3QW0A

Crystal structure of the zn-ridc1 complex stabilized by bmb crosslinks
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANECKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome cb562
publication title Templated construction of a zn-selective protein dimerization motif.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 47
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3qw0A00
1YYJA 3U8PA 4CJGA 3ZWIA 3NMJA 2XM0A 2YL0A 4N6HA 4CIPA 3IQ5A 1CGOA 1NBBA 2YL1A 1GQAA 3DE9A 5JVEA 1E86A 1BBHA 3L1MA 1A7VA 2CCYA 5JSLA 2XLWA 2YL7A 3NMKA 1QQ3A 1QPUA 1E83A 5JT4A 1S05A 3VRCA 1EKYA 3ZTZA 3M15A 5AGFA 2XLHA 2YL3A 5JRAA 4CX9A 4WGYA 256BA 2XLMA 1CGNA 1JAFA 4WGZA 4CDVA 4IAQA 2J8WA 3M4CA 3NMIA 3FOOA 3QW1A 2XL6A 4U9EA 5JP7A 4ER9A 5B3IA 5JS5A 4ULVA 1YZCA 3M4BA 4CDAA 3HNLA 4CDYA 1E85A 5JUAA 3FOPA 4JE9A 1LM3B 3QW0A 3HNIA 3TOLA 4EIYA 1APCA 4CJOA 3C63A 1MQVA 3ZQYA 2YLIA 4N4WA 5JLIA 2BC5A 4IB4A 1E84A 2YKZA 3ZQVA 1RCPA 2QLAA 4IARA 1CPQA 4JEBA 4D4NA 4U9DA 2YLDA 3QVZA 1YZAA 2XLDA 2YLGA 4JEAA 3TOMA 1YYXA 3QVYA 1CPRA 3DE8A 2J9BA 3M79A 1M6TA 3C62A 2XL8A 4L6RA 3ZTMA 3HNKA 2XLEA 4D4XA 4NC3A 2XM4A 2XLOA 3IQ6A 3HNJA 2XLVA 4JKVA
chains in the Genus database with same CATH superfamily
3U8PA 3S90A 2AWYA 1HMDA 1QLEC 4CIPA 4LLEA 3M1CB 5B1BC 2Y3DA 1M56C 3ABLC 5DVWA 3SZRA 2O9XA 2CNWA 1YDIA 2OCCC 3E70C 1Z23A 5BUOA 4PJJA 2E87A 2FGYA 3RQEA 2XXAB 2VCBA 1ZW2A 4PJNA 5EK0A 1M2OA 4XPWA 4QI0A 1LE4A 4MW8A 3LEOA 2HUJA 2XLWA 4O7GA 2WVOA 1RKEB 2C03A 2P61A 4PJMA 3U8VA 2R7UA 1QQ3A 2ICWG 2V3CC 2A69F 1WN0A 2AU5A 4O79A 3GM1A 5JT4A 1S05A 1EKYA 4QDLA 3KYJA 2HSQA 5AGFA 4PJLA 1VK5A 4Z9HA 2J46A 2DYSC 1M2VB 3HLZA 2YL3A 3IEEA 2WZGA 3RYLA 5DQTA 5JRAA 4MVQA 4ANJA 4YT5A 1HW2A 3H65A 3CQZA 3JCUQ 1VLTA 1KNYA 5KYNA 1ZHZA 4W8KA 4PFOA 5L3QA 1LS1A 3FHDA 3ATPA 5A69A 3JZ0A 1LPEA 2D5RB 1ZVZA 3WAQA 2C04A 1SF8A 4EKWA 3IQCA 2DGJA 2YRFA 3S27A 2ZXWC 4M63A 1VOMA 4LLCA 5COGA 3V5XA 4OIQF 1OXKA 3MFNA 4XEFA 4H54A 4C7OB 4U5HA 1FFHA 4ULVA 4MQ9F 3ZVRA 1VB5A 1OCOC 3S9OA 3EH1A 4CDYA 2ETSA 2UUHA 5B1AC 4XLPF 3FOPA 2DB4A 4U5CE 1LM3B 2A6EF 4MTFA 3ZC4A 4EIYA 4RDAA 3LS1A 1MQVA 3WHNA 5T1DB 3RQGA 2YZSA 3DWWA 3UGPA 2P1AA 1TWAA 1FTSA 4UDVA 3U5SA 2WL8A 4JIOA 1HE9A 1ST6A 4K1OA 5JLIA 3EZIA 1Q0KA 1T6IA 4DOZA 3NDBB 2HS5A 1LKXA 3DZAA 1TR2A 2W45A 3DMDA 2OEXA 2G62A 2JX0A 2OG2A 2KNHA 4IARA 4FWVA 3DJUB 4X0RA 2NG1A 2KYHA 2AVKA 3KYIA 3AG2C 2YLDA 2W4BA 2WB7A 4EBBA 2IXNA 3PDMP 3O55A 2YWAA 4JEAA 5L0DA 2NSGA 3ABMC 4MTOA 1MMGA 1OQCA 3WG7C 2VASA 1C02A 3N0TA 4U5GA 1TWGA 2R7TA 1V54C 3OWTA 3SP1A 3IPMO 2CNWD 4DXWA 1CPRA 2R9RB 2L6GA 2Q9BA 1YJGA 1FMWA 1PD0A 1Z5ZA 3ASOC 4GQHA 4JJGA 3FXHA 3L34A 3TQOA 5KYYA 2F22A 2LFFA 3C8GA 4NTFA 2XS1A 3T6BA 3U3FA 1Z6AA 1S7ZA 2QNLA 3HNKA 3RH3A 1ORSC 2PF4E 2X0CA 3G4XA 2LCHA 3NKEA 4G78A 3ZG1A 5AC4A 1ZHWA 3NG1A 3LEVA 1OXBA 2HFIA 4N06A 1I5NA 2CYDA 2XM4A 3DAFA 5BQHA 3I5PA 1NG1A 2IXPA 2JPUA 5COFA 1EQ1A 2ZXOA 3NYJA 4KNWA 2AP3A 5A6BA 4O6MA 2A6HF 3AGTA 3VAYA 1RMVA 4E0IA 5A6JA 1YYXA 1TFOB 2KQ9A 4I1MA 2XL4A 4J7TA 2J9BA 1YYJA 4JKVA 4NCQA 4OD4A 2PNOA 3MYFA 2H7OA 2VCAA 4R32A 4CJGA 1TWCA 2B0JA 3HKKA 4JCHA 2YL0A 5EHHA 3EH2A 1WOLA 3POVA 1HE1A 2IXOA 3N24A 3RVYA 4QI2A 4P9TA 2HKVA 2P7VA 2YL1A 4CIHA 2X51A 3BEHA 1GQAA 3JYHA 1E86A 2TMVP 1OCCC 3F47A 3L1MA 2YQYA 3W2VA 1CGME 5A6KA 2OU6A 4WABA 2HMQA 4NY3A 2ZXPA 3RVZA 4OIRF 3HTKC 1PCXA 1ORJA 4DRIB 1FR0A 5KYWA 4XPYA 4B6IA 3ASNC 1MNEA 2Y3GA 3PHF2 4LDQA 4MVMA 4N6CA 1QZXA 4OINF 5L3VA 3M15A 4DBRA 4I1OB 4RBNA 1M57C 4P6IC 4BJ6A 4LDRA 5HV9A 2VH3A 2Q3TA 2HV7A 2XLHA 4C7OA 5KYYB 1V74B 4MVRA 2GDCA 3C8GB 256BA 4J32B 5FZTA 2NUTA 4XEKA 3JYYA 5BQGA 2IXMA 3FAPB 3CAXA 4FX5A 1TQGA 4JCZA 5JS5A 4BPMA 4YWQA 5CI8A 4WGZA 3U2LA 1Q0MA 4EBKA 1K04A 4G7HF 4Z9JA 3GWNA 5DS4A 3UR3C 1T6QA 4CS8C 3M4CA 2EIKC 2R05A 2WZLA 2XL6A 4U9EA 4U5BE 2YHSA 4I3MA 4ER9A 4YT8A 1DOWA 3EZHA 2B0HA 4LDKA 1LVKA 4BJ1A 1HMOA 1D0XA 4DVYP 2ASRA 1YARO 4E7SA 1BZ4A 1D1AA 2PX3A 2LSEA 3C8GD 2ZXRA 1MMDA 3CEXA 4JJFA 3V5YA 2KJGA 1A41A 3IQTA 3QW0A 1V55C 1WATA 2BE5F 2CDQA 3K1IC 3N2ZB 3S29A 4MW3A 5T3WA 1QKRA 2QTVA 2RD9A 2Y69C 3EJNA 3I5QA 4N4WA 3DI5A 2H8AA 4HFKB 4U5DE 2OQMA 3G4ZA 4YJWA 5KYXB 1IZMA 2WZFA 2HSBA 2GAQA 3KH2A 5AC5A 2FAPB 1E84A 3DJNB 1NU9C 1D1BA 4JRZA 2VCCA 1FNTc 2LQGA 1T9KA 3RIPA 2LFDA 2W4MA 3EG9A 2Q00A 4U5EE 5E33A 5T3TA 5A6BD 3EGDA 2Z15A 4JEBA 1PD1A 5KYWB 2QE9A 2R7XA 4JTCB 2Y3BA 5L0JA 1NSGB 4XTKA 1OCRC 4CS7A 1YZAA 2YLGA 1DOVA 3S0XA 4BEMJ 4ZLDA 3K7DA 3TOMA 2J7PD 3EQLF 4O6YA 1MNDA 2PFDA 3MYIA 4XQ1A 5L0FA 1XWJA 4WJ0A 1YVIA 4G7OF 4DRJB 1HY5A 1Y6DA 2NUTB 3QVYA 4HEAJ 1BR4A 1KU2A 1NLXA 3EHNA 4MVOA 4CSAC 2R25A 2H7BA 4RD9A 3WODF 1JPJA 3DKAA 2L9JA 3DM9B 3HJCA 4ONSA 2P6VA 1M6TA 3C62A 2NSFA 2XL8A 3AOUA 1Z7Qc 4IWBA 5F5FA 4JC7A 2W9YA 1Q0FA 1T5OA 2J9WA 3L8JA 1OW7A 1AUEA 1RJ9A 3LLIA 2HJMA 3SXKA 1KTMA 3KPHA 2R7QA 3GANA 5DS5A 2R7SA 4XWJA 3T9OA 4P9FA 3VM6A 3DM5A 4MVUA 2OJQA 3EFOA 3EPVA 1EI7A 3IQ6A 2XLVA 3JSZA 1O3UA 1RXQA 1Q0GA 4Q7CA 3GODA 2JD3A 4PK4A 1C03A 2VB6A 3ZWIA 3SXZA 2XM0A 4XLNF 3LNMB 1FMVA 4N6HA 2M4EA 3IQ5A 4E7ZA 4K7BA 4CS9C 1TWHA 1Y4CA 2J9UA 3E9VA 3EG9B 4IGGA 3V5ZA 4DRHB 1D0ZA 3EGDB 3I4UA 3LUTB 4BJ5A 3JRMO 4IJJA 1BR2A 3DE9A 1A7EA 1Q0DA 1R4TA 2J45A 3GEIA 1A7VA 3VYWA 1G5ZA 3U0CA 1YA9A 2YL7A 5L0IA 5BQIA 3NMKA 2D4UA 3EHMA 2Q9AA 1QPUA 1H7IA 2G3VA 5FCLA 4GEHA 2IYLD 1ZU5A 3JSEO 3Q7LA 3ZTZA 5E3CA 4EWCA 3V7OA 1MMAA 2PP4A 4A2NB 3NRHA 3LLKA 3ZIBA 3ZSUA 1NFNA 4EUKB 1UFBA 3F46A 3QTHA 3GEEA 4BG0A 4CX9A 2XLMA 3IHUA 3R2PA 5D92A 4EHPA 3U9MA 2HZ8A 1H9GA 2MHRA 2J7PA 4ULWA 1J8YF 2J0XA 3S84A 3MX3A 3SXMA 4AL0A 3CSKA 4C3EA 3H2UA 4PACA 1CGNA 1C17M 1G4WR 1RJ9B 2KC3A 3EGXB 3K33A 5KYXA 2R7WA 2MYSA 1SYQA 3O10A 2A0UA 2L6HA 3AGUA 5COMA 1XZQA 2J8WA 3SNHA 1QSPA 3NMIA 3FOOA 1ZU4A 2OEVA 5JP7A 1VLSA 4GYTA 1NU7D 2RSEB 2Q9CA 4YT2A 5B3IA 3EFOB 5EGYA 2EPLX 5F28E 3M4BA 2EILC 3HNLA 1NFOA 4C3DA 2XRHA 3TD7A 3MBGA 1OCZC 1RKCA 4JE9A 3HNIA 3TOLA 4MVSA 1APCA 1U89A 4CJOA 3X1OA 4J7YA 3ZQYA 3O6XA 3QZCA 4LERA 3S28A 1H9TA 4JZAA 5KYUA 4I44A 4KNVA 1J8MF 3BRJA 4EBJA 4DBQA 4IB4A 3A9CA 2WVNA 5D91A 1OR3A 4H4KC 4OIOF 3KMIA 1UG7A 2R02A 2QLAA 1N1CA 4LACB 4NTAA 1CPQA 3T4RA 4HE8D 1JMWA 2IM8A 2ZPAA 3AJMA 3AG1C 4JVSA 3QVZA 3FMSA 2XLDA 4MNDA 3TJ5A 2H7VC 1H6GA 1L3PA 3T6GB 4YL3A 2R7OA 4FAPB 4K0DA 4KC9A 2V26A 3B0PA 3FDQA 2KSFA 4CSAA 2IOQA 4JTAB 3W2WA 1LS4A 3C18A 1XZPA 3DE8A 3H2VA 2R03A 1W2WA 3X2QC 3U9JA 2BL2A 3AG3C 3JTLO 4E0HA 3U3BA 1OKKA 2OOCA 4E18A 4A4AA 4HFFB 3NYMA 3M79A 3SYNA 2KGOA 4YL0A 1ZHYA 4NQFA 2Q4FA 1TKNA 4DJ9A 3LNRA 3ZTMA 1U0BB 5L0HA 5E2QA 1K05A 1B68A 2P0NA 4BJ6C 2M64A 1D1CA 4AK9A 4D4XA 2R7RA 2R7VA 1JR8A 2QY9A 5DS6A 3UGOA 2YVKA 1QVXA 1Z3IX 4NTBA 1GM5A 5L0CA 4OD5A 2A0BA 4XEVA 1ZYRF 5TJ5E 3RQFA 3UMIA 2L81A 2LK4A 1HW1A 1WASA 3HNJA 5B3SC 2YEVA 3FAJA 5KYUB 3G50A 3DD7A 3NMJA 3PMRA 3RW0A 2MWQA 1SMYF 2XSEA 3L8IA 5E3AA 2I8BA 4PFPA 3SEOA 1CGOA 3MLGA 2AWCA 1NBBA 3A11A 1G8XA 1O5HA 1WTYA 3LAYA 3RKOF 2UUIA 4MTGA 2EPOA 2PBEA 3ITFA 5JVEA 1BBHA 2I15A 5L0GA 1V4AA 3UNGC 3B71A 1AVOB 1VYKA 2CCYA 1ZHXA 3EGXA 5JSLA 3FVYA 3T6JA 3UMHA 2NUPB 4C3BA 4PR9A 4CS9A 1YA7O 1E2XA 4YL1A 2EPMX 1IW7F 2EIJC 3KL4A 3O39A 2DYRC 1E83A 1FAPB 3VRCA 5GPGB 4KI2A 1EA8A 1SZIA 2Y39A 2KK1A 2LP4A 2CGEA 4AE4A 2LIGA 4WGYA 2EPNA 4Q4ZF 3OEOA 2J0WA 3TULA 3JRTA 1LIHA 4YT4A 3OA1A 4G0HA 2CW0F 1OW8A 3UMKA 3AQBA 4BJTA 4W8PA 1JAFA 2GFHA 2IBFA 4BEJA 1O87A 2FFHA 4IAQA 3U2MA 3W8IA 4CDVA 3L0IA 3AG4C 3ZDLA 1AEPA 3QW1A 4CBEA 1BR1A 5CIVA 4XPXA 1JRAA 2ZD9A 3K6BA 2EPKX 5HSWA 3PCVA 3GM2A 3VF0A 4IRUA 1YZCA 1OKKD 2A68F 2L7AA 3GM3A 4YK5A 4CDAA 1F1MA 1OW6A 2HMZA 3B9QA 3Q6NA 4MS2A 5JUAA 4AX2A 1E85A 2J9VA 3B0UX 3J06A 3C7JA 4AL1A 4JURI 2DI3A 3C63A 1MMNA 1ZW3A 2VC9A 3Q7GA 1I4ZA 1WGWA 1GGQA 1SR2A 1TFKB 1T6UA 2YLIA 2OJED 4KBLA 4MVZA 4OIPF 1LI5A 3TJ6A 2PX0A 1BDJB 1VTMP 1LE2A 4J30B 1A7DA 1VMAA 2L6FA 2G3KA 4U5FE 4F4BA 2BC5A 2EIMC 2GWWA 3W4YA 2YKZA 3CZ6A 3ZQVA 1RCPA 4Z9IA 5IY5C 1VYIA 1JPNA 1ZHTA 2Y3HA 1L7CA 2XXAA 1JOGA 4D4NA 4U9DA 2LD6A 3ABKC 1ORYA 1I4YA 3RFYA 1K40A 5K0IA 3LJBA 1GS9A 3GORA 3C8ZA 2QUPA 4E17A 3K66A 1RKEA 1Z63A 5DQZA 4AE4B 1ZZPA 4BJ5C 1YAUO 3GEHA 3TK0A 1WWPA 2KW3C 3KKBA 3B29A 4G7ZF 2A1DD 4CS8A 2HJ3A 3K1HA 4JTDB 2NPUA 3QMKA 1T01A 4Q5SF 2HV6A 1M2VA 3NKDA 3R7CA 5F5HA 2GA0A 1NZEA 2Q7RA 5DLJA 1D0YA 3LS0A 3DAGA 3NYLA 4IAOA 4L6RA 1G4US 1A0BA 2WVQA 2XLEA 4YN0B 3DXJF 4O6NA 3K1IA 1R5ID 4JW1A 3JT1A 5A6AA 3Q6MA 4NC3A 1FFTC 1PV3A 3GWLA 1OR2A 2XLOA 3RF3A 1LI7A 3US6A 2XS8A 3LESA 4FESA 3B0VC 1U6HA 2EINC 2NUPA 3SXYA 4DVZA 3ECSA 3W8HA 4ZLCA 5CI9A 2OKUA 3AQCA 1YLMA
chains in the Genus database with same CATH topology
1YYJA 3U8PA 4CJGA 3ZWIA 3NMJA 2XM0A 2YL0A 4N6HA 4CIPA 3IQ5A 1CGOA 1NBBA 2YL1A 1GQAA 3DE9A 5JVEA 1E86A 1BBHA 3L1MA 1A7VA 2CCYA 5JSLA 2XLWA 2YL7A 3NMKA 1QQ3A 1QPUA 1E83A 5JT4A 1S05A 3VRCA 1EKYA 3ZTZA 3M15A 5AGFA 2XLHA 2YL3A 5JRAA 4CX9A 4WGYA 256BA 2XLMA 1CGNA 1JAFA 4WGZA 4CDVA 4IAQA 2J8WA 3M4CA 3NMIA 3FOOA 3QW1A 2XL6A 4U9EA 5JP7A 4ER9A 5B3IA 5JS5A 4ULVA 1YZCA 3M4BA 4CDAA 3HNLA 4CDYA 1E85A 5JUAA 3FOPA 4JE9A 1LM3B 3QW0A 3HNIA 3TOLA 4EIYA 1APCA 4CJOA 3C63A 1MQVA 3ZQYA 2YLIA 4N4WA 5JLIA 2BC5A 4IB4A 1E84A 2YKZA 3ZQVA 1RCPA 2QLAA 4IARA 1CPQA 4JEBA 4D4NA 4U9DA 2YLDA 3QVZA 1YZAA 2XLDA 2YLGA 4JEAA 3TOMA 1YYXA 3QVYA 1CPRA 3DE8A 2J9BA 3M79A 1M6TA 3C62A 2XL8A 4L6RA 3ZTMA 3HNKA 2XLEA 4D4XA 4NC3A 2XM4A 2XLOA 3IQ6A 3HNJA 2XLVA 4JKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYJ A;  3U8P A;  4CJG A;  3ZWI A;  3NMJ A;  2XM0 A;  2YL0 A;  4N6H A;  4CIP A;  3IQ5 A;  1CGO A;  1NBB A;  2YL1 A;  1GQA A;  3DE9 A;  5JVE A;  1E86 A;  1BBH A;  3L1M A;  1A7V A;  2CCY A;  5JSL A;  2XLW A;  2YL7 A;  3NMK A;  1QQ3 A;  1QPU A;  1E83 A;  5JT4 A;  1S05 A;  3VRC A;  1EKY A;  3ZTZ A;  3M15 A;  5AGF A;  2XLH A;  2YL3 A;  5JRA A;  4CX9 A;  4WGY A;  256B A;  2XLM A;  1CGN A;  1JAF A;  4WGZ A;  4CDV A;  4IAQ A;  2J8W A;  3M4C A;  3NMI A;  3FOO A;  3QW1 A;  2XL6 A;  4U9E A;  5JP7 A;  4ER9 A;  5B3I A;  5JS5 A;  4ULV A;  1YZC A;  3M4B A;  4CDA A;  3HNL A;  4CDY A;  1E85 A;  5JUA A;  3FOP A;  4JE9 A;  1LM3 B;  3QW0 A;  3HNI A;  3TOL A;  4EIY A;  1APC A;  4CJO A;  3C63 A;  1MQV A;  3ZQY A;  2YLI A;  4N4W A;  5JLI A;  2BC5 A;  4IB4 A;  1E84 A;  2YKZ A;  3ZQV A;  1RCP A;  2QLA A;  4IAR A;  1CPQ A;  4JEB A;  4D4N A;  4U9D A;  2YLD A;  3QVZ A;  1YZA A;  2XLD A;  2YLG A;  4JEA A;  3TOM A;  1YYX A;  3QVY A;  1CPR A;  3DE8 A;  2J9B A;  3M79 A;  1M6T A;  3C62 A;  2XL8 A;  4L6R A;  3ZTM A;  3HNK A;  2XLE A;  4D4X A;  4NC3 A;  2XM4 A;  2XLO A;  3IQ6 A;  3HNJ A;  2XLV A;  4JKV A; 
#chains in the Genus database with same CATH topology
 3U8P A;  3S90 A;  2AWY A;  1HMD A;  1QLE C;  4CIP A;  4LLE A;  3M1C B;  5B1B C;  2Y3D A;  1M56 C;  3ABL C;  5DVW A;  3SZR A;  2O9X A;  2CNW A;  1YDI A;  2OCC C;  3E70 C;  1Z23 A;  5BUO A;  4PJJ A;  2E87 A;  2FGY A;  3RQE A;  2XXA B;  2VCB A;  1ZW2 A;  4PJN A;  5EK0 A;  1M2O A;  4XPW A;  4QI0 A;  1LE4 A;  4MW8 A;  3LEO A;  2HUJ A;  2XLW A;  4O7G A;  2WVO A;  1RKE B;  2C03 A;  2P61 A;  4PJM A;  3U8V A;  2R7U A;  1QQ3 A;  2ICW G;  2V3C C;  2A69 F;  1WN0 A;  2AU5 A;  4O79 A;  3GM1 A;  5JT4 A;  1S05 A;  1EKY A;  4QDL A;  3KYJ A;  2HSQ A;  5AGF A;  4PJL A;  1VK5 A;  4Z9H A;  2J46 A;  2DYS C;  1M2V B;  3HLZ A;  2YL3 A;  3IEE A;  2WZG A;  3RYL A;  5DQT A;  5JRA A;  4MVQ A;  4ANJ A;  4YT5 A;  1HW2 A;  3H65 A;  3CQZ A;  3JCU Q;  1VLT A;  1KNY A;  5KYN A;  1ZHZ A;  4W8K A;  4PFO A;  5L3Q A;  1LS1 A;  3FHD A;  3ATP A;  5A69 A;  3JZ0 A;  1LPE A;  2D5R B;  1ZVZ A;  3WAQ A;  2C04 A;  1SF8 A;  4EKW A;  3IQC A;  2DGJ A;  2YRF A;  3S27 A;  2ZXW C;  4M63 A;  1VOM A;  4LLC A;  5COG A;  3V5X A;  4OIQ F;  1OXK A;  3MFN A;  4XEF A;  4H54 A;  4C7O B;  4U5H A;  1FFH A;  4ULV A;  4MQ9 F;  3ZVR A;  1VB5 A;  1OCO C;  3S9O A;  3EH1 A;  4CDY A;  2ETS A;  2UUH A;  5B1A C;  4XLP F;  3FOP A;  2DB4 A;  4U5C E;  1LM3 B;  2A6E F;  4MTF A;  3ZC4 A;  4EIY A;  4RDA A;  3LS1 A;  1MQV A;  3WHN A;  5T1D B;  3RQG A;  2YZS A;  3DWW A;  3UGP A;  2P1A A;  1TWA A;  1FTS A;  4UDV A;  3U5S A;  2WL8 A;  4JIO A;  1HE9 A;  1ST6 A;  4K1O A;  5JLI A;  3EZI A;  1Q0K A;  1T6I A;  4DOZ A;  3NDB B;  2HS5 A;  1LKX A;  3DZA A;  1TR2 A;  2W45 A;  3DMD A;  2OEX A;  2G62 A;  2JX0 A;  2OG2 A;  2KNH A;  4IAR A;  4FWV A;  3DJU B;  4X0R A;  2NG1 A;  2KYH A;  2AVK A;  3KYI A;  3AG2 C;  2YLD A;  2W4B A;  2WB7 A;  4EBB A;  2IXN A;  3PDM P;  3O55 A;  2YWA A;  4JEA A;  5L0D A;  2NSG A;  3ABM C;  4MTO A;  1MMG A;  1OQC A;  3WG7 C;  2VAS A;  1C02 A;  3N0T A;  4U5G A;  1TWG A;  2R7T A;  1V54 C;  3OWT A;  3SP1 A;  3IPM O;  2CNW D;  4DXW A;  1CPR A;  2R9R B;  2L6G A;  2Q9B A;  1YJG A;  1FMW A;  1PD0 A;  1Z5Z A;  3ASO C;  4GQH A;  4JJG A;  3FXH A;  3L34 A;  3TQO A;  5KYY A;  2F22 A;  2LFF A;  3C8G A;  4NTF A;  2XS1 A;  3T6B A;  3U3F A;  1Z6A A;  1S7Z A;  2QNL A;  3HNK A;  3RH3 A;  1ORS C;  2PF4 E;  2X0C A;  3G4X A;  2LCH A;  3NKE A;  4G78 A;  3ZG1 A;  5AC4 A;  1ZHW A;  3NG1 A;  3LEV A;  1OXB A;  2HFI A;  4N06 A;  1I5N A;  2CYD A;  2XM4 A;  3DAF A;  5BQH A;  3I5P A;  1NG1 A;  2IXP A;  2JPU A;  5COF A;  1EQ1 A;  2ZXO A;  3NYJ A;  4KNW A;  2AP3 A;  5A6B A;  4O6M A;  2A6H F;  3AGT A;  3VAY A;  1RMV A;  4E0I A;  5A6J A;  1YYX A;  1TFO B;  2KQ9 A;  4I1M A;  2XL4 A;  4J7T A;  2J9B A;  1YYJ A;  4JKV A;  4NCQ A;  4OD4 A;  2PNO A;  3MYF A;  2H7O A;  2VCA A;  4R32 A;  4CJG A;  1TWC A;  2B0J A;  3HKK A;  4JCH A;  2YL0 A;  5EHH A;  3EH2 A;  1WOL A;  3POV A;  1HE1 A;  2IXO A;  3N24 A;  3RVY A;  4QI2 A;  4P9T A;  2HKV A;  2P7V A;  2YL1 A;  4CIH A;  2X51 A;  3BEH A;  1GQA A;  3JYH A;  1E86 A;  2TMV P;  1OCC C;  3F47 A;  3L1M A;  2YQY A;  3W2V A;  1CGM E;  5A6K A;  2OU6 A;  4WAB A;  2HMQ A;  4NY3 A;  2ZXP A;  3RVZ A;  4OIR F;  3HTK C;  1PCX A;  1ORJ A;  4DRI B;  1FR0 A;  5KYW A;  4XPY A;  4B6I A;  3ASN C;  1MNE A;  2Y3G A;  3PHF 2;  4LDQ A;  4MVM A;  4N6C A;  1QZX A;  4OIN F;  5L3V A;  3M15 A;  4DBR A;  4I1O B;  4RBN A;  1M57 C;  4P6I C;  4BJ6 A;  4LDR A;  5HV9 A;  2VH3 A;  2Q3T A;  2HV7 A;  2XLH A;  4C7O A;  5KYY B;  1V74 B;  4MVR A;  2GDC A;  3C8G B;  256B A;  4J32 B;  5FZT A;  2NUT A;  4XEK A;  3JYY A;  5BQG A;  2IXM A;  3FAP B;  3CAX A;  4FX5 A;  1TQG A;  4JCZ A;  5JS5 A;  4BPM A;  4YWQ A;  5CI8 A;  4WGZ A;  3U2L A;  1Q0M A;  4EBK A;  1K04 A;  4G7H F;  4Z9J A;  3GWN A;  5DS4 A;  3UR3 C;  1T6Q A;  4CS8 C;  3M4C A;  2EIK C;  2R05 A;  2WZL A;  2XL6 A;  4U9E A;  4U5B E;  2YHS A;  4I3M A;  4ER9 A;  4YT8 A;  1DOW A;  3EZH A;  2B0H A;  4LDK A;  1LVK A;  4BJ1 A;  1HMO A;  1D0X A;  4DVY P;  2ASR A;  1YAR O;  4E7S A;  1BZ4 A;  1D1A A;  2PX3 A;  2LSE A;  3C8G D;  2ZXR A;  1MMD A;  3CEX A;  4JJF A;  3V5Y A;  2KJG A;  1A41 A;  3IQT A;  3QW0 A;  1V55 C;  1WAT A;  2BE5 F;  2CDQ A;  3K1I C;  3N2Z B;  3S29 A;  4MW3 A;  5T3W A;  1QKR A;  2QTV A;  2RD9 A;  2Y69 C;  3EJN A;  3I5Q A;  4N4W A;  3DI5 A;  2H8A A;  4HFK B;  4U5D E;  2OQM A;  3G4Z A;  4YJW A;  5KYX B;  1IZM A;  2WZF A;  2HSB A;  2GAQ A;  3KH2 A;  5AC5 A;  2FAP B;  1E84 A;  3DJN B;  1NU9 C;  1D1B A;  4JRZ A;  2VCC A;  1FNT c;  2LQG A;  1T9K A;  3RIP A;  2LFD A;  2W4M A;  3EG9 A;  2Q00 A;  4U5E E;  5E33 A;  5T3T A;  5A6B D;  3EGD A;  2Z15 A;  4JEB A;  1PD1 A;  5KYW B;  2QE9 A;  2R7X A;  4JTC B;  2Y3B A;  5L0J A;  1NSG B;  4XTK A;  1OCR C;  4CS7 A;  1YZA A;  2YLG A;  1DOV A;  3S0X A;  4BEM J;  4ZLD A;  3K7D A;  3TOM A;  2J7P D;  3EQL F;  4O6Y A;  1MND A;  2PFD A;  3MYI A;  4XQ1 A;  5L0F A;  1XWJ A;  4WJ0 A;  1YVI A;  4G7O F;  4DRJ B;  1HY5 A;  1Y6D A;  2NUT B;  3QVY A;  4HEA J;  1BR4 A;  1KU2 A;  1NLX A;  3EHN A;  4MVO A;  4CSA C;  2R25 A;  2H7B A;  4RD9 A;  3WOD F;  1JPJ A;  3DKA A;  2L9J A;  3DM9 B;  3HJC A;  4ONS A;  2P6V A;  1M6T A;  3C62 A;  2NSF A;  2XL8 A;  3AOU A;  1Z7Q c;  4IWB A;  5F5F A;  4JC7 A;  2W9Y A;  1Q0F A;  1T5O A;  2J9W A;  3L8J A;  1OW7 A;  1AUE A;  1RJ9 A;  3LLI A;  2HJM A;  3SXK A;  1KTM A;  3KPH A;  2R7Q A;  3GAN A;  5DS5 A;  2R7S A;  4XWJ A;  3T9O A;  4P9F A;  3VM6 A;  3DM5 A;  4MVU A;  2OJQ A;  3EFO A;  3EPV A;  1EI7 A;  3IQ6 A;  2XLV A;  3JSZ A;  1O3U A;  1RXQ A;  1Q0G A;  4Q7C A;  3GOD A;  2JD3 A;  4PK4 A;  1C03 A;  2VB6 A;  3ZWI A;  3SXZ A;  2XM0 A;  4XLN F;  3LNM B;  1FMV A;  4N6H A;  2M4E A;  3IQ5 A;  4E7Z A;  4K7B A;  4CS9 C;  1TWH A;  1Y4C A;  2J9U A;  3E9V A;  3EG9 B;  4IGG A;  3V5Z A;  4DRH B;  1D0Z A;  3EGD B;  3I4U A;  3LUT B;  4BJ5 A;  3JRM O;  4IJJ A;  1BR2 A;  3DE9 A;  1A7E A;  1Q0D A;  1R4T A;  2J45 A;  3GEI A;  1A7V A;  3VYW A;  1G5Z A;  3U0C A;  1YA9 A;  2YL7 A;  5L0I A;  5BQI A;  3NMK A;  2D4U A;  3EHM A;  2Q9A A;  1QPU A;  1H7I A;  2G3V A;  5FCL A;  4GEH A;  2IYL D;  1ZU5 A;  3JSE O;  3Q7L A;  3ZTZ A;  5E3C A;  4EWC A;  3V7O A;  1MMA A;  2PP4 A;  4A2N B;  3NRH A;  3LLK A;  3ZIB A;  3ZSU A;  1NFN A;  4EUK B;  1UFB A;  3F46 A;  3QTH A;  3GEE A;  4BG0 A;  4CX9 A;  2XLM A;  3IHU A;  3R2P A;  5D92 A;  4EHP A;  3U9M A;  2HZ8 A;  1H9G A;  2MHR A;  2J7P A;  4ULW A;  1J8Y F;  2J0X A;  3S84 A;  3MX3 A;  3SXM A;  4AL0 A;  3CSK A;  4C3E A;  3H2U A;  4PAC A;  1CGN A;  1C17 M;  1G4W R;  1RJ9 B;  2KC3 A;  3EGX B;  3K33 A;  5KYX A;  2R7W A;  2MYS A;  1SYQ A;  3O10 A;  2A0U A;  2L6H A;  3AGU A;  5COM A;  1XZQ A;  2J8W A;  3SNH A;  1QSP A;  3NMI A;  3FOO A;  1ZU4 A;  2OEV A;  5JP7 A;  1VLS A;  4GYT A;  1NU7 D;  2RSE B;  2Q9C A;  4YT2 A;  5B3I A;  3EFO B;  5EGY A;  2EPL X;  5F28 E;  3M4B A;  2EIL C;  3HNL A;  1NFO A;  4C3D A;  2XRH A;  3TD7 A;  3MBG A;  1OCZ C;  1RKC A;  4JE9 A;  3HNI A;  3TOL A;  4MVS A;  1APC A;  1U89 A;  4CJO A;  3X1O A;  4J7Y A;  3ZQY A;  3O6X A;  3QZC A;  4LER A;  3S28 A;  1H9T A;  4JZA A;  5KYU A;  4I44 A;  4KNV A;  1J8M F;  3BRJ A;  4EBJ A;  4DBQ A;  4IB4 A;  3A9C A;  2WVN A;  5D91 A;  1OR3 A;  4H4K C;  4OIO F;  3KMI A;  1UG7 A;  2R02 A;  2QLA A;  1N1C A;  4LAC B;  4NTA A;  1CPQ A;  3T4R A;  4HE8 D;  1JMW A;  2IM8 A;  2ZPA A;  3AJM A;  3AG1 C;  4JVS A;  3QVZ A;  3FMS A;  2XLD A;  4MND A;  3TJ5 A;  2H7V C;  1H6G A;  1L3P A;  3T6G B;  4YL3 A;  2R7O A;  4FAP B;  4K0D A;  4KC9 A;  2V26 A;  3B0P A;  3FDQ A;  2KSF A;  4CSA A;  2IOQ A;  4JTA B;  3W2W A;  1LS4 A;  3C18 A;  1XZP A;  3DE8 A;  3H2V A;  2R03 A;  1W2W A;  3X2Q C;  3U9J A;  2BL2 A;  3AG3 C;  3JTL O;  4E0H A;  3U3B A;  1OKK A;  2OOC A;  4E18 A;  4A4A A;  4HFF B;  3NYM A;  3M79 A;  3SYN A;  2KGO A;  4YL0 A;  1ZHY A;  4NQF A;  2Q4F A;  1TKN A;  4DJ9 A;  3LNR A;  3ZTM A;  1U0B B;  5L0H A;  5E2Q A;  1K05 A;  1B68 A;  2P0N A;  4BJ6 C;  2M64 A;  1D1C A;  4AK9 A;  4D4X A;  2R7R A;  2R7V A;  1JR8 A;  2QY9 A;  5DS6 A;  3UGO A;  2YVK A;  1QVX A;  1Z3I X;  4NTB A;  1GM5 A;  5L0C A;  4OD5 A;  2A0B A;  4XEV A;  1ZYR F;  5TJ5 E;  3RQF A;  3UMI A;  2L81 A;  2LK4 A;  1HW1 A;  1WAS A;  3HNJ A;  5B3S C;  2YEV A;  3FAJ A;  5KYU B;  3G50 A;  3DD7 A;  3NMJ A;  3PMR A;  3RW0 A;  2MWQ A;  1SMY F;  2XSE A;  3L8I A;  5E3A A;  2I8B A;  4PFP A;  3SEO A;  1CGO A;  3MLG A;  2AWC A;  1NBB A;  3A11 A;  1G8X A;  1O5H A;  1WTY A;  3LAY A;  3RKO F;  2UUI A;  4MTG A;  2EPO A;  2PBE A;  3ITF A;  5JVE A;  1BBH A;  2I15 A;  5L0G A;  1V4A A;  3UNG C;  3B71 A;  1AVO B;  1VYK A;  2CCY A;  1ZHX A;  3EGX A;  5JSL A;  3FVY A;  3T6J A;  3UMH A;  2NUP B;  4C3B A;  4PR9 A;  4CS9 A;  1YA7 O;  1E2X A;  4YL1 A;  2EPM X;  1IW7 F;  2EIJ C;  3KL4 A;  3O39 A;  2DYR C;  1E83 A;  1FAP B;  3VRC A;  5GPG B;  4KI2 A;  1EA8 A;  1SZI A;  2Y39 A;  2KK1 A;  2LP4 A;  2CGE A;  4AE4 A;  2LIG A;  4WGY A;  2EPN A;  4Q4Z F;  3OEO A;  2J0W A;  3TUL A;  3JRT A;  1LIH A;  4YT4 A;  3OA1 A;  4G0H A;  2CW0 F;  1OW8 A;  3UMK A;  3AQB A;  4BJT A;  4W8P A;  1JAF A;  2GFH A;  2IBF A;  4BEJ A;  1O87 A;  2FFH A;  4IAQ A;  3U2M A;  3W8I A;  4CDV A;  3L0I A;  3AG4 C;  3ZDL A;  1AEP A;  3QW1 A;  4CBE A;  1BR1 A;  5CIV A;  4XPX A;  1JRA A;  2ZD9 A;  3K6B A;  2EPK X;  5HSW A;  3PCV A;  3GM2 A;  3VF0 A;  4IRU A;  1YZC A;  1OKK D;  2A68 F;  2L7A A;  3GM3 A;  4YK5 A;  4CDA A;  1F1M A;  1OW6 A;  2HMZ A;  3B9Q A;  3Q6N A;  4MS2 A;  5JUA A;  4AX2 A;  1E85 A;  2J9V A;  3B0U X;  3J06 A;  3C7J A;  4AL1 A;  4JUR I;  2DI3 A;  3C63 A;  1MMN A;  1ZW3 A;  2VC9 A;  3Q7G A;  1I4Z A;  1WGW A;  1GGQ A;  1SR2 A;  1TFK B;  1T6U A;  2YLI A;  2OJE D;  4KBL A;  4MVZ A;  4OIP F;  1LI5 A;  3TJ6 A;  2PX0 A;  1BDJ B;  1VTM P;  1LE2 A;  4J30 B;  1A7D A;  1VMA A;  2L6F A;  2G3K A;  4U5F E;  4F4B A;  2BC5 A;  2EIM C;  2GWW A;  3W4Y A;  2YKZ A;  3CZ6 A;  3ZQV A;  1RCP A;  4Z9I A;  5IY5 C;  1VYI A;  1JPN A;  1ZHT A;  2Y3H A;  1L7C A;  2XXA A;  1JOG A;  4D4N A;  4U9D A;  2LD6 A;  3ABK C;  1ORY A;  1I4Y A;  3RFY A;  1K40 A;  5K0I A;  3LJB A;  1GS9 A;  3GOR A;  3C8Z A;  2QUP A;  4E17 A;  3K66 A;  1RKE A;  1Z63 A;  5DQZ A;  4AE4 B;  1ZZP A;  4BJ5 C;  1YAU O;  3GEH A;  3TK0 A;  1WWP A;  2KW3 C;  3KKB A;  3B29 A;  4G7Z F;  2A1D D;  4CS8 A;  2HJ3 A;  3K1H A;  4JTD B;  2NPU A;  3QMK A;  1T01 A;  4Q5S F;  2HV6 A;  1M2V A;  3NKD A;  3R7C A;  5F5H A;  2GA0 A;  1NZE A;  2Q7R A;  5DLJ A;  1D0Y A;  3LS0 A;  3DAG A;  3NYL A;  4IAO A;  4L6R A;  1G4U S;  1A0B A;  2WVQ A;  2XLE A;  4YN0 B;  3DXJ F;  4O6N A;  3K1I A;  1R5I D;  4JW1 A;  3JT1 A;  5A6A A;  3Q6M A;  4NC3 A;  1FFT C;  1PV3 A;  3GWL A;  1OR2 A;  2XLO A;  3RF3 A;  1LI7 A;  3US6 A;  2XS8 A;  3LES A;  4FES A;  3B0V C;  1U6H A;  2EIN C;  2NUP A;  3SXY A;  4DVZ A;  3ECS A;  3W8H A;  4ZLC A;  5CI9 A;  2OKU A;  3AQC A;  1YLM A; 
#chains in the Genus database with same CATH homology
 1YYJ A;  3U8P A;  4CJG A;  3ZWI A;  3NMJ A;  2XM0 A;  2YL0 A;  4N6H A;  4CIP A;  3IQ5 A;  1CGO A;  1NBB A;  2YL1 A;  1GQA A;  3DE9 A;  5JVE A;  1E86 A;  1BBH A;  3L1M A;  1A7V A;  2CCY A;  5JSL A;  2XLW A;  2YL7 A;  3NMK A;  1QQ3 A;  1QPU A;  1E83 A;  5JT4 A;  1S05 A;  3VRC A;  1EKY A;  3ZTZ A;  3M15 A;  5AGF A;  2XLH A;  2YL3 A;  5JRA A;  4CX9 A;  4WGY A;  256B A;  2XLM A;  1CGN A;  1JAF A;  4WGZ A;  4CDV A;  4IAQ A;  2J8W A;  3M4C A;  3NMI A;  3FOO A;  3QW1 A;  2XL6 A;  4U9E A;  5JP7 A;  4ER9 A;  5B3I A;  5JS5 A;  4ULV A;  1YZC A;  3M4B A;  4CDA A;  3HNL A;  4CDY A;  1E85 A;  5JUA A;  3FOP A;  4JE9 A;  1LM3 B;  3QW0 A;  3HNI A;  3TOL A;  4EIY A;  1APC A;  4CJO A;  3C63 A;  1MQV A;  3ZQY A;  2YLI A;  4N4W A;  5JLI A;  2BC5 A;  4IB4 A;  1E84 A;  2YKZ A;  3ZQV A;  1RCP A;  2QLA A;  4IAR A;  1CPQ A;  4JEB A;  4D4N A;  4U9D A;  2YLD A;  3QVZ A;  1YZA A;  2XLD A;  2YLG A;  4JEA A;  3TOM A;  1YYX A;  3QVY A;  1CPR A;  3DE8 A;  2J9B A;  3M79 A;  1M6T A;  3C62 A;  2XL8 A;  4L6R A;  3ZTM A;  3HNK A;  2XLE A;  4D4X A;  4NC3 A;  2XM4 A;  2XLO A;  3IQ6 A;  3HNJ A;  2XLV A;  4JKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...