 A;  4BG0 A;  2CNW A;  4LAC B;  3SZR A;  2VAS A;  3EQL F;  1J8M F;  5KYW B;  3DM9 B;  1O87 A;  3Q6M A;  1ZHX A;  4M63 A;  4AK9 A;  2R7T A;  4LLC A;  3ZC4 A;  5HSW A;  3ECS A;  3I4U A;  4PK4 A;  2KQ9 A;  5IY5 C;  1ZHY A;  2EIK C;  3MLG A;  3RIP A;  3EG9 A;  4HE8 D;  1D0Z A;  4JVS A;  1ZU4 A;  4Q4Z F;  3DAF A;  3K33 A;  1MNE A;  2EIM C;  4U5F E;  2JD3 A;  4X0R A;  2WZL A;  4RDA A;  1TWA A;  3EHN A;  4YJW A;  4NY3 A;  3EG9 B;  1MMA A;  3W8I A;  4CS9 C;  4KNV A;  2IYL D;  3OA1 A;  4BJ5 C;  1TWH A;  3B9Q A;  4I1O B;  5DQT A;  3UMH A;  3K66 A;  3AG2 C;  3ABM C;  3K1I C;  4JZA A;  3X1O A;  1VMA A;  2A6E F;  1MMD A;  4YWQ A;  3N24 A;  3LS0 A;  2G3K A;  1S7Z A;  1LS1 A;  1D1B A;  2EIN C;  5KYX A;  2W4B A;  1M2V A;  3M1C B;  2VB6 A;  4JJF A;  4PJN A;  4FWV A;  5B1B C;  5KYX B;  1PCX A;  2M4E A;  2QTV A;  3E9V A;  2V26 A;  3I5Q A;  4I1M A;  3DJU B;  2PF4 E;  4G0H A;  2IOQ A;  3O6X A;  2EIL C;  2P7V A;  1SF8 A;  2KGO A;  2L81 A;  1QZX A;  4ULW A;  4IWB A;  2ZXO A;  1V54 C;  1OKK D;  2CW0 F;  2Y3D A;  3KH2 A;  4KI2 A;  3B0P A;  3GOD A;  3Q7G A;  5E2Q A;  1ZHT A;  3UMI A;  3WOD F;  2G3V A;  5DS6 A;  4IJJ A;  2R7W A;  3DJN B;  3CQZ A;  3DM5 A;  3UNG C;  1FMV A;  3JRT A;  2WZG A;  3LLK A;  2XRH A;  3ZIB A;  4KC9 A;  2CDQ A;  2R7R A;  2Y69 C;  4OD4 A;  4HFK B;  2WVN A;  2NG1 A;  3KMI A;  2YEV A;  3UGO A;  3CSK A;  5EGY A;  4BJ5 A;  2A1D D;  3LNR A;  3DXJ F;  2Y3G A;  1J8Y F;  2CGE A;  3ABL C;  3MX3 A;  4C3B A;  3VAY A;  3ASO C;  4BJ6 C;  4YT8 A;  2XSE A;  4WJ0 A;  3TD7 A;  4CS8 C;  3NKE A;  1PD1 A;  5E3A A;  3DMD A;  3PHF 2;  1OKK A;  2FGY A;  3RYL A;  2GFH A;  3NKD A;  2V3C C;  4PFP A;  1TWG A;  4DVZ A;  5L3V A;  4O6Y A;  1TR2 A;  4AE4 B;  1D0Y A;  3EH1 A;  1ZHZ A;  4CSA C;  4GEH A;  1SZI A;  2J0X A;  3X2Q C;  4QI0 A;  3T6B A;  2Q9C A;  2J9V A;  5DVW A;  4G7O F;  3EGD A;  3EJN A;  1M57 C;  1Z23 A;  2IXP A;  3NRH A;  1FFH A;  4YT5 A;  4GYT A;  3SYN A;  1W2W A;  3K7D A;  3HJC A;  1N1C A;  4U5G A;  3V7O A;  3EGD B;  3AG1 C;  5DS4 A;  1BR1 A;  3B0U X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...