2PP4A

Solution structure of eto-tafh refined in explicit solvent
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
107
structure length
107
Chain Sequence
GARQLSKLKRFLTTLQQYGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein ETO
publication title A TAF4-homology domain from the corepressor ETO is a docking platform for positive and negative regulators of transcription
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 34
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2pp4A00
2P6VA 2KNHA 2PP4A 2H7BA
chains in the Genus database with same CATH superfamily
1YDIA 3MX3A 4UDVA 2EIJC 3RQFA 3QVZA 3HNIA 2CNWA 2B0JA 1LKXA 1D0YA 1E84A 4YT5A 4NY3A 3GANA 2R7WA 1EI7A 4XTKA 4CX9A 4AL0A 1A41A 2XLEA 3LNMB 3ZTZA 5A69A 4E0IA 2P0NA 2QLAA 3K66A 2HMZA 2YL3A 1M56C 3LEVA 3V5YA 5KYWA 2UUIA 2XSEA 3C63A 3E9VA 2IXNA 3EHMA 2H7OA 2M4EA 4I44A 1ORYA 3DMDA 4XPXA 1IZMA 1VLTA 3IHUA 2ZXPA 2J9BA 2TMVP 1VK5A 1SF8A 1JOGA 2L9JA 3WG7C 5A6BD 3ZVRA 1V54C 1NG1A 2A6HF 5E2QA 5COGA 4Q7CA 4EUKB 2R7TA 4CJOA 5K0IA 2Y39A 2YEVA 5KYWB 1J8YF 4FESA 5L0JA 2GAQA 2G3KA 1LE2A 2YLDA 3C7JA 2CYDA 3KYIA 4WGYA 1TFOB 2UUHA 2AP3A 3A11A 4BJ6A 5L3QA 3UGOA 1WOLA 5CI9A 4E7SA 3FMSA 2MYSA 2PX0A 1C17M 3FAJA 2FAPB 4LACB 2LK4A 3RYLA 4CS7A 3LLKA 4KC9A 3EHNA 1OW6A 4NTFA 2FFHA 5KYXA 2XL8A 4CIPA 4G7HF 3C8GD 4FAPB 1SMYF 4BJ5C 1FFHA 1NBBA 3LAYA 3U2LA 4JEBA 4EIYA 1LM3B 3WAQA 2YRFA 1FNTc 1WTYA 1ZHWA 3EJNA 1OCRC 5DVWA 4PFOA 3SXKA 4CJGA 2EPLX 3H2VA 4E7ZA 2LIGA 5COMA 4MW3A 4YL1A 1SYQA 1MNDA 3VAYA 1BR2A 4EKWA 1D0XA 2JX0A 5TJ5E 1YJGA 3C8ZA 1H9TA 1OQCA 2YL0A 2Q4FA 1YVIA 3GORA 4U5BE 1MQVA 3B9QA 4JCHA 1CGNA 1CPRA 3LNRA 5L0CA 5D91A 3AGTA 3AG1C 1RJ9A 5JVEA 2ASRA 1WASA 3V5ZA 1MMAA 3WODF 3DKAA 1HMDA 2R7SA 3QVYA 3S0XA 1IW7F 3ASNC 3I5QA 4HFFB 3F46A 3ZIBA 2W4BA 3H65A 4EBBA 1O3UA 4MTGA 5T3WA 1Q0MA 5JUAA 4JC7A 2B0HA 3JRMO 1TR2A 1D0ZA 3GM2A 2P61A 4IGGA 3W8HA 1L3PA 1XZPA 2I15A 3RQEA 3T9OA 4DBQA 3K1IA 1RJ9B 3GEEA 2J9UA 2LQGA 4MTFA 1GQAA 1VLSA 3S29A 4DRHB 4CSAA 2OQMA 2EPKX 4LDQA 4JZAA 4D4XA 2EPMX 2AWYA 4LDKA 2NUTA 2AWCA 2IXPA 2ZXWC 2Q7RA 1WN0A 2D4UA 3ITFA 4K7BA 4YN0B 1EQ1A 2CGEA 1SZIA 5EHHA 1JAFA 4LDRA 2NG1A 1A7EA 3LS1A 3MFNA 1ZU4A 3HJCA 4MW8A 3HNKA 4NQFA 2KJGA 3EPVA 2J7PA 3V7OA 2EIKC 1LI5A 1OW7A 3HNLA 4WJ0A 3T6BA 2GA0A 2QTVA 1MMNA 3NMKA 3HNJA 4EHPA 4G7ZF 1A7DA 1Q0KA 2GDCA 2NUTB 3JT1A 4O7GA 2KNHA 5JLIA 3LS0A 2HV7A 1Y6DA 4YK5A 2XL6A 3JRTA 4G78A 4E0HA 4PACA 2WB7A 2ZXOA 3AOUA 4JTAB 4C7OB 3RVYA 1BR4A 2OEXA 3SXYA 3JSZA 1J8MF 2A6EF 2L7AA 2XLDA 3KPHA 2Q9CA 5FCLA 1LIHA 2F22A 2CW0F 4CDVA 2J9WA 2Z15A 2HV6A 2NPUA 1G8XA 1V55C 2YVKA 3DE9A 3IQCA 2X51A 3L0IA 4CIHA 4AL1A 3M4BA 4GYTA 4Z9JA 4IJJA 4PFPA 3HLZA 1Q0GA 3EZIA 4XPWA 1NU9C 1U89A 3RH3A 3SXZA 1QKRA 3O10A 4D4NA 5AC5A 2R02A 2R9RB 1WATA 1YYJA 5BQIA 1T6UA 4EWCA 1T9KA 5EGYA 2EINC 5B1BC 1L7CA 3AJMA 3ASOC 3VRCA 2HSQA 4MS2A 4KNWA 3SXMA 5BUOA 3FDQA 2GWWA 3GWNA 3CSKA 1VB5A 4P6IC 1JRAA 3DI5A 3TQOA 4YT4A 1OXKA 1TWCA 3LJBA 4G0HA 1T6QA 2KW3C 3NG1A 3ZSUA 1Z7Qc 3TOLA 4OIQF 2J0WA 3GM3A 2XL4A 1FAPB 5CIVA 2Q3TA 1BR1A 1FR0A 1HE9A 3G4ZA 4LERA 3NDBB 1PD0A 1FMWA 4JCZA 3RFYA 2KK1A 2C03A 2P1AA 3X2QC 1ZHXA 4JE9A 3FVYA 1M57C 1R5ID 4NCQA 4U9DA 1B68A 2A0BA 2R7QA 2VCBA 3JCUQ 1FFTC 3O39A 3U3BA 2ZPAA 3ZDLA 3NMJA 2BL2A 1W2WA 4QI0A 3KMIA 1FTSA 4YJWA 4G7OF 3K7DA 1OR2A 1K04A 3NRHA 2XRHA 1KU2A 4ULVA 4U5FE 2DB4A 2J8WA 2LD6A 3N0TA 2R7RA 1AUEA 1LI7A 3DJUB 3M15A 2HS5A 4BPMA 2XLMA 2IBFA 4H4KC 4Z9IA 3K6BA 2J9VA 2VASA 5AC4A 4ZLDA 1F1MA 3Q6NA 4IRUA 1ORSC 3IEEA 5AGFA 4DVZA 1YZAA 3T6GB 1NU7D 3BRJA 3ZTMA 4DBRA 2CNWD 3U5SA 3MYIA 4A2NB 3UMIA 2IXMA 1NSGB 4BJTA 4MQ9F 2PF4E 4BJ1A 4N6CA 3MBGA 4CS8A 2XS8A 4XEFA 4YT8A 1ZYRF 2R05A 1LVKA 3W2WA 1NLXA 2KSFA 4O6NA 1VTMP 2O9XA 2Y3GA 1CPQA 2Q00A 5A6AA 4JJGA 3AG3C 2PFDA 1EKYA 2P7VA 2NUPA 2YWAA 1BZ4A 3B0UX 2YL1A 2WZFA 5KYXB 1ORJA 5L0IA 4JJFA 3CZ6A 3M4CA 4OINF 5F5HA 2WVQA 3K1IC 1Z5ZA 2OOCA 3VF0A 2L6FA 3LUTB 2W4MA 4N6HA 4AK9A 2WZLA 1U6HA 2H8AA 4KI2A 4K1OA 3U3FA 4PK4A 2E87A 1Z23A 1O87A 5D92A 5JS5A 1OCOC 4MVQA 4CS9C 3EH2A 4U5DE 2NUPB 1ZZPA 2L81A 3SNHA 3O55A 3S27A 1OR3A 3GEHA 2A1DD 2XM0A 1EA8A 1V4AA 3UMHA 4MVRA 3FAPB 3QTHA 1PV3A 4J30B 3AG4C 1C02A 1H9GA 4RDAA 5L0GA 3K1HA 1YA7O 3U2MA 5BQHA 3DM5A 3F47A 2LP4A 2OJQA 4CDYA 4K0DA 3GWLA 3EH1A 4BJ5A 4CS9A 2YL7A 1TWAA 3KYJA 3ABMC 4L6RA 4J7YA 4U5EE 4C3DA 4PR9A 4P9FA 2EPNA 2Y3BA 4J7TA 3TULA 3KH2A 2VCAA 5KYUA 3RIPA 4XEKA 4NTBA 3JYHA 2G62A 2MWQA 3J06A 4GQHA 3U8VA 2Y69C 3A9CA 3G4XA 4WABA 1TWHA 3CAXA 5HSWA 1YAUO 2BE5F 2EIMC 3NKDA 1OXBA 4U5CE 3RVZA 1NFOA 1OCZC 4KBLA 4O6MA 1G4WR 3UGPA 4DVYP 1TQGA 3NKEA 5DQZA 5JT4A 4PJLA 3L8IA 2R25A 5E3CA 1ST6A 3B0PA 3I4UA 4XWJA 4A4AA 3CEXA 3L8JA 5KYUB 3PHF2 2NSFA 1NFNA 2VC9A 3JSEO 4JURI 3W2VA 5L0FA 4FWVA 4PJNA 4Q5SF 1N1CA 3V5XA 2R7VA 1UFBA 2AVKA 3R2PA 4HE8D 5GPGB 2H7BA 3DM9B 4YL3A 1QLEC 4JRZA 3SP1A 2R7XA 2KQ9A 1JPNA 5B1AC 4DOZA 1YYXA 1H7IA 3S90A 3POVA 3M79A 1M6TA 1ZW2A 2WVNA 3JYYA 4C3EA 2Y3HA 3U9JA 4CBEA 5FZTA 2J7PD 5L0HA 5JRAA 2YHSA 3C18A 3TOMA 1TWGA 2P6VA 2A69F 3GM1A 3QZCA 4AX2A 2J45A 3ABLC 5JSLA 4DJ9A 3DJNB 1TKNA 3QW1A 2X0CA 3ZQVA 1D1BA 5T3TA 5B3IA 1OKKA 3NYMA 1VYIA 4W8KA 1ZHYA 2Q9BA 1QPUA 4MVUA 1CGME 2WZGA 2DYRC 2XM4A 3PCVA 5E3AA 4MNDA 5B3SC 5DS5A 1DOVA 3BEHA 3PDMP 4DRJB 5F28E 2LCHA 5CI8A 2HKVA 3B0VC 2KC3A 4X0RA 1E85A 3OEOA 1ZHZA 4U5GA 2XS1A 1LPEA 1QVXA 2LSEA 2R7OA 3DWWA 1TFKB 3E70C 3EGDA 3I5PA 3RF3A 1I5NA 3W8IA 1ZVZA 3JZ0A 3B29A 4O79A 1D1CA 1T6IA 2R03A 2I8BA 3KKBA 3NYLA 3TD7A 2LFDA 1YA9A 4LLEA 4MVZA 3US6A 2OCCC 3W4YA 1RCPA 1MMDA 2OU6A 2G3VA 5DS6A 3Q7LA 3T4RA 1JPJA 2VB6A 3N2ZB 4BJ6C 3G50A 3OA1A 5A6BA 3OWTA 2IXOA 4IAQA 4OIOF 1Z3IX 4AE4A 3AG2C 3ZG1A 2EILC 3IQ6A 3EGDB 4OD5A 4I3MA 3VM6A 2YKZA 1ZHTA 2ICWG 2R7UA 4O6YA 4E18A 2HJ3A 1PD1A 5DLJA 1S05A 4Q4ZF 1DOWA 1GS9A 2XLHA 1G5ZA 4GEHA 4EBKA 2CDQA 1V74B 1RKEA 2KYHA 2XLVA 4OIPF 1T5OA 2FGYA 4ULWA 2HUJA 3C8GA 3UNGC 4AE4B 3DD7A 4IARA 4DXWA 4MTOA 3EFOA 3SYNA 4OD4A 1D1AA 1KNYA 1OW8A 1E83A 3GEIA 2A68F 2EPOA 3K33A 1MMGA 4YT2A 1SR2A 4XPYA 1VMAA 2J46A 2MHRA 3DXJF 4XEVA 1RKEB 1JR8A 1A0BA 2ZXRA 3FOOA 5COFA 2HSBA 4I1OB 4IAOA 2DGJA 3C8GB 3MYFA 3DAGA 3M1CB 3EFOB 2AU5A 1AVOB 2QUPA 2Y3DA 1LS1A 3TJ6A 2YQYA 1M2OA 2OJED 5DQTA 4BEJA 3NMIA 1HW1A 2HJMA 1A7VA 2RD9A 3EG9A 1KTMA 1U0BB 3LESA 3FHDA 4N06A 1GGQA 2IM8A 1UG7A 3IQ5A 4R32A 1I4YA 3T6JA 4CSAC 3N24A 3TK0A 1WWPA 1Q0DA 1RKCA 2D5RB 2OG2A 2PP4A 2WL8A 3C62A 3UR3C 1HY5A 2ETSA 2V26A 1JMWA 4JW1A 1VOMA 1Y4CA 3ECSA 1R4TA 2DI3A 4PJJA 3ZQYA 2WVOA 2QY9A 3IPMO 4IWBA 3EG9B 1T01A 4ZLCA 3HKKA 2DYSC 2IYLD 1VYKA 2Q9AA 5KYNA 2YLGA 1CGOA 2PX3A 1LS4A 3X1OA 2NSGA 3AQCA 3ZC4A 4IB4A 4JEAA 2ZD9A 1ZU5A 4W8PA 5JP7A 1WGWA 3ATPA 1YZCA 1RMVA 4J32B 1HMOA 3U8PA 1YLMA 1OCCC 2L6GA 3EZHA 3QMKA 4BG0A 2M64A 3S28A 3S9OA 4MVOA 3GODA 4U9EA 1QQ3A 1M2VA 2JPUA 3RW0A 4B6IA 3U0CA 5BQGA 3UMKA 5L0DA 3AQBA 2YZSA 3SEOA 4XLPF 1FMVA 1RXQA 2PBEA 4XLNF 2HFIA 1GM5A 4PJMA 3JTLO 4RBNA 1QZXA 1S7ZA 3KL4A 4XQ1A 2YLIA 2VH3A 4EBJA 2H7VC 2KGOA 3ABKC 2HZ8A 4MVMA 2BC5A 3B71A 3DZAA 1M2VB 2CCYA 2IOQA 2RSEB 3DE8A 4JTCB 4P9TA 5F5FA 1QSPA 2VCCA 3EGXA 4BEMJ 1Z63A 5A6JA 2LFFA 4MVSA 4C7OA 1K40A 4JIOA 5EK0A 5T1DB 1E2XA 4U5HA 3WHNA 4ANJA 2XLOA 3IQTA 3PMRA 2W9YA 3Q7GA 3TJ5A 1O5HA 2L6HA 3O6XA 4ONSA 3R7CA 5L3VA 5DS4A 2C04A 2GFHA 1XWJA 3HTKC 3S84A 3QW0A 1MNEA 4HEAJ 256BA 2JD3A 2W45A 1K05A 4WGZA 4HFKB 4NC3A 3EGXB 4LLCA 4JKVA 1HW2A 4DRIB 1Q0FA 4QI2A 1LE4A 2XLWA 3FXHA 3LLIA 3L1MA 2A0UA 4YWQA 3ZWIA 3FOPA 2V3CC 1G4US 4I1MA 1AEPA 3RKOF 4CDAA 1ZW3A 2XXAA 2OKUA 3CQZA 5A6KA 5E33A 4QDLA 4JVSA 1E86A 3MLGA 4M63A 3LEOA 1PCXA 3H2UA 3Q6MA 5KYYA 1BDJB 4Z9HA 4JTDB 5HV9A 4C3BA 2QE9A 1YARO 2J0XA 4F4BA 4RD9A 3VYWA 4YL0A 1BBHA 3EQLF 3SZRA 1HE1A 4KNVA 3DAFA 4NTAA 3RQGA 2XXAB 4OIRF 4E17A 4FX5A 2OEVA 3U9MA 2HMQA 1APCA 5IY5C 1XZQA 1Z6AA 1C03A 3NYJA 2QNLA 5KYYB 1I4ZA 2PNOA 3L34A 4N4WA 4H54A 1H6GA 1NZEA 1OKKD 4ER9A 3AGUA 4CS8C
chains in the Genus database with same CATH topology
3MX3A 2EIJC 2CNWA 2B0JA 1LKXA 1D0YA 4YT5A 4NY3A 3GANA 2R7WA 4XTKA 3K66A 5KYWA 1M56C 3LEVA 2XSEA 3E9VA 2IXNA 3EHMA 2H7OA 2M4EA 4I44A 3DMDA 1IZMA 2ZXPA 1VK5A 1SF8A 2L9JA 3WG7C 3ZVRA 1V54C 1NG1A 2A6HF 5E2QA 4Q7CA 2R7TA 2Y39A 2YEVA 5KYWB 1J8YF 4FESA 2G3KA 3UGOA 5L3QA 4BJ6A 5CI9A 4E7SA 2MYSA 2PX0A 4CS7A 3FAJA 4LACB 3RYLA 3LLKA 4KC9A 3EHNA 2FFHA 5KYXA 4G7HF 1SMYF 4BJ5C 1FFHA 3LAYA 5DVWA 1ZHWA 3EJNA 1OCRC 4PFOA 4E7ZA 1MNDA 3VAYA 1BR2A 1D0XA 4U5BE 3B9QA 4JCHA 3LNRA 5D91A 3AG1C 1RJ9A 1MMAA 3WODF 2R7SA 3S0XA 1IW7F 3ASNC 3I5QA 4HFFB 3F46A 3ZIBA 2W4BA 3H65A 4EBBA 5T3WA 1TR2A 1D0ZA 3W8HA 4DBQA 1RJ9B 2J9UA 3S29A 4CSAA 4JZAA 2NUTA 2IXPA 2ZXWC 3ITFA 4K7BA 4YN0B 2CGEA 1SZIA 5EHHA 2NG1A 3LS1A 1ZU4A 3HJCA 2KJGA 3EPVA 2J7PA 3V7OA 2EIKC 3W8IA 4WJ0A 4YWQA 3T6BA 4G7OF 2QTVA 1MMNA 4G7ZF 3JT1A 2NUTB 4O7GA 2KNHA 3LS0A 2HV7A 3JRTA 4C7OB 2WB7A 2ZXOA 1BR4A 3JSZA 1J8MF 2A6EF 2Q9CA 5FCLA 2CW0F 2J9WA 2Z15A 2HV6A 1G8XA 1V55C 4CIHA 2X51A 3L0IA 4GYTA 4IJJA 4PFPA 3HLZA 3EZIA 3RH3A 1NU9C 4EWCA 5EGYA 2EINC 5B1BC 3ASOC 3FDQA 4KNWA 5BUOA 4YT4A 3CSKA 4P6IC 1TWCA 3LJBA 4G0HA 2KW3C 3ZSUA 3NG1A 4OIQF 2J0WA 2XL4A 2Q3TA 1BR1A 4LERA 3NDBB 1PD0A 1FMWA 3RFYA 2C03A 3X2QC 1ZHXA 3FVYA 1M57C 2R7QA 3JCUQ 1FFTC 3O39A 2ZPAA 1W2WA 4QI0A 3KMIA 1FTSA 4YJWA 3K7DA 3NRHA 2XRHA 1KU2A 4U5FE 2R7RA 3N0TA 3DJUB 4H4KC 3K6BA 2J9VA 2VASA 4ZLDA 3Q6NA 4IRUA 3IEEA 4DVZA 4DBRA 1NU7D 2CNWD 4A2NB 3UMIA 2IXMA 4BJTA 4MQ9F 2PF4E 4BJ1A 4CS8A 4YT8A 1ZYRF 1LVKA 3W2WA 4O6NA 2O9XA 2Y3GA 4JJGA 3AG3C 2PFDA 2P7VA 2NUPA 3B0UX 5KYXB 2WZFA 4JJFA 3CZ6A 4OINF 5F5HA 2WVQA 3K1IC 1Z5ZA 2W4MA 4AK9A 2WZLA 4KI2A 4PK4A 2E87A 1Z23A 1O87A 5D92A 1OCOC 3EH2A 4U5DE 2NUPB 2L81A 3SNHA 3S27A 2A1DD 3UMHA 4J30B 3AG4C 4RDAA 3K1HA 3DM5A 3F47A 4K0DA 4CS9A 3EH1A 4BJ5A 1TWAA 3ABMC 4U5EE 4C3DA 2Y3BA 3KH2A 5KYUA 3RIPA 3JYHA 2G62A 2MWQA 2Y69C 1TWHA 5HSWA 3NKDA 2BE5F 2EIMC 4U5CE 1OCZC 4KBLA 4O6MA 3UGPA 4DVYP 3NKEA 5DQZA 4PJLA 5E3CA 1ST6A 3B0PA 3I4UA 4XWJA 5KYUB 3PHF2 4JURI 3W2VA 4FWVA 4PJNA 4Q5SF 1N1CA 2R7VA 4HE8D 2H7BA 3DM9B 1QLEC 3SP1A 2R7XA 2KQ9A 1JPNA 5B1AC 4DOZA 3POVA 2WVNA 4C3EA 2Y3HA 4CBEA 2J7PD 2YHSA 1TWGA 2P6VA 2A69F 3QZCA 4AX2A 2J45A 3ABLC 3DJNB 1TKNA 1D1BA 5T3TA 1OKKA 3NYMA 1VYIA 4W8KA 1ZHYA 2Q9BA 2WZGA 2DYRC 5DS5A 5E3AA 4MNDA 5B3SC 5CI8A 4X0RA 3OEOA 1ZHZA 4U5GA 3RKOF 2LSEA 3E70C 2R7OA 3I5PA 3EGDA 4O79A 1D1CA 3NYLA 2I8BA 3KKBA 3TD7A 4LLEA 2OCCC 1MMDA 2G3VA 5DS6A 3Q7LA 3T4RA 1JPJA 2VB6A 3N2ZB 4BJ6C 3OA1A 3OWTA 2IXOA 4OIOF 1Z3IX 4AE4A 3AG2C 3ZG1A 2EILC 3EGDB 4OD5A 4I3MA 1ZHTA 2R7UA 4O6YA 1PD1A 5DLJA 4Q4ZF 4GEHA 2CDQA 4OIPF 2FGYA 4ULWA 3UNGC 4AE4B 3DD7A 3EFOA 3SYNA 4OD4A 1D1AA 2A68F 3K33A 3B0VC 1MMGA 4YT2A 1VMAA 2J46A 3DXJF 2ZXRA 4I1OB 4IAOA 2DGJA 3DAGA 3M1CB 3EFOB 2Y3DA 1LS1A 1M2OA 5DQTA 4BEJA 3EG9A 3LESA 3FHDA 4N06A 3T6JA 4CSAC 3N24A 2D5RB 2PP4A 2OG2A 2WL8A 3UR3C 4CS9C 4JW1A 2V26A 1VOMA 4PJJA 3ECSA 2WVOA 2QY9A 4IWBA 3EG9B 4ZLCA 2DYSC 2IYLD 1VYKA 2Q9AA 5KYNA 2PX3A 3X1OA 3AQCA 3ZC4A 1ZU5A 1WGWA 4J32B 1OCCC 3EZHA 3QMKA 4BG0A 3S28A 3GODA 1M2VA 4B6IA 3UMKA 3AQBA 2YZSA 3SEOA 4XLPF 1FMVA 4XLNF 4PJMA 4RBNA 1QZXA 1S7ZA 3KL4A 2VH3A 2H7VC 2KGOA 3ABKC 3DZAA 1M2VB 2IOQA 5F5FA 1Z63A 3EGXA 4C7OA 5T1DB 4U5HA 4ANJA 3PMRA 2W9YA 3Q7GA 1O5HA 3O6XA 5L3VA 5DS4A 2C04A 2GFHA 3HTKC 1MNEA 4HEAJ 2JD3A 2W45A 4HFKB 3EGXB 4LLCA 4QI2A 3LLIA 2V3CC 4I1MA 2XXAA 3CQZA 5E33A 4QDLA 4JVSA 3MLGA 4M63A 5KYYA 1PCXA 3Q6MA 4C3BA 2J0XA 4F4BA 4RD9A 3VYWA 3SZRA 3EQLF 4KNVA 3DAFA 2XXAB 4OIRF 4FX5A 5IY5C 1Z6AA 3NYJA 5KYYB 3L34A 1NZEA 1OKKD 4CS8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6V A;  2KNH A;  2PP4 A;  2H7B A; 
#chains in the Genus database with same CATH topology
 1YDI A;  3MX3 A;  4UDV A;  2EIJ C;  3RQF A;  3QVZ A;  3HNI A;  2CNW A;  2B0J A;  1LKX A;  1D0Y A;  1E84 A;  4YT5 A;  4NY3 A;  3GAN A;  2R7W A;  1EI7 A;  4XTK A;  4CX9 A;  4AL0 A;  1A41 A;  2XLE A;  3LNM B;  3ZTZ A;  5A69 A;  4E0I A;  2P0N A;  2QLA A;  3K66 A;  2HMZ A;  2YL3 A;  1M56 C;  3LEV A;  3V5Y A;  5KYW A;  2UUI A;  2XSE A;  3C63 A;  3E9V A;  2IXN A;  3EHM A;  2H7O A;  2M4E A;  4I44 A;  1ORY A;  3DMD A;  4XPX A;  1IZM A;  1VLT A;  3IHU A;  2ZXP A;  2J9B A;  2TMV P;  1VK5 A;  1SF8 A;  1JOG A;  2L9J A;  3WG7 C;  5A6B D;  3ZVR A;  1V54 C;  1NG1 A;  2A6H F;  5E2Q A;  5COG A;  4Q7C A;  4EUK B;  2R7T A;  4CJO A;  5K0I A;  2Y39 A;  2YEV A;  5KYW B;  1J8Y F;  4FES A;  5L0J A;  2GAQ A;  2G3K A;  1LE2 A;  2YLD A;  3C7J A;  2CYD A;  3KYI A;  4WGY A;  1TFO B;  2UUH A;  2AP3 A;  3A11 A;  4BJ6 A;  5L3Q A;  3UGO A;  1WOL A;  5CI9 A;  4E7S A;  3FMS A;  2MYS A;  2PX0 A;  1C17 M;  3FAJ A;  2FAP B;  4LAC B;  2LK4 A;  3RYL A;  4CS7 A;  3LLK A;  4KC9 A;  3EHN A;  1OW6 A;  4NTF A;  2FFH A;  5KYX A;  2XL8 A;  4CIP A;  4G7H F;  3C8G D;  4FAP B;  1SMY F;  4BJ5 C;  1FFH A;  1NBB A;  3LAY A;  3U2L A;  4JEB A;  4EIY A;  1LM3 B;  3WAQ A;  2YRF A;  1FNT c;  1WTY A;  1ZHW A;  3EJN A;  1OCR C;  5DVW A;  4PFO A;  3SXK A;  4CJG A;  2EPL X;  3H2V A;  4E7Z A;  2LIG A;  5COM A;  4MW3 A;  4YL1 A;  1SYQ A;  1MND A;  3VAY A;  1BR2 A;  4EKW A;  1D0X A;  2JX0 A;  5TJ5 E;  1YJG A;  3C8Z A;  1H9T A;  1OQC A;  2YL0 A;  2Q4F A;  1YVI A;  3GOR A;  4U5B E;  1MQV A;  3B9Q A;  4JCH A;  1CGN A;  1CPR A;  3LNR A;  5L0C A;  5D91 A;  3AGT A;  3AG1 C;  1RJ9 A;  5JVE A;  2ASR A;  1WAS A;  3V5Z A;  1MMA A;  3WOD F;  3DKA A;  1HMD A;  2R7S A;  3QVY A;  3S0X A;  1IW7 F;  3ASN C;  3I5Q A;  4HFF B;  3F46 A;  3ZIB A;  2W4B A;  3H65 A;  4EBB A;  1O3U A;  4MTG A;  5T3W A;  1Q0M A;  5JUA A;  4JC7 A;  2B0H A;  3JRM O;  1TR2 A;  1D0Z A;  3GM2 A;  2P61 A;  4IGG A;  3W8H A;  1L3P A;  1XZP A;  2I15 A;  3RQE A;  3T9O A;  4DBQ A;  3K1I A;  1RJ9 B;  3GEE A;  2J9U A;  2LQG A;  4MTF A;  1GQA A;  1VLS A;  3S29 A;  4DRH B;  4CSA A;  2OQM A;  2EPK X;  4LDQ A;  4JZA A;  4D4X A;  2EPM X;  2AWY A;  4LDK A;  2NUT A;  2AWC A;  2IXP A;  2ZXW C;  2Q7R A;  1WN0 A;  2D4U A;  3ITF A;  4K7B A;  4YN0 B;  1EQ1 A;  2CGE A;  1SZI A;  5EHH A;  1JAF A;  4LDR A;  2NG1 A;  1A7E A;  3LS1 A;  3MFN A;  1ZU4 A;  3HJC A;  4MW8 A;  3HNK A;  4NQF A;  2KJG A;  3EPV A;  2J7P A;  3V7O A;  2EIK C;  1LI5 A;  1OW7 A;  3HNL A;  4WJ0 A;  3T6B A;  2GA0 A;  2QTV A;  1MMN A;  3NMK A;  3HNJ A;  4EHP A;  4G7Z F;  1A7D A;  1Q0K A;  2GDC A;  2NUT B;  3JT1 A;  4O7G A;  2KNH A;  5JLI A;  3LS0 A;  2HV7 A;  1Y6D A;  4YK5 A;  2XL6 A;  3JRT A;  4G78 A;  4E0H A;  4PAC A;  2WB7 A;  2ZXO A;  3AOU A;  4JTA B;  4C7O B;  3RVY A;  1BR4 A;  2OEX A;  3SXY A;  3JSZ A;  1J8M F;  2A6E F;  2L7A A;  2XLD A;  3KPH A;  2Q9C A;  5FCL A;  1LIH A;  2F22 A;  2CW0 F;  4CDV A;  2J9W A;  2Z15 A;  2HV6 A;  2NPU A;  1G8X A;  1V55 C;  2YVK A;  3DE9 A;  3IQC A;  2X51 A;  3L0I A;  4CIH A;  4AL1 A;  3M4B A;  4GYT A;  4Z9J A;  4IJJ A;  4PFP A;  3HLZ A;  1Q0G A;  3EZI A;  4XPW A;  1NU9 C;  1U89 A;  3RH3 A;  3SXZ A;  1QKR A;  3O10 A;  4D4N A;  5AC5 A;  2R02 A;  2R9R B;  1WAT A;  1YYJ A;  5BQI A;  1T6U A;  4EWC A;  1T9K A;  5EGY A;  2EIN C;  5B1B C;  1L7C A;  3AJM A;  3ASO C;  3VRC A;  2HSQ A;  4MS2 A;  4KNW A;  3SXM A;  5BUO A;  3FDQ A;  2GWW A;  3GWN A;  3CSK A;  1VB5 A;  4P6I C;  1JRA A;  3DI5 A;  3TQO A;  4YT4 A;  1OXK A;  1TWC A;  3LJB A;  4G0H A;  1T6Q A;  2KW3 C;  3NG1 A;  3ZSU A;  1Z7Q c;  3TOL A;  4OIQ F;  2J0W A;  3GM3 A;  2XL4 A;  1FAP B;  5CIV A;  2Q3T A;  1BR1 A;  1FR0 A;  1HE9 A;  3G4Z A;  4LER A;  3NDB B;  1PD0 A;  1FMW A;  4JCZ A;  3RFY A;  2KK1 A;  2C03 A;  2P1A A;  3X2Q C;  1ZHX A;  4JE9 A;  3FVY A;  1M57 C;  1R5I D;  4NCQ A;  4U9D A;  1B68 A;  2A0B A;  2R7Q A;  2VCB A;  3JCU Q;  1FFT C;  3O39 A;  3U3B A;  2ZPA A;  3ZDL A;  3NMJ A;  2BL2 A;  1W2W A;  4QI0 A;  3KMI A;  1FTS A;  4YJW A;  4G7O F;  3K7D A;  1OR2 A;  1K04 A;  3NRH A;  2XRH A;  1KU2 A;  4ULV A;  4U5F E;  2DB4 A;  2J8W A;  2LD6 A;  3N0T A;  2R7R A;  1AUE A;  1LI7 A;  3DJU B;  3M15 A;  2HS5 A;  4BPM A;  2XLM A;  2IBF A;  4H4K C;  4Z9I A;  3K6B A;  2J9V A;  2VAS A;  5AC4 A;  4ZLD A;  1F1M A;  3Q6N A;  4IRU A;  1ORS C;  3IEE A;  5AGF A;  4DVZ A;  1YZA A;  3T6G B;  1NU7 D;  3BRJ A;  3ZTM A;  4DBR A;  2CNW D;  3U5S A;  3MYI A;  4A2N B;  3UMI A;  2IXM A;  1NSG B;  4BJT A;  4MQ9 F;  2PF4 E;  4BJ1 A;  4N6C A;  3MBG A;  4CS8 A;  2XS8 A;  4XEF A;  4YT8 A;  1ZYR F;  2R05 A;  1LVK A;  3W2W A;  1NLX A;  2KSF A;  4O6N A;  1VTM P;  2O9X A;  2Y3G A;  1CPQ A;  2Q00 A;  5A6A A;  4JJG A;  3AG3 C;  2PFD A;  1EKY A;  2P7V A;  2NUP A;  2YWA A;  1BZ4 A;  3B0U X;  2YL1 A;  2WZF A;  5KYX B;  1ORJ A;  5L0I A;  4JJF A;  3CZ6 A;  3M4C A;  4OIN F;  5F5H A;  2WVQ A;  3K1I C;  1Z5Z A;  2OOC A;  3VF0 A;  2L6F A;  3LUT B;  2W4M A;  4N6H A;  4AK9 A;  2WZL A;  1U6H A;  2H8A A;  4KI2 A;  4K1O A;  3U3F A;  4PK4 A;  2E87 A;  1Z23 A;  1O87 A;  5D92 A;  5JS5 A;  1OCO C;  4MVQ A;  4CS9 C;  3EH2 A;  4U5D E;  2NUP B;  1ZZP A;  2L81 A;  3SNH A;  3O55 A;  3S27 A;  1OR3 A;  3GEH A;  2A1D D;  2XM0 A;  1EA8 A;  1V4A A;  3UMH A;  4MVR A;  3FAP B;  3QTH A;  1PV3 A;  4J30 B;  3AG4 C;  1C02 A;  1H9G A;  4RDA A;  5L0G A;  3K1H A;  1YA7 O;  3U2M A;  5BQH A;  3DM5 A;  3F47 A;  2LP4 A;  2OJQ A;  4CDY A;  4K0D A;  3GWL A;  3EH1 A;  4BJ5 A;  4CS9 A;  2YL7 A;  1TWA A;  3KYJ A;  3ABM C;  4L6R A;  4J7Y A;  4U5E E;  4C3D A;  4PR9 A;  4P9F A;  2EPN A;  2Y3B A;  4J7T A;  3TUL A;  3KH2 A;  2VCA A;  5KYU A;  3RIP A;  4XEK A;  4NTB A;  3JYH A;  2G62 A;  2MWQ A;  3J06 A;  4GQH A;  3U8V A;  2Y69 C;  3A9C A;  3G4X A;  4WAB A;  1TWH A;  3CAX A;  5HSW A;  1YAU O;  2BE5 F;  2EIM C;  3NKD A;  1OXB A;  4U5C E;  3RVZ A;  1NFO A;  1OCZ C;  4KBL A;  4O6M A;  1G4W R;  3UGP A;  4DVY P;  1TQG A;  3NKE A;  5DQZ A;  5JT4 A;  4PJL A;  3L8I A;  2R25 A;  5E3C A;  1ST6 A;  3B0P A;  3I4U A;  4XWJ A;  4A4A A;  3CEX A;  3L8J A;  5KYU B;  3PHF 2;  2NSF A;  1NFN A;  2VC9 A;  3JSE O;  4JUR I;  3W2V A;  5L0F A;  4FWV A;  4PJN A;  4Q5S F;  1N1C A;  3V5X A;  2R7V A;  1UFB A;  2AVK A;  3R2P A;  4HE8 D;  5GPG B;  2H7B A;  3DM9 B;  4YL3 A;  1QLE C;  4JRZ A;  3SP1 A;  2R7X A;  2KQ9 A;  1JPN A;  5B1A C;  4DOZ A;  1YYX A;  1H7I A;  3S90 A;  3POV A;  3M79 A;  1M6T A;  1ZW2 A;  2WVN A;  3JYY A;  4C3E A;  2Y3H A;  3U9J A;  4CBE A;  5FZT A;  2J7P D;  5L0H A;  5JRA A;  2YHS A;  3C18 A;  3TOM A;  1TWG A;  2P6V A;  2A69 F;  3GM1 A;  3QZC A;  4AX2 A;  2J45 A;  3ABL C;  5JSL A;  4DJ9 A;  3DJN B;  1TKN A;  3QW1 A;  2X0C A;  3ZQV A;  1D1B A;  5T3T A;  5B3I A;  1OKK A;  3NYM A;  1VYI A;  4W8K A;  1ZHY A;  2Q9B A;  1QPU A;  4MVU A;  1CGM E;  2WZG A;  2DYR C;  2XM4 A;  3PCV A;  5E3A A;  4MND A;  5B3S C;  5DS5 A;  1DOV A;  3BEH A;  3PDM P;  4DRJ B;  5F28 E;  2LCH A;  5CI8 A;  2HKV A;  3B0V C;  2KC3 A;  4X0R A;  1E85 A;  3OEO A;  1ZHZ A;  4U5G A;  2XS1 A;  1LPE A;  1QVX A;  2LSE A;  2R7O A;  3DWW A;  1TFK B;  3E70 C;  3EGD A;  3I5P A;  3RF3 A;  1I5N A;  3W8I A;  1ZVZ A;  3JZ0 A;  3B29 A;  4O79 A;  1D1C A;  1T6I A;  2R03 A;  2I8B A;  3KKB A;  3NYL A;  3TD7 A;  2LFD A;  1YA9 A;  4LLE A;  4MVZ A;  3US6 A;  2OCC C;  3W4Y A;  1RCP A;  1MMD A;  2OU6 A;  2G3V A;  5DS6 A;  3Q7L A;  3T4R A;  1JPJ A;  2VB6 A;  3N2Z B;  4BJ6 C;  3G50 A;  3OA1 A;  5A6B A;  3OWT A;  2IXO A;  4IAQ A;  4OIO F;  1Z3I X;  4AE4 A;  3AG2 C;  3ZG1 A;  2EIL C;  3IQ6 A;  3EGD B;  4OD5 A;  4I3M A;  3VM6 A;  2YKZ A;  1ZHT A;  2ICW G;  2R7U A;  4O6Y A;  4E18 A;  2HJ3 A;  1PD1 A;  5DLJ A;  1S05 A;  4Q4Z F;  1DOW A;  1GS9 A;  2XLH A;  1G5Z A;  4GEH A;  4EBK A;  2CDQ A;  1V74 B;  1RKE A;  2KYH A;  2XLV A;  4OIP F;  1T5O A;  2FGY A;  4ULW A;  2HUJ A;  3C8G A;  3UNG C;  4AE4 B;  3DD7 A;  4IAR A;  4DXW A;  4MTO A;  3EFO A;  3SYN A;  4OD4 A;  1D1A A;  1KNY A;  1OW8 A;  1E83 A;  3GEI A;  2A68 F;  2EPO A;  3K33 A;  1MMG A;  4YT2 A;  1SR2 A;  4XPY A;  1VMA A;  2J46 A;  2MHR A;  3DXJ F;  4XEV A;  1RKE B;  1JR8 A;  1A0B A;  2ZXR A;  3FOO A;  5COF A;  2HSB A;  4I1O B;  4IAO A;  2DGJ A;  3C8G B;  3MYF A;  3DAG A;  3M1C B;  3EFO B;  2AU5 A;  1AVO B;  2QUP A;  2Y3D A;  1LS1 A;  3TJ6 A;  2YQY A;  1M2O A;  2OJE D;  5DQT A;  4BEJ A;  3NMI A;  1HW1 A;  2HJM A;  1A7V A;  2RD9 A;  3EG9 A;  1KTM A;  1U0B B;  3LES A;  3FHD A;  4N06 A;  1GGQ A;  2IM8 A;  1UG7 A;  3IQ5 A;  4R32 A;  1I4Y A;  3T6J A;  4CSA C;  3N24 A;  3TK0 A;  1WWP A;  1Q0D A;  1RKC A;  2D5R B;  2OG2 A;  2PP4 A;  2WL8 A;  3C62 A;  3UR3 C;  1HY5 A;  2ETS A;  2V26 A;  1JMW A;  4JW1 A;  1VOM A;  1Y4C A;  3ECS A;  1R4T A;  2DI3 A;  4PJJ A;  3ZQY A;  2WVO A;  2QY9 A;  3IPM O;  4IWB A;  3EG9 B;  1T01 A;  4ZLC A;  3HKK A;  2DYS C;  2IYL D;  1VYK A;  2Q9A A;  5KYN A;  2YLG A;  1CGO A;  2PX3 A;  1LS4 A;  3X1O A;  2NSG A;  3AQC A;  3ZC4 A;  4IB4 A;  4JEA A;  2ZD9 A;  1ZU5 A;  4W8P A;  5JP7 A;  1WGW A;  3ATP A;  1YZC A;  1RMV A;  4J32 B;  1HMO A;  3U8P A;  1YLM A;  1OCC C;  2L6G A;  3EZH A;  3QMK A;  4BG0 A;  2M64 A;  3S28 A;  3S9O A;  4MVO A;  3GOD A;  4U9E A;  1QQ3 A;  1M2V A;  2JPU A;  3RW0 A;  4B6I A;  3U0C A;  5BQG A;  3UMK A;  5L0D A;  3AQB A;  2YZS A;  3SEO A;  4XLP F;  1FMV A;  1RXQ A;  2PBE A;  4XLN F;  2HFI A;  1GM5 A;  4PJM A;  3JTL O;  4RBN A;  1QZX A;  1S7Z A;  3KL4 A;  4XQ1 A;  2YLI A;  2VH3 A;  4EBJ A;  2H7V C;  2KGO A;  3ABK C;  2HZ8 A;  4MVM A;  2BC5 A;  3B71 A;  3DZA A;  1M2V B;  2CCY A;  2IOQ A;  2RSE B;  3DE8 A;  4JTC B;  4P9T A;  5F5F A;  1QSP A;  2VCC A;  3EGX A;  4BEM J;  1Z63 A;  5A6J A;  2LFF A;  4MVS A;  4C7O A;  1K40 A;  4JIO A;  5EK0 A;  5T1D B;  1E2X A;  4U5H A;  3WHN A;  4ANJ A;  2XLO A;  3IQT A;  3PMR A;  2W9Y A;  3Q7G A;  3TJ5 A;  1O5H A;  2L6H A;  3O6X A;  4ONS A;  3R7C A;  5L3V A;  5DS4 A;  2C04 A;  2GFH A;  1XWJ A;  3HTK C;  3S84 A;  3QW0 A;  1MNE A;  4HEA J;  256B A;  2JD3 A;  2W45 A;  1K05 A;  4WGZ A;  4HFK B;  4NC3 A;  3EGX B;  4LLC A;  4JKV A;  1HW2 A;  4DRI B;  1Q0F A;  4QI2 A;  1LE4 A;  2XLW A;  3FXH A;  3LLI A;  3L1M A;  2A0U A;  4YWQ A;  3ZWI A;  3FOP A;  2V3C C;  1G4U S;  4I1M A;  1AEP A;  3RKO F;  4CDA A;  1ZW3 A;  2XXA A;  2OKU A;  3CQZ A;  5A6K A;  5E33 A;  4QDL A;  4JVS A;  1E86 A;  3MLG A;  4M63 A;  3LEO A;  1PCX A;  3H2U A;  3Q6M A;  5KYY A;  1BDJ B;  4Z9H A;  4JTD B;  5HV9 A;  4C3B A;  2QE9 A;  1YAR O;  2J0X A;  4F4B A;  4RD9 A;  3VYW A;  4YL0 A;  1BBH A;  3EQL F;  3SZR A;  1HE1 A;  4KNV A;  3DAF A;  4NTA A;  3RQG A;  2XXA B;  4OIR F;  4E17 A;  4FX5 A;  2OEV A;  3U9M A;  2HMQ A;  1APC A;  5IY5 C;  1XZQ A;  1Z6A A;  1C03 A;  3NYJ A;  2QNL A;  5KYY B;  1I4Z A;  2PNO A;  3L34 A;  4N4W A;  4H54 A;  1H6G A;  1NZE A;  1OKK D;  4ER9 A;  3AGU A;  4CS8 C; 
#chains in the Genus database with same CATH homology
 3MX3 A;  2EIJ C;  2CNW A;  2B0J A;  1LKX A;  1D0Y A;  4YT5 A;  4NY3 A;  3GAN A;  2R7W A;  4XTK A;  3K66 A;  5KYW A;  1M56 C;  3LEV A;  2XSE A;  3E9V A;  2IXN A;  3EHM A;  2H7O A;  2M4E A;  4I44 A;  3DMD A;  1IZM A;  2ZXP A;  1VK5 A;  1SF8 A;  2L9J A;  3WG7 C;  3ZVR A;  1V54 C;  1NG1 A;  2A6H F;  5E2Q A;  4Q7C A;  2R7T A;  2Y39 A;  2YEV A;  5KYW B;  1J8Y F;  4FES A;  2G3K A;  3UGO A;  5L3Q A;  4BJ6 A;  5CI9 A;  4E7S A;  2MYS A;  2PX0 A;  4CS7 A;  3FAJ A;  4LAC B;  3RYL A;  3LLK A;  4KC9 A;  3EHN A;  2FFH A;  5KYX A;  4G7H F;  1SMY F;  4BJ5 C;  1FFH A;  3LAY A;  5DVW A;  1ZHW A;  3EJN A;  1OCR C;  4PFO A;  4E7Z A;  1MND A;  3VAY A;  1BR2 A;  1D0X A;  4U5B E;  3B9Q A;  4JCH A;  3LNR A;  5D91 A;  3AG1 C;  1RJ9 A;  1MMA A;  3WOD F;  2R7S A;  3S0X A;  1IW7 F;  3ASN C;  3I5Q A;  4HFF B;  3F46 A;  3ZIB A;  2W4B A;  3H65 A;  4EBB A;  5T3W A;  1TR2 A;  1D0Z A;  3W8H A;  4DBQ A;  1RJ9 B;  2J9U A;  3S29 A;  4CSA A;  4JZA A;  2NUT A;  2IXP A;  2ZXW C;  3ITF A;  4K7B A;  4YN0 B;  2CGE A;  1SZI A;  5EHH A;  2NG1 A;  3LS1 A;  1ZU4 A;  3HJC A;  2KJG A;  3EPV A;  2J7P A;  3V7O A;  2EIK C;  3W8I A;  4WJ0 A;  4YWQ A;  3T6B A;  4G7O F;  2QTV A;  1MMN A;  4G7Z F;  3JT1 A;  2NUT B;  4O7G A;  2KNH A;  3LS0 A;  2HV7 A;  3JRT A;  4C7O B;  2WB7 A;  2ZXO A;  1BR4 A;  3JSZ A;  1J8M F;  2A6E F;  2Q9C A;  5FCL A;  2CW0 F;  2J9W A;  2Z15 A;  2HV6 A;  1G8X A;  1V55 C;  4CIH A;  2X51 A;  3L0I A;  4GYT A;  4IJJ A;  4PFP A;  3HLZ A;  3EZI A;  3RH3 A;  1NU9 C;  4EWC A;  5EGY A;  2EIN C;  5B1B C;  3ASO C;  3FDQ A;  4KNW A;  5BUO A;  4YT4 A;  3CSK A;  4P6I C;  1TWC A;  3LJB A;  4G0H A;  2KW3 C;  3ZSU A;  3NG1 A;  4OIQ F;  2J0W A;  2XL4 A;  2Q3T A;  1BR1 A;  4LER A;  3NDB B;  1PD0 A;  1FMW A;  3RFY A;  2C03 A;  3X2Q C;  1ZHX A;  3FVY A;  1M57 C;  2R7Q A;  3JCU Q;  1FFT C;  3O39 A;  2ZPA A;  1W2W A;  4QI0 A;  3KMI A;  1FTS A;  4YJW A;  3K7D A;  3NRH A;  2XRH A;  1KU2 A;  4U5F E;  2R7R A;  3N0T A;  3DJU B;  4H4K C;  3K6B A;  2J9V A;  2VAS A;  4ZLD A;  3Q6N A;  4IRU A;  3IEE A;  4DVZ A;  4DBR A;  1NU7 D;  2CNW D;  4A2N B;  3UMI A;  2IXM A;  4BJT A;  4MQ9 F;  2PF4 E;  4BJ1 A;  4CS8 A;  4YT8 A;  1ZYR F;  1LVK A;  3W2W A;  4O6N A;  2O9X A;  2Y3G A;  4JJG A;  3AG3 C;  2PFD A;  2P7V A;  2NUP A;  3B0U X;  5KYX B;  2WZF A;  4JJF A;  3CZ6 A;  4OIN F;  5F5H A;  2WVQ A;  3K1I C;  1Z5Z A;  2W4M A;  4AK9 A;  2WZL A;  4KI2 A;  4PK4 A;  2E87 A;  1Z23 A;  1O87 A;  5D92 A;  1OCO C;  3EH2 A;  4U5D E;  2NUP B;  2L81 A;  3SNH A;  3S27 A;  2A1D D;  3UMH A;  4J30 B;  3AG4 C;  4RDA A;  3K1H A;  3DM5 A;  3F47 A;  4K0D A;  4CS9 A;  3EH1 A;  4BJ5 A;  1TWA A;  3ABM C;  4U5E E;  4C3D A;  2Y3B A;  3KH2 A;  5KYU A;  3RIP A;  3JYH A;  2G62 A;  2MWQ A;  2Y69 C;  1TWH A;  5HSW A;  3NKD A;  2BE5 F;  2EIM C;  4U5C E;  1OCZ C;  4KBL A;  4O6M A;  3UGP A;  4DVY P;  3NKE A;  5DQZ A;  4PJL A;  5E3C A;  1ST6 A;  3B0P A;  3I4U A;  4XWJ A;  5KYU B;  3PHF 2;  4JUR I;  3W2V A;  4FWV A;  4PJN A;  4Q5S F;  1N1C A;  2R7V A;  4HE8 D;  2H7B A;  3DM9 B;  1QLE C;  3SP1 A;  2R7X A;  2KQ9 A;  1JPN A;  5B1A C;  4DOZ A;  3POV A;  2WVN A;  4C3E A;  2Y3H A;  4CBE A;  2J7P D;  2YHS A;  1TWG A;  2P6V A;  2A69 F;  3QZC A;  4AX2 A;  2J45 A;  3ABL C;  3DJN B;  1TKN A;  1D1B A;  5T3T A;  1OKK A;  3NYM A;  1VYI A;  4W8K A;  1ZHY A;  2Q9B A;  2WZG A;  2DYR C;  5DS5 A;  5E3A A;  4MND A;  5B3S C;  5CI8 A;  4X0R A;  3OEO A;  1ZHZ A;  4U5G A;  3RKO F;  2LSE A;  3E70 C;  2R7O A;  3I5P A;  3EGD A;  4O79 A;  1D1C A;  3NYL A;  2I8B A;  3KKB A;  3TD7 A;  4LLE A;  2OCC C;  1MMD A;  2G3V A;  5DS6 A;  3Q7L A;  3T4R A;  1JPJ A;  2VB6 A;  3N2Z B;  4BJ6 C;  3OA1 A;  3OWT A;  2IXO A;  4OIO F;  1Z3I X;  4AE4 A;  3AG2 C;  3ZG1 A;  2EIL C;  3EGD B;  4OD5 A;  4I3M A;  1ZHT A;  2R7U A;  4O6Y A;  1PD1 A;  5DLJ A;  4Q4Z F;  4GEH A;  2CDQ A;  4OIP F;  2FGY A;  4ULW A;  3UNG C;  4AE4 B;  3DD7 A;  3EFO A;  3SYN A;  4OD4 A;  1D1A A;  2A68 F;  3K33 A;  3B0V C;  1MMG A;  4YT2 A;  1VMA A;  2J46 A;  3DXJ F;  2ZXR A;  4I1O B;  4IAO A;  2DGJ A;  3DAG A;  3M1C B;  3EFO B;  2Y3D A;  1LS1 A;  1M2O A;  5DQT A;  4BEJ A;  3EG9 A;  3LES A;  3FHD A;  4N06 A;  3T6J A;  4CSA C;  3N24 A;  2D5R B;  2PP4 A;  2OG2 A;  2WL8 A;  3UR3 C;  4CS9 C;  4JW1 A;  2V26 A;  1VOM A;  4PJJ A;  3ECS A;  2WVO A;  2QY9 A;  4IWB A;  3EG9 B;  4ZLC A;  2DYS C;  2IYL D;  1VYK A;  2Q9A A;  5KYN A;  2PX3 A;  3X1O A;  3AQC A;  3ZC4 A;  1ZU5 A;  1WGW A;  4J32 B;  1OCC C;  3EZH A;  3QMK A;  4BG0 A;  3S28 A;  3GOD A;  1M2V A;  4B6I A;  3UMK A;  3AQB A;  2YZS A;  3SEO A;  4XLP F;  1FMV A;  4XLN F;  4PJM A;  4RBN A;  1QZX A;  1S7Z A;  3KL4 A;  2VH3 A;  2H7V C;  2KGO A;  3ABK C;  3DZA A;  1M2V B;  2IOQ A;  5F5F A;  1Z63 A;  3EGX A;  4C7O A;  5T1D B;  4U5H A;  4ANJ A;  3PMR A;  2W9Y A;  3Q7G A;  1O5H A;  3O6X A;  5L3V A;  5DS4 A;  2C04 A;  2GFH A;  3HTK C;  1MNE A;  4HEA J;  2JD3 A;  2W45 A;  4HFK B;  3EGX B;  4LLC A;  4QI2 A;  3LLI A;  2V3C C;  4I1M A;  2XXA A;  3CQZ A;  5E33 A;  4QDL A;  4JVS A;  3MLG A;  4M63 A;  5KYY A;  1PCX A;  3Q6M A;  4C3B A;  2J0X A;  4F4B A;  4RD9 A;  3VYW A;  3SZR A;  3EQL F;  4KNV A;  3DAF A;  2XXA B;  4OIR F;  4FX5 A;  5IY5 C;  1Z6A A;  3NYJ A;  5KYY B;  3L34 A;  1NZE A;  1OKK D;  4CS8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...