2PP4A

Solution structure of eto-tafh refined in explicit solvent
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
107
structure length
107
Chain Sequence
GARQLSKLKRFLTTLQQYGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein ETO
publication title A TAF4-homology domain from the corepressor ETO is a docking platform for positive and negative regulators of transcription
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2pp4A00
2KNHA 2PP4A 2P6VA 2H7BA
chains in the Genus database with same CATH superfamily
2XRHA 3KL4A 3WAQA 5JVEA 2XS1A 3LLIA 2HUJA 4W8PA 2HV7A 3X1OA 3S9OA 4OIQF 3HJCA 4YN0B 4UDVA 1T9KA 2A6EF 3EGDA 4ZLDA 2XL4A 4RD9A 2Q7RA 1ZU4A 3ZIBA 1APCA 1D1AA 5L0FA 1CGME 2HJ3A 2QE9A 4G0HA 4YL1A 2LIGA 4XEVA 2VH3A 4K7BA 1QKRA 3AJMA 2JPUA 5L3QA 2OKUA 2HS5A 1YVIA 3S84A 3C8GD 1XZPA 4XEKA 3C8ZA 1T6QA 2FAPB 2NUPA 3EHNA 3ECSA 1H9TA 3TD7A 1GM5A 1JOGA 4FESA 1NZEA 3IQ5A 3K66A 3L8IA 1HE9A 1ZHTA 4CIPA 4IAOA 4N06A 4R32A 1LPEA 2Q9BA 4HFKB 4NQFA 3NMIA 4YT8A 1D1CA 3DWWA 1D0YA 4J7YA 2XM0A 1M2VB 4DOZA 3ZSUA 1SMYF 1K04A 3VF0A 3W8IA 2XLMA 4PFPA 1RKEB 1V55C 4KNWA 4MTFA 1HW2A 1IW7F 4ONSA 3SNHA 4DRHB 2VCCA 2O9XA 2L9JA 1A0BA 3Q6NA 1XZQA 2G3VA 3DI5A 1ZW3A 4IB4A 4N6HA 1C17M 1IZMA 2IXPA 4G7HF 4OIPF 3OWTA 4WGYA 3EFOB 4HFFB 1KU2A 1A7EA 256BA 2Y3HA 4MTGA 4OIRF 4D4NA 5L3VA 1UFBA 2FGYA 4D4XA 1OR2A 4A4AA 5BQGA 1NU9C 1U6HA 1TFOB 2L6GA 3LS0A 2CNWD 2Y3GA 3NDBB 2YL3A 4M63A 1E85A 1FFTC 1Z23A 2LD6A 2EPOA 2NUTA 3MBGA 3H65A 2Y3DA 1JPNA 2Z15A 2J7PA 2EPLX 3UMIA 4XLPF 1ST6A 5T3TA 5JUAA 1ZHZA 2AWCA 3OEOA 4JW1A 2DB4A 2R9RB 3OA1A 1LS4A 4N4WA 3AG3C 4JZAA 2WZFA 2QTVA 4K1OA 4PJJA 5A6BA 3AOUA 4JTAB 1T5OA 5B3SC 5A6AA 2IXOA 3EGDB 3L0IA 3EQLF 1Q0DA 4MVOA 1TFKB 3ABKC 2EINC 3LEOA 3Q7GA 3GEHA 4YL3A 1L3PA 2XXAA 5D91A 1YARO 3FDQA 1NG1A 2PFDA 1Q0MA 2OG2A 1ORYA 1R5ID 1BR4A 1W2WA 1YZCA 3SXMA 4DRJB 1K40A 1E84A 1M2OA 1ORSC 2P61A 2NUPB 2OCCC 3TJ5A 3TOMA 4KC9A 1FMVA 4CJOA 3FAPB 2GAQA 1VYKA 3HLZA 3FHDA 2DYRC 1H9GA 3F46A 1E86A 5B3IA 2YQYA 2B0HA 1C02A 3I5PA 5B1BC 2KSFA 3TJ6A 1M6TA 1NSGB 2LP4A 3ABMC 4YJWA 4U5DE 1OCRC 1MMAA 4I1OB 5TJ5E 5KYYA 1OR3A 1OKKA 2NSFA 4WABA 3GANA 4YK5A 1Z7Qc 2BC5A 1CGOA 1HW1A 1TQGA 2VCAA 4AX2A 2F22A 3RYLA 3CAXA 1ZYRF 1NFOA 4CS7A 1Q0KA 3T6JA 3VRCA 2ICWG 5F5FA 4Q7CA 1EQ1A 3R2PA 5EGYA 2A68F 3GEIA 3W8HA 2WVNA 1ZHYA 2YLIA 1TWHA 2R02A 1SF8A 2ZXOA 4LLEA 4XPYA 3SEOA 2BL2A 3U2LA 1Z3IX 2Y39A 4I44A 5A6JA 4NTBA 3IEEA 2J45A 1U89A 3ZG1A 3IQCA 2X51A 3MYFA 1MMDA 4C3DA 3AG4C 5CI8A 4YT4A 1D1BA 5T3WA 2LK4A 1TWCA 2KJGA 3EH2A 3L8JA 3NYJA 3RH3A 4JURI 2V26A 2HKVA 2IXMA 1E2XA 2XLOA 2ZD9A 4G7ZF 1Q0GA 4E18A 1QLEC 1OXKA 2EPKX 2GA0A 4BJ5C 2NUTB 3MX3A 5HV9A 5KYNA 4AE4A 3ASNC 4JCZA 3X2QC 5L0JA 3C8GA 3MYIA 4Z9IA 4MQ9F 2HJMA 2J46A 1V4AA 3N0TA 4CBEA 4A2NB 1T01A 2Q9AA 2YL0A 1N1CA 5L0DA 2KK1A 2KQ9A 5DVWA 3SZRA 4E7SA 2Q4FA 4U5BE 3HKKA 4CSAC 2W9YA 4C3BA 4XQ1A 2LQGA 1OQCA 1J8YF 2Q00A 3U0CA 5EK0A 5GPGB 2QUPA 3UMKA 2C04A 2NG1A 2XSEA 3ABLC 4RDAA 3TK0A 4E0HA 1YLMA 3G4XA 3GM2A 3QVYA 2X0CA 4PJMA 4B6IA 4FAPB 5L0IA 3GEEA 2A69F 2VB6A 2ZXPA 2W4BA 1TR2A 4NCQA 4OINF 5COFA 1EKYA 1RJ9A 1WASA 3U8PA 5DQZA 1VLTA 1OCZC 2HSQA 4LDQA 1O3UA 2PP4A 4O6YA 2J9UA 4J32B 2KC3A 2YZSA 4U5EE 5COGA 3ZVRA 1Z5ZA 4O6NA 2MHRA 5K0IA 1Q0FA 2EIKC 4C7OA 1HE1A 4U5GA 2H7BA 2HV6A 2CNWA 5KYYB 1NLXA 2IOQA 3TULA 1WN0A 3GM3A 1BZ4A 1MNDA 1BR2A 3U9MA 2XL8A 2YEVA 5E3AA 3F47A 3J06A 1G4US 1RKCA 1LI5A 3SXYA 2M64A 3JRTA 1WGWA 2WVQA 3VYWA 4AK9A 1D0XA 3T9OA 3U2MA 2EPMX 2YLDA 3FXHA 3JYYA 4U5CE 4JEAA 4JJGA 5E33A 3US6A 4EWCA 2XS8A 4EBKA 2HFIA 4IGGA 3AG2C 3AGUA 1FR0A 1DOVA 3NYMA 3LUTB 3M4BA 4I3MA 2C03A 2VCBA 4EUKB 4LDKA 1WWPA 1SYQA 2R05A 3RIPA 4BEJA 4EBBA 5AC4A 1M57C 2E87A 2PBEA 2ZPAA 4AE4B 2DYSC 4KI2A 3C8GB 5E3CA 2JD3A 3CSKA 3M79A 2J9WA 5KYUA 3EH1A 3M4CA 3QZCA 5DQTA 4XTKA 2LFDA 2UUIA 2V3CC 1ZU5A 2IXNA 1FFHA 2KYHA 3O6XA 5B1AC 4BJTA 1SR2A 4PACA 4BJ5A 1JRAA 1VK5A 4C3EA 2M4EA 1T6UA 4WGZA 1VB5A 3I5QA 3JTLO 2A6HF 3N24A 5F5HA 4CS8C 3K7DA 3R7CA 1YZAA 2OU6A 3B9QA 4Z9HA 1LE4A 5KYXA 2XL6A 2LCHA 4XEFA 4E7ZA 1VMAA 4JTCB 4RBNA 4ULVA 2CGEA 2H7OA 2YVKA 3ITFA 4H54A 4EIYA 3DE9A 4MS2A 4CSAA 3JRMO 3SXZA 4JJFA 2HMZA 1RJ9B 2QNLA 2YL1A 1WOLA 1FTSA 3HNKA 4L6RA 1O87A 2GFHA 3EHMA 5DLJA 3S27A 4KBLA 3RW0A 3V5ZA 3BEHA 2R25A 1A7VA 3UNGC 2WVOA 4MVUA 5F28E 2OEXA 2OQMA 4DVZA 4YL0A 4C7OB 2L6FA 4DJ9A 4ULWA 3IQTA 3JYHA 2H8AA 4JRZA 2OJQA 4XPXA 2W4MA 4AL0A 3ZDLA 4J30B 3AG1C 3LEVA 3GWNA 3Q7LA 2L7AA 4GEHA 1TWGA 2DGJA 1V74B 3C62A 2GDCA 1TKNA 2J8WA 2OEVA 1VLSA 1QSPA 4E0IA 1OW6A 1L7CA 2UUHA 4DBRA 4ER9A 4PR9A 2GWWA 1RMVA 1SZIA 4PK4A 4OD5A 4CDVA 4CIHA 4GQHA 1GQAA 1LKXA 1GS9A 1JAFA 3DM5A 3KMIA 5A6BD 3B29A 2WL8A 5CI9A 1WATA 3KH2A 3U3FA 2TMVP 4P6IC 3WHNA 3POVA 3B0UX 1LE2A 5FZTA 5KYUB 1FMWA 4HEAJ 1QQ3A 3GODA 4J7TA 4YT5A 1I4ZA 3PCVA 4IWBA 2R7VA 4EHPA 1G8XA 1GGQA 3NKDA 1JPJA 3UGOA 1LS1A 2XLEA 3KYIA 3LJBA 2XLWA 2XLDA 4U9DA 3PMRA 4DBQA 2RSEB 2H7VC 1DOWA 3JSZA 3LNMB 4PFOA 1LVKA 2I15A 4BJ6C 4Q4ZF 3EG9A 3RQGA 5KYXB 1OW8A 3KPHA 3V5YA 2YRFA 2EILC 4F4BA 3AQBA 3HNLA 1Y6DA 2XXAB 3TOLA 5JSLA 3RVYA 3DJNB 4IRUA 4ZLCA 1A41A 3LLKA 4H4KC 2R7UA 5BQIA 4G78A 5T1DB 3IHUA 3C7JA 3CZ6A 4CS8A 1NFNA 4JIOA 3RVZA 4YWQA 3IQ6A 3RF3A 2JX0A 2R7OA 2ZXRA 3GORA 3E70C 2CYDA 2NPUA 3HNIA 4MVRA 4X0RA 3RFYA 3SP1A 1AVOB 2J0WA 3BRJA 5A6KA 1E83A 2HZ8A 2NSGA 5JS5A 1AUEA 1PV3A 4U5HA 2R7SA 3FOOA 3LS1A 3VAYA 1D0ZA 1OCCC 3VM6A 3JSEO 1RXQA 5CIVA 2AWYA 3PHF2 3RQEA 3S0XA 4Q5SF 4IARA 1XWJA 3S28A 2I8BA 3K33A 3GM1A 1PCXA 3LNRA 3MFNA 3DM9B 3PDMP 1ZZPA 5L0GA 4MNDA 1RCPA 2R03A 1ZW2A 5AC5A 1CPRA 3DMDA 2P6VA 3A11A 3NMJA 2PF4E 3DAFA 3HNJA 1CGNA 2YHSA 2R7WA 4MVMA 2R7RA 5L0HA 1G4WR 1G5ZA 2P1AA 1LIHA 2PNOA 2YWAA 2VC9A 3M15A 1UG7A 2IM8A 3EJNA 1F1MA 2AU5A 3W4YA 2LSEA 3K6BA 1YA9A 2FFHA 1LI7A 4CX9A 1YAUO 1HMOA 1S05A 4LDRA 3QTHA 1EA8A 3KYJA 1YYXA 4YT2A 3K1IC 2ETSA 1I5NA 1YA7O 3DE8A 3UMHA 2PX3A 3O55A 4JCHA 4XPWA 3O39A 4JKVA 4FX5A 2Y69C 4JC7A 2W45A 1PD0A 3A9CA 3DZAA 2CCYA 3HTKC 3EZIA 2RD9A 3DXJF 3ASOC 2KW3C 5D92A 5JP7A 1VTMP 1M56C 5JRAA 4CS9C 1PD1A 3EZHA 2R7TA 5BUOA 3B71A 3JZ0A 3DD7A 4IJJA 4O79A 3LAYA 3DJUB 2A1DD 1VOMA 3EGXA 2BE5F 1QZXA 2P0NA 3EG9B 4MW8A 5JT4A 2MYSA 3M1CB 4BEMJ 4LERA 1ORJA 4N6CA 1JR8A 1KNYA 2KGOA 1LM3B 3ATPA 3NRHA 3AQCA 1FAPB 2R7QA 2XLVA 3CQZA 2XM4A 3FVYA 4O7GA 4WJ0A 3TQOA 5A69A 1C03A 1OW7A 2VASA 1B68A 4BPMA 1TWAA 3B0VC 1H7IA 1OCOC 2D5RB 5DS5A 3QVZA 1QVXA 4BJ6A 1WTYA 2G62A 4P9TA 1I4YA 1ZHXA 2AVKA 3ZWIA 5EHHA 3AGTA 3Q6MA 4DVYP 4GYTA 2R7XA 4CDAA 3RKOF 2A0UA 4MTOA 5COMA 5JLIA 1Y4CA 1H6GA 2YL7A 3K1HA 4LACB 5KYWA 3T6BA 3WODF 1FNTc 3MLGA 4W8KA 1MQVA 3I4UA 3C18A 5DS6A 2J9VA 3L34A 4OIOF 3G50A 4G7OF 3ZTZA 1QPUA 4NC3A 3JT1A 5FCLA 4U5FE 4XLNF 4BG0A 5DS4A 2ASRA 2P7VA 2OOCA 3W2WA 2QY9A 2B0JA 2LFFA 3FAJA 3WG7C 2G3KA 3T4RA 2DI3A 3U5SA 4JEBA 5L0CA 1KTMA 2EIMC 3CEXA 4JE9A 1HY5A 1YJGA 3FMSA 2WZGA 4MW3A 4LLCA 1T6IA 1BR1A 1BDJB 2L81A 3NYLA 4QI0A 3L1MA 1YDIA 1JMWA 4NY3A 2YKZA 3LESA 2J7PD 2HMQA 1Z63A 3QW1A 4QDLA 2IBFA 4ANJA 4JVSA 1O5HA 4E17A 1V54C 4DXWA 3V5XA 4CDYA 3E9VA 1YYJA 2CW0F 5HSWA 2EIJC 1ZHWA 2CDQA 3UGPA 2Q9CA 1J8MF 1S7ZA 3DAGA 4OD4A 4I1MA 2HSBA 1ZVZA 3O10A 5E2QA 4EBJA 4MVSA 3B0PA 3W2VA 3ZQYA 3DKAA 1NU7D 1HMDA 3EPVA 4NTFA 3SXKA 4PJNA 4HE8D 1EI7A 3K1IA 1M2VA 3T6GB 1A7DA 1MNEA 3GWLA 3KKBA 3U8VA 4DRIB 2AP3A 1VYIA 5IY5C 3EGXB 3S90A 1RKEA 3N2ZB 4IAQA 5BQHA 2Y3BA 2YLGA 3RQFA 2IYLD 1CPQA 1K05A 2A0BA 2L6HA 3NKEA 5AGFA 3G4ZA 2KNHA 4PJLA 3C63A 3H2UA 4KNVA 3U9JA 4JTDB 1OXBA 4CS9A 4XWJA 3ZTMA 1BBHA 4O6MA 3EFOA 2WZLA 3QW0A 4CJGA 2EPNA 3ZC4A 3JCUQ 3UR3C 3NMKA 4U9EA 2J0XA 4Z9JA 2MWQA 4QI2A 4P9FA 4BJ1A 3NG1A 3H2VA 3QMKA 1OKKD 1MMGA 4MVZA 1AEPA 4FWVA 4NTAA 4EKWA 2J9BA 2ZXWC 5KYWB 1MMNA 2D4UA 3ZQVA 4MVQA 2OJED 4AL1A 1R4TA 1U0BB 2PX0A 3IPMO 3U3BA 2Q3TA 2QLAA 2XLHA 3SYNA 1Z6AA 2WB7A 3V7OA 1NBBA 4K0DA 3S29A 3FOPA
chains in the Genus database with same CATH topology
2XRHA 3KL4A 3LLIA 3X1OA 2HV7A 4OIQF 3HJCA 4YN0B 2A6EF 3EGDA 4ZLDA 2XL4A 4RD9A 3ZIBA 1ZU4A 1D1AA 4G0HA 2VH3A 4K7BA 5L3QA 2NUPA 3EHNA 3ECSA 3TD7A 4FESA 1NZEA 3K66A 1ZHTA 4IAOA 4N06A 2Q9BA 4HFKB 4YT8A 1D1CA 1D0YA 4DOZA 1M2VB 3ZSUA 1SMYF 3W8IA 4PFPA 1V55C 4KNWA 1IW7F 3SNHA 2O9XA 2L9JA 3Q6NA 2G3VA 1IZMA 2IXPA 4G7HF 4OIPF 3OWTA 3EFOB 4HFFB 1KU2A 2Y3HA 5L3VA 4OIRF 2FGYA 1NU9C 3LS0A 2CNWD 2Y3GA 3NDBB 4M63A 1FFTC 1Z23A 2NUTA 3H65A 2Y3DA 1JPNA 2Z15A 2J7PA 3UMIA 4XLPF 1ST6A 5T3TA 1ZHZA 3OEOA 4JW1A 3OA1A 3AG3C 4JZAA 2WZFA 2QTVA 4PJJA 5B3SC 2IXOA 3EGDB 3L0IA 3EQLF 3ABKC 2EINC 3Q7GA 2XXAA 5D91A 3FDQA 1NG1A 2PFDA 2OG2A 1W2WA 1BR4A 1M2OA 2NUPB 2OCCC 4KC9A 1FMVA 3HLZA 1VYKA 3FHDA 2DYRC 3F46A 3I5PA 5B1BC 3ABMC 4YJWA 4U5DE 1OCRC 1MMAA 4I1OB 5KYYA 1OKKA 3GANA 4AX2A 3RYLA 1ZYRF 4CS7A 3T6JA 5F5FA 4Q7CA 5EGYA 2A68F 3W8HA 2WVNA 1ZHYA 1TWHA 2ZXOA 1SF8A 3SEOA 4LLEA 1Z3IX 2Y39A 4I44A 3IEEA 2J45A 3ZG1A 4C3DA 2X51A 1MMDA 3AG4C 5CI8A 4YT4A 1D1BA 5T3WA 3EH2A 1TWCA 2KJGA 3NYJA 3RH3A 4JURI 2V26A 2IXMA 4G7ZF 1QLEC 4BJ5C 2NUTB 3MX3A 5KYNA 4AE4A 3ASNC 3X2QC 4MQ9F 2J46A 4CBEA 3N0TA 4A2NB 2Q9AA 1N1CA 2KQ9A 5DVWA 3SZRA 4E7SA 4U5BE 4CSAC 2W9YA 4C3BA 1J8YF 3UMKA 2C04A 2NG1A 2XSEA 3ABLC 4RDAA 4B6IA 4PJMA 2A69F 2VB6A 2ZXPA 2W4BA 1TR2A 4OINF 1RJ9A 5DQZA 1OCZC 2PP4A 4O6YA 2J9UA 4J32B 4U5EE 2YZSA 3ZVRA 1Z5ZA 4O6NA 2EIKC 4C7OA 4U5GA 2H7BA 2HV6A 2CNWA 5KYYB 2IOQA 1MNDA 1BR2A 2YEVA 5E3AA 3F47A 3VYWA 3JRTA 1WGWA 2WVQA 4AK9A 1D0XA 4U5CE 4JJGA 5E33A 4EWCA 3AG2C 3NYMA 4I3MA 2C03A 3RIPA 4BEJA 4EBBA 1M57C 2E87A 2ZPAA 4AE4B 2DYSC 4KI2A 5E3CA 2JD3A 3CSKA 2J9WA 5KYUA 3EH1A 3QZCA 5DQTA 4XTKA 2V3CC 1ZU5A 2IXNA 1FFHA 3O6XA 5B1AC 4BJTA 4BJ5A 1VK5A 4C3EA 2M4EA 3I5QA 5F5HA 2A6HF 3N24A 4CS8C 3K7DA 3B9QA 5KYXA 4E7ZA 1VMAA 4RBNA 2CGEA 2H7OA 3ITFA 4CSAA 4JJFA 1RJ9B 1FTSA 1O87A 2GFHA 3EHMA 5DLJA 3S27A 4KBLA 3UNGC 2WVOA 4DVZA 4C7OB 4ULWA 3JYHA 2W4MA 4J30B 3AG1C 3LEVA 3Q7LA 4GEHA 1TWGA 2DGJA 1TKNA 4DBRA 1SZIA 4PK4A 4OD5A 4CIHA 1LKXA 3DM5A 3KMIA 2WL8A 5CI9A 3KH2A 4P6IC 3POVA 3B0UX 5KYUB 1FMWA 4HEAJ 3GODA 4YT5A 4IWBA 2R7VA 1G8XA 3NKDA 1JPJA 3UGOA 1LS1A 3LJBA 4DBQA 3PMRA 2H7VC 3JSZA 4Q4ZF 4PFOA 1LVKA 4BJ6C 3EG9A 5KYXB 2EILC 4F4BA 3AQBA 2XXAB 3DJNB 4IRUA 4ZLCA 3LLKA 4H4KC 2R7UA 5T1DB 3CZ6A 4CS8A 4YWQA 2R7OA 2ZXRA 3E70C 4X0RA 3RFYA 3SP1A 2J0WA 2R7SA 4U5HA 3LS1A 3VAYA 1D0ZA 1OCCC 3PHF2 4Q5SF 3S0XA 3S28A 2I8BA 3K33A 1PCXA 3LNRA 3DM9B 4MNDA 3DMDA 2P6VA 2PF4E 3DAFA 2R7WA 2YHSA 2R7RA 3EJNA 2LSEA 3K6BA 2FFHA 4YT2A 3K1IC 3UMHA 2PX3A 4JCHA 3O39A 4FX5A 2Y69C 2W45A 1PD0A 3DZAA 3HTKC 3EZIA 3DXJF 3ASOC 2KW3C 5D92A 1M56C 4CS9C 1PD1A 3EZHA 2R7TA 5BUOA 4IJJA 3DD7A 4O79A 3LAYA 3DJUB 2A1DD 1VOMA 3EGXA 2BE5F 1QZXA 3EG9B 2MYSA 3M1CB 4LERA 2KGOA 3NRHA 3AQCA 3CQZA 2R7QA 3FVYA 4O7GA 4WJ0A 2VASA 5DS5A 3B0VC 1TWAA 1OCOC 2D5RB 4BJ6A 2G62A 1ZHXA 5EHHA 3Q6MA 4DVYP 4GYTA 2R7XA 3RKOF 3K1HA 5KYWA 4LACB 3T6BA 3WODF 3MLGA 4W8KA 3I4UA 5DS6A 2J9VA 3L34A 4OIOF 4G7OF 3JT1A 5FCLA 4U5FE 4XLNF 4BG0A 5DS4A 2P7VA 3W2WA 2QY9A 2B0JA 3FAJA 3WG7C 2G3KA 3T4RA 2EIMC 2WZGA 4LLCA 1BR1A 2L81A 3NYLA 4QI0A 4NY3A 3LESA 2J7PD 1Z63A 4QDLA 4ANJA 4JVSA 1O5HA 1V54C 3E9VA 2CW0F 5HSWA 2EIJC 1ZHWA 2CDQA 3UGPA 2Q9CA 1J8MF 1S7ZA 3DAGA 4OD4A 4I1MA 5E2QA 3B0PA 3W2VA 1NU7D 3EPVA 4PJNA 4HE8D 1M2VA 1MNEA 3KKBA 1VYIA 5IY5C 3EGXB 3N2ZB 2Y3BA 2IYLD 3NKEA 2KNHA 4PJLA 4KNVA 4CS9A 4XWJA 4O6MA 3EFOA 2WZLA 3ZC4A 3JCUQ 3UR3C 2J0XA 2MWQA 4QI2A 4BJ1A 3NG1A 3QMKA 1OKKD 1MMGA 4FWVA 2ZXWC 5KYWB 1MMNA 2PX0A 2Q3TA 3SYNA 1Z6AA 2WB7A 3V7OA 4K0DA 3S29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNH A;  2PP4 A;  2P6V A;  2H7B A; 
#chains in the Genus database with same CATH topology
 2XRH A;  3KL4 A;  3WAQ A;  5JVE A;  2XS1 A;  3LLI A;  2HUJ A;  4W8P A;  2HV7 A;  3X1O A;  3S9O A;  4OIQ F;  3HJC A;  4YN0 B;  4UDV A;  1T9K A;  2A6E F;  3EGD A;  4ZLD A;  2XL4 A;  4RD9 A;  2Q7R A;  1ZU4 A;  3ZIB A;  1APC A;  1D1A A;  5L0F A;  1CGM E;  2HJ3 A;  2QE9 A;  4G0H A;  4YL1 A;  2LIG A;  4XEV A;  2VH3 A;  4K7B A;  1QKR A;  3AJM A;  2JPU A;  5L3Q A;  2OKU A;  2HS5 A;  1YVI A;  3S84 A;  3C8G D;  1XZP A;  4XEK A;  3C8Z A;  1T6Q A;  2FAP B;  2NUP A;  3EHN A;  3ECS A;  1H9T A;  3TD7 A;  1GM5 A;  1JOG A;  4FES A;  1NZE A;  3IQ5 A;  3K66 A;  3L8I A;  1HE9 A;  1ZHT A;  4CIP A;  4IAO A;  4N06 A;  4R32 A;  1LPE A;  2Q9B A;  4HFK B;  4NQF A;  3NMI A;  4YT8 A;  1D1C A;  3DWW A;  1D0Y A;  4J7Y A;  2XM0 A;  1M2V B;  4DOZ A;  3ZSU A;  1SMY F;  1K04 A;  3VF0 A;  3W8I A;  2XLM A;  4PFP A;  1RKE B;  1V55 C;  4KNW A;  4MTF A;  1HW2 A;  1IW7 F;  4ONS A;  3SNH A;  4DRH B;  2VCC A;  2O9X A;  2L9J A;  1A0B A;  3Q6N A;  1XZQ A;  2G3V A;  3DI5 A;  1ZW3 A;  4IB4 A;  4N6H A;  1C17 M;  1IZM A;  2IXP A;  4G7H F;  4OIP F;  3OWT A;  4WGY A;  3EFO B;  4HFF B;  1KU2 A;  1A7E A;  256B A;  2Y3H A;  4MTG A;  4OIR F;  4D4N A;  5L3V A;  1UFB A;  2FGY A;  4D4X A;  1OR2 A;  4A4A A;  5BQG A;  1NU9 C;  1U6H A;  1TFO B;  2L6G A;  3LS0 A;  2CNW D;  2Y3G A;  3NDB B;  2YL3 A;  4M63 A;  1E85 A;  1FFT C;  1Z23 A;  2LD6 A;  2EPO A;  2NUT A;  3MBG A;  3H65 A;  2Y3D A;  1JPN A;  2Z15 A;  2J7P A;  2EPL X;  3UMI A;  4XLP F;  1ST6 A;  5T3T A;  5JUA A;  1ZHZ A;  2AWC A;  3OEO A;  4JW1 A;  2DB4 A;  2R9R B;  3OA1 A;  1LS4 A;  4N4W A;  3AG3 C;  4JZA A;  2WZF A;  2QTV A;  4K1O A;  4PJJ A;  5A6B A;  3AOU A;  4JTA B;  1T5O A;  5B3S C;  5A6A A;  2IXO A;  3EGD B;  3L0I A;  3EQL F;  1Q0D A;  4MVO A;  1TFK B;  3ABK C;  2EIN C;  3LEO A;  3Q7G A;  3GEH A;  4YL3 A;  1L3P A;  2XXA A;  5D91 A;  1YAR O;  3FDQ A;  1NG1 A;  2PFD A;  1Q0M A;  2OG2 A;  1ORY A;  1R5I D;  1BR4 A;  1W2W A;  1YZC A;  3SXM A;  4DRJ B;  1K40 A;  1E84 A;  1M2O A;  1ORS C;  2P61 A;  2NUP B;  2OCC C;  3TJ5 A;  3TOM A;  4KC9 A;  1FMV A;  4CJO A;  3FAP B;  2GAQ A;  1VYK A;  3HLZ A;  3FHD A;  2DYR C;  1H9G A;  3F46 A;  1E86 A;  5B3I A;  2YQY A;  2B0H A;  1C02 A;  3I5P A;  5B1B C;  2KSF A;  3TJ6 A;  1M6T A;  1NSG B;  2LP4 A;  3ABM C;  4YJW A;  4U5D E;  1OCR C;  1MMA A;  4I1O B;  5TJ5 E;  5KYY A;  1OR3 A;  1OKK A;  2NSF A;  4WAB A;  3GAN A;  4YK5 A;  1Z7Q c;  2BC5 A;  1CGO A;  1HW1 A;  1TQG A;  2VCA A;  4AX2 A;  2F22 A;  3RYL A;  3CAX A;  1ZYR F;  1NFO A;  4CS7 A;  1Q0K A;  3T6J A;  3VRC A;  2ICW G;  5F5F A;  4Q7C A;  1EQ1 A;  3R2P A;  5EGY A;  2A68 F;  3GEI A;  3W8H A;  2WVN A;  1ZHY A;  2YLI A;  1TWH A;  2R02 A;  1SF8 A;  2ZXO A;  4LLE A;  4XPY A;  3SEO A;  2BL2 A;  3U2L A;  1Z3I X;  2Y39 A;  4I44 A;  5A6J A;  4NTB A;  3IEE A;  2J45 A;  1U89 A;  3ZG1 A;  3IQC A;  2X51 A;  3MYF A;  1MMD A;  4C3D A;  3AG4 C;  5CI8 A;  4YT4 A;  1D1B A;  5T3W A;  2LK4 A;  1TWC A;  2KJG A;  3EH2 A;  3L8J A;  3NYJ A;  3RH3 A;  4JUR I;  2V26 A;  2HKV A;  2IXM A;  1E2X A;  2XLO A;  2ZD9 A;  4G7Z F;  1Q0G A;  4E18 A;  1QLE C;  1OXK A;  2EPK X;  2GA0 A;  4BJ5 C;  2NUT B;  3MX3 A;  5HV9 A;  5KYN A;  4AE4 A;  3ASN C;  4JCZ A;  3X2Q C;  5L0J A;  3C8G A;  3MYI A;  4Z9I A;  4MQ9 F;  2HJM A;  2J46 A;  1V4A A;  3N0T A;  4CBE A;  4A2N B;  1T01 A;  2Q9A A;  2YL0 A;  1N1C A;  5L0D A;  2KK1 A;  2KQ9 A;  5DVW A;  3SZR A;  4E7S A;  2Q4F A;  4U5B E;  3HKK A;  4CSA C;  2W9Y A;  4C3B A;  4XQ1 A;  2LQG A;  1OQC A;  1J8Y F;  2Q00 A;  3U0C A;  5EK0 A;  5GPG B;  2QUP A;  3UMK A;  2C04 A;  2NG1 A;  2XSE A;  3ABL C;  4RDA A;  3TK0 A;  4E0H A;  1YLM A;  3G4X A;  3GM2 A;  3QVY A;  2X0C A;  4PJM A;  4B6I A;  4FAP B;  5L0I A;  3GEE A;  2A69 F;  2VB6 A;  2ZXP A;  2W4B A;  1TR2 A;  4NCQ A;  4OIN F;  5COF A;  1EKY A;  1RJ9 A;  1WAS A;  3U8P A;  5DQZ A;  1VLT A;  1OCZ C;  2HSQ A;  4LDQ A;  1O3U A;  2PP4 A;  4O6Y A;  2J9U A;  4J32 B;  2KC3 A;  2YZS A;  4U5E E;  5COG A;  3ZVR A;  1Z5Z A;  4O6N A;  2MHR A;  5K0I A;  1Q0F A;  2EIK C;  4C7O A;  1HE1 A;  4U5G A;  2H7B A;  2HV6 A;  2CNW A;  5KYY B;  1NLX A;  2IOQ A;  3TUL A;  1WN0 A;  3GM3 A;  1BZ4 A;  1MND A;  1BR2 A;  3U9M A;  2XL8 A;  2YEV A;  5E3A A;  3F47 A;  3J06 A;  1G4U S;  1RKC A;  1LI5 A;  3SXY A;  2M64 A;  3JRT A;  1WGW A;  2WVQ A;  3VYW A;  4AK9 A;  1D0X A;  3T9O A;  3U2M A;  2EPM X;  2YLD A;  3FXH A;  3JYY A;  4U5C E;  4JEA A;  4JJG A;  5E33 A;  3US6 A;  4EWC A;  2XS8 A;  4EBK A;  2HFI A;  4IGG A;  3AG2 C;  3AGU A;  1FR0 A;  1DOV A;  3NYM A;  3LUT B;  3M4B A;  4I3M A;  2C03 A;  2VCB A;  4EUK B;  4LDK A;  1WWP A;  1SYQ A;  2R05 A;  3RIP A;  4BEJ A;  4EBB A;  5AC4 A;  1M57 C;  2E87 A;  2PBE A;  2ZPA A;  4AE4 B;  2DYS C;  4KI2 A;  3C8G B;  5E3C A;  2JD3 A;  3CSK A;  3M79 A;  2J9W A;  5KYU A;  3EH1 A;  3M4C A;  3QZC A;  5DQT A;  4XTK A;  2LFD A;  2UUI A;  2V3C C;  1ZU5 A;  2IXN A;  1FFH A;  2KYH A;  3O6X A;  5B1A C;  4BJT A;  1SR2 A;  4PAC A;  4BJ5 A;  1JRA A;  1VK5 A;  4C3E A;  2M4E A;  1T6U A;  4WGZ A;  1VB5 A;  3I5Q A;  3JTL O;  2A6H F;  3N24 A;  5F5H A;  4CS8 C;  3K7D A;  3R7C A;  1YZA A;  2OU6 A;  3B9Q A;  4Z9H A;  1LE4 A;  5KYX A;  2XL6 A;  2LCH A;  4XEF A;  4E7Z A;  1VMA A;  4JTC B;  4RBN A;  4ULV A;  2CGE A;  2H7O A;  2YVK A;  3ITF A;  4H54 A;  4EIY A;  3DE9 A;  4MS2 A;  4CSA A;  3JRM O;  3SXZ A;  4JJF A;  2HMZ A;  1RJ9 B;  2QNL A;  2YL1 A;  1WOL A;  1FTS A;  3HNK A;  4L6R A;  1O87 A;  2GFH A;  3EHM A;  5DLJ A;  3S27 A;  4KBL A;  3RW0 A;  3V5Z A;  3BEH A;  2R25 A;  1A7V A;  3UNG C;  2WVO A;  4MVU A;  5F28 E;  2OEX A;  2OQM A;  4DVZ A;  4YL0 A;  4C7O B;  2L6F A;  4DJ9 A;  4ULW A;  3IQT A;  3JYH A;  2H8A A;  4JRZ A;  2OJQ A;  4XPX A;  2W4M A;  4AL0 A;  3ZDL A;  4J30 B;  3AG1 C;  3LEV A;  3GWN A;  3Q7L A;  2L7A A;  4GEH A;  1TWG A;  2DGJ A;  1V74 B;  3C62 A;  2GDC A;  1TKN A;  2J8W A;  2OEV A;  1VLS A;  1QSP A;  4E0I A;  1OW6 A;  1L7C A;  2UUH A;  4DBR A;  4ER9 A;  4PR9 A;  2GWW A;  1RMV A;  1SZI A;  4PK4 A;  4OD5 A;  4CDV A;  4CIH A;  4GQH A;  1GQA A;  1LKX A;  1GS9 A;  1JAF A;  3DM5 A;  3KMI A;  5A6B D;  3B29 A;  2WL8 A;  5CI9 A;  1WAT A;  3KH2 A;  3U3F A;  2TMV P;  4P6I C;  3WHN A;  3POV A;  3B0U X;  1LE2 A;  5FZT A;  5KYU B;  1FMW A;  4HEA J;  1QQ3 A;  3GOD A;  4J7T A;  4YT5 A;  1I4Z A;  3PCV A;  4IWB A;  2R7V A;  4EHP A;  1G8X A;  1GGQ A;  3NKD A;  1JPJ A;  3UGO A;  1LS1 A;  2XLE A;  3KYI A;  3LJB A;  2XLW A;  2XLD A;  4U9D A;  3PMR A;  4DBQ A;  2RSE B;  2H7V C;  1DOW A;  3JSZ A;  3LNM B;  4PFO A;  1LVK A;  2I15 A;  4BJ6 C;  4Q4Z F;  3EG9 A;  3RQG A;  5KYX B;  1OW8 A;  3KPH A;  3V5Y A;  2YRF A;  2EIL C;  4F4B A;  3AQB A;  3HNL A;  1Y6D A;  2XXA B;  3TOL A;  5JSL A;  3RVY A;  3DJN B;  4IRU A;  4ZLC A;  1A41 A;  3LLK A;  4H4K C;  2R7U A;  5BQI A;  4G78 A;  5T1D B;  3IHU A;  3C7J A;  3CZ6 A;  4CS8 A;  1NFN A;  4JIO A;  3RVZ A;  4YWQ A;  3IQ6 A;  3RF3 A;  2JX0 A;  2R7O A;  2ZXR A;  3GOR A;  3E70 C;  2CYD A;  2NPU A;  3HNI A;  4MVR A;  4X0R A;  3RFY A;  3SP1 A;  1AVO B;  2J0W A;  3BRJ A;  5A6K A;  1E83 A;  2HZ8 A;  2NSG A;  5JS5 A;  1AUE A;  1PV3 A;  4U5H A;  2R7S A;  3FOO A;  3LS1 A;  3VAY A;  1D0Z A;  1OCC C;  3VM6 A;  3JSE O;  1RXQ A;  5CIV A;  2AWY A;  3PHF 2;  3RQE A;  3S0X A;  4Q5S F;  4IAR A;  1XWJ A;  3S28 A;  2I8B A;  3K33 A;  3GM1 A;  1PCX A;  3LNR A;  3MFN A;  3DM9 B;  3PDM P;  1ZZP A;  5L0G A;  4MND A;  1RCP A;  2R03 A;  1ZW2 A;  5AC5 A;  1CPR A;  3DMD A;  2P6V A;  3A11 A;  3NMJ A;  2PF4 E;  3DAF A;  3HNJ A;  1CGN A;  2YHS A;  2R7W A;  4MVM A;  2R7R A;  5L0H A;  1G4W R;  1G5Z A;  2P1A A;  1LIH A;  2PNO A;  2YWA A;  2VC9 A;  3M15 A;  1UG7 A;  2IM8 A;  3EJN A;  1F1M A;  2AU5 A;  3W4Y A;  2LSE A;  3K6B A;  1YA9 A;  2FFH A;  1LI7 A;  4CX9 A;  1YAU O;  1HMO A;  1S05 A;  4LDR A;  3QTH A;  1EA8 A;  3KYJ A;  1YYX A;  4YT2 A;  3K1I C;  2ETS A;  1I5N A;  1YA7 O;  3DE8 A;  3UMH A;  2PX3 A;  3O55 A;  4JCH A;  4XPW A;  3O39 A;  4JKV A;  4FX5 A;  2Y69 C;  4JC7 A;  2W45 A;  1PD0 A;  3A9C A;  3DZA A;  2CCY A;  3HTK C;  3EZI A;  2RD9 A;  3DXJ F;  3ASO C;  2KW3 C;  5D92 A;  5JP7 A;  1VTM P;  1M56 C;  5JRA A;  4CS9 C;  1PD1 A;  3EZH A;  2R7T A;  5BUO A;  3B71 A;  3JZ0 A;  3DD7 A;  4IJJ A;  4O79 A;  3LAY A;  3DJU B;  2A1D D;  1VOM A;  3EGX A;  2BE5 F;  1QZX A;  2P0N A;  3EG9 B;  4MW8 A;  5JT4 A;  2MYS A;  3M1C B;  4BEM J;  4LER A;  1ORJ A;  4N6C A;  1JR8 A;  1KNY A;  2KGO A;  1LM3 B;  3ATP A;  3NRH A;  3AQC A;  1FAP B;  2R7Q A;  2XLV A;  3CQZ A;  2XM4 A;  3FVY A;  4O7G A;  4WJ0 A;  3TQO A;  5A69 A;  1C03 A;  1OW7 A;  2VAS A;  1B68 A;  4BPM A;  1TWA A;  3B0V C;  1H7I A;  1OCO C;  2D5R B;  5DS5 A;  3QVZ A;  1QVX A;  4BJ6 A;  1WTY A;  2G62 A;  4P9T A;  1I4Y A;  1ZHX A;  2AVK A;  3ZWI A;  5EHH A;  3AGT A;  3Q6M A;  4DVY P;  4GYT A;  2R7X A;  4CDA A;  3RKO F;  2A0U A;  4MTO A;  5COM A;  5JLI A;  1Y4C A;  1H6G A;  2YL7 A;  3K1H A;  4LAC B;  5KYW A;  3T6B A;  3WOD F;  1FNT c;  3MLG A;  4W8K A;  1MQV A;  3I4U A;  3C18 A;  5DS6 A;  2J9V A;  3L34 A;  4OIO F;  3G50 A;  4G7O F;  3ZTZ A;  1QPU A;  4NC3 A;  3JT1 A;  5FCL A;  4U5F E;  4XLN F;  4BG0 A;  5DS4 A;  2ASR A;  2P7V A;  2OOC A;  3W2W A;  2QY9 A;  2B0J A;  2LFF A;  3FAJ A;  3WG7 C;  2G3K A;  3T4R A;  2DI3 A;  3U5S A;  4JEB A;  5L0C A;  1KTM A;  2EIM C;  3CEX A;  4JE9 A;  1HY5 A;  1YJG A;  3FMS A;  2WZG A;  4MW3 A;  4LLC A;  1T6I A;  1BR1 A;  1BDJ B;  2L81 A;  3NYL A;  4QI0 A;  3L1M A;  1YDI A;  1JMW A;  4NY3 A;  2YKZ A;  3LES A;  2J7P D;  2HMQ A;  1Z63 A;  3QW1 A;  4QDL A;  2IBF A;  4ANJ A;  4JVS A;  1O5H A;  4E17 A;  1V54 C;  4DXW A;  3V5X A;  4CDY A;  3E9V A;  1YYJ A;  2CW0 F;  5HSW A;  2EIJ C;  1ZHW A;  2CDQ A;  3UGP A;  2Q9C A;  1J8M F;  1S7Z A;  3DAG A;  4OD4 A;  4I1M A;  2HSB A;  1ZVZ A;  3O10 A;  5E2Q A;  4EBJ A;  4MVS A;  3B0P A;  3W2V A;  3ZQY A;  3DKA A;  1NU7 D;  1HMD A;  3EPV A;  4NTF A;  3SXK A;  4PJN A;  4HE8 D;  1EI7 A;  3K1I A;  1M2V A;  3T6G B;  1A7D A;  1MNE A;  3GWL A;  3KKB A;  3U8V A;  4DRI B;  2AP3 A;  1VYI A;  5IY5 C;  3EGX B;  3S90 A;  1RKE A;  3N2Z B;  4IAQ A;  5BQH A;  2Y3B A;  2YLG A;  3RQF A;  2IYL D;  1CPQ A;  1K05 A;  2A0B A;  2L6H A;  3NKE A;  5AGF A;  3G4Z A;  2KNH A;  4PJL A;  3C63 A;  3H2U A;  4KNV A;  3U9J A;  4JTD B;  1OXB A;  4CS9 A;  4XWJ A;  3ZTM A;  1BBH A;  4O6M A;  3EFO A;  2WZL A;  3QW0 A;  4CJG A;  2EPN A;  3ZC4 A;  3JCU Q;  3UR3 C;  3NMK A;  4U9E A;  2J0X A;  4Z9J A;  2MWQ A;  4QI2 A;  4P9F A;  4BJ1 A;  3NG1 A;  3H2V A;  3QMK A;  1OKK D;  1MMG A;  4MVZ A;  1AEP A;  4FWV A;  4NTA A;  4EKW A;  2J9B A;  2ZXW C;  5KYW B;  1MMN A;  2D4U A;  3ZQV A;  4MVQ A;  2OJE D;  4AL1 A;  1R4T A;  1U0B B;  2PX0 A;  3IPM O;  3U3B A;  2Q3T A;  2QLA A;  2XLH A;  3SYN A;  1Z6A A;  2WB7 A;  3V7O A;  1NBB A;  4K0D A;  3S29 A;  3FOP A; 
#chains in the Genus database with same CATH homology
 2XRH A;  3KL4 A;  3LLI A;  3X1O A;  2HV7 A;  4OIQ F;  3HJC A;  4YN0 B;  2A6E F;  3EGD A;  4ZLD A;  2XL4 A;  4RD9 A;  3ZIB A;  1ZU4 A;  1D1A A;  4G0H A;  2VH3 A;  4K7B A;  5L3Q A;  2NUP A;  3EHN A;  3ECS A;  3TD7 A;  4FES A;  1NZE A;  3K66 A;  1ZHT A;  4IAO A;  4N06 A;  2Q9B A;  4HFK B;  4YT8 A;  1D1C A;  1D0Y A;  4DOZ A;  1M2V B;  3ZSU A;  1SMY F;  3W8I A;  4PFP A;  1V55 C;  4KNW A;  1IW7 F;  3SNH A;  2O9X A;  2L9J A;  3Q6N A;  2G3V A;  1IZM A;  2IXP A;  4G7H F;  4OIP F;  3OWT A;  3EFO B;  4HFF B;  1KU2 A;  2Y3H A;  5L3V A;  4OIR F;  2FGY A;  1NU9 C;  3LS0 A;  2CNW D;  2Y3G A;  3NDB B;  4M63 A;  1FFT C;  1Z23 A;  2NUT A;  3H65 A;  2Y3D A;  1JPN A;  2Z15 A;  2J7P A;  3UMI A;  4XLP F;  1ST6 A;  5T3T A;  1ZHZ A;  3OEO A;  4JW1 A;  3OA1 A;  3AG3 C;  4JZA A;  2WZF A;  2QTV A;  4PJJ A;  5B3S C;  2IXO A;  3EGD B;  3L0I A;  3EQL F;  3ABK C;  2EIN C;  3Q7G A;  2XXA A;  5D91 A;  3FDQ A;  1NG1 A;  2PFD A;  2OG2 A;  1W2W A;  1BR4 A;  1M2O A;  2NUP B;  2OCC C;  4KC9 A;  1FMV A;  3HLZ A;  1VYK A;  3FHD A;  2DYR C;  3F46 A;  3I5P A;  5B1B C;  3ABM C;  4YJW A;  4U5D E;  1OCR C;  1MMA A;  4I1O B;  5KYY A;  1OKK A;  3GAN A;  4AX2 A;  3RYL A;  1ZYR F;  4CS7 A;  3T6J A;  5F5F A;  4Q7C A;  5EGY A;  2A68 F;  3W8H A;  2WVN A;  1ZHY A;  1TWH A;  2ZXO A;  1SF8 A;  3SEO A;  4LLE A;  1Z3I X;  2Y39 A;  4I44 A;  3IEE A;  2J45 A;  3ZG1 A;  4C3D A;  2X51 A;  1MMD A;  3AG4 C;  5CI8 A;  4YT4 A;  1D1B A;  5T3W A;  3EH2 A;  1TWC A;  2KJG A;  3NYJ A;  3RH3 A;  4JUR I;  2V26 A;  2IXM A;  4G7Z F;  1QLE C;  4BJ5 C;  2NUT B;  3MX3 A;  5KYN A;  4AE4 A;  3ASN C;  3X2Q C;  4MQ9 F;  2J46 A;  4CBE A;  3N0T A;  4A2N B;  2Q9A A;  1N1C A;  2KQ9 A;  5DVW A;  3SZR A;  4E7S A;  4U5B E;  4CSA C;  2W9Y A;  4C3B A;  1J8Y F;  3UMK A;  2C04 A;  2NG1 A;  2XSE A;  3ABL C;  4RDA A;  4B6I A;  4PJM A;  2A69 F;  2VB6 A;  2ZXP A;  2W4B A;  1TR2 A;  4OIN F;  1RJ9 A;  5DQZ A;  1OCZ C;  2PP4 A;  4O6Y A;  2J9U A;  4J32 B;  4U5E E;  2YZS A;  3ZVR A;  1Z5Z A;  4O6N A;  2EIK C;  4C7O A;  4U5G A;  2H7B A;  2HV6 A;  2CNW A;  5KYY B;  2IOQ A;  1MND A;  1BR2 A;  2YEV A;  5E3A A;  3F47 A;  3VYW A;  3JRT A;  1WGW A;  2WVQ A;  4AK9 A;  1D0X A;  4U5C E;  4JJG A;  5E33 A;  4EWC A;  3AG2 C;  3NYM A;  4I3M A;  2C03 A;  3RIP A;  4BEJ A;  4EBB A;  1M57 C;  2E87 A;  2ZPA A;  4AE4 B;  2DYS C;  4KI2 A;  5E3C A;  2JD3 A;  3CSK A;  2J9W A;  5KYU A;  3EH1 A;  3QZC A;  5DQT A;  4XTK A;  2V3C C;  1ZU5 A;  2IXN A;  1FFH A;  3O6X A;  5B1A C;  4BJT A;  4BJ5 A;  1VK5 A;  4C3E A;  2M4E A;  3I5Q A;  5F5H A;  2A6H F;  3N24 A;  4CS8 C;  3K7D A;  3B9Q A;  5KYX A;  4E7Z A;  1VMA A;  4RBN A;  2CGE A;  2H7O A;  3ITF A;  4CSA A;  4JJF A;  1RJ9 B;  1FTS A;  1O87 A;  2GFH A;  3EHM A;  5DLJ A;  3S27 A;  4KBL A;  3UNG C;  2WVO A;  4DVZ A;  4C7O B;  4ULW A;  3JYH A;  2W4M A;  4J30 B;  3AG1 C;  3LEV A;  3Q7L A;  4GEH A;  1TWG A;  2DGJ A;  1TKN A;  4DBR A;  1SZI A;  4PK4 A;  4OD5 A;  4CIH A;  1LKX A;  3DM5 A;  3KMI A;  2WL8 A;  5CI9 A;  3KH2 A;  4P6I C;  3POV A;  3B0U X;  5KYU B;  1FMW A;  4HEA J;  3GOD A;  4YT5 A;  4IWB A;  2R7V A;  1G8X A;  3NKD A;  1JPJ A;  3UGO A;  1LS1 A;  3LJB A;  4DBQ A;  3PMR A;  2H7V C;  3JSZ A;  4Q4Z F;  4PFO A;  1LVK A;  4BJ6 C;  3EG9 A;  5KYX B;  2EIL C;  4F4B A;  3AQB A;  2XXA B;  3DJN B;  4IRU A;  4ZLC A;  3LLK A;  4H4K C;  2R7U A;  5T1D B;  3CZ6 A;  4CS8 A;  4YWQ A;  2R7O A;  2ZXR A;  3E70 C;  4X0R A;  3RFY A;  3SP1 A;  2J0W A;  2R7S A;  4U5H A;  3LS1 A;  3VAY A;  1D0Z A;  1OCC C;  3PHF 2;  4Q5S F;  3S0X A;  3S28 A;  2I8B A;  3K33 A;  1PCX A;  3LNR A;  3DM9 B;  4MND A;  3DMD A;  2P6V A;  2PF4 E;  3DAF A;  2R7W A;  2YHS A;  2R7R A;  3EJN A;  2LSE A;  3K6B A;  2FFH A;  4YT2 A;  3K1I C;  3UMH A;  2PX3 A;  4JCH A;  3O39 A;  4FX5 A;  2Y69 C;  2W45 A;  1PD0 A;  3DZA A;  3HTK C;  3EZI A;  3DXJ F;  3ASO C;  2KW3 C;  5D92 A;  1M56 C;  4CS9 C;  1PD1 A;  3EZH A;  2R7T A;  5BUO A;  4IJJ A;  3DD7 A;  4O79 A;  3LAY A;  3DJU B;  2A1D D;  1VOM A;  3EGX A;  2BE5 F;  1QZX A;  3EG9 B;  2MYS A;  3M1C B;  4LER A;  2KGO A;  3NRH A;  3AQC A;  3CQZ A;  2R7Q A;  3FVY A;  4O7G A;  4WJ0 A;  2VAS A;  5DS5 A;  3B0V C;  1TWA A;  1OCO C;  2D5R B;  4BJ6 A;  2G62 A;  1ZHX A;  5EHH A;  3Q6M A;  4DVY P;  4GYT A;  2R7X A;  3RKO F;  3K1H A;  5KYW A;  4LAC B;  3T6B A;  3WOD F;  3MLG A;  4W8K A;  3I4U A;  5DS6 A;  2J9V A;  3L34 A;  4OIO F;  4G7O F;  3JT1 A;  5FCL A;  4U5F E;  4XLN F;  4BG0 A;  5DS4 A;  2P7V A;  3W2W A;  2QY9 A;  2B0J A;  3FAJ A;  3WG7 C;  2G3K A;  3T4R A;  2EIM C;  2WZG A;  4LLC A;  1BR1 A;  2L81 A;  3NYL A;  4QI0 A;  4NY3 A;  3LES A;  2J7P D;  1Z63 A;  4QDL A;  4ANJ A;  4JVS A;  1O5H A;  1V54 C;  3E9V A;  2CW0 F;  5HSW A;  2EIJ C;  1ZHW A;  2CDQ A;  3UGP A;  2Q9C A;  1J8M F;  1S7Z A;  3DAG A;  4OD4 A;  4I1M A;  5E2Q A;  3B0P A;  3W2V A;  1NU7 D;  3EPV A;  4PJN A;  4HE8 D;  1M2V A;  1MNE A;  3KKB A;  1VYI A;  5IY5 C;  3EGX B;  3N2Z B;  2Y3B A;  2IYL D;  3NKE A;  2KNH A;  4PJL A;  4KNV A;  4CS9 A;  4XWJ A;  4O6M A;  3EFO A;  2WZL A;  3ZC4 A;  3JCU Q;  3UR3 C;  2J0X A;  2MWQ A;  4QI2 A;  4BJ1 A;  3NG1 A;  3QMK A;  1OKK D;  1MMG A;  4FWV A;  2ZXW C;  5KYW B;  1MMN A;  2PX0 A;  2Q3T A;  3SYN A;  1Z6A A;  2WB7 A;  3V7O A;  4K0D A;  3S29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...