3QW0A

Crystal structure of the zn-ridc1 complex stabilized by bmb crosslinks
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANECKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome cb562
publication title Templated construction of a zn-selective protein dimerization motif.
pubmed doi rcsb
source organism Escherichia coli
total genus 47
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3qw0A00
3NMJA 4CJOA 3M15A 3IQ6A 3HNJA 5JLIA 3ZTZA 3DE8A 3QVYA 5JT4A 3IQ5A 2J9BA 3NMIA 3ZTMA 5JRAA 4U9EA 1YZAA 1JAFA 1CPRA 5B3IA 1QPUA 1YZCA 1CGNA 4L6RA 2XL8A 1E86A 3HNIA 3L1MA 2QLAA 4CDYA 4N4WA 5JP7A 3ZQYA 4IB4A 2YL0A 1QQ3A 3M4BA 4JE9A 1E84A 3QVZA 4JEBA 3DE9A 2YLDA 1CPQA 1E83A 4JEAA 3U8PA 1EKYA 5JVEA 2YL3A 3QW0A 3C63A 3FOPA 1A7VA 2J8WA 2XLOA 2XLVA 4IAQA 2XM4A 4D4XA 4CX9A 1MQVA 2XLEA 256BA 1S05A 4ULVA 3TOMA 5JUAA 4WGZA 4IARA 5AGFA 4U9DA 1GQAA 2XL6A 2XLWA 4CDAA 2YL7A 1YYJA 3VRCA 4EIYA 3M79A 2BC5A 3NMKA 3M4CA 2YL1A 1YYXA 2YLIA 3ZQVA 2XM0A 3QW1A 4N6HA 4D4NA 3TOLA 1CGOA 5JSLA 5JS5A 1M6TA 4CDVA 3HNKA 1LM3B 4ER9A 2YLGA 4NC3A 1BBHA 1APCA 2YKZA 3ZWIA 3C62A 4CIPA 1RCPA 2XLDA 2CCYA 1NBBA 4WGYA 3FOOA 4CJGA 2XLHA 1E85A 4JKVA 2XLMA 3HNLA
chains in the Genus database with same CATH superfamily
2Q9BA 3N24A 1C03A 3RH3A 3DM5A 4HE8D 4YWQA 1I4YA 2EINC 2NUPA 3DJUB 3IQ6A 1V54C 1AVOB 4GYTA 1NFOA 3ZTZA 1QVXA 1OCZC 3H2VA 4RBNA 1T6QA 2HKVA 3QVYA 1ZHYA 1Y4CA 2HUJA 4NTFA 5BQHA 1SMYF 1DOWA 4MNDA 1H6GA 4KNVA 3V5XA 2WVOA 3DXJF 2XS8A 2LCHA 3RIPA 2IYLD 1YA9A 5JRAA 5L0HA 1U0BB 3NKDA 4BJ6C 4DXWA 1YZAA 5BUOA 3CSKA 2L6FA 1BR4A 3CZ6A 3DM9B 4U5FE 3LEVA 4AE4B 1QPUA 1YZCA 3LS1A 1CGME 2HS5A 4L6RA 2H7OA 2AVKA 3US6A 1BDJB 3FXHA 2XL8A 4LDKA 1E86A 1VYIA 1GS9A 1L3PA 2PF4E 3EG9A 3GWLA 4JC7A 4JTCB 2J45A 5JP7A 2GWWA 4PJNA 3ZQYA 5A6BD 2X51A 5KYUA 2YL0A 1YJGA 1LI5A 3NKEA 2NUTA 3U2LA 3ZVRA 3KKBA 3SP1A 2J0WA 2B0JA 1ZHWA 1TQGA 1CPQA 3ASOC 2QY9A 2MYSA 3ABMC 4JTDB 5DLJA 3F47A 3S28A 2DB4A 4JCHA 1ZZPA 4OD4A 3DAFA 4OD5A 2R7TA 1A0BA 4MW3A 1YLMA 5EHHA 4C3EA 4YT8A 3IEEA 3QMKA 3UMHA 1BZ4A 1I5NA 2XM4A 3GM1A 2HSQA 3JTLO 4JZAA 5B1BC 2QTVA 4IWBA 2WVQA 1OXKA 3OEOA 5EGYA 2XLEA 2O9XA 3A11A 5AC5A 2EIMC 2FGYA 4F4BA 4QDLA 3UR3C 1M56C 3EJNA 3FVYA 5DQTA 2WZFA 2EPOA 2ASRA 4N06A 3TOMA 4DRHB 1RKEB 2Y69C 3JRMO 3VYWA 2NG1A 1XZQA 2P1AA 3LLIA 4NTBA 1TWHA 4PFOA 1H9GA 2G3KA 3PHF2 4IARA 2AWYA 1ZU5A 4WJ0A 4G7HF 5KYYA 2MWQA 2OJED 1GQAA 5KYNA 2Z15A 2KNHA 3O6XA 3U2MA 4CDAA 3KMIA 4CS7A 2R7XA 1LPEA 1YYJA 4A2NB 4O6MA 2P0NA 4NCQA 5KYXB 2UUIA 1YAUO 3M79A 3S27A 2IXNA 1NFNA 1V55C 2J9VA 2RSEB 1YYXA 4N6CA 4E7ZA 3FAJA 1J8MF 3ZQVA 1O87A 3GM3A 1ZHXA 4FX5A 4N6HA 3SXZA 3TOLA 1T6UA 1GM5A 2EPLX 1M2VA 2WL8A 1CGOA 2L81A 5JSLA 3I4UA 1TFKB 3GWNA 4P6IC 2C04A 3GM2A 4NC3A 1BBHA 5COFA 3KL4A 3T6BA 1T5OA 2AP3A 2AWCA 2YKZA 3GEIA 3Q6NA 4H54A 3IHUA 3ZWIA 1WTYA 2LK4A 1SF8A 3OA1A 1RCPA 3B71A 2XLDA 5B3SC 2CCYA 1MMNA 3RFYA 3L0IA 2NSFA 1TWCA 3M1CB 2R9RB 1PV3A 2LSEA 3CAXA 3JRTA 3NG1A 4YT2A 5BQIA 1NU7D 2XLHA 1HMOA 4CJGA 4O6YA 4OIPF 1V4AA 4NTAA 3TD7A 1G5ZA 1O5HA 1U89A 1RKEA 3H65A 4CS9C 1MNEA 3TJ5A 1MMGA 1A41A 1QZXA 1VLTA 2OOCA 2PFDA 2VB6A 4BJ5A 3POVA 3U3BA 3RYLA 3EH1A 4DBQA 4G7OF 2OJQA 1VOMA 5DS5A 5IY5C 3LAYA 4CJOA 3M15A 1HE9A 4U5CE 2A0BA 2JD3A 1FFTC 1KNYA 1OW6A 2OCCC 3EPVA 1NLXA 4YJWA 4EKWA 4JIOA 5JLIA 1OQCA 1FTSA 4HFFB 3DE8A 1EQ1A 4MTGA 3RKOF 5F5HA 4WABA 4CSAC 2Y3HA 5COMA 3SEOA 2KJGA 5JT4A 1ORYA 2VC9A 1K05A 2OU6A 3EG9B 1HE1A 3LJBA 3UNGC 1FNTc 2J9BA 2KQ9A 2WZLA 2J7PA 3NMIA 5KYUB 1RXQA 2PBEA 2NUTB 2QE9A 4C3BA 3HLZA 2DGJA 2W9YA 4IJJA 3I5PA 1TKNA 4U9EA 4PK4A 4MS2A 4MVSA 3U5SA 1CPRA 1WGWA 3F46A 2KW3C 3ZSUA 4CS8A 4EWCA 1JPNA 2OG2A 3K1IA 3V5ZA 1D1AA 4O7GA 4FAPB 1VMAA 2R7QA 4M63A 2ETSA 1YDIA 3ASNC 4UDVA 2LFFA 5CI9A 3WHNA 4MQ9F 1XZPA 1TWAA 3U9JA 2A68F 3MBGA 1IW7F 3O55A 1ZHTA 2Y3GA 1D1BA 1G8XA 1QQ3A 2J7PD 3M4BA 2R7RA 4JE9A 1ORSC 3LNMB 3RQFA 1E84A 3AGUA 3IQTA 4C3DA 1FMVA 4JW1A 1T01A 4PR9A 1E83A 4G0HA 3DMDA 2W4BA 4BG0A 5A6BA 4GEHA 3L34A 1OW8A 4AL1A 5JVEA 3UGPA 1WASA 2Y3DA 5BQGA 1OKKD 2W4MA 1MNDA 2Y3BA 2XLOA 3FHDA 4ZLDA 3W8IA 2HV6A 2HJ3A 5KYYB 3Q7GA 2D4UA 2EILC 1EA8A 1OR3A 1MQVA 1Q0KA 1Z6AA 4LERA 2L7AA 3J06A 3S90A 3EGDA 1QLEC 1AUEA 1MMDA 4P9FA 1A7EA 1JPJA 1RKCA 3A9CA 4ULWA 3VM6A 4QI0A 1ZVZA 1OCOC 2F22A 2PX3A 2HV7A 5TJ5E 2OEVA 3RVZA 4Z9IA 1S7ZA 2M4EA 3JYHA 4WGZA 4XQ1A 1NG1A 5AGFA 1Z23A 1LKXA 2ICWG 3UMIA 1M2VB 2XLWA 1M2OA 1OCRC 1WATA 2J9UA 2KGOA 2YL7A 3GANA 3MLGA 4LLEA 1ZYRF 2HZ8A 4CBEA 2GA0A 3EQLF 4XEFA 2OQMA 2EIKC 3NYJA 2Q00A 3VRCA 3W2VA 3ZG1A 4EIYA 2BC5A 2HMQA 2VCCA 3N0TA 2YL1A 1ORJA 5GPGB 3TULA 1BR1A 2R7OA 1F1MA 1LVKA 1VB5A 2YLIA 4BJTA 3Q7LA 1T9KA 3RQGA 2W45A 3AGTA 4D4NA 1C17M 4DOZA 2AU5A 2P61A 2GFHA 5JS5A 3MYFA 2XXAA 1M6TA 1OXBA 2DYSC 2P7VA 4LACB 4W8KA 3LNRA 4BEJA 1AEPA 3SXKA 4E0IA 5A6KA 5K0IA 2WZGA 3T6GB 5A6JA 4J7YA 4YN0B 2A1DD 2XSEA 3T4RA 1I4ZA 2BL2A 5L3VA 2Q9AA 3C62A 4BJ6A 4CIPA 2YQYA 3CQZA 2LIGA 3LESA 5A6AA 4Q7CA 4R32A 1D0XA 3K33A 1PCXA 4IGGA 3ZIBA 3GODA 3AG2C 3V5YA 4WGYA 3ZC4A 4E7SA 2J46A 3FOOA 1H9TA 3RF3A 1ZHZA 3CEXA 3FAPB 4XWJA 4AK9A 4I1OB 3HNLA 3C8GA 4J30B 4EUKB 1JR8A 4JRZA 3NMJA 4K1OA 5FZTA 3T9OA 3EZHA 4LLCA 3U8VA 1ZW3A 5L3QA 3JSZA 4RDAA 3VAYA 1W2WA 2PX0A 3DI5A 3R7CA 4DVYP 4U5EE 2HJMA 4A4AA 5E2QA 1VTMP 1KTMA 4EBJA 2MHRA 2C03A 1WOLA 3ATPA 4Z9JA 5KYWB 3AQCA 3E70C 1SZIA 2CNWA 3C8GD 4I44A 1FFHA 2YEVA 1H7IA 3ZTMA 3O10A 1L7CA 3W8HA 2A6EF 2B0HA 4PJMA 2ZPAA 3PCVA 3RW0A 3GORA 1CGNA 4MVZA 4U5DE 3B9QA 2IXMA 2CW0F 4B6IA 2V3CC 2M64A 2RD9A 4O79A 3EGXA 2QLAA 3WAQA 4N4WA 4MVRA 1M57C 2CNWD 4CS8C 3ABKC 4IB4A 1SR2A 2R03A 1LI7A 2Q4FA 3JSEO 2IXOA 3WG7C 2EPNA 3IPMO 3LEOA 3NRHA 3EGDB 3QZCA 2Q7RA 1YVIA 2R05A 1RJ9A 3DE9A 2YLDA 3EZIA 4LDQA 2YWAA 3S9OA 2ZXRA 3ABLC 3JCUQ 2YL3A 3ECSA 1A7VA 2J8WA 1LS1A 2G3VA 3JT1A 1Q0MA 4XLPF 2LQGA 4DVZA 3SYNA 4IAQA 3X1OA 1Q0FA 2V26A 3KPHA 3E9VA 2FAPB 2LP4A 4CX9A 2X0CA 5DS6A 1WN0A 3K66A 3GEHA 256BA 2KC3A 2TMVP 1ZU4A 4NQFA 4W8PA 1OKKA 4K0DA 1VK5A 4J7TA 2YZSA 3DAGA 3KYIA 5KYWA 4ULVA 4AL0A 1Z7Qc 4JCZA 3V7OA 2R7VA 4PFPA 2DI3A 5DQZA 3EFOA 4I3MA 3GEEA 4Z9HA 5L0DA 2OKUA 5T3TA 3B0PA 3BEHA 1EI7A 4YK5A 1Q0DA 3AOUA 2H8AA 4U9DA 2XL6A 1O3UA 2LD6A 3G50A 4JURI 4LDRA 3SZRA 3FMSA 2XXAB 1PD0A 4YT5A 2VH3A 4CS9A 5DS4A 2L6GA 1QKRA 2I8BA 3C7JA 2JX0A 2HSBA 4YT4A 2XS1A 5B1AC 3QTHA 4PACA 2HFIA 3AG3C 4XLNF 3S29A 5L0FA 4MW8A 1Q0GA 2JPUA 2LFDA 3NDBB 3PMRA 3RQEA 4PJLA 4YL1A 1HW1A 4CSAA 1J8YF 2YHSA 3DD7A 4CDYA 2YLGA 3L8JA 1LIHA 3VF0A 3B29A 3N2ZB 1G4US 3C8GB 2CDQA 3Q6MA 2EPKX 5COGA 4YL3A 4E0HA 1ZW2A 2R02A 4MVMA 1T6IA 4GQHA 3U9MA 4HFKB 4EBKA 1NBBA 3MX3A 2E87A 1R4TA 2WB7A 2XL4A 3NYMA 5D92A 1K04A 5E3CA 4KI2A 2R7SA 2IOQA 2H7BA 3B0UX 1HY5A 1A7DA 1BR2A 3TK0A 1E85A 4OIQF 4JKVA 1XWJA 2CGEA 2XLMA 5FCLA 1R5ID 3SXMA 1TWGA 3AJMA 4MVOA 3X2QC 1Z63A 5CIVA 3T6JA 3MYIA 2A0UA 4JVSA 1RMVA 3HKKA 2A6HF 4FWVA 4JJFA 4DBRA 2OEXA 2VASA 3HNJA 4XPWA 4EHPA 4AX2A 3JZ0A 5L0JA 4C7OA 1QSPA 1TFOB 2YRFA 2D5RB 3C18A 2I15A 4NY3A 4KC9A 4JJGA 3UMKA 3EGXB 1OW7A 2GDCA 4IRUA 1NU9C 2KK1A 3IQ5A 4BEMJ 4DRIB 5A69A 2A69F 1Z3IX 4PJJA 3DZAA 4K7BA 4HEAJ 4OINF 1VYKA 1YA7O 4ZLCA 5CI8A 3C8ZA 1NZEA 4Q4ZF 1JRAA 1JAFA 1FAPB 5D91A 2HMZA 1RJ9B 5B3IA 4G7ZF 2R25A 4BJ1A 1D1CA 4CIHA 1YARO 2ZXWC 2H7VC 2KYHA 1FMWA 3HNIA 3L1MA 3LLKA 2PP4A 2Y39A 2IXPA 1B68A 5E33A 3DJNB 2DYRC 1U6HA 2IBFA 5L0GA 1GGQA 4BJ5C 4P9TA 1DOVA 3QVZA 4J32B 4JEBA 1LE2A 3S84A 4AE4A 2QUPA 2Q3TA 2EIJC 3PDMP 5L0CA 1SYQA 3AQBA 4JEAA 1LS4A 3U8PA 1UFBA 2WVNA 3AG1C 4RD9A 4U5GA 1EKYA 3QW0A 4JTAB 3C63A 3FOPA 2CYDA 2FFHA 3EFOB 3L8IA 3H2UA 5HSWA 2ZD9A 1VLSA 2XLVA 1D0ZA 2L9JA 3IQCA 2XRHA 4KNWA 3OWTA 3K6BA 4D4XA 3U0CA 1Z5ZA 3FDQA 3UGOA 1LE4A 2PNOA 1G4WR 3EHMA 3O39A 4EBBA 1Y6DA 4MVQA 1S05A 2YVKA 3LS0A 5AC4A 4MTOA 5EK0A 3G4ZA 3K7DA 1UG7A 4X0RA 5JUAA 4OIRF 3K1IC 3R2PA 3TJ6A 2J9WA 2ZXOA 4FESA 4U5HA 2L6HA 3JYYA 4XPYA 5HV9A 3LUTB 4XEVA 4ANJA 2NUPB 5E3AA 4DRJB 1V74B 2VCAA 4XEKA 3B0VC 1KU2A 4U5BE 1HW2A 3NMKA 3M4CA 3K1HA 3ZDLA 4Q5SF 2KSFA 2NPUA 1C02A 4IAOA 1NSGB 2ZXPA 4ONSA 4XPXA 4DJ9A 1IZMA 2R7WA 2EPMX 4YL0A 2XM0A 3QW1A 3SNHA 4E17A 3RVYA 3HJCA 3AG4C 5T3WA 1D0YA 1OR2A 2UUHA 3KH2A 5DVWA 1E2XA 4CDVA 1WWPA 3HNKA 1LM3B 4ER9A 4OIOF 1N1CA 3KYJA 1PD1A 3TQOA 3HTKC 3NYLA 2P6VA 5KYXA 1OCCC 1APCA 2IM8A 1JOGA 3DKAA 3I5QA 1MMAA 4H4KC 1ST6A 4KBLA 3MFNA 3W2WA 3W4YA 1HMDA 3SXYA 2QNLA 5F5FA 2R7UA 1K40A 4QI2A 3G4XA 4G78A 3BRJA 4I1MA 3WODF 2Q9CA 2GAQA 4O6NA 4MTFA 5T1DB 1FR0A 1TR2A 3EHNA 3EH2A 4MVUA 2J0XA 4BPMA 5L0IA 3U3FA 4C7OB 4XTKA 3S0XA 3DWWA 3ITFA 2G62A 1JMWA 2VCBA 4E18A 2NSGA 2BE5F 5F28E
chains in the Genus database with same CATH topology
3NMJA 4CJOA 3M15A 3IQ6A 3HNJA 5JLIA 3ZTZA 3DE8A 3QVYA 5JT4A 3IQ5A 2J9BA 3NMIA 3ZTMA 5JRAA 4U9EA 1YZAA 1JAFA 1CPRA 5B3IA 1QPUA 1YZCA 1CGNA 4L6RA 2XL8A 1E86A 3HNIA 3L1MA 2QLAA 4CDYA 4N4WA 5JP7A 3ZQYA 4IB4A 2YL0A 1QQ3A 3M4BA 4JE9A 1E84A 3QVZA 4JEBA 3DE9A 2YLDA 1CPQA 1E83A 4JEAA 3U8PA 1EKYA 5JVEA 2YL3A 3QW0A 3C63A 3FOPA 1A7VA 2J8WA 2XLOA 2XLVA 4IAQA 2XM4A 4D4XA 4CX9A 1MQVA 2XLEA 256BA 1S05A 4ULVA 3TOMA 5JUAA 4WGZA 4IARA 5AGFA 4U9DA 1GQAA 2XL6A 2XLWA 4CDAA 2YL7A 1YYJA 3VRCA 4EIYA 3M79A 2BC5A 3NMKA 3M4CA 2YL1A 1YYXA 2YLIA 3ZQVA 2XM0A 3QW1A 4N6HA 4D4NA 3TOLA 1CGOA 5JSLA 5JS5A 1M6TA 4CDVA 3HNKA 1LM3B 4ER9A 2YLGA 4NC3A 1BBHA 1APCA 2YKZA 3ZWIA 3C62A 4CIPA 1RCPA 2XLDA 2CCYA 1NBBA 4WGYA 3FOOA 4CJGA 2XLHA 1E85A 4JKVA 2XLMA 3HNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NMJ A;  4CJO A;  3M15 A;  3IQ6 A;  3HNJ A;  5JLI A;  3ZTZ A;  3DE8 A;  3QVY A;  5JT4 A;  3IQ5 A;  2J9B A;  3NMI A;  3ZTM A;  5JRA A;  4U9E A;  1YZA A;  1JAF A;  1CPR A;  5B3I A;  1QPU A;  1YZC A;  1CGN A;  4L6R A;  2XL8 A;  1E86 A;  3HNI A;  3L1M A;  2QLA A;  4CDY A;  4N4W A;  5JP7 A;  3ZQY A;  4IB4 A;  2YL0 A;  1QQ3 A;  3M4B A;  4JE9 A;  1E84 A;  3QVZ A;  4JEB A;  3DE9 A;  2YLD A;  1CPQ A;  1E83 A;  4JEA A;  3U8P A;  1EKY A;  5JVE A;  2YL3 A;  3QW0 A;  3C63 A;  3FOP A;  1A7V A;  2J8W A;  2XLO A;  2XLV A;  4IAQ A;  2XM4 A;  4D4X A;  4CX9 A;  1MQV A;  2XLE A;  256B A;  1S05 A;  4ULV A;  3TOM A;  5JUA A;  4WGZ A;  4IAR A;  5AGF A;  4U9D A;  1GQA A;  2XL6 A;  2XLW A;  4CDA A;  2YL7 A;  1YYJ A;  3VRC A;  4EIY A;  3M79 A;  2BC5 A;  3NMK A;  3M4C A;  2YL1 A;  1YYX A;  2YLI A;  3ZQV A;  2XM0 A;  3QW1 A;  4N6H A;  4D4N A;  3TOL A;  1CGO A;  5JSL A;  5JS5 A;  1M6T A;  4CDV A;  3HNK A;  1LM3 B;  4ER9 A;  2YLG A;  4NC3 A;  1BBH A;  1APC A;  2YKZ A;  3ZWI A;  3C62 A;  4CIP A;  1RCP A;  2XLD A;  2CCY A;  1NBB A;  4WGY A;  3FOO A;  4CJG A;  2XLH A;  1E85 A;  4JKV A;  2XLM A;  3HNL A; 
#chains in the Genus database with same CATH topology
 2Q9B A;  3N24 A;  1C03 A;  3RH3 A;  3DM5 A;  4HE8 D;  4YWQ A;  1I4Y A;  2EIN C;  2NUP A;  3DJU B;  3IQ6 A;  1V54 C;  1AVO B;  4GYT A;  1NFO A;  3ZTZ A;  1QVX A;  1OCZ C;  3H2V A;  4RBN A;  1T6Q A;  2HKV A;  3QVY A;  1ZHY A;  1Y4C A;  2HUJ A;  4NTF A;  5BQH A;  1SMY F;  1DOW A;  4MND A;  1H6G A;  4KNV A;  3V5X A;  2WVO A;  3DXJ F;  2XS8 A;  2LCH A;  3RIP A;  2IYL D;  1YA9 A;  5JRA A;  5L0H A;  1U0B B;  3NKD A;  4BJ6 C;  4DXW A;  1YZA A;  5BUO A;  3CSK A;  2L6F A;  1BR4 A;  3CZ6 A;  3DM9 B;  4U5F E;  3LEV A;  4AE4 B;  1QPU A;  1YZC A;  3LS1 A;  1CGM E;  2HS5 A;  4L6R A;  2H7O A;  2AVK A;  3US6 A;  1BDJ B;  3FXH A;  2XL8 A;  4LDK A;  1E86 A;  1VYI A;  1GS9 A;  1L3P A;  2PF4 E;  3EG9 A;  3GWL A;  4JC7 A;  4JTC B;  2J45 A;  5JP7 A;  2GWW A;  4PJN A;  3ZQY A;  5A6B D;  2X51 A;  5KYU A;  2YL0 A;  1YJG A;  1LI5 A;  3NKE A;  2NUT A;  3U2L A;  3ZVR A;  3KKB A;  3SP1 A;  2J0W A;  2B0J A;  1ZHW A;  1TQG A;  1CPQ A;  3ASO C;  2QY9 A;  2MYS A;  3ABM C;  4JTD B;  5DLJ A;  3F47 A;  3S28 A;  2DB4 A;  4JCH A;  1ZZP A;  4OD4 A;  3DAF A;  4OD5 A;  2R7T A;  1A0B A;  4MW3 A;  1YLM A;  5EHH A;  4C3E A;  4YT8 A;  3IEE A;  3QMK A;  3UMH A;  1BZ4 A;  1I5N A;  2XM4 A;  3GM1 A;  2HSQ A;  3JTL O;  4JZA A;  5B1B C;  2QTV A;  4IWB A;  2WVQ A;  1OXK A;  3OEO A;  5EGY A;  2XLE A;  2O9X A;  3A11 A;  5AC5 A;  2EIM C;  2FGY A;  4F4B A;  4QDL A;  3UR3 C;  1M56 C;  3EJN A;  3FVY A;  5DQT A;  2WZF A;  2EPO A;  2ASR A;  4N06 A;  3TOM A;  4DRH B;  1RKE B;  2Y69 C;  3JRM O;  3VYW A;  2NG1 A;  1XZQ A;  2P1A A;  3LLI A;  4NTB A;  1TWH A;  4PFO A;  1H9G A;  2G3K A;  3PHF 2;  4IAR A;  2AWY A;  1ZU5 A;  4WJ0 A;  4G7H F;  5KYY A;  2MWQ A;  2OJE D;  1GQA A;  5KYN A;  2Z15 A;  2KNH A;  3O6X A;  3U2M A;  4CDA A;  3KMI A;  4CS7 A;  2R7X A;  1LPE A;  1YYJ A;  4A2N B;  4O6M A;  2P0N A;  4NCQ A;  5KYX B;  2UUI A;  1YAU O;  3M79 A;  3S27 A;  2IXN A;  1NFN A;  1V55 C;  2J9V A;  2RSE B;  1YYX A;  4N6C A;  4E7Z A;  3FAJ A;  1J8M F;  3ZQV A;  1O87 A;  3GM3 A;  1ZHX A;  4FX5 A;  4N6H A;  3SXZ A;  3TOL A;  1T6U A;  1GM5 A;  2EPL X;  1M2V A;  2WL8 A;  1CGO A;  2L81 A;  5JSL A;  3I4U A;  1TFK B;  3GWN A;  4P6I C;  2C04 A;  3GM2 A;  4NC3 A;  1BBH A;  5COF A;  3KL4 A;  3T6B A;  1T5O A;  2AP3 A;  2AWC A;  2YKZ A;  3GEI A;  3Q6N A;  4H54 A;  3IHU A;  3ZWI A;  1WTY A;  2LK4 A;  1SF8 A;  3OA1 A;  1RCP A;  3B71 A;  2XLD A;  5B3S C;  2CCY A;  1MMN A;  3RFY A;  3L0I A;  2NSF A;  1TWC A;  3M1C B;  2R9R B;  1PV3 A;  2LSE A;  3CAX A;  3JRT A;  3NG1 A;  4YT2 A;  5BQI A;  1NU7 D;  2XLH A;  1HMO A;  4CJG A;  4O6Y A;  4OIP F;  1V4A A;  4NTA A;  3TD7 A;  1G5Z A;  1O5H A;  1U89 A;  1RKE A;  3H65 A;  4CS9 C;  1MNE A;  3TJ5 A;  1MMG A;  1A41 A;  1QZX A;  1VLT A;  2OOC A;  2PFD A;  2VB6 A;  4BJ5 A;  3POV A;  3U3B A;  3RYL A;  3EH1 A;  4DBQ A;  4G7O F;  2OJQ A;  1VOM A;  5DS5 A;  5IY5 C;  3LAY A;  4CJO A;  3M15 A;  1HE9 A;  4U5C E;  2A0B A;  2JD3 A;  1FFT C;  1KNY A;  1OW6 A;  2OCC C;  3EPV A;  1NLX A;  4YJW A;  4EKW A;  4JIO A;  5JLI A;  1OQC A;  1FTS A;  4HFF B;  3DE8 A;  1EQ1 A;  4MTG A;  3RKO F;  5F5H A;  4WAB A;  4CSA C;  2Y3H A;  5COM A;  3SEO A;  2KJG A;  5JT4 A;  1ORY A;  2VC9 A;  1K05 A;  2OU6 A;  3EG9 B;  1HE1 A;  3LJB A;  3UNG C;  1FNT c;  2J9B A;  2KQ9 A;  2WZL A;  2J7P A;  3NMI A;  5KYU B;  1RXQ A;  2PBE A;  2NUT B;  2QE9 A;  4C3B A;  3HLZ A;  2DGJ A;  2W9Y A;  4IJJ A;  3I5P A;  1TKN A;  4U9E A;  4PK4 A;  4MS2 A;  4MVS A;  3U5S A;  1CPR A;  1WGW A;  3F46 A;  2KW3 C;  3ZSU A;  4CS8 A;  4EWC A;  1JPN A;  2OG2 A;  3K1I A;  3V5Z A;  1D1A A;  4O7G A;  4FAP B;  1VMA A;  2R7Q A;  4M63 A;  2ETS A;  1YDI A;  3ASN C;  4UDV A;  2LFF A;  5CI9 A;  3WHN A;  4MQ9 F;  1XZP A;  1TWA A;  3U9J A;  2A68 F;  3MBG A;  1IW7 F;  3O55 A;  1ZHT A;  2Y3G A;  1D1B A;  1G8X A;  1QQ3 A;  2J7P D;  3M4B A;  2R7R A;  4JE9 A;  1ORS C;  3LNM B;  3RQF A;  1E84 A;  3AGU A;  3IQT A;  4C3D A;  1FMV A;  4JW1 A;  1T01 A;  4PR9 A;  1E83 A;  4G0H A;  3DMD A;  2W4B A;  4BG0 A;  5A6B A;  4GEH A;  3L34 A;  1OW8 A;  4AL1 A;  5JVE A;  3UGP A;  1WAS A;  2Y3D A;  5BQG A;  1OKK D;  2W4M A;  1MND A;  2Y3B A;  2XLO A;  3FHD A;  4ZLD A;  3W8I A;  2HV6 A;  2HJ3 A;  5KYY B;  3Q7G A;  2D4U A;  2EIL C;  1EA8 A;  1OR3 A;  1MQV A;  1Q0K A;  1Z6A A;  4LER A;  2L7A A;  3J06 A;  3S90 A;  3EGD A;  1QLE C;  1AUE A;  1MMD A;  4P9F A;  1A7E A;  1JPJ A;  1RKC A;  3A9C A;  4ULW A;  3VM6 A;  4QI0 A;  1ZVZ A;  1OCO C;  2F22 A;  2PX3 A;  2HV7 A;  5TJ5 E;  2OEV A;  3RVZ A;  4Z9I A;  1S7Z A;  2M4E A;  3JYH A;  4WGZ A;  4XQ1 A;  1NG1 A;  5AGF A;  1Z23 A;  1LKX A;  2ICW G;  3UMI A;  1M2V B;  2XLW A;  1M2O A;  1OCR C;  1WAT A;  2J9U A;  2KGO A;  2YL7 A;  3GAN A;  3MLG A;  4LLE A;  1ZYR F;  2HZ8 A;  4CBE A;  2GA0 A;  3EQL F;  4XEF A;  2OQM A;  2EIK C;  3NYJ A;  2Q00 A;  3VRC A;  3W2V A;  3ZG1 A;  4EIY A;  2BC5 A;  2HMQ A;  2VCC A;  3N0T A;  2YL1 A;  1ORJ A;  5GPG B;  3TUL A;  1BR1 A;  2R7O A;  1F1M A;  1LVK A;  1VB5 A;  2YLI A;  4BJT A;  3Q7L A;  1T9K A;  3RQG A;  2W45 A;  3AGT A;  4D4N A;  1C17 M;  4DOZ A;  2AU5 A;  2P61 A;  2GFH A;  5JS5 A;  3MYF A;  2XXA A;  1M6T A;  1OXB A;  2DYS C;  2P7V A;  4LAC B;  4W8K A;  3LNR A;  4BEJ A;  1AEP A;  3SXK A;  4E0I A;  5A6K A;  5K0I A;  2WZG A;  3T6G B;  5A6J A;  4J7Y A;  4YN0 B;  2A1D D;  2XSE A;  3T4R A;  1I4Z A;  2BL2 A;  5L3V A;  2Q9A A;  3C62 A;  4BJ6 A;  4CIP A;  2YQY A;  3CQZ A;  2LIG A;  3LES A;  5A6A A;  4Q7C A;  4R32 A;  1D0X A;  3K33 A;  1PCX A;  4IGG A;  3ZIB A;  3GOD A;  3AG2 C;  3V5Y A;  4WGY A;  3ZC4 A;  4E7S A;  2J46 A;  3FOO A;  1H9T A;  3RF3 A;  1ZHZ A;  3CEX A;  3FAP B;  4XWJ A;  4AK9 A;  4I1O B;  3HNL A;  3C8G A;  4J30 B;  4EUK B;  1JR8 A;  4JRZ A;  3NMJ A;  4K1O A;  5FZT A;  3T9O A;  3EZH A;  4LLC A;  3U8V A;  1ZW3 A;  5L3Q A;  3JSZ A;  4RDA A;  3VAY A;  1W2W A;  2PX0 A;  3DI5 A;  3R7C A;  4DVY P;  4U5E E;  2HJM A;  4A4A A;  5E2Q A;  1VTM P;  1KTM A;  4EBJ A;  2MHR A;  2C03 A;  1WOL A;  3ATP A;  4Z9J A;  5KYW B;  3AQC A;  3E70 C;  1SZI A;  2CNW A;  3C8G D;  4I44 A;  1FFH A;  2YEV A;  1H7I A;  3ZTM A;  3O10 A;  1L7C A;  3W8H A;  2A6E F;  2B0H A;  4PJM A;  2ZPA A;  3PCV A;  3RW0 A;  3GOR A;  1CGN A;  4MVZ A;  4U5D E;  3B9Q A;  2IXM A;  2CW0 F;  4B6I A;  2V3C C;  2M64 A;  2RD9 A;  4O79 A;  3EGX A;  2QLA A;  3WAQ A;  4N4W A;  4MVR A;  1M57 C;  2CNW D;  4CS8 C;  3ABK C;  4IB4 A;  1SR2 A;  2R03 A;  1LI7 A;  2Q4F A;  3JSE O;  2IXO A;  3WG7 C;  2EPN A;  3IPM O;  3LEO A;  3NRH A;  3EGD B;  3QZC A;  2Q7R A;  1YVI A;  2R05 A;  1RJ9 A;  3DE9 A;  2YLD A;  3EZI A;  4LDQ A;  2YWA A;  3S9O A;  2ZXR A;  3ABL C;  3JCU Q;  2YL3 A;  3ECS A;  1A7V A;  2J8W A;  1LS1 A;  2G3V A;  3JT1 A;  1Q0M A;  4XLP F;  2LQG A;  4DVZ A;  3SYN A;  4IAQ A;  3X1O A;  1Q0F A;  2V26 A;  3KPH A;  3E9V A;  2FAP B;  2LP4 A;  4CX9 A;  2X0C A;  5DS6 A;  1WN0 A;  3K66 A;  3GEH A;  256B A;  2KC3 A;  2TMV P;  1ZU4 A;  4NQF A;  4W8P A;  1OKK A;  4K0D A;  1VK5 A;  4J7T A;  2YZS A;  3DAG A;  3KYI A;  5KYW A;  4ULV A;  4AL0 A;  1Z7Q c;  4JCZ A;  3V7O A;  2R7V A;  4PFP A;  2DI3 A;  5DQZ A;  3EFO A;  4I3M A;  3GEE A;  4Z9H A;  5L0D A;  2OKU A;  5T3T A;  3B0P A;  3BEH A;  1EI7 A;  4YK5 A;  1Q0D A;  3AOU A;  2H8A A;  4U9D A;  2XL6 A;  1O3U A;  2LD6 A;  3G50 A;  4JUR I;  4LDR A;  3SZR A;  3FMS A;  2XXA B;  1PD0 A;  4YT5 A;  2VH3 A;  4CS9 A;  5DS4 A;  2L6G A;  1QKR A;  2I8B A;  3C7J A;  2JX0 A;  2HSB A;  4YT4 A;  2XS1 A;  5B1A C;  3QTH A;  4PAC A;  2HFI A;  3AG3 C;  4XLN F;  3S29 A;  5L0F A;  4MW8 A;  1Q0G A;  2JPU A;  2LFD A;  3NDB B;  3PMR A;  3RQE A;  4PJL A;  4YL1 A;  1HW1 A;  4CSA A;  1J8Y F;  2YHS A;  3DD7 A;  4CDY A;  2YLG A;  3L8J A;  1LIH A;  3VF0 A;  3B29 A;  3N2Z B;  1G4U S;  3C8G B;  2CDQ A;  3Q6M A;  2EPK X;  5COG A;  4YL3 A;  4E0H A;  1ZW2 A;  2R02 A;  4MVM A;  1T6I A;  4GQH A;  3U9M A;  4HFK B;  4EBK A;  1NBB A;  3MX3 A;  2E87 A;  1R4T A;  2WB7 A;  2XL4 A;  3NYM A;  5D92 A;  1K04 A;  5E3C A;  4KI2 A;  2R7S A;  2IOQ A;  2H7B A;  3B0U X;  1HY5 A;  1A7D A;  1BR2 A;  3TK0 A;  1E85 A;  4OIQ F;  4JKV A;  1XWJ A;  2CGE A;  2XLM A;  5FCL A;  1R5I D;  3SXM A;  1TWG A;  3AJM A;  4MVO A;  3X2Q C;  1Z63 A;  5CIV A;  3T6J A;  3MYI A;  2A0U A;  4JVS A;  1RMV A;  3HKK A;  2A6H F;  4FWV A;  4JJF A;  4DBR A;  2OEX A;  2VAS A;  3HNJ A;  4XPW A;  4EHP A;  4AX2 A;  3JZ0 A;  5L0J A;  4C7O A;  1QSP A;  1TFO B;  2YRF A;  2D5R B;  3C18 A;  2I15 A;  4NY3 A;  4KC9 A;  4JJG A;  3UMK A;  3EGX B;  1OW7 A;  2GDC A;  4IRU A;  1NU9 C;  2KK1 A;  3IQ5 A;  4BEM J;  4DRI B;  5A69 A;  2A69 F;  1Z3I X;  4PJJ A;  3DZA A;  4K7B A;  4HEA J;  4OIN F;  1VYK A;  1YA7 O;  4ZLC A;  5CI8 A;  3C8Z A;  1NZE A;  4Q4Z F;  1JRA A;  1JAF A;  1FAP B;  5D91 A;  2HMZ A;  1RJ9 B;  5B3I A;  4G7Z F;  2R25 A;  4BJ1 A;  1D1C A;  4CIH A;  1YAR O;  2ZXW C;  2H7V C;  2KYH A;  1FMW A;  3HNI A;  3L1M A;  3LLK A;  2PP4 A;  2Y39 A;  2IXP A;  1B68 A;  5E33 A;  3DJN B;  2DYR C;  1U6H A;  2IBF A;  5L0G A;  1GGQ A;  4BJ5 C;  4P9T A;  1DOV A;  3QVZ A;  4J32 B;  4JEB A;  1LE2 A;  3S84 A;  4AE4 A;  2QUP A;  2Q3T A;  2EIJ C;  3PDM P;  5L0C A;  1SYQ A;  3AQB A;  4JEA A;  1LS4 A;  3U8P A;  1UFB A;  2WVN A;  3AG1 C;  4RD9 A;  4U5G A;  1EKY A;  3QW0 A;  4JTA B;  3C63 A;  3FOP A;  2CYD A;  2FFH A;  3EFO B;  3L8I A;  3H2U A;  5HSW A;  2ZD9 A;  1VLS A;  2XLV A;  1D0Z A;  2L9J A;  3IQC A;  2XRH A;  4KNW A;  3OWT A;  3K6B A;  4D4X A;  3U0C A;  1Z5Z A;  3FDQ A;  3UGO A;  1LE4 A;  2PNO A;  1G4W R;  3EHM A;  3O39 A;  4EBB A;  1Y6D A;  4MVQ A;  1S05 A;  2YVK A;  3LS0 A;  5AC4 A;  4MTO A;  5EK0 A;  3G4Z A;  3K7D A;  1UG7 A;  4X0R A;  5JUA A;  4OIR F;  3K1I C;  3R2P A;  3TJ6 A;  2J9W A;  2ZXO A;  4FES A;  4U5H A;  2L6H A;  3JYY A;  4XPY A;  5HV9 A;  3LUT B;  4XEV A;  4ANJ A;  2NUP B;  5E3A A;  4DRJ B;  1V74 B;  2VCA A;  4XEK A;  3B0V C;  1KU2 A;  4U5B E;  1HW2 A;  3NMK A;  3M4C A;  3K1H A;  3ZDL A;  4Q5S F;  2KSF A;  2NPU A;  1C02 A;  4IAO A;  1NSG B;  2ZXP A;  4ONS A;  4XPX A;  4DJ9 A;  1IZM A;  2R7W A;  2EPM X;  4YL0 A;  2XM0 A;  3QW1 A;  3SNH A;  4E17 A;  3RVY A;  3HJC A;  3AG4 C;  5T3W A;  1D0Y A;  1OR2 A;  2UUH A;  3KH2 A;  5DVW A;  1E2X A;  4CDV A;  1WWP A;  3HNK A;  1LM3 B;  4ER9 A;  4OIO F;  1N1C A;  3KYJ A;  1PD1 A;  3TQO A;  3HTK C;  3NYL A;  2P6V A;  5KYX A;  1OCC C;  1APC A;  2IM8 A;  1JOG A;  3DKA A;  3I5Q A;  1MMA A;  4H4K C;  1ST6 A;  4KBL A;  3MFN A;  3W2W A;  3W4Y A;  1HMD A;  3SXY A;  2QNL A;  5F5F A;  2R7U A;  1K40 A;  4QI2 A;  3G4X A;  4G78 A;  3BRJ A;  4I1M A;  3WOD F;  2Q9C A;  2GAQ A;  4O6N A;  4MTF A;  5T1D B;  1FR0 A;  1TR2 A;  3EHN A;  3EH2 A;  4MVU A;  2J0X A;  4BPM A;  5L0I A;  3U3F A;  4C7O B;  4XTK A;  3S0X A;  3DWW A;  3ITF A;  2G62 A;  1JMW A;  2VCB A;  4E18 A;  2NSG A;  2BE5 F;  5F28 E; 
#chains in the Genus database with same CATH homology
 3NMJ A;  4CJO A;  3M15 A;  3IQ6 A;  3HNJ A;  5JLI A;  3ZTZ A;  3DE8 A;  3QVY A;  5JT4 A;  3IQ5 A;  2J9B A;  3NMI A;  3ZTM A;  5JRA A;  4U9E A;  1YZA A;  1JAF A;  1CPR A;  5B3I A;  1QPU A;  1YZC A;  1CGN A;  4L6R A;  2XL8 A;  1E86 A;  3HNI A;  3L1M A;  2QLA A;  4CDY A;  4N4W A;  5JP7 A;  3ZQY A;  4IB4 A;  2YL0 A;  1QQ3 A;  3M4B A;  4JE9 A;  1E84 A;  3QVZ A;  4JEB A;  3DE9 A;  2YLD A;  1CPQ A;  1E83 A;  4JEA A;  3U8P A;  1EKY A;  5JVE A;  2YL3 A;  3QW0 A;  3C63 A;  3FOP A;  1A7V A;  2J8W A;  2XLO A;  2XLV A;  4IAQ A;  2XM4 A;  4D4X A;  4CX9 A;  1MQV A;  2XLE A;  256B A;  1S05 A;  4ULV A;  3TOM A;  5JUA A;  4WGZ A;  4IAR A;  5AGF A;  4U9D A;  1GQA A;  2XL6 A;  2XLW A;  4CDA A;  2YL7 A;  1YYJ A;  3VRC A;  4EIY A;  3M79 A;  2BC5 A;  3NMK A;  3M4C A;  2YL1 A;  1YYX A;  2YLI A;  3ZQV A;  2XM0 A;  3QW1 A;  4N6H A;  4D4N A;  3TOL A;  1CGO A;  5JSL A;  5JS5 A;  1M6T A;  4CDV A;  3HNK A;  1LM3 B;  4ER9 A;  2YLG A;  4NC3 A;  1BBH A;  1APC A;  2YKZ A;  3ZWI A;  3C62 A;  4CIP A;  1RCP A;  2XLD A;  2CCY A;  1NBB A;  4WGY A;  3FOO A;  4CJG A;  2XLH A;  1E85 A;  4JKV A;  2XLM A;  3HNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...