2PP4A

Solution structure of eto-tafh refined in explicit solvent
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
107
structure length
107
Chain Sequence
b'GARQLSKLKRFLTTLQQYGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein ETO
publication title A TAF4-homology domain from the corepressor ETO is a docking platform for positive and negative regulators of transcription
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 34
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07531 TAFH NHR1 homology to TAF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1110 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2pp4A00
2P6VA 2PP4A 2H7BA 2KNHA
chains in the Genus database with same CATH superfamily
1D0YA 2G62A 2OQMA 4EHPA 4CIHA 5L0FA 3K6BA 4YL1A 4ONSA 2A0UA 3G4ZA 4LACB 4U9DA 2WB7A 4PJNA 3LJBA 3KKBA 3LUTB 1WWPA 3ZC4A 5A6AA 3IQTA 4Z9IA 3ZQVA 3U3FA 3POVA 2J9BA 1TWCA 3C8ZA 4NCQA 256BA 1A7DA 3UMKA 5T3TA 3DMDA 3L34A 2L9JA 2IXOA 1KNYA 5F5FA 2L81A 4IAOA 2EPNA 1HMOA 1VB5A 1W2WA 3FMSA 1BR4A 1YJGA 3QVYA 4IAQA 1CGOA 1T6QA 1S7ZA 5AC4A 2DI3A 1E84A 5EGYA 2HZ8A 2A1DD 3M79A 2PX3A 2P7VA 2HMZA 2LSEA 1XZQA 1BR1A 3R7CA 1NBBA 1T01A 2LCHA 2HFIA 4CS9C 2D5RB 2M64A 1U6HA 4IRUA 4DOZA 1T9KA 4P9TA 4IGGA 3GEEA 1JR8A 4C7OB 4DVZA 4U5GA 3I5PA 3S27A 1GM5A 1PCXA 1T6IA 3PCVA 4DVYP 2EIMC 2YL0A 3TK0A 1Y4CA 4LDKA 3TOLA 3WHNA 3UGOA 3B0PA 4JTDB 2R7SA 2UUIA 4NC3A 1ZHZA 4NQFA 4GQHA 3X2QC 5BUOA 1Q0KA 5B1AC 1OW7A 1WASA 4I1OB 4DXWA 3Q6NA 4U5FE 5KYUB 4O6NA 5F28E 1HE9A 1YYXA 4HFFB 1UG7A 3IQ6A 5JSLA 4BG0A 4D4XA 1BBHA 1A7EA 3EG9B 2IBFA 2ZXRA 4LLEA 4WGYA 3QW0A 1L7CA 4DRJB 1YVIA 3LLIA 2OEXA 5AC5A 5E3CA 4LLCA 3EPVA 3DKAA 3LS1A 4AK9A 4G7ZF 3ZG1A 3UNGC 2QTVA 4I3MA 4ZLCA 4U5DE 1JOGA 4R32A 2R7XA 3O10A 3FHDA 1GGQA 2A6HF 4BJ6A 3V7OA 3W8HA 1CPQA 1E2XA 3SYNA 4EKWA 4NTFA 4BJTA 3FDQA 2QE9A 2YKZA 3VM6A 1OQCA 1I4ZA 1NFNA 3W8IA 4HEAJ 5CI9A 3GWLA 2V26A 2NSFA 2I8BA 4E0HA 5KYWB 4K7BA 5KYXB 4OIOF 4RBNA 3DE9A 5A69A 5L3QA 1NFOA 3FAJA 3HNJA 3ZIBA 2DYSC 1MMGA 3E70C 4OIRF 3SXMA 1HW2A 3OWTA 4G7OF 3LLKA 3AOUA 3EFOB 1D1BA 3C63A 2ZXOA 4Z9JA 3U3BA 4OINF 2WZLA 3VF0A 3CSKA 2IYLD 3MX3A 1L3PA 1MNDA 3AG1C 1Z5ZA 2IXMA 3EZHA 4M63A 4U9EA 1H9GA 2WVQA 4KC9A 1A41A 4IJJA 4U5CE 4ZLDA 2AWYA 5AGFA 1ZU4A 4JCZA 3BRJA 4ULVA 2VCAA 2R7VA 3GANA 1RJ9B 2ASRA 2OKUA 3DI5A 3DAGA 2UUHA 3RVZA 2CCYA 5A6BD 5K0IA 2KW3C 3PMRA 3K33A 4G78A 5E33A 1SZIA 4ULWA 2DGJA 1ZU5A 2EIJC 1JMWA 1OKKD 1PV3A 1YARO 2GAQA 2KSFA 1E83A 3JYHA 2MHRA 3VYWA 4EIYA 3M1CB 3Q7LA 1JPJA 2LFDA 3DM5A 4I44A 1D1CA 1FMVA 2XLEA 4JTAB 3RQGA 4CJGA 2Q9CA 2CGEA 2EPLX 1LVKA 3GEHA 2ICWG 4MVQA 5DVWA 1BDJB 3MBGA 1Z23A 5A6KA 1RCPA 3QVZA 2JPUA 5KYYA 3KL4A 3IPMO 4U5HA 1FNTc 1ZHWA 4CX9A 2FGYA 5L0JA 1E85A 1HY5A 1T6UA 4U5EE 4I1MA 3R2PA 3DWWA 2L6HA 4MQ9F 4XPWA 3NRHA 2P6VA 3S84A 1MQVA 2A68F 2H7VC 4LDRA 3SP1A 2J9UA 4YT4A 4YWQA 3ITFA 5BQIA 1FR0A 1WN0A 3C18A 2YL7A 1B68A 2WVOA 3OA1A 3T6JA 4CS8A 3C7JA 2EINC 3ZTMA 5DS5A 1XWJA 3EZIA 1N1CA 1GQAA 2Y69C 3AJMA 3RH3A 1F1MA 2WZGA 2Y3DA 2YL1A 1NSGB 3MLGA 4GYTA 3U9JA 2JX0A 2XSEA 2NUTB 1LS1A 5DLJA 4E7SA 2VASA 1AEPA 5L3VA 3IEEA 3GM3A 1QSPA 1IW7F 2C04A 3RW0A 3HNKA 3IQCA 1QVXA 3W2WA 1ORSC 1TFKB 3L1MA 1VOMA 1Z63A 4JZAA 3QW1A 4J7YA 5FCLA 2R7UA 3HTKC 3GWNA 1K04A 4H54A 1HW1A 5KYNA 3K1IC 1S05A 2IXNA 3C62A 3RF3A 2WL8A 4CBEA 2Y3BA 1MMAA 5CIVA 4Q5SF 2NPUA 2TMVP 2J9VA 1M57C 2PBEA 4F4BA 3AGTA 3K7DA 4K1OA 2Z15A 1FTSA 1FFHA 1YA9A 2L7AA 1KU2A 2OU6A 4Q7CA 1FMWA 4PJLA 3TJ6A 1M2VB 3AQBA 3EHMA 2Q3TA 5DQTA 2V3CC 1O87A 3A9CA 4AE4B 1A7VA 2KNHA 3ASOC 4PR9A 1Z7Qc 4U5BE 3DE8A 1J8YF 3US6A 4DJ9A 2J8WA 3FOPA 2EILC 4CDYA 2VH3A 1QKRA 3C8GD 3S9OA 4O6YA 1WTYA 4JURI 3DZAA 4MTGA 1OCRC 4YN0B 1XZPA 3SXYA 3F46A 5JRAA 1QZXA 3MFNA 2L6FA 2R7TA 3UMIA 2LD6A 4O79A 2XL4A 2PNOA 3W4YA 1ZYRF 3AG4C 2HSQA 1OXKA 1QLEC 2DB4A 2A69F 3LEOA 2HKVA 1YA7O 1ZHTA 1ZHXA 2RSEB 3PHF2 1U89A 1M2OA 3LS0A 2VCCA 3QZCA 2H8AA 2Y3GA 3JTLO 2XS1A 1I4YA 5B3SC 4CSAC 4C7OA 1K05A 1NU9C 1K40A 2XLHA 5E3AA 2YEVA 1J8MF 1WOLA 3U2MA 4KI2A 4GEHA 2XXAB 3JZ0A 3G4XA 4Z9HA 3EH2A 3TOMA 3JYYA 2GFHA 2HSBA 2LIGA 3SZRA 4NY3A 2A6EF 5IY5C 3SNHA 2X51A 2QNLA 5COGA 1Q0FA 2LK4A 3U9MA 3WODF 4AL1A 3B0UX 5KYUA 4XWJA 4AX2A 1TKNA 3EG9A 1JAFA 2R05A 4X0RA 1UFBA 4DBRA 4UDVA 2EIKC 1D1AA 1OXBA 1Q0MA 4PACA 1NZEA 2XS8A 3EGXB 2CNWA 4EUKB 4XLNF 1Z6AA 4WJ0A 5L0GA 2A0BA 1RKEB 1LPEA 2KQ9A 2XLOA 3NMIA 4CS9A 2Q9BA 3EHNA 3LAYA 3SEOA 1Z3IX 1TWAA 4NTBA 5B3IA 2FFHA 3N0TA 4C3DA 2XM4A 2BE5F 5L0HA 2R25A 2HJ3A 1LE4A 3ABMC 5KYWA 4O6MA 3NYLA 1TQGA 3DXJF 1EA8A 5KYXA 2EPKX 4PK4A 4YT5A 4E17A 2HUJA 4MTOA 1RMVA 2J7PA 2YL3A 2D4UA 1A0BA 2ZXPA 4JCHA 3EQLF 2VB6A 5TJ5E 1RXQA 5JLIA 5COMA 3OEOA 3EFOA 2B0HA 3I5QA 3WAQA 1T5OA 3DJUB 4BJ5C 3EGDB 4MVUA 3AG3C 1CGME 2AVKA 4CSAA 3FOOA 1APCA 4CS7A 4EBJA 4B6IA 2MWQA 2Q4FA 3M4BA 2W4BA 3L0IA 4XEVA 2PF4E 4MTFA 2Y3HA 4C3BA 5BQGA 1VLSA 4E18A 1AUEA 2J46A 2CDQA 2NUPB 1V74B 4WABA 3U0CA 2KJGA 1OCZC 1V4AA 3O55A 3QTHA 1EI7A 1RJ9A 4PJMA 4DRIB 3PDMP 1IZMA 3KH2A 3Q7GA 1YZAA 1FAPB 2B0JA 1OW8A 2XLVA 3NMJA 3UGPA 1H7IA 2XLMA 4D4NA 4MW8A 1NLXA 4LDQA 3C8GB 3N24A 2BL2A 3G50A 3V5ZA 1VK5A 4XPXA 3IHUA 1ORYA 5DQZA 3S90A 4KNVA 1ST6A 4OD5A 4ER9A 2J0XA 4N6HA 4RD9A 4E0IA 2Q7RA 4IARA 3HLZA 5B1BC 4PJJA 3NKEA 2OOCA 2AU5A 3ZVRA 4CDAA 5JT4A 2LP4A 3KYIA 4MVSA 5D92A 3U5SA 2NUPA 2PX0A 3B0VC 2XLWA 3UMHA 1M56C 1EQ1A 4JW1A 5L0DA 3GM2A 1G8XA 2ZPAA 4ANJA 1D0XA 3DJNB 3O39A 1U0BB 2F22A 3FXHA 3H65A 3NYMA 2CW0F 2QLAA 1TFOB 2G3VA 1YYJA 2L6GA 1BZ4A 2BC5A 3J06A 4BEMJ 1E86A 3GODA 3JRTA 3MYIA 2HJMA 1NG1A 5T1DB 1FFTC 2IM8A 3W2VA 3NDBB 2YLGA 1KTMA 1PD0A 2NUTA 4WGZA 3S0XA 2PP4A 3KPHA 4J30B 3LESA 2OJQA 2R9RB 3NG1A 4N06A 2FAPB 3IQ5A 2NG1A 2NSGA 3A11A 2Q9AA 3FVYA 1C17M 1DOVA 2P0NA 3NKDA 3FAPB 4CDVA 3LNMB 1MNEA 3B9QA 4BJ6C 4PFOA 4XEKA 2EPMX 1CPRA 1H6GA 1LI5A 4FAPB 1HE1A 3M4CA 4E7ZA 3ABKC 3HKKA 1WGWA 1SR2A 1VYKA 3U8VA 2XM0A 2R7WA 1ZHYA 2R02A 4JVSA 3RKOF 3VRCA 3L8JA 1O3UA 2P1AA 4OD4A 2YLDA 1ZVZA 2O9XA 1EKYA 4XEFA 3CZ6A 2AWCA 3HNLA 3LEVA 4KNWA 4YJWA 2VC9A 4CJOA 2EPOA 3SXKA 4RDAA 5HV9A 2Q00A 3EJNA 3TULA 2HV7A 2YHSA 1D0ZA 1M2VA 1YAUO 3BEHA 5BQHA 2ZD9A 1OW6A 2YRFA 3DAFA 1RKCA 2Y39A 2I15A 3I4UA 3AG2C 3KMIA 4FESA 4AE4A 2HV6A 3RQFA 4FWVA 3AGUA 4BEJA 4EBKA 2YLIA 4W8PA 1R5ID 2R7OA 2XRHA 1SYQA 3F47A 4LERA 4G0HA 1PD1A 4QI2A 1V54C 1YZCA 1C02A 1OR3A 4MVRA 1DOWA 3V5XA 4JJFA 2IXPA 2HS5A 4HFKB 4J7TA 4XLPF 4H4KC 1C03A 3S29A 4MW3A 3K1IA 4BPMA 2KYHA 4EBBA 3JRMO 2ZXWC 1LE2A 2RD9A 4P6IC 5F5HA 1Q0DA 5DS6A 2W45A 3VAYA 2OEVA 1TWHA 3TJ5A 3V5YA 4DBQA 1MMNA 3WG7C 3DM9B 2MYSA 1JRAA 1MMDA 3L8IA 5A6BA 4W8KA 5L0IA 2M4EA 1O5HA 1HMDA 1Q0GA 2DYRC 4O7GA 1OKKA 3DD7A 4MVOA 4BJ1A 5JUAA 2WVNA 2XXAA 2P61A 2W9YA 3LNRA 3ZQYA 1VTMP 3ABLC 4YK5A 4P9FA 4EWCA 2OCCC 1M6TA 4JEAA 3U2LA 3ZSUA 3KYJA 2R03A 4A4AA 5T3WA 2QUPA 3HNIA 4FX5A 3ECSA 4JTCB 2YWAA 3S28A 2J45A 4JE9A 4IWBA 4OIQF 2KC3A 1QQ3A 2OG2A 4YL0A 4PFPA 1BR2A 1AVOB 1G4US 1LIHA 2OJED 3JSZA 4CS8C 5JS5A 1JPNA 2R7RA 4MS2A 2PFDA 3QMKA 5D91A 3CQZA 3U8PA 1V55C 1SF8A 2ETSA 3B71A 3EGXA 3RVYA 2KGOA 2GA0A 2XL6A 1LKXA 5JVEA 3ASNC 1RKEA 4XPYA 4L6RA 2HMQA 4N6CA 3EH1A 4JKVA 3JCUQ 5E2QA 3O6XA 1H9TA 3JT1A 2X0CA 1CGNA 2YVKA 3X1OA 1Y6DA 4A2NB 3ZTZA 5KYYB 2QY9A 5JP7A 2WZFA 2H7BA 3RFYA 2J9WA 3GM1A 4YT2A 2CYDA 4QDLA 3CAXA 2AP3A 1GS9A 4DRHB 2XLDA 4YT8A 5L0CA 4JRZA 1VMAA 3E9VA 3NYJA 1VYIA 5GPGB 4JC7A 3ZWIA 4J32B 2W4MA 1LI7A 1WATA 3B29A 2J0WA 3N2ZB 1NU7D 2CNWD 3H2VA 3Q6MA 3RIPA 3SXZA 3GEIA 3K66A 1TWGA 4AL0A 3M15A 3EGDA 4XQ1A 3T6GB 1OCCC 4MNDA 2XL8A 3T9OA 4C3EA 1I5NA 1LS4A 4HE8D 1TR2A 1OR2A 3NMKA 1G4WR 1LM3B 3HJCA 2JD3A 1ZW2A 2YQYA 3GORA 4Q4ZF 2G3KA 3TD7A 3H2UA 4N4WA 4JIOA 3UR3C 5A6JA 3K1HA 5EHHA 4XTKA 3T6BA 4G7HF 5FZTA 4JEBA 2VCBA 1G5ZA 2GWWA 2YZSA 1SMYF 3TQOA 4CIPA 2GDCA 2J7PD 3AQCA 3RQEA 2LFFA 1ZZPA 4KBLA 2E87A 3ZDLA 5HSWA 2KK1A 1OCOC 2IOQA 1ORJA 2R7QA 4JJGA 3C8GA 4NTAA 4MVZA 5EK0A 3JSEO 1ZW3A 1QPUA 1R4TA 1VLTA 4MVMA 5DS4A 4YL3A 4OIPF 3MYFA 3T4RA 5COFA 4QI0A 2H7OA 1YDIA 5CI8A 1YLMA 2LQGA 3ATPA 3CEXA 4BJ5A 4K0DA 2C03A 4IB4A 3RYLA
chains in the Genus database with same CATH topology
1D0YA 2G62A 4CIHA 3K6BA 4LACB 2WB7A 4PJNA 3LJBA 3KKBA 3ZC4A 3POVA 1TWCA 3UMKA 5T3TA 3DMDA 3L34A 2L9JA 2IXOA 5F5FA 2L81A 4IAOA 1W2WA 1BR4A 1S7ZA 5EGYA 2A1DD 2PX3A 2P7VA 2LSEA 1BR1A 4CS9C 2D5RB 4IRUA 4DOZA 4C7OB 4DVZA 4U5GA 3I5PA 3S27A 1PCXA 4DVYP 2EIMC 3UGOA 3B0PA 2R7SA 1ZHZA 3X2QC 5BUOA 5B1AC 4I1OB 3Q6NA 4U5FE 5KYUB 4O6NA 4HFFB 4BG0A 3EG9B 4LLEA 2ZXRA 3LLIA 5E3CA 4LLCA 3EPVA 3LS1A 4AK9A 4G7ZF 3ZG1A 3UNGC 2QTVA 4I3MA 4ZLCA 4U5DE 2R7XA 3FHDA 2A6HF 4BJ6A 3V7OA 3W8HA 3SYNA 3FDQA 4BJTA 3W8IA 4HEAJ 5CI9A 5KYWB 2V26A 4OIOF 2I8BA 4K7BA 5KYXB 4RBNA 5L3QA 3FAJA 3ZIBA 2DYSC 1MMGA 3E70C 4OIRF 4G7OF 3OWTA 3LLKA 3EFOB 1D1BA 2ZXOA 4OINF 2WZLA 3CSKA 2IYLD 3MX3A 1MNDA 3AG1C 1Z5ZA 2IXMA 3EZHA 4M63A 2WVQA 4KC9A 4IJJA 4U5CE 4ZLDA 1ZU4A 2R7VA 3GANA 1RJ9B 3DAGA 2KW3C 3PMRA 3K33A 5E33A 1SZIA 4ULWA 2DGJA 1ZU5A 2EIJC 1OKKD 3JYHA 3VYWA 3M1CB 3Q7LA 1JPJA 3DM5A 4I44A 1D1CA 1FMVA 2Q9CA 2CGEA 1LVKA 5DVWA 1Z23A 5KYYA 3KL4A 4U5HA 1ZHWA 2FGYA 4U5EE 4I1MA 4MQ9F 3NRHA 2P6VA 2A68F 2H7VC 4YWQA 3SP1A 2J9UA 4YT4A 3ITFA 2WVOA 3OA1A 3T6JA 4CS8A 2EINC 5DS5A 3EZIA 1N1CA 2Y69C 3RH3A 2WZGA 2Y3DA 3MLGA 4GYTA 2XSEA 4E7SA 2NUTB 1LS1A 5DLJA 2VASA 5L3VA 3IEEA 1IW7F 2C04A 3W2WA 1Z63A 1VOMA 4JZAA 2R7UA 5FCLA 3HTKC 5KYNA 3K1IC 2IXNA 4CBEA 2WL8A 2Y3BA 1MMAA 4Q5SF 2J9VA 1M57C 4F4BA 3K7DA 2Z15A 1FTSA 1FFHA 4PJLA 1KU2A 4Q7CA 1FMWA 1M2VB 3AQBA 3EHMA 2Q3TA 5DQTA 2V3CC 1O87A 4AE4B 2KNHA 3ASOC 4U5BE 1J8YF 2EILC 2VH3A 4O6YA 4JURI 3DZAA 4YN0B 1OCRC 3F46A 1QZXA 3UMIA 4O79A 2XL4A 1ZYRF 3AG4C 1QLEC 2A69F 1ZHXA 1ZHTA 3PHF2 3LS0A 1M2OA 3QZCA 2Y3GA 4CSAC 5B3SC 4C7OA 1NU9C 5E3AA 2YEVA 1J8MF 4KI2A 2XXAB 4GEHA 3EH2A 2GFHA 3SZRA 4NY3A 2A6EF 5IY5C 3SNHA 2X51A 3WODF 3B0UX 5KYUA 4XWJA 4AX2A 1TKNA 3EG9A 4X0RA 4DBRA 2EIKC 1D1AA 1NZEA 3EGXB 2CNWA 4XLNF 1Z6AA 4WJ0A 4CS9A 2KQ9A 2Q9BA 3EHNA 3LAYA 3SEOA 1Z3IX 1TWAA 2FFHA 3N0TA 4C3DA 2BE5F 3ABMC 5KYWA 4O6MA 3NYLA 3DXJF 5KYXA 4PK4A 4YT5A 2J7PA 2ZXPA 4JCHA 3EQLF 2VB6A 3OEOA 3EFOA 3I5QA 3DJUB 4BJ5C 3EGDB 3AG3C 4CSAA 4CS7A 4B6IA 2MWQA 2W4BA 3L0IA 4C3BA 2PF4E 2Y3HA 2J46A 2CDQA 2NUPB 2KJGA 1OCZC 1RJ9A 4PJMA 1IZMA 3KH2A 3Q7GA 2B0JA 3UGPA 3N24A 1VK5A 5DQZA 4KNVA 1ST6A 4OD5A 2J0XA 4RD9A 3HLZA 5B1BC 4PJJA 3NKEA 3ZVRA 5D92A 3B0VC 2NUPA 2PX0A 3UMHA 1M56C 4JW1A 1G8XA 2ZPAA 4ANJA 1D0XA 3DJNB 3O39A 3H65A 3NYMA 2CW0F 2G3VA 3GODA 3JRTA 1NG1A 5T1DB 1FFTC 3W2VA 1PD0A 2NUTA 3S0XA 2PP4A 4J30B 3LESA 4N06A 3NG1A 2NG1A 3FVYA 2Q9AA 3NKDA 1MNEA 3B9QA 4BJ6C 4PFOA 4E7ZA 3ABKC 1WGWA 1VYKA 2R7WA 1ZHYA 4JVSA 3RKOF 4OD4A 2O9XA 2R7TA 3CZ6A 3LEVA 4KNWA 4YJWA 4RDAA 3EJNA 2HV7A 2YHSA 1D0ZA 1M2VA 3DAFA 3I4UA 2Y39A 4FESA 4AE4A 3KMIA 3AG2C 2HV6A 4FWVA 4BEJA 2R7OA 2XRHA 3F47A 4LERA 4G0HA 1PD1A 4QI2A 1V54C 4JJFA 2IXPA 4HFKB 4XLPF 4H4KC 3S29A 4EBBA 2ZXWC 4P6IC 5F5HA 5DS6A 2W45A 3VAYA 1TWHA 4DBQA 1MMNA 3WG7C 3DM9B 2MYSA 1MMDA 4W8KA 2M4EA 1O5HA 2DYRC 4O7GA 1OKKA 3DD7A 4BJ1A 2WVNA 2XXAA 2W9YA 3LNRA 3ABLC 4EWCA 2OCCC 3ZSUA 5T3WA 4FX5A 3ECSA 3S28A 2J45A 4IWBA 4OIQF 2OG2A 4PFPA 1BR2A 3JSZA 4CS8C 1JPNA 2R7RA 2PFDA 3QMKA 5D91A 3CQZA 1V55C 1SF8A 3EGXA 2KGOA 1LKXA 3ASNC 3EH1A 3JCUQ 5E2QA 3O6XA 3JT1A 3X1OA 4A2NB 5KYYB 2QY9A 3RFYA 2WZFA 2H7BA 2J9WA 4YT2A 4QDLA 4YT8A 1VMAA 3E9VA 3NYJA 1VYIA 4J32B 2W4MA 2J0WA 3N2ZB 1NU7D 2CNWD 3Q6MA 3RIPA 3K66A 1TWGA 3EGDA 1OCCC 4MNDA 4C3EA 4HE8D 1TR2A 3HJCA 2JD3A 4Q4ZF 2G3KA 3TD7A 3UR3C 3K1HA 5EHHA 4XTKA 3T6BA 4G7HF 2YZSA 1SMYF 2J7PD 3AQCA 3NDBB 4KBLA 2E87A 5HSWA 1OCOC 2IOQA 2R7QA 4JJGA 5DS4A 4OIPF 3T4RA 4QI0A 2H7OA 5CI8A 4BJ5A 4K0DA 2C03A 3RYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6V A;  2PP4 A;  2H7B A;  2KNH A; 
#chains in the Genus database with same CATH topology
 1D0Y A;  2G62 A;  2OQM A;  4EHP A;  4CIH A;  5L0F A;  3K6B A;  4YL1 A;  4ONS A;  2A0U A;  3G4Z A;  4LAC B;  4U9D A;  2WB7 A;  4PJN A;  3LJB A;  3KKB A;  3LUT B;  1WWP A;  3ZC4 A;  5A6A A;  3IQT A;  4Z9I A;  3ZQV A;  3U3F A;  3POV A;  2J9B A;  1TWC A;  3C8Z A;  4NCQ A;  256B A;  1A7D A;  3UMK A;  5T3T A;  3DMD A;  3L34 A;  2L9J A;  2IXO A;  1KNY A;  5F5F A;  2L81 A;  4IAO A;  2EPN A;  1HMO A;  1VB5 A;  1W2W A;  3FMS A;  1BR4 A;  1YJG A;  3QVY A;  4IAQ A;  1CGO A;  1T6Q A;  1S7Z A;  5AC4 A;  2DI3 A;  1E84 A;  5EGY A;  2HZ8 A;  2A1D D;  3M79 A;  2PX3 A;  2P7V A;  2HMZ A;  2LSE A;  1XZQ A;  1BR1 A;  3R7C A;  1NBB A;  1T01 A;  2LCH A;  2HFI A;  4CS9 C;  2D5R B;  2M64 A;  1U6H A;  4IRU A;  4DOZ A;  1T9K A;  4P9T A;  4IGG A;  3GEE A;  1JR8 A;  4C7O B;  4DVZ A;  4U5G A;  3I5P A;  3S27 A;  1GM5 A;  1PCX A;  1T6I A;  3PCV A;  4DVY P;  2EIM C;  2YL0 A;  3TK0 A;  1Y4C A;  4LDK A;  3TOL A;  3WHN A;  3UGO A;  3B0P A;  4JTD B;  2R7S A;  2UUI A;  4NC3 A;  1ZHZ A;  4NQF A;  4GQH A;  3X2Q C;  5BUO A;  1Q0K A;  5B1A C;  1OW7 A;  1WAS A;  4I1O B;  4DXW A;  3Q6N A;  4U5F E;  5KYU B;  4O6N A;  5F28 E;  1HE9 A;  1YYX A;  4HFF B;  1UG7 A;  3IQ6 A;  5JSL A;  4BG0 A;  4D4X A;  1BBH A;  1A7E A;  3EG9 B;  2IBF A;  2ZXR A;  4LLE A;  4WGY A;  3QW0 A;  1L7C A;  4DRJ B;  1YVI A;  3LLI A;  2OEX A;  5AC5 A;  5E3C A;  4LLC A;  3EPV A;  3DKA A;  3LS1 A;  4AK9 A;  4G7Z F;  3ZG1 A;  3UNG C;  2QTV A;  4I3M A;  4ZLC A;  4U5D E;  1JOG A;  4R32 A;  2R7X A;  3O10 A;  3FHD A;  1GGQ A;  2A6H F;  4BJ6 A;  3V7O A;  3W8H A;  1CPQ A;  1E2X A;  3SYN A;  4EKW A;  4NTF A;  4BJT A;  3FDQ A;  2QE9 A;  2YKZ A;  3VM6 A;  1OQC A;  1I4Z A;  1NFN A;  3W8I A;  4HEA J;  5CI9 A;  3GWL A;  2V26 A;  2NSF A;  2I8B A;  4E0H A;  5KYW B;  4K7B A;  5KYX B;  4OIO F;  4RBN A;  3DE9 A;  5A69 A;  5L3Q A;  1NFO A;  3FAJ A;  3HNJ A;  3ZIB A;  2DYS C;  1MMG A;  3E70 C;  4OIR F;  3SXM A;  1HW2 A;  3OWT A;  4G7O F;  3LLK A;  3AOU A;  3EFO B;  1D1B A;  3C63 A;  2ZXO A;  4Z9J A;  3U3B A;  4OIN F;  2WZL A;  3VF0 A;  3CSK A;  2IYL D;  3MX3 A;  1L3P A;  1MND A;  3AG1 C;  1Z5Z A;  2IXM A;  3EZH A;  4M63 A;  4U9E A;  1H9G A;  2WVQ A;  4KC9 A;  1A41 A;  4IJJ A;  4U5C E;  4ZLD A;  2AWY A;  5AGF A;  1ZU4 A;  4JCZ A;  3BRJ A;  4ULV A;  2VCA A;  2R7V A;  3GAN A;  1RJ9 B;  2ASR A;  2OKU A;  3DI5 A;  3DAG A;  2UUH A;  3RVZ A;  2CCY A;  5A6B D;  5K0I A;  2KW3 C;  3PMR A;  3K33 A;  4G78 A;  5E33 A;  1SZI A;  4ULW A;  2DGJ A;  1ZU5 A;  2EIJ C;  1JMW A;  1OKK D;  1PV3 A;  1YAR O;  2GAQ A;  2KSF A;  1E83 A;  3JYH A;  2MHR A;  3VYW A;  4EIY A;  3M1C B;  3Q7L A;  1JPJ A;  2LFD A;  3DM5 A;  4I44 A;  1D1C A;  1FMV A;  2XLE A;  4JTA B;  3RQG A;  4CJG A;  2Q9C A;  2CGE A;  2EPL X;  1LVK A;  3GEH A;  2ICW G;  4MVQ A;  5DVW A;  1BDJ B;  3MBG A;  1Z23 A;  5A6K A;  1RCP A;  3QVZ A;  2JPU A;  5KYY A;  3KL4 A;  3IPM O;  4U5H A;  1FNT c;  1ZHW A;  4CX9 A;  2FGY A;  5L0J A;  1E85 A;  1HY5 A;  1T6U A;  4U5E E;  4I1M A;  3R2P A;  3DWW A;  2L6H A;  4MQ9 F;  4XPW A;  3NRH A;  2P6V A;  3S84 A;  1MQV A;  2A68 F;  2H7V C;  4LDR A;  3SP1 A;  2J9U A;  4YT4 A;  4YWQ A;  3ITF A;  5BQI A;  1FR0 A;  1WN0 A;  3C18 A;  2YL7 A;  1B68 A;  2WVO A;  3OA1 A;  3T6J A;  4CS8 A;  3C7J A;  2EIN C;  3ZTM A;  5DS5 A;  1XWJ A;  3EZI A;  1N1C A;  1GQA A;  2Y69 C;  3AJM A;  3RH3 A;  1F1M A;  2WZG A;  2Y3D A;  2YL1 A;  1NSG B;  3MLG A;  4GYT A;  3U9J A;  2JX0 A;  2XSE A;  2NUT B;  1LS1 A;  5DLJ A;  4E7S A;  2VAS A;  1AEP A;  5L3V A;  3IEE A;  3GM3 A;  1QSP A;  1IW7 F;  2C04 A;  3RW0 A;  3HNK A;  3IQC A;  1QVX A;  3W2W A;  1ORS C;  1TFK B;  3L1M A;  1VOM A;  1Z63 A;  4JZA A;  3QW1 A;  4J7Y A;  5FCL A;  2R7U A;  3HTK C;  3GWN A;  1K04 A;  4H54 A;  1HW1 A;  5KYN A;  3K1I C;  1S05 A;  2IXN A;  3C62 A;  3RF3 A;  2WL8 A;  4CBE A;  2Y3B A;  1MMA A;  5CIV A;  4Q5S F;  2NPU A;  2TMV P;  2J9V A;  1M57 C;  2PBE A;  4F4B A;  3AGT A;  3K7D A;  4K1O A;  2Z15 A;  1FTS A;  1FFH A;  1YA9 A;  2L7A A;  1KU2 A;  2OU6 A;  4Q7C A;  1FMW A;  4PJL A;  3TJ6 A;  1M2V B;  3AQB A;  3EHM A;  2Q3T A;  5DQT A;  2V3C C;  1O87 A;  3A9C A;  4AE4 B;  1A7V A;  2KNH A;  3ASO C;  4PR9 A;  1Z7Q c;  4U5B E;  3DE8 A;  1J8Y F;  3US6 A;  4DJ9 A;  2J8W A;  3FOP A;  2EIL C;  4CDY A;  2VH3 A;  1QKR A;  3C8G D;  3S9O A;  4O6Y A;  1WTY A;  4JUR I;  3DZA A;  4MTG A;  1OCR C;  4YN0 B;  1XZP A;  3SXY A;  3F46 A;  5JRA A;  1QZX A;  3MFN A;  2L6F A;  2R7T A;  3UMI A;  2LD6 A;  4O79 A;  2XL4 A;  2PNO A;  3W4Y A;  1ZYR F;  3AG4 C;  2HSQ A;  1OXK A;  1QLE C;  2DB4 A;  2A69 F;  3LEO A;  2HKV A;  1YA7 O;  1ZHT A;  1ZHX A;  2RSE B;  3PHF 2;  1U89 A;  1M2O A;  3LS0 A;  2VCC A;  3QZC A;  2H8A A;  2Y3G A;  3JTL O;  2XS1 A;  1I4Y A;  5B3S C;  4CSA C;  4C7O A;  1K05 A;  1NU9 C;  1K40 A;  2XLH A;  5E3A A;  2YEV A;  1J8M F;  1WOL A;  3U2M A;  4KI2 A;  4GEH A;  2XXA B;  3JZ0 A;  3G4X A;  4Z9H A;  3EH2 A;  3TOM A;  3JYY A;  2GFH A;  2HSB A;  2LIG A;  3SZR A;  4NY3 A;  2A6E F;  5IY5 C;  3SNH A;  2X51 A;  2QNL A;  5COG A;  1Q0F A;  2LK4 A;  3U9M A;  3WOD F;  4AL1 A;  3B0U X;  5KYU A;  4XWJ A;  4AX2 A;  1TKN A;  3EG9 A;  1JAF A;  2R05 A;  4X0R A;  1UFB A;  4DBR A;  4UDV A;  2EIK C;  1D1A A;  1OXB A;  1Q0M A;  4PAC A;  1NZE A;  2XS8 A;  3EGX B;  2CNW A;  4EUK B;  4XLN F;  1Z6A A;  4WJ0 A;  5L0G A;  2A0B A;  1RKE B;  1LPE A;  2KQ9 A;  2XLO A;  3NMI A;  4CS9 A;  2Q9B A;  3EHN A;  3LAY A;  3SEO A;  1Z3I X;  1TWA A;  4NTB A;  5B3I A;  2FFH A;  3N0T A;  4C3D A;  2XM4 A;  2BE5 F;  5L0H A;  2R25 A;  2HJ3 A;  1LE4 A;  3ABM C;  5KYW A;  4O6M A;  3NYL A;  1TQG A;  3DXJ F;  1EA8 A;  5KYX A;  2EPK X;  4PK4 A;  4YT5 A;  4E17 A;  2HUJ A;  4MTO A;  1RMV A;  2J7P A;  2YL3 A;  2D4U A;  1A0B A;  2ZXP A;  4JCH A;  3EQL F;  2VB6 A;  5TJ5 E;  1RXQ A;  5JLI A;  5COM A;  3OEO A;  3EFO A;  2B0H A;  3I5Q A;  3WAQ A;  1T5O A;  3DJU B;  4BJ5 C;  3EGD B;  4MVU A;  3AG3 C;  1CGM E;  2AVK A;  4CSA A;  3FOO A;  1APC A;  4CS7 A;  4EBJ A;  4B6I A;  2MWQ A;  2Q4F A;  3M4B A;  2W4B A;  3L0I A;  4XEV A;  2PF4 E;  4MTF A;  2Y3H A;  4C3B A;  5BQG A;  1VLS A;  4E18 A;  1AUE A;  2J46 A;  2CDQ A;  2NUP B;  1V74 B;  4WAB A;  3U0C A;  2KJG A;  1OCZ C;  1V4A A;  3O55 A;  3QTH A;  1EI7 A;  1RJ9 A;  4PJM A;  4DRI B;  3PDM P;  1IZM A;  3KH2 A;  3Q7G A;  1YZA A;  1FAP B;  2B0J A;  1OW8 A;  2XLV A;  3NMJ A;  3UGP A;  1H7I A;  2XLM A;  4D4N A;  4MW8 A;  1NLX A;  4LDQ A;  3C8G B;  3N24 A;  2BL2 A;  3G50 A;  3V5Z A;  1VK5 A;  4XPX A;  3IHU A;  1ORY A;  5DQZ A;  3S90 A;  4KNV A;  1ST6 A;  4OD5 A;  4ER9 A;  2J0X A;  4N6H A;  4RD9 A;  4E0I A;  2Q7R A;  4IAR A;  3HLZ A;  5B1B C;  4PJJ A;  3NKE A;  2OOC A;  2AU5 A;  3ZVR A;  4CDA A;  5JT4 A;  2LP4 A;  3KYI A;  4MVS A;  5D92 A;  3U5S A;  2NUP A;  2PX0 A;  3B0V C;  2XLW A;  3UMH A;  1M56 C;  1EQ1 A;  4JW1 A;  5L0D A;  3GM2 A;  1G8X A;  2ZPA A;  4ANJ A;  1D0X A;  3DJN B;  3O39 A;  1U0B B;  2F22 A;  3FXH A;  3H65 A;  3NYM A;  2CW0 F;  2QLA A;  1TFO B;  2G3V A;  1YYJ A;  2L6G A;  1BZ4 A;  2BC5 A;  3J06 A;  4BEM J;  1E86 A;  3GOD A;  3JRT A;  3MYI A;  2HJM A;  1NG1 A;  5T1D B;  1FFT C;  2IM8 A;  3W2V A;  3NDB B;  2YLG A;  1KTM A;  1PD0 A;  2NUT A;  4WGZ A;  3S0X A;  2PP4 A;  3KPH A;  4J30 B;  3LES A;  2OJQ A;  2R9R B;  3NG1 A;  4N06 A;  2FAP B;  3IQ5 A;  2NG1 A;  2NSG A;  3A11 A;  2Q9A A;  3FVY A;  1C17 M;  1DOV A;  2P0N A;  3NKD A;  3FAP B;  4CDV A;  3LNM B;  1MNE A;  3B9Q A;  4BJ6 C;  4PFO A;  4XEK A;  2EPM X;  1CPR A;  1H6G A;  1LI5 A;  4FAP B;  1HE1 A;  3M4C A;  4E7Z A;  3ABK C;  3HKK A;  1WGW A;  1SR2 A;  1VYK A;  3U8V A;  2XM0 A;  2R7W A;  1ZHY A;  2R02 A;  4JVS A;  3RKO F;  3VRC A;  3L8J A;  1O3U A;  2P1A A;  4OD4 A;  2YLD A;  1ZVZ A;  2O9X A;  1EKY A;  4XEF A;  3CZ6 A;  2AWC A;  3HNL A;  3LEV A;  4KNW A;  4YJW A;  2VC9 A;  4CJO A;  2EPO A;  3SXK A;  4RDA A;  5HV9 A;  2Q00 A;  3EJN A;  3TUL A;  2HV7 A;  2YHS A;  1D0Z A;  1M2V A;  1YAU O;  3BEH A;  5BQH A;  2ZD9 A;  1OW6 A;  2YRF A;  3DAF A;  1RKC A;  2Y39 A;  2I15 A;  3I4U A;  3AG2 C;  3KMI A;  4FES A;  4AE4 A;  2HV6 A;  3RQF A;  4FWV A;  3AGU A;  4BEJ A;  4EBK A;  2YLI A;  4W8P A;  1R5I D;  2R7O A;  2XRH A;  1SYQ A;  3F47 A;  4LER A;  4G0H A;  1PD1 A;  4QI2 A;  1V54 C;  1YZC A;  1C02 A;  1OR3 A;  4MVR A;  1DOW A;  3V5X A;  4JJF A;  2IXP A;  2HS5 A;  4HFK B;  4J7T A;  4XLP F;  4H4K C;  1C03 A;  3S29 A;  4MW3 A;  3K1I A;  4BPM A;  2KYH A;  4EBB A;  3JRM O;  2ZXW C;  1LE2 A;  2RD9 A;  4P6I C;  5F5H A;  1Q0D A;  5DS6 A;  2W45 A;  3VAY A;  2OEV A;  1TWH A;  3TJ5 A;  3V5Y A;  4DBQ A;  1MMN A;  3WG7 C;  3DM9 B;  2MYS A;  1JRA A;  1MMD A;  3L8I A;  5A6B A;  4W8K A;  5L0I A;  2M4E A;  1O5H A;  1HMD A;  1Q0G A;  2DYR C;  4O7G A;  1OKK A;  3DD7 A;  4MVO A;  4BJ1 A;  5JUA A;  2WVN A;  2XXA A;  2P61 A;  2W9Y A;  3LNR A;  3ZQY A;  1VTM P;  3ABL C;  4YK5 A;  4P9F A;  4EWC A;  2OCC C;  1M6T A;  4JEA A;  3U2L A;  3ZSU A;  3KYJ A;  2R03 A;  4A4A A;  5T3W A;  2QUP A;  3HNI A;  4FX5 A;  3ECS A;  4JTC B;  2YWA A;  3S28 A;  2J45 A;  4JE9 A;  4IWB A;  4OIQ F;  2KC3 A;  1QQ3 A;  2OG2 A;  4YL0 A;  4PFP A;  1BR2 A;  1AVO B;  1G4U S;  1LIH A;  2OJE D;  3JSZ A;  4CS8 C;  5JS5 A;  1JPN A;  2R7R A;  4MS2 A;  2PFD A;  3QMK A;  5D91 A;  3CQZ A;  3U8P A;  1V55 C;  1SF8 A;  2ETS A;  3B71 A;  3EGX A;  3RVY A;  2KGO A;  2GA0 A;  2XL6 A;  1LKX A;  5JVE A;  3ASN C;  1RKE A;  4XPY A;  4L6R A;  2HMQ A;  4N6C A;  3EH1 A;  4JKV A;  3JCU Q;  5E2Q A;  3O6X A;  1H9T A;  3JT1 A;  2X0C A;  1CGN A;  2YVK A;  3X1O A;  1Y6D A;  4A2N B;  3ZTZ A;  5KYY B;  2QY9 A;  5JP7 A;  2WZF A;  2H7B A;  3RFY A;  2J9W A;  3GM1 A;  4YT2 A;  2CYD A;  4QDL A;  3CAX A;  2AP3 A;  1GS9 A;  4DRH B;  2XLD A;  4YT8 A;  5L0C A;  4JRZ A;  1VMA A;  3E9V A;  3NYJ A;  1VYI A;  5GPG B;  4JC7 A;  3ZWI A;  4J32 B;  2W4M A;  1LI7 A;  1WAT A;  3B29 A;  2J0W A;  3N2Z B;  1NU7 D;  2CNW D;  3H2V A;  3Q6M A;  3RIP A;  3SXZ A;  3GEI A;  3K66 A;  1TWG A;  4AL0 A;  3M15 A;  3EGD A;  4XQ1 A;  3T6G B;  1OCC C;  4MND A;  2XL8 A;  3T9O A;  4C3E A;  1I5N A;  1LS4 A;  4HE8 D;  1TR2 A;  1OR2 A;  3NMK A;  1G4W R;  1LM3 B;  3HJC A;  2JD3 A;  1ZW2 A;  2YQY A;  3GOR A;  4Q4Z F;  2G3K A;  3TD7 A;  3H2U A;  4N4W A;  4JIO A;  3UR3 C;  5A6J A;  3K1H A;  5EHH A;  4XTK A;  3T6B A;  4G7H F;  5FZT A;  4JEB A;  2VCB A;  1G5Z A;  2GWW A;  2YZS A;  1SMY F;  3TQO A;  4CIP A;  2GDC A;  2J7P D;  3AQC A;  3RQE A;  2LFF A;  1ZZP A;  4KBL A;  2E87 A;  3ZDL A;  5HSW A;  2KK1 A;  1OCO C;  2IOQ A;  1ORJ A;  2R7Q A;  4JJG A;  3C8G A;  4NTA A;  4MVZ A;  5EK0 A;  3JSE O;  1ZW3 A;  1QPU A;  1R4T A;  1VLT A;  4MVM A;  5DS4 A;  4YL3 A;  4OIP F;  3MYF A;  3T4R A;  5COF A;  4QI0 A;  2H7O A;  1YDI A;  5CI8 A;  1YLM A;  2LQG A;  3ATP A;  3CEX A;  4BJ5 A;  4K0D A;  2C03 A;  4IB4 A;  3RYL A; 
#chains in the Genus database with same CATH homology
 1D0Y A;  2G62 A;  4CIH A;  3K6B A;  4LAC B;  2WB7 A;  4PJN A;  3LJB A;  3KKB A;  3ZC4 A;  3POV A;  1TWC A;  3UMK A;  5T3T A;  3DMD A;  3L34 A;  2L9J A;  2IXO A;  5F5F A;  2L81 A;  4IAO A;  1W2W A;  1BR4 A;  1S7Z A;  5EGY A;  2A1D D;  2PX3 A;  2P7V A;  2LSE A;  1BR1 A;  4CS9 C;  2D5R B;  4IRU A;  4DOZ A;  4C7O B;  4DVZ A;  4U5G A;  3I5P A;  3S27 A;  1PCX A;  4DVY P;  2EIM C;  3UGO A;  3B0P A;  2R7S A;  1ZHZ A;  3X2Q C;  5BUO A;  5B1A C;  4I1O B;  3Q6N A;  4U5F E;  5KYU B;  4O6N A;  4HFF B;  4BG0 A;  3EG9 B;  4LLE A;  2ZXR A;  3LLI A;  5E3C A;  4LLC A;  3EPV A;  3LS1 A;  4AK9 A;  4G7Z F;  3ZG1 A;  3UNG C;  2QTV A;  4I3M A;  4ZLC A;  4U5D E;  2R7X A;  3FHD A;  2A6H F;  4BJ6 A;  3V7O A;  3W8H A;  3SYN A;  3FDQ A;  4BJT A;  3W8I A;  4HEA J;  5CI9 A;  5KYW B;  2V26 A;  4OIO F;  2I8B A;  4K7B A;  5KYX B;  4RBN A;  5L3Q A;  3FAJ A;  3ZIB A;  2DYS C;  1MMG A;  3E70 C;  4OIR F;  4G7O F;  3OWT A;  3LLK A;  3EFO B;  1D1B A;  2ZXO A;  4OIN F;  2WZL A;  3CSK A;  2IYL D;  3MX3 A;  1MND A;  3AG1 C;  1Z5Z A;  2IXM A;  3EZH A;  4M63 A;  2WVQ A;  4KC9 A;  4IJJ A;  4U5C E;  4ZLD A;  1ZU4 A;  2R7V A;  3GAN A;  1RJ9 B;  3DAG A;  2KW3 C;  3PMR A;  3K33 A;  5E33 A;  1SZI A;  4ULW A;  2DGJ A;  1ZU5 A;  2EIJ C;  1OKK D;  3JYH A;  3VYW A;  3M1C B;  3Q7L A;  1JPJ A;  3DM5 A;  4I44 A;  1D1C A;  1FMV A;  2Q9C A;  2CGE A;  1LVK A;  5DVW A;  1Z23 A;  5KYY A;  3KL4 A;  4U5H A;  1ZHW A;  2FGY A;  4U5E E;  4I1M A;  4MQ9 F;  3NRH A;  2P6V A;  2A68 F;  2H7V C;  4YWQ A;  3SP1 A;  2J9U A;  4YT4 A;  3ITF A;  2WVO A;  3OA1 A;  3T6J A;  4CS8 A;  2EIN C;  5DS5 A;  3EZI A;  1N1C A;  2Y69 C;  3RH3 A;  2WZG A;  2Y3D A;  3MLG A;  4GYT A;  2XSE A;  4E7S A;  2NUT B;  1LS1 A;  5DLJ A;  2VAS A;  5L3V A;  3IEE A;  1IW7 F;  2C04 A;  3W2W A;  1Z63 A;  1VOM A;  4JZA A;  2R7U A;  5FCL A;  3HTK C;  5KYN A;  3K1I C;  2IXN A;  4CBE A;  2WL8 A;  2Y3B A;  1MMA A;  4Q5S F;  2J9V A;  1M57 C;  4F4B A;  3K7D A;  2Z15 A;  1FTS A;  1FFH A;  4PJL A;  1KU2 A;  4Q7C A;  1FMW A;  1M2V B;  3AQB A;  3EHM A;  2Q3T A;  5DQT A;  2V3C C;  1O87 A;  4AE4 B;  2KNH A;  3ASO C;  4U5B E;  1J8Y F;  2EIL C;  2VH3 A;  4O6Y A;  4JUR I;  3DZA A;  4YN0 B;  1OCR C;  3F46 A;  1QZX A;  3UMI A;  4O79 A;  2XL4 A;  1ZYR F;  3AG4 C;  1QLE C;  2A69 F;  1ZHX A;  1ZHT A;  3PHF 2;  3LS0 A;  1M2O A;  3QZC A;  2Y3G A;  4CSA C;  5B3S C;  4C7O A;  1NU9 C;  5E3A A;  2YEV A;  1J8M F;  4KI2 A;  2XXA B;  4GEH A;  3EH2 A;  2GFH A;  3SZR A;  4NY3 A;  2A6E F;  5IY5 C;  3SNH A;  2X51 A;  3WOD F;  3B0U X;  5KYU A;  4XWJ A;  4AX2 A;  1TKN A;  3EG9 A;  4X0R A;  4DBR A;  2EIK C;  1D1A A;  1NZE A;  3EGX B;  2CNW A;  4XLN F;  1Z6A A;  4WJ0 A;  4CS9 A;  2KQ9 A;  2Q9B A;  3EHN A;  3LAY A;  3SEO A;  1Z3I X;  1TWA A;  2FFH A;  3N0T A;  4C3D A;  2BE5 F;  3ABM C;  5KYW A;  4O6M A;  3NYL A;  3DXJ F;  5KYX A;  4PK4 A;  4YT5 A;  2J7P A;  2ZXP A;  4JCH A;  3EQL F;  2VB6 A;  3OEO A;  3EFO A;  3I5Q A;  3DJU B;  4BJ5 C;  3EGD B;  3AG3 C;  4CSA A;  4CS7 A;  4B6I A;  2MWQ A;  2W4B A;  3L0I A;  4C3B A;  2PF4 E;  2Y3H A;  2J46 A;  2CDQ A;  2NUP B;  2KJG A;  1OCZ C;  1RJ9 A;  4PJM A;  1IZM A;  3KH2 A;  3Q7G A;  2B0J A;  3UGP A;  3N24 A;  1VK5 A;  5DQZ A;  4KNV A;  1ST6 A;  4OD5 A;  2J0X A;  4RD9 A;  3HLZ A;  5B1B C;  4PJJ A;  3NKE A;  3ZVR A;  5D92 A;  3B0V C;  2NUP A;  2PX0 A;  3UMH A;  1M56 C;  4JW1 A;  1G8X A;  2ZPA A;  4ANJ A;  1D0X A;  3DJN B;  3O39 A;  3H65 A;  3NYM A;  2CW0 F;  2G3V A;  3GOD A;  3JRT A;  1NG1 A;  5T1D B;  1FFT C;  3W2V A;  1PD0 A;  2NUT A;  3S0X A;  2PP4 A;  4J30 B;  3LES A;  4N06 A;  3NG1 A;  2NG1 A;  3FVY A;  2Q9A A;  3NKD A;  1MNE A;  3B9Q A;  4BJ6 C;  4PFO A;  4E7Z A;  3ABK C;  1WGW A;  1VYK A;  2R7W A;  1ZHY A;  4JVS A;  3RKO F;  4OD4 A;  2O9X A;  2R7T A;  3CZ6 A;  3LEV A;  4KNW A;  4YJW A;  4RDA A;  3EJN A;  2HV7 A;  2YHS A;  1D0Z A;  1M2V A;  3DAF A;  3I4U A;  2Y39 A;  4FES A;  4AE4 A;  3KMI A;  3AG2 C;  2HV6 A;  4FWV A;  4BEJ A;  2R7O A;  2XRH A;  3F47 A;  4LER A;  4G0H A;  1PD1 A;  4QI2 A;  1V54 C;  4JJF A;  2IXP A;  4HFK B;  4XLP F;  4H4K C;  3S29 A;  4EBB A;  2ZXW C;  4P6I C;  5F5H A;  5DS6 A;  2W45 A;  3VAY A;  1TWH A;  4DBQ A;  1MMN A;  3WG7 C;  3DM9 B;  2MYS A;  1MMD A;  4W8K A;  2M4E A;  1O5H A;  2DYR C;  4O7G A;  1OKK A;  3DD7 A;  4BJ1 A;  2WVN A;  2XXA A;  2W9Y A;  3LNR A;  3ABL C;  4EWC A;  2OCC C;  3ZSU A;  5T3W A;  4FX5 A;  3ECS A;  3S28 A;  2J45 A;  4IWB A;  4OIQ F;  2OG2 A;  4PFP A;  1BR2 A;  3JSZ A;  4CS8 C;  1JPN A;  2R7R A;  2PFD A;  3QMK A;  5D91 A;  3CQZ A;  1V55 C;  1SF8 A;  3EGX A;  2KGO A;  1LKX A;  3ASN C;  3EH1 A;  3JCU Q;  5E2Q A;  3O6X A;  3JT1 A;  3X1O A;  4A2N B;  5KYY B;  2QY9 A;  3RFY A;  2WZF A;  2H7B A;  2J9W A;  4YT2 A;  4QDL A;  4YT8 A;  1VMA A;  3E9V A;  3NYJ A;  1VYI A;  4J32 B;  2W4M A;  2J0W A;  3N2Z B;  1NU7 D;  2CNW D;  3Q6M A;  3RIP A;  3K66 A;  1TWG A;  3EGD A;  1OCC C;  4MND A;  4C3E A;  4HE8 D;  1TR2 A;  3HJC A;  2JD3 A;  4Q4Z F;  2G3K A;  3TD7 A;  3UR3 C;  3K1H A;  5EHH A;  4XTK A;  3T6B A;  4G7H F;  2YZS A;  1SMY F;  2J7P D;  3AQC A;  3NDB B;  4KBL A;  2E87 A;  5HSW A;  1OCO C;  2IOQ A;  2R7Q A;  4JJG A;  5DS4 A;  4OIP F;  3T4R A;  4QI0 A;  2H7O A;  5CI8 A;  4BJ5 A;  4K0D A;  2C03 A;  3RYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...