2PP4A

Solution structure of eto-tafh refined in explicit solvent
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
107
structure length
107
Chain Sequence
GARQLSKLKRFLTTLQQYGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein ETO
publication title A TAF4-homology domain from the corepressor ETO is a docking platform for positive and negative regulators of transcription
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 34
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2pp4A00
2P6VA 2H7BA 2PP4A 2KNHA
chains in the Genus database with same CATH superfamily
2TMVP 4XLPF 2J46A 3TK0A 4IARA 3T6BA 1M2VA 1WASA 3MFNA 1YVIA 2ZD9A 3OA1A 4MVUA 2Q7RA 5DS5A 4E18A 1U0BB 4OIOF 1RJ9B 2HJ3A 4WGZA 2KNHA 1H7IA 1U89A 4JVSA 4ULWA 1T6UA 1M57C 2R05A 2WVQA 1YA7O 3FDQA 3HNKA 4JCZA 1EI7A 1C02A 1G4WR 4G78A 5L0DA 1R4TA 4D4XA 3K7DA 4YJWA 3Q7GA 4LERA 2A0BA 4BEMJ 1APCA 4MW8A 5TJ5E 4CS7A 3VF0A 1RKCA 2FFHA 2W9YA 2XL6A 2IXNA 3LS1A 5DVWA 5KYWA 2FGYA 3HNJA 3O39A 1OXKA 3U2MA 5L0HA 3N2ZB 2KGOA 2B0HA 1TWAA 3M15A 4K0DA 1E86A 3ABLC 1QPUA 1TWHA 2L6FA 3JSEO 1JPJA 1SR2A 4F4BA 2KQ9A 2ZXPA 3HNLA 4NCQA 4DRIB 4MVZA 2PFDA 1IW7F 3H2UA 1CPQA 1ZYRF 1FMWA 1LVKA 3TULA 3Q6MA 1Z63A 4CJGA 4PR9A 1LI5A 2L6HA 3ASOC 5D92A 4CDVA 3V7OA 3B0VC 5DQTA 4IWBA 3I4UA 3U0CA 3CEXA 4OIQF 4JEBA 1K05A 4JTAB 2QTVA 1QSPA 1FR0A 4Q5SF 4IJJA 3ASNC 3RYLA 2A69F 2QNLA 1MMNA 1Y6DA 5JUAA 2C04A 1M6TA 2LCHA 5KYUA 1AUEA 2YLIA 2AVKA 3B29A 1G5ZA 3F46A 3X1OA 1M2OA 1ZW2A 3DJNB 1OCOC 4AE4A 5DLJA 3NMIA 3OEOA 1G4US 1R5ID 3O55A 1Z3IX 2YL3A 1A7DA 1NU7D 2OCCC 4CS9A 2Y3HA 4CX9A 4P9TA 2DI3A 2PX0A 1S7ZA 2KJGA 2NUTA 1PD0A 4OIRF 1E2XA 3ABMC 3JCUQ 2J45A 3EQLF 1U6HA 1RXQA 1TQGA 1YAUO 3FHDA 4HEAJ 4L6RA 4XPXA 3V5ZA 2OU6A 2R9RB 3EG9A 3LNRA 1OCCC 4YL3A 3GEEA 2Z15A 3VAYA 2LD6A 3AQBA 2YKZA 1ORYA 1AEPA 1HMOA 1XZQA 3G4XA 3LUTB 4BJ5C 4O6MA 4JEAA 3POVA 4XLNF 3EFOB 1HE9A 4XPYA 1BDJB 3IQTA 3L8IA 3WODF 3CZ6A 1MMAA 2OQMA 3VYWA 5A6BD 1K40A 3KPHA 1D0YA 1BR4A 4MVQA 2OG2A 3GEIA 4KNVA 4LLEA 3U9MA 3L0IA 3LEOA 1WGWA 1BZ4A 4OD5A 1E83A 2WVNA 3U8PA 2GDCA 2G62A 4JRZA 1NZEA 3DM5A 4GEHA 2JPUA 1DOVA 5T3WA 2WZLA 5B3IA 2R7RA 2AWYA 3U3FA 3ZQYA 3U3BA 3N0TA 3EH1A 1KU2A 3W4YA 5BQGA 5B1BC 2H7VC 4QDLA 3KL4A 4EHPA 1JRAA 2EPLX 3AOUA 3S29A 4AK9A 4MTOA 2QUPA 4W8KA 3SXYA 4EWCA 1I4ZA 5A6KA 3GM2A 3EGDB 2Y3DA 2B0JA 2HSBA 4CJOA 3EHNA 3TOMA 4AX2A 5COFA 4E7ZA 3K1HA 1JMWA 3JYHA 2Q9CA 3DKAA 1VYKA 1VLSA 2GA0A 2P0NA 3C63A 3JSZA 4O6NA 4PFPA 3X2QC 3ZC4A 5B3SC 2HV7A 2NUPA 1V54C 4O79A 1T6IA 2IBFA 3B71A 1WTYA 2XM4A 4PJLA 4ONSA 2EPOA 2OEXA 1NSGB 2EIKC 1UFBA 1D0ZA 3DAFA 3SNHA 2MYSA 1AVOB 4YL0A 3EGXA 3W2WA 2XL8A 3QVZA 4DRHB 1YYXA 2C03A 3NMKA 2RD9A 1DOWA 4N6CA 2XLDA 4MW3A 5F28E 1O3UA 3ATPA 3WHNA 4BJ6A 5EHHA 4D4NA 2L81A 1BBHA 1T9KA 1ZHZA 3S28A 4LLCA 4CS8A 3UNGC 1OW6A 1LM3B 1NG1A 2D5RB 2EPMX 2YQYA 2YL1A 4MQ9F 2Q3TA 2NG1A 1D1BA 2DYSC 2R25A 1T5OA 1TKNA 3KKBA 3AGUA 1RKEB 4CIPA 2BE5F 1TFKB 3M79A 5E3CA 2VCBA 3NG1A 4JJFA 5HSWA 1TWGA 3WG7C 3HNIA 3KYJA 2F22A 1FFTC 4KI2A 3EZIA 1A7VA 2HSQA 3C8GB 3C62A 3CQZA 2J9BA 1QQ3A 3EPVA 4AL1A 3UMIA 1ZVZA 1XZPA 3UMHA 2QE9A 3DM9B 1S05A 2XLHA 3E9VA 3K33A 3I5QA 4EBKA 3HTKC 4RDAA 2WL8A 5KYXB 1T01A 4DBRA 3LESA 3VRCA 4Q7CA 2KW3C 1I4YA 1OKKD 3RW0A 4YWQA 4IB4A 4PJJA 4YT8A 3FOPA 2ICWG 2DB4A 2UUHA 3HKKA 3L1MA 5DQZA 3S27A 3S84A 1D1AA 1BR1A 2ZXOA 2XXAA 1TWCA 3AJMA 3SYNA 2A0UA 3AG4C 4E0IA 2LIGA 5F5FA 4J30B 3EHMA 3A9CA 2NSGA 4C3EA 1NFOA 3RVYA 4BJTA 2YEVA 2KYHA 3RIPA 1M56C 4BPMA 4PJNA 3HLZA 2Q9AA 5AGFA 4CIHA 1V4AA 3L8JA 2R03A 5BUOA 2CCYA 3IQ5A 1LE4A 1Q0DA 1LS4A 4LDKA 1FAPB 4FESA 3RQFA 3S9OA 5A6BA 1ST6A 4MTGA 4J32B 1JOGA 2CYDA 3G50A 1Q0MA 1GQAA 2W4MA 2ZPAA 3JT1A 4I3MA 1JPNA 4WABA 3JYYA 3RVZA 4U9EA 4CSAC 2WVOA 4E17A 2YLGA 3MYIA 4N4WA 4E7SA 2VC9A 1L3PA 2J7PD 1YJGA 3TOLA 2W4BA 1O87A 3QMKA 2O9XA 2PNOA 3ZG1A 2Y3GA 1E84A 2XLWA 3B0PA 3FAPB 4Z9HA 3AG3C 1MNEA 5A6JA 1Q0KA 2YVKA 3PDMP 2J0WA 3DAGA 4ULVA 4YL1A 1PD1A 1D0XA 5L0CA 3ITFA 2YL7A 4NTAA 4EBJA 4MVOA 1FNTc 2R7SA 2OJQA 4CDAA 4G0HA 2P7VA 2J9UA 2LSEA 5AC5A 2HUJA 1LS1A 2MWQA 2NUPB 3H65A 3N24A 3Q6NA 1EQ1A 3QTHA 1C17M 4N06A 2HV6A 3LLKA 1CGNA 3DMDA 3TQOA 5JP7A 2YZSA 4Q4ZF 5B1AC 1QVXA 1RJ9A 2CNWA 3MYFA 4MTFA 3SP1A 2GFHA 3ZSUA 4EUKB 5KYYB 4OIPF 4MVSA 2L9JA 2JX0A 4MVMA 1OCRC 2D4UA 2HS5A 2W45A 3F47A 5T3TA 3U8VA 2NSFA 4JTCB 4DVZA 1MMGA 1A41A 1OW8A 3DI5A 3RFYA 3OWTA 2IM8A 4E0HA 4MS2A 4XEKA 5GPGB 5L0JA 3JRMO 4BJ1A 2YHSA 2VASA 3K1IA 4WJ0A 3AG1C 3IQ6A 3UR3C 4JURI 1JAFA 3LLIA 5IY5C 1L7CA 3ECSA 4OINF 2E87A 4C3DA 5BQIA 3U9JA 5FCLA 2HMZA 4YT5A 4G7ZF 1ZHXA 2Q00A 2EPNA 3FAJA 1A0BA 3GM3A 4DBQA 5L0GA 3KMIA 5E2QA 4UDVA 2X51A 2VH3A 5T1DB 1VLTA 1J8YF 3QW1A 1LKXA 2GWWA 1M2VB 2PBEA 4MNDA 3C7JA 2H7BA 3GM1A 2XS1A 3TJ5A 2DYRC 3FMSA 3GWNA 3DXJF 1C03A 3PCVA 2Q4FA 4XEVA 3UGOA 4ZLDA 1KTMA 2R7XA 3ZVRA 1PV3A 5L3QA 2G3VA 3C8ZA 2YRFA 3RQGA 2VB6A 3DZAA 4PK4A 3VM6A 3B0UX 4PACA 3TJ6A 2L6GA 2CNWD 1YARO 1MNDA 2HZ8A 3KH2A 1YDIA 1CGOA 2I8BA 3KYIA 4M63A 1OW7A 1OCZC 1JR8A 3LNMB 2M4EA 5KYWB 2AWCA 3DE8A 3M4CA 2IXPA 4U9DA 1OKKA 3EJNA 2XRHA 3ZQVA 2DGJA 2OOCA 1FTSA 2QY9A 4NQFA 2IYLD 2UUIA 3QW0A 1SZIA 1VK5A 4BJ5A 1MQVA 4RBNA 3T4RA 4G7HF 2AU5A 1LIHA 4MVRA 2EIJC 4IAQA 3ZWIA 4ANJA 5E33A 3NRHA 3ZIBA 3MX3A 3S90A 1VMAA 1V74B 2KC3A 4JC7A 3DWWA 4RD9A 3EH2A 4YK5A 1TFOB 2XLVA 5JS5A 2YL0A 3NYJA 2P61A 3NYLA 4B6IA 4I1OB 1K04A 1D1CA 3T6JA 1I5NA 2IXOA 4FWVA 4W8PA 3V5XA 2R02A 4IGGA 3AQCA 5L0IA 1E85A 1VTMP 2IXMA 1RMVA 1UG7A 4EIYA 1QKRA 3EFOA 3K66A 4U5HA 5JLIA 1Z23A 1O5HA 4A2NB 5KYUB 4XPWA 1ZHWA 4AE4B 3JZ0A 4JTDB 4P6IC 256BA 1A7EA 2J7PA 1SMYF 4JJGA 3S0XA 1HW2A 3L34A 2R7UA 4FX5A 2R7VA 1NFNA 5CIVA 4NY3A 5K0IA 1QLEC 4XTKA 5D91A 1EKYA 3ZTZA 2AP3A 1NBBA 2NUTB 1PCXA 2QLAA 3CAXA 4A4AA 2P6VA 2J8WA 5JRAA 4YT4A 1FMVA 1SYQA 1RCPA 3I5PA 3G4ZA 1GS9A 5L3VA 5AC4A 4G7OF 3GANA 1HW1A 4K1OA 3EG9B 1W2WA 5A69A 3EGDA 2OJED 4IAOA 1VOMA 1WN0A 2H7OA 2A6EF 2Y39A 1NU9C 5DS6A 2A68F 4CS9C 2EPKX 3JTLO 4BEJA 4CBEA 2PP4A 4H54A 4Z9IA 3IHUA 4LACB 4LDRA 2J9WA 2LK4A 1OR3A 4CDYA 3K6BA 2Y69C 2YWAA 3M4BA 3MLGA 3Q7LA 3SXMA 3IEEA 3V5YA 1CGME 2M64A 4NC3A 2V26A 3AG2C 3FOOA 3W8IA 1ZHTA 5FZTA 1Y4CA 3US6A 2XSEA 3DD7A 4U5EE 3RF3A 3FVYA 4LDQA 4R32A 2Y3BA 4U5DE 4U5GA 2Q9BA 3RH3A 4WGYA 2PF4E 4JKVA 4U5FE 1WATA 1EA8A 2GAQA 1YZCA 2XM0A 4XWJA 2XL4A 2XLMA 2ZXRA 4H4KC 2X0CA 5A6AA 2R7WA 4JW1A 3J06A 3K1IC 4C7OA 3GEHA 2KSFA 1RKEA 4Z9JA 1ORSC 3PHF2 4KNWA 4KBLA 4DRJB 3JRTA 3SEOA 2WZFA 2HFIA 1YZAA 2RSEB 1XWJA 5JT4A 2J9VA 4PFOA 4XQ1A 3R7CA 1ZU4A 4QI2A 1T6QA 2A1DD 2ZXWC 4YT2A 3CSKA 3WAQA 3B9QA 3C8GA 3NKEA 2XLOA 4IRUA 3EGXB 1VB5A 3O10A 1N1CA 2CGEA 3MBGA 4C3BA 1QZXA 5KYXA 1SF8A 4N6HA 5F5HA 1LE2A 2HMQA 4I44A 4OD4A 2ETSA 3LS0A 4X0RA 5KYNA 1Q0FA 3RQEA 1IZMA 2KK1A 3QVYA 5HV9A 4DVYP 4QI0A 2J0XA 1OQCA 2LP4A 4P9FA 4U5BE 5EGYA 2WB7A 2NPUA 1B68A 2XS8A 3E70C 4I1MA 1MMDA 2ASRA 3U2LA 4AL0A 2BC5A 3QZCA 3NKDA 3GWLA 4KC9A 4CSAA 3NYMA 1V55C 1YLMA 2IOQA 2OEVA 2P1AA 3R2PA 3ZDLA 4BJ6C 5L0FA 1H9TA 2G3KA 4GQHA 4J7YA 1ZW3A 2OKUA 3ABKC 3DE9A 2I15A 4CS8C 3M1CB 4J7TA 4JCHA 4YN0B 4EKWA 4XEFA 4NTFA 1ORJA 3TD7A 1Z5ZA 2VCCA 3H2VA 3IQCA 5EK0A 5COGA 4HFKB 3C8GD 3HJCA 2JD3A 3SXKA 4PJMA 3T9OA 2LFFA 2CW0F 2LQGA 3GORA 3UMKA 4DXWA 1BR2A 1ZHYA 4JIOA 3UGPA 2XXAB 1GGQA 2XLEA 3A11A 1FFHA 2YLDA 5DS4A 5E3AA 1TR2A 1CPRA 1F1MA 2HJMA 3C18A 1ZZPA 3DJUB 4JZAA 5COMA 4EBBA 4O7GA 1YA9A 2LFDA 4BG0A 1WOLA 2L7AA 2WZGA 3NMJA 3W2VA 1HE1A 5JVEA 5CI9A 1Q0GA 1LI7A 3ZTMA 4DOZA 3SZRA 2EINC 3SXZA 3EZHA 1HMDA 2EIMC 3W8HA 4FAPB 5BQHA 2BL2A 3AGTA 3RKOF 1G8XA 3T6GB 4ZLCA 3IPMO 1WWPA 2MHRA 3GODA 2FAPB 4HFFB 4U5CE 2HKVA 1YYJA 2PX3A 3LAYA 5KYYA 2R7TA 4K7BA 4DJ9A 2R7QA 1J8MF 1NLXA 3FXHA 2R7OA 2A6HF 3LEVA 2V3CC 1OR2A 1LPEA 2VCAA 1HY5A 1VYIA 1Z6AA 3O6XA 3PMRA 3BRJA 1H6GA 4GYTA 4HE8D 4JE9A 2CDQA 2H8AA 4C7OB 2EILC 4NTBA 1ZU5A 3LJBA 3NDBB 1KNYA 5JSLA 3BEHA 1Z7Qc 1OXBA 3U5SA 4O6YA 1GM5A 4ER9A 5CI8A 1H9GA
chains in the Genus database with same CATH topology
4XLPF 2J46A 3T6BA 1M2VA 3OA1A 5DS5A 4OIOF 1RJ9B 2KNHA 4JVSA 4ULWA 1M57C 2WVQA 3FDQA 3K7DA 4YJWA 3Q7GA 4LERA 4CS7A 3LS1A 2FFHA 2W9YA 2IXNA 5DVWA 5KYWA 2FGYA 3O39A 3N2ZB 2KGOA 1TWAA 4K0DA 3ABLC 1TWHA 1JPJA 4F4BA 2KQ9A 2ZXPA 2PFDA 1IW7F 1ZYRF 1FMWA 1LVKA 1Z63A 3Q6MA 3ASOC 5D92A 3V7OA 3B0VC 5DQTA 4IWBA 3I4UA 4OIQF 2QTVA 4Q5SF 4IJJA 3ASNC 3RYLA 2A69F 1MMNA 2C04A 5KYUA 3X1OA 5DLJA 4AE4A 3F46A 1M2OA 3DJNB 1OCOC 3OEOA 1Z3IX 1NU7D 2OCCC 4CS9A 2Y3HA 2PX0A 1S7ZA 2KJGA 2NUTA 1PD0A 4OIRF 3ABMC 3JCUQ 2J45A 3EQLF 3FHDA 4HEAJ 3EG9A 3LNRA 1OCCC 3VAYA 2Z15A 3AQBA 4BJ5C 3POVA 4O6MA 4XLNF 3EFOB 3WODF 3CZ6A 1MMAA 3VYWA 1BR4A 1D0YA 2OG2A 4KNVA 4LLEA 3L0IA 4OD5A 1WGWA 2WVNA 2G62A 1NZEA 3DM5A 4GEHA 5T3WA 2WZLA 2R7RA 3N0TA 3EH1A 1KU2A 5B1BC 2H7VC 4QDLA 3KL4A 2R7SA 3S29A 4AK9A 4EWCA 4W8KA 3EGDB 2Y3DA 2B0JA 3EHNA 4AX2A 4E7ZA 3K1HA 3JYHA 2Q9CA 1VYKA 4PFPA 3JSZA 3X2QC 4O6NA 5B3SC 3ZC4A 2HV7A 2NUPA 1V54C 4O79A 4PJLA 2EIKC 1D0ZA 3DAFA 3SNHA 2MYSA 3W2WA 3EGXA 2C03A 4BJ6A 5EHHA 2L81A 1ZHZA 3S28A 4LLCA 4CS8A 3UNGC 1NG1A 2D5RB 4MQ9F 2Q3TA 2NG1A 1D1BA 2DYSC 3KKBA 1TKNA 2BE5F 5E3CA 3NG1A 4JJFA 5HSWA 1TWGA 3WG7C 4KI2A 1FFTC 3EZIA 3CQZA 3EPVA 3UMIA 3UMHA 3DM9B 3E9VA 3K33A 3I5QA 5KYXB 3HTKC 4RDAA 2WL8A 4DBRA 3LESA 4Q7CA 2KW3C 1OKKD 4YWQA 4PJJA 4YT8A 5DQZA 3S27A 1D1AA 1BR1A 2ZXOA 2XXAA 1TWCA 3SYNA 3AG4C 5F5FA 4J30B 3EHMA 4C3EA 4BJTA 2YEVA 3RIPA 1M56C 4PJNA 3HLZA 2Q9AA 4CIHA 5BUOA 4FESA 1ST6A 4J32B 4I3MA 2W4MA 2ZPAA 3JT1A 1JPNA 4CSAC 2WVOA 4E7SA 3ZG1A 2J7PD 2W4BA 1O87A 3QMKA 2O9XA 2Y3GA 3B0PA 3AG3C 1MNEA 2J0WA 3DAGA 1PD1A 1D0XA 3ITFA 4G0HA 2P7VA 2J9UA 2LSEA 1LS1A 2MWQA 2NUPB 3H65A 3N24A 3Q6NA 4N06A 2HV6A 3LLKA 3DMDA 4Q4ZF 2YZSA 5B1AC 1RJ9A 2CNWA 3SP1A 5KYYB 4OIPF 2GFHA 3ZSUA 2L9JA 1OCRC 5T3TA 2W45A 3F47A 4DVZA 1MMGA 3RFYA 3OWTA 4BJ1A 2YHSA 2VASA 4WJ0A 3AG1C 3UR3C 4JURI 3LLIA 5IY5C 3ECSA 4OINF 2E87A 4C3DA 5FCLA 4YT5A 4G7ZF 1ZHXA 3FAJA 4DBQA 3KMIA 5E2QA 2X51A 2VH3A 5T1DB 1J8YF 1LKXA 4MNDA 1M2VB 2H7BA 2DYRC 3DXJF 3UGOA 4ZLDA 2R7XA 3ZVRA 5L3QA 2G3VA 2VB6A 3DZAA 4PK4A 3B0UX 2CNWD 1MNDA 3KH2A 2I8BA 4M63A 1OCZC 5KYWB 2M4EA 2IXPA 1OKKA 3EJNA 2XRHA 2DGJA 2QY9A 1FTSA 2IYLD 1SZIA 1VK5A 4BJ5A 3T4RA 4RBNA 4G7HF 4ANJA 2EIJC 5E33A 3NRHA 3ZIBA 3MX3A 1VMAA 4RD9A 3EH2A 3NYJA 3NYLA 4B6IA 4I1OB 3T6JA 1D1CA 2IXOA 4FWVA 3AQCA 2IXMA 3EFOA 3K66A 4U5HA 1Z23A 1O5HA 4A2NB 5KYUB 1ZHWA 4AE4B 4P6IC 2J7PA 1SMYF 4JJGA 3S0XA 3L34A 2R7UA 4FX5A 2R7VA 4NY3A 1QLEC 4XTKA 5D91A 2NUTB 1PCXA 2P6VA 4YT4A 1FMVA 3I5PA 5L3VA 4G7OF 3GANA 3EG9B 1W2WA 3EGDA 4IAOA 1VOMA 2H7OA 2A6EF 2Y39A 1NU9C 5DS6A 2A68F 4CS9C 4BEJA 4CBEA 2PP4A 4LACB 2J9WA 3K6BA 2Y69C 3MLGA 3Q7LA 3IEEA 2V26A 3AG2C 3W8IA 1ZHTA 2XSEA 3DD7A 4U5EE 3FVYA 2Y3BA 4U5DE 4U5GA 2Q9BA 3RH3A 2PF4E 4U5FE 4XWJA 2XL4A 4H4KC 2ZXRA 2R7WA 4JW1A 3K1IC 4C7OA 3PHF2 4KNWA 4KBLA 3JRTA 3SEOA 2WZFA 2J9VA 4PFOA 4QI2A 1ZU4A 2A1DD 4YT2A 2ZXWC 3CSKA 3B9QA 3NKEA 4IRUA 3EGXB 1N1CA 2CGEA 4C3BA 1QZXA 5KYXA 1SF8A 5F5HA 4I44A 4OD4A 3LS0A 4X0RA 5KYNA 1IZMA 4DVYP 4QI0A 2J0XA 4U5BE 5EGYA 2WB7A 3E70C 4I1MA 1MMDA 3QZCA 3NKDA 4KC9A 4CSAA 3NYMA 1V55C 2IOQA 4BJ6C 2G3KA 3ABKC 4CS8C 3M1CB 4JCHA 4YN0B 3TD7A 1Z5ZA 4HFKB 3HJCA 2JD3A 4PJMA 2CW0F 3UMKA 1BR2A 1ZHYA 3UGPA 2XXAB 1FFHA 5DS4A 5E3AA 1TR2A 3DJUB 4JZAA 4EBBA 4O7GA 4BG0A 2WZGA 3W2VA 5CI9A 4DOZA 3SZRA 2EINC 3EZHA 2EIMC 3W8HA 4ZLCA 3RKOF 1G8XA 3GODA 4HFFB 4U5CE 5KYYA 2R7TA 2PX3A 3LAYA 4K7BA 2R7QA 1J8MF 2R7OA 2A6HF 3LEVA 2V3CC 1VYIA 1Z6AA 3O6XA 3PMRA 4GYTA 4HE8D 2CDQA 4C7OB 2EILC 1ZU5A 3LJBA 3NDBB 4O6YA 5CI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6V A;  2H7B A;  2PP4 A;  2KNH A; 
#chains in the Genus database with same CATH topology
 2TMV P;  4XLP F;  2J46 A;  3TK0 A;  4IAR A;  3T6B A;  1M2V A;  1WAS A;  3MFN A;  1YVI A;  2ZD9 A;  3OA1 A;  4MVU A;  2Q7R A;  5DS5 A;  4E18 A;  1U0B B;  4OIO F;  1RJ9 B;  2HJ3 A;  4WGZ A;  2KNH A;  1H7I A;  1U89 A;  4JVS A;  4ULW A;  1T6U A;  1M57 C;  2R05 A;  2WVQ A;  1YA7 O;  3FDQ A;  3HNK A;  4JCZ A;  1EI7 A;  1C02 A;  1G4W R;  4G78 A;  5L0D A;  1R4T A;  4D4X A;  3K7D A;  4YJW A;  3Q7G A;  4LER A;  2A0B A;  4BEM J;  1APC A;  4MW8 A;  5TJ5 E;  4CS7 A;  3VF0 A;  1RKC A;  2FFH A;  2W9Y A;  2XL6 A;  2IXN A;  3LS1 A;  5DVW A;  5KYW A;  2FGY A;  3HNJ A;  3O39 A;  1OXK A;  3U2M A;  5L0H A;  3N2Z B;  2KGO A;  2B0H A;  1TWA A;  3M15 A;  4K0D A;  1E86 A;  3ABL C;  1QPU A;  1TWH A;  2L6F A;  3JSE O;  1JPJ A;  1SR2 A;  4F4B A;  2KQ9 A;  2ZXP A;  3HNL A;  4NCQ A;  4DRI B;  4MVZ A;  2PFD A;  1IW7 F;  3H2U A;  1CPQ A;  1ZYR F;  1FMW A;  1LVK A;  3TUL A;  3Q6M A;  1Z63 A;  4CJG A;  4PR9 A;  1LI5 A;  2L6H A;  3ASO C;  5D92 A;  4CDV A;  3V7O A;  3B0V C;  5DQT A;  4IWB A;  3I4U A;  3U0C A;  3CEX A;  4OIQ F;  4JEB A;  1K05 A;  4JTA B;  2QTV A;  1QSP A;  1FR0 A;  4Q5S F;  4IJJ A;  3ASN C;  3RYL A;  2A69 F;  2QNL A;  1MMN A;  1Y6D A;  5JUA A;  2C04 A;  1M6T A;  2LCH A;  5KYU A;  1AUE A;  2YLI A;  2AVK A;  3B29 A;  1G5Z A;  3F46 A;  3X1O A;  1M2O A;  1ZW2 A;  3DJN B;  1OCO C;  4AE4 A;  5DLJ A;  3NMI A;  3OEO A;  1G4U S;  1R5I D;  3O55 A;  1Z3I X;  2YL3 A;  1A7D A;  1NU7 D;  2OCC C;  4CS9 A;  2Y3H A;  4CX9 A;  4P9T A;  2DI3 A;  2PX0 A;  1S7Z A;  2KJG A;  2NUT A;  1PD0 A;  4OIR F;  1E2X A;  3ABM C;  3JCU Q;  2J45 A;  3EQL F;  1U6H A;  1RXQ A;  1TQG A;  1YAU O;  3FHD A;  4HEA J;  4L6R A;  4XPX A;  3V5Z A;  2OU6 A;  2R9R B;  3EG9 A;  3LNR A;  1OCC C;  4YL3 A;  3GEE A;  2Z15 A;  3VAY A;  2LD6 A;  3AQB A;  2YKZ A;  1ORY A;  1AEP A;  1HMO A;  1XZQ A;  3G4X A;  3LUT B;  4BJ5 C;  4O6M A;  4JEA A;  3POV A;  4XLN F;  3EFO B;  1HE9 A;  4XPY A;  1BDJ B;  3IQT A;  3L8I A;  3WOD F;  3CZ6 A;  1MMA A;  2OQM A;  3VYW A;  5A6B D;  1K40 A;  3KPH A;  1D0Y A;  1BR4 A;  4MVQ A;  2OG2 A;  3GEI A;  4KNV A;  4LLE A;  3U9M A;  3L0I A;  3LEO A;  1WGW A;  1BZ4 A;  4OD5 A;  1E83 A;  2WVN A;  3U8P A;  2GDC A;  2G62 A;  4JRZ A;  1NZE A;  3DM5 A;  4GEH A;  2JPU A;  1DOV A;  5T3W A;  2WZL A;  5B3I A;  2R7R A;  2AWY A;  3U3F A;  3ZQY A;  3U3B A;  3N0T A;  3EH1 A;  1KU2 A;  3W4Y A;  5BQG A;  5B1B C;  2H7V C;  4QDL A;  3KL4 A;  4EHP A;  1JRA A;  2EPL X;  3AOU A;  3S29 A;  4AK9 A;  4MTO A;  2QUP A;  4W8K A;  3SXY A;  4EWC A;  1I4Z A;  5A6K A;  3GM2 A;  3EGD B;  2Y3D A;  2B0J A;  2HSB A;  4CJO A;  3EHN A;  3TOM A;  4AX2 A;  5COF A;  4E7Z A;  3K1H A;  1JMW A;  3JYH A;  2Q9C A;  3DKA A;  1VYK A;  1VLS A;  2GA0 A;  2P0N A;  3C63 A;  3JSZ A;  4O6N A;  4PFP A;  3X2Q C;  3ZC4 A;  5B3S C;  2HV7 A;  2NUP A;  1V54 C;  4O79 A;  1T6I A;  2IBF A;  3B71 A;  1WTY A;  2XM4 A;  4PJL A;  4ONS A;  2EPO A;  2OEX A;  1NSG B;  2EIK C;  1UFB A;  1D0Z A;  3DAF A;  3SNH A;  2MYS A;  1AVO B;  4YL0 A;  3EGX A;  3W2W A;  2XL8 A;  3QVZ A;  4DRH B;  1YYX A;  2C03 A;  3NMK A;  2RD9 A;  1DOW A;  4N6C A;  2XLD A;  4MW3 A;  5F28 E;  1O3U A;  3ATP A;  3WHN A;  4BJ6 A;  5EHH A;  4D4N A;  2L81 A;  1BBH A;  1T9K A;  1ZHZ A;  3S28 A;  4LLC A;  4CS8 A;  3UNG C;  1OW6 A;  1LM3 B;  1NG1 A;  2D5R B;  2EPM X;  2YQY A;  2YL1 A;  4MQ9 F;  2Q3T A;  2NG1 A;  1D1B A;  2DYS C;  2R25 A;  1T5O A;  1TKN A;  3KKB A;  3AGU A;  1RKE B;  4CIP A;  2BE5 F;  1TFK B;  3M79 A;  5E3C A;  2VCB A;  3NG1 A;  4JJF A;  5HSW A;  1TWG A;  3WG7 C;  3HNI A;  3KYJ A;  2F22 A;  1FFT C;  4KI2 A;  3EZI A;  1A7V A;  2HSQ A;  3C8G B;  3C62 A;  3CQZ A;  2J9B A;  1QQ3 A;  3EPV A;  4AL1 A;  3UMI A;  1ZVZ A;  1XZP A;  3UMH A;  2QE9 A;  3DM9 B;  1S05 A;  2XLH A;  3E9V A;  3K33 A;  3I5Q A;  4EBK A;  3HTK C;  4RDA A;  2WL8 A;  5KYX B;  1T01 A;  4DBR A;  3LES A;  3VRC A;  4Q7C A;  2KW3 C;  1I4Y A;  1OKK D;  3RW0 A;  4YWQ A;  4IB4 A;  4PJJ A;  4YT8 A;  3FOP A;  2ICW G;  2DB4 A;  2UUH A;  3HKK A;  3L1M A;  5DQZ A;  3S27 A;  3S84 A;  1D1A A;  1BR1 A;  2ZXO A;  2XXA A;  1TWC A;  3AJM A;  3SYN A;  2A0U A;  3AG4 C;  4E0I A;  2LIG A;  5F5F A;  4J30 B;  3EHM A;  3A9C A;  2NSG A;  4C3E A;  1NFO A;  3RVY A;  4BJT A;  2YEV A;  2KYH A;  3RIP A;  1M56 C;  4BPM A;  4PJN A;  3HLZ A;  2Q9A A;  5AGF A;  4CIH A;  1V4A A;  3L8J A;  2R03 A;  5BUO A;  2CCY A;  3IQ5 A;  1LE4 A;  1Q0D A;  1LS4 A;  4LDK A;  1FAP B;  4FES A;  3RQF A;  3S9O A;  5A6B A;  1ST6 A;  4MTG A;  4J32 B;  1JOG A;  2CYD A;  3G50 A;  1Q0M A;  1GQA A;  2W4M A;  2ZPA A;  3JT1 A;  4I3M A;  1JPN A;  4WAB A;  3JYY A;  3RVZ A;  4U9E A;  4CSA C;  2WVO A;  4E17 A;  2YLG A;  3MYI A;  4N4W A;  4E7S A;  2VC9 A;  1L3P A;  2J7P D;  1YJG A;  3TOL A;  2W4B A;  1O87 A;  3QMK A;  2O9X A;  2PNO A;  3ZG1 A;  2Y3G A;  1E84 A;  2XLW A;  3B0P A;  3FAP B;  4Z9H A;  3AG3 C;  1MNE A;  5A6J A;  1Q0K A;  2YVK A;  3PDM P;  2J0W A;  3DAG A;  4ULV A;  4YL1 A;  1PD1 A;  1D0X A;  5L0C A;  3ITF A;  2YL7 A;  4NTA A;  4EBJ A;  4MVO A;  1FNT c;  2R7S A;  2OJQ A;  4CDA A;  4G0H A;  2P7V A;  2J9U A;  2LSE A;  5AC5 A;  2HUJ A;  1LS1 A;  2MWQ A;  2NUP B;  3H65 A;  3N24 A;  3Q6N A;  1EQ1 A;  3QTH A;  1C17 M;  4N06 A;  2HV6 A;  3LLK A;  1CGN A;  3DMD A;  3TQO A;  5JP7 A;  2YZS A;  4Q4Z F;  5B1A C;  1QVX A;  1RJ9 A;  2CNW A;  3MYF A;  4MTF A;  3SP1 A;  2GFH A;  3ZSU A;  4EUK B;  5KYY B;  4OIP F;  4MVS A;  2L9J A;  2JX0 A;  4MVM A;  1OCR C;  2D4U A;  2HS5 A;  2W45 A;  3F47 A;  5T3T A;  3U8V A;  2NSF A;  4JTC B;  4DVZ A;  1MMG A;  1A41 A;  1OW8 A;  3DI5 A;  3RFY A;  3OWT A;  2IM8 A;  4E0H A;  4MS2 A;  4XEK A;  5GPG B;  5L0J A;  3JRM O;  4BJ1 A;  2YHS A;  2VAS A;  3K1I A;  4WJ0 A;  3AG1 C;  3IQ6 A;  3UR3 C;  4JUR I;  1JAF A;  3LLI A;  5IY5 C;  1L7C A;  3ECS A;  4OIN F;  2E87 A;  4C3D A;  5BQI A;  3U9J A;  5FCL A;  2HMZ A;  4YT5 A;  4G7Z F;  1ZHX A;  2Q00 A;  2EPN A;  3FAJ A;  1A0B A;  3GM3 A;  4DBQ A;  5L0G A;  3KMI A;  5E2Q A;  4UDV A;  2X51 A;  2VH3 A;  5T1D B;  1VLT A;  1J8Y F;  3QW1 A;  1LKX A;  2GWW A;  1M2V B;  2PBE A;  4MND A;  3C7J A;  2H7B A;  3GM1 A;  2XS1 A;  3TJ5 A;  2DYR C;  3FMS A;  3GWN A;  3DXJ F;  1C03 A;  3PCV A;  2Q4F A;  4XEV A;  3UGO A;  4ZLD A;  1KTM A;  2R7X A;  3ZVR A;  1PV3 A;  5L3Q A;  2G3V A;  3C8Z A;  2YRF A;  3RQG A;  2VB6 A;  3DZA A;  4PK4 A;  3VM6 A;  3B0U X;  4PAC A;  3TJ6 A;  2L6G A;  2CNW D;  1YAR O;  1MND A;  2HZ8 A;  3KH2 A;  1YDI A;  1CGO A;  2I8B A;  3KYI A;  4M63 A;  1OW7 A;  1OCZ C;  1JR8 A;  3LNM B;  2M4E A;  5KYW B;  2AWC A;  3DE8 A;  3M4C A;  2IXP A;  4U9D A;  1OKK A;  3EJN A;  2XRH A;  3ZQV A;  2DGJ A;  2OOC A;  1FTS A;  2QY9 A;  4NQF A;  2IYL D;  2UUI A;  3QW0 A;  1SZI A;  1VK5 A;  4BJ5 A;  1MQV A;  4RBN A;  3T4R A;  4G7H F;  2AU5 A;  1LIH A;  4MVR A;  2EIJ C;  4IAQ A;  3ZWI A;  4ANJ A;  5E33 A;  3NRH A;  3ZIB A;  3MX3 A;  3S90 A;  1VMA A;  1V74 B;  2KC3 A;  4JC7 A;  3DWW A;  4RD9 A;  3EH2 A;  4YK5 A;  1TFO B;  2XLV A;  5JS5 A;  2YL0 A;  3NYJ A;  2P61 A;  3NYL A;  4B6I A;  4I1O B;  1K04 A;  1D1C A;  3T6J A;  1I5N A;  2IXO A;  4FWV A;  4W8P A;  3V5X A;  2R02 A;  4IGG A;  3AQC A;  5L0I A;  1E85 A;  1VTM P;  2IXM A;  1RMV A;  1UG7 A;  4EIY A;  1QKR A;  3EFO A;  3K66 A;  4U5H A;  5JLI A;  1Z23 A;  1O5H A;  4A2N B;  5KYU B;  4XPW A;  1ZHW A;  4AE4 B;  3JZ0 A;  4JTD B;  4P6I C;  256B A;  1A7E A;  2J7P A;  1SMY F;  4JJG A;  3S0X A;  1HW2 A;  3L34 A;  2R7U A;  4FX5 A;  2R7V A;  1NFN A;  5CIV A;  4NY3 A;  5K0I A;  1QLE C;  4XTK A;  5D91 A;  1EKY A;  3ZTZ A;  2AP3 A;  1NBB A;  2NUT B;  1PCX A;  2QLA A;  3CAX A;  4A4A A;  2P6V A;  2J8W A;  5JRA A;  4YT4 A;  1FMV A;  1SYQ A;  1RCP A;  3I5P A;  3G4Z A;  1GS9 A;  5L3V A;  5AC4 A;  4G7O F;  3GAN A;  1HW1 A;  4K1O A;  3EG9 B;  1W2W A;  5A69 A;  3EGD A;  2OJE D;  4IAO A;  1VOM A;  1WN0 A;  2H7O A;  2A6E F;  2Y39 A;  1NU9 C;  5DS6 A;  2A68 F;  4CS9 C;  2EPK X;  3JTL O;  4BEJ A;  4CBE A;  2PP4 A;  4H54 A;  4Z9I A;  3IHU A;  4LAC B;  4LDR A;  2J9W A;  2LK4 A;  1OR3 A;  4CDY A;  3K6B A;  2Y69 C;  2YWA A;  3M4B A;  3MLG A;  3Q7L A;  3SXM A;  3IEE A;  3V5Y A;  1CGM E;  2M64 A;  4NC3 A;  2V26 A;  3AG2 C;  3FOO A;  3W8I A;  1ZHT A;  5FZT A;  1Y4C A;  3US6 A;  2XSE A;  3DD7 A;  4U5E E;  3RF3 A;  3FVY A;  4LDQ A;  4R32 A;  2Y3B A;  4U5D E;  4U5G A;  2Q9B A;  3RH3 A;  4WGY A;  2PF4 E;  4JKV A;  4U5F E;  1WAT A;  1EA8 A;  2GAQ A;  1YZC A;  2XM0 A;  4XWJ A;  2XL4 A;  2XLM A;  2ZXR A;  4H4K C;  2X0C A;  5A6A A;  2R7W A;  4JW1 A;  3J06 A;  3K1I C;  4C7O A;  3GEH A;  2KSF A;  1RKE A;  4Z9J A;  1ORS C;  3PHF 2;  4KNW A;  4KBL A;  4DRJ B;  3JRT A;  3SEO A;  2WZF A;  2HFI A;  1YZA A;  2RSE B;  1XWJ A;  5JT4 A;  2J9V A;  4PFO A;  4XQ1 A;  3R7C A;  1ZU4 A;  4QI2 A;  1T6Q A;  2A1D D;  2ZXW C;  4YT2 A;  3CSK A;  3WAQ A;  3B9Q A;  3C8G A;  3NKE A;  2XLO A;  4IRU A;  3EGX B;  1VB5 A;  3O10 A;  1N1C A;  2CGE A;  3MBG A;  4C3B A;  1QZX A;  5KYX A;  1SF8 A;  4N6H A;  5F5H A;  1LE2 A;  2HMQ A;  4I44 A;  4OD4 A;  2ETS A;  3LS0 A;  4X0R A;  5KYN A;  1Q0F A;  3RQE A;  1IZM A;  2KK1 A;  3QVY A;  5HV9 A;  4DVY P;  4QI0 A;  2J0X A;  1OQC A;  2LP4 A;  4P9F A;  4U5B E;  5EGY A;  2WB7 A;  2NPU A;  1B68 A;  2XS8 A;  3E70 C;  4I1M A;  1MMD A;  2ASR A;  3U2L A;  4AL0 A;  2BC5 A;  3QZC A;  3NKD A;  3GWL A;  4KC9 A;  4CSA A;  3NYM A;  1V55 C;  1YLM A;  2IOQ A;  2OEV A;  2P1A A;  3R2P A;  3ZDL A;  4BJ6 C;  5L0F A;  1H9T A;  2G3K A;  4GQH A;  4J7Y A;  1ZW3 A;  2OKU A;  3ABK C;  3DE9 A;  2I15 A;  4CS8 C;  3M1C B;  4J7T A;  4JCH A;  4YN0 B;  4EKW A;  4XEF A;  4NTF A;  1ORJ A;  3TD7 A;  1Z5Z A;  2VCC A;  3H2V A;  3IQC A;  5EK0 A;  5COG A;  4HFK B;  3C8G D;  3HJC A;  2JD3 A;  3SXK A;  4PJM A;  3T9O A;  2LFF A;  2CW0 F;  2LQG A;  3GOR A;  3UMK A;  4DXW A;  1BR2 A;  1ZHY A;  4JIO A;  3UGP A;  2XXA B;  1GGQ A;  2XLE A;  3A11 A;  1FFH A;  2YLD A;  5DS4 A;  5E3A A;  1TR2 A;  1CPR A;  1F1M A;  2HJM A;  3C18 A;  1ZZP A;  3DJU B;  4JZA A;  5COM A;  4EBB A;  4O7G A;  1YA9 A;  2LFD A;  4BG0 A;  1WOL A;  2L7A A;  2WZG A;  3NMJ A;  3W2V A;  1HE1 A;  5JVE A;  5CI9 A;  1Q0G A;  1LI7 A;  3ZTM A;  4DOZ A;  3SZR A;  2EIN C;  3SXZ A;  3EZH A;  1HMD A;  2EIM C;  3W8H A;  4FAP B;  5BQH A;  2BL2 A;  3AGT A;  3RKO F;  1G8X A;  3T6G B;  4ZLC A;  3IPM O;  1WWP A;  2MHR A;  3GOD A;  2FAP B;  4HFF B;  4U5C E;  2HKV A;  1YYJ A;  2PX3 A;  3LAY A;  5KYY A;  2R7T A;  4K7B A;  4DJ9 A;  2R7Q A;  1J8M F;  1NLX A;  3FXH A;  2R7O A;  2A6H F;  3LEV A;  2V3C C;  1OR2 A;  1LPE A;  2VCA A;  1HY5 A;  1VYI A;  1Z6A A;  3O6X A;  3PMR A;  3BRJ A;  1H6G A;  4GYT A;  4HE8 D;  4JE9 A;  2CDQ A;  2H8A A;  4C7O B;  2EIL C;  4NTB A;  1ZU5 A;  3LJB A;  3NDB B;  1KNY A;  5JSL A;  3BEH A;  1Z7Q c;  1OXB A;  3U5S A;  4O6Y A;  1GM5 A;  4ER9 A;  5CI8 A;  1H9G A; 
#chains in the Genus database with same CATH homology
 4XLP F;  2J46 A;  3T6B A;  1M2V A;  3OA1 A;  5DS5 A;  4OIO F;  1RJ9 B;  2KNH A;  4JVS A;  4ULW A;  1M57 C;  2WVQ A;  3FDQ A;  3K7D A;  4YJW A;  3Q7G A;  4LER A;  4CS7 A;  3LS1 A;  2FFH A;  2W9Y A;  2IXN A;  5DVW A;  5KYW A;  2FGY A;  3O39 A;  3N2Z B;  2KGO A;  1TWA A;  4K0D A;  3ABL C;  1TWH A;  1JPJ A;  4F4B A;  2KQ9 A;  2ZXP A;  2PFD A;  1IW7 F;  1ZYR F;  1FMW A;  1LVK A;  1Z63 A;  3Q6M A;  3ASO C;  5D92 A;  3V7O A;  3B0V C;  5DQT A;  4IWB A;  3I4U A;  4OIQ F;  2QTV A;  4Q5S F;  4IJJ A;  3ASN C;  3RYL A;  2A69 F;  1MMN A;  2C04 A;  5KYU A;  3X1O A;  5DLJ A;  4AE4 A;  3F46 A;  1M2O A;  3DJN B;  1OCO C;  3OEO A;  1Z3I X;  1NU7 D;  2OCC C;  4CS9 A;  2Y3H A;  2PX0 A;  1S7Z A;  2KJG A;  2NUT A;  1PD0 A;  4OIR F;  3ABM C;  3JCU Q;  2J45 A;  3EQL F;  3FHD A;  4HEA J;  3EG9 A;  3LNR A;  1OCC C;  3VAY A;  2Z15 A;  3AQB A;  4BJ5 C;  3POV A;  4O6M A;  4XLN F;  3EFO B;  3WOD F;  3CZ6 A;  1MMA A;  3VYW A;  1BR4 A;  1D0Y A;  2OG2 A;  4KNV A;  4LLE A;  3L0I A;  4OD5 A;  1WGW A;  2WVN A;  2G62 A;  1NZE A;  3DM5 A;  4GEH A;  5T3W A;  2WZL A;  2R7R A;  3N0T A;  3EH1 A;  1KU2 A;  5B1B C;  2H7V C;  4QDL A;  3KL4 A;  2R7S A;  3S29 A;  4AK9 A;  4EWC A;  4W8K A;  3EGD B;  2Y3D A;  2B0J A;  3EHN A;  4AX2 A;  4E7Z A;  3K1H A;  3JYH A;  2Q9C A;  1VYK A;  4PFP A;  3JSZ A;  3X2Q C;  4O6N A;  5B3S C;  3ZC4 A;  2HV7 A;  2NUP A;  1V54 C;  4O79 A;  4PJL A;  2EIK C;  1D0Z A;  3DAF A;  3SNH A;  2MYS A;  3W2W A;  3EGX A;  2C03 A;  4BJ6 A;  5EHH A;  2L81 A;  1ZHZ A;  3S28 A;  4LLC A;  4CS8 A;  3UNG C;  1NG1 A;  2D5R B;  4MQ9 F;  2Q3T A;  2NG1 A;  1D1B A;  2DYS C;  3KKB A;  1TKN A;  2BE5 F;  5E3C A;  3NG1 A;  4JJF A;  5HSW A;  1TWG A;  3WG7 C;  4KI2 A;  1FFT C;  3EZI A;  3CQZ A;  3EPV A;  3UMI A;  3UMH A;  3DM9 B;  3E9V A;  3K33 A;  3I5Q A;  5KYX B;  3HTK C;  4RDA A;  2WL8 A;  4DBR A;  3LES A;  4Q7C A;  2KW3 C;  1OKK D;  4YWQ A;  4PJJ A;  4YT8 A;  5DQZ A;  3S27 A;  1D1A A;  1BR1 A;  2ZXO A;  2XXA A;  1TWC A;  3SYN A;  3AG4 C;  5F5F A;  4J30 B;  3EHM A;  4C3E A;  4BJT A;  2YEV A;  3RIP A;  1M56 C;  4PJN A;  3HLZ A;  2Q9A A;  4CIH A;  5BUO A;  4FES A;  1ST6 A;  4J32 B;  4I3M A;  2W4M A;  2ZPA A;  3JT1 A;  1JPN A;  4CSA C;  2WVO A;  4E7S A;  3ZG1 A;  2J7P D;  2W4B A;  1O87 A;  3QMK A;  2O9X A;  2Y3G A;  3B0P A;  3AG3 C;  1MNE A;  2J0W A;  3DAG A;  1PD1 A;  1D0X A;  3ITF A;  4G0H A;  2P7V A;  2J9U A;  2LSE A;  1LS1 A;  2MWQ A;  2NUP B;  3H65 A;  3N24 A;  3Q6N A;  4N06 A;  2HV6 A;  3LLK A;  3DMD A;  4Q4Z F;  2YZS A;  5B1A C;  1RJ9 A;  2CNW A;  3SP1 A;  5KYY B;  4OIP F;  2GFH A;  3ZSU A;  2L9J A;  1OCR C;  5T3T A;  2W45 A;  3F47 A;  4DVZ A;  1MMG A;  3RFY A;  3OWT A;  4BJ1 A;  2YHS A;  2VAS A;  4WJ0 A;  3AG1 C;  3UR3 C;  4JUR I;  3LLI A;  5IY5 C;  3ECS A;  4OIN F;  2E87 A;  4C3D A;  5FCL A;  4YT5 A;  4G7Z F;  1ZHX A;  3FAJ A;  4DBQ A;  3KMI A;  5E2Q A;  2X51 A;  2VH3 A;  5T1D B;  1J8Y F;  1LKX A;  4MND A;  1M2V B;  2H7B A;  2DYR C;  3DXJ F;  3UGO A;  4ZLD A;  2R7X A;  3ZVR A;  5L3Q A;  2G3V A;  2VB6 A;  3DZA A;  4PK4 A;  3B0U X;  2CNW D;  1MND A;  3KH2 A;  2I8B A;  4M63 A;  1OCZ C;  5KYW B;  2M4E A;  2IXP A;  1OKK A;  3EJN A;  2XRH A;  2DGJ A;  2QY9 A;  1FTS A;  2IYL D;  1SZI A;  1VK5 A;  4BJ5 A;  3T4R A;  4RBN A;  4G7H F;  4ANJ A;  2EIJ C;  5E33 A;  3NRH A;  3ZIB A;  3MX3 A;  1VMA A;  4RD9 A;  3EH2 A;  3NYJ A;  3NYL A;  4B6I A;  4I1O B;  3T6J A;  1D1C A;  2IXO A;  4FWV A;  3AQC A;  2IXM A;  3EFO A;  3K66 A;  4U5H A;  1Z23 A;  1O5H A;  4A2N B;  5KYU B;  1ZHW A;  4AE4 B;  4P6I C;  2J7P A;  1SMY F;  4JJG A;  3S0X A;  3L34 A;  2R7U A;  4FX5 A;  2R7V A;  4NY3 A;  1QLE C;  4XTK A;  5D91 A;  2NUT B;  1PCX A;  2P6V A;  4YT4 A;  1FMV A;  3I5P A;  5L3V A;  4G7O F;  3GAN A;  3EG9 B;  1W2W A;  3EGD A;  4IAO A;  1VOM A;  2H7O A;  2A6E F;  2Y39 A;  1NU9 C;  5DS6 A;  2A68 F;  4CS9 C;  4BEJ A;  4CBE A;  2PP4 A;  4LAC B;  2J9W A;  3K6B A;  2Y69 C;  3MLG A;  3Q7L A;  3IEE A;  2V26 A;  3AG2 C;  3W8I A;  1ZHT A;  2XSE A;  3DD7 A;  4U5E E;  3FVY A;  2Y3B A;  4U5D E;  4U5G A;  2Q9B A;  3RH3 A;  2PF4 E;  4U5F E;  4XWJ A;  2XL4 A;  4H4K C;  2ZXR A;  2R7W A;  4JW1 A;  3K1I C;  4C7O A;  3PHF 2;  4KNW A;  4KBL A;  3JRT A;  3SEO A;  2WZF A;  2J9V A;  4PFO A;  4QI2 A;  1ZU4 A;  2A1D D;  4YT2 A;  2ZXW C;  3CSK A;  3B9Q A;  3NKE A;  4IRU A;  3EGX B;  1N1C A;  2CGE A;  4C3B A;  1QZX A;  5KYX A;  1SF8 A;  5F5H A;  4I44 A;  4OD4 A;  3LS0 A;  4X0R A;  5KYN A;  1IZM A;  4DVY P;  4QI0 A;  2J0X A;  4U5B E;  5EGY A;  2WB7 A;  3E70 C;  4I1M A;  1MMD A;  3QZC A;  3NKD A;  4KC9 A;  4CSA A;  3NYM A;  1V55 C;  2IOQ A;  4BJ6 C;  2G3K A;  3ABK C;  4CS8 C;  3M1C B;  4JCH A;  4YN0 B;  3TD7 A;  1Z5Z A;  4HFK B;  3HJC A;  2JD3 A;  4PJM A;  2CW0 F;  3UMK A;  1BR2 A;  1ZHY A;  3UGP A;  2XXA B;  1FFH A;  5DS4 A;  5E3A A;  1TR2 A;  3DJU B;  4JZA A;  4EBB A;  4O7G A;  4BG0 A;  2WZG A;  3W2V A;  5CI9 A;  4DOZ A;  3SZR A;  2EIN C;  3EZH A;  2EIM C;  3W8H A;  4ZLC A;  3RKO F;  1G8X A;  3GOD A;  4HFF B;  4U5C E;  5KYY A;  2R7T A;  2PX3 A;  3LAY A;  4K7B A;  2R7Q A;  1J8M F;  2R7O A;  2A6H F;  3LEV A;  2V3C C;  1VYI A;  1Z6A A;  3O6X A;  3PMR A;  4GYT A;  4HE8 D;  2CDQ A;  4C7O B;  2EIL C;  1ZU5 A;  3LJB A;  3NDB B;  4O6Y A;  5CI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...