3UGOA

Crystal structure of rna-polymerase sigma subunit domain 2 complexed with -10 promoter element ssdna oligo (tacaat)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
180
structure length
180
Chain Sequence
b'TSDPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTARIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor
publication title Structural basis for promoter-10 element recognition by the bacterial RNA polymerase sigma subunit.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
total genus 72
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00140 Sigma70_r1_2 Sigma-70 factor, region 1.2
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1810 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ugoA00
1ZYRF 2A6HF 2BE5F 1SMYF 3LEVA 4OIPF 3UGOA 3UGPA 4MQ9F 4OIOF 4G7OF 4G7ZF 4KI2A 3WODF 2A6EF 1KU2A 3LESA 1IW7F 3EQLF 4OIRF 2A68F 2A69F 4Q4ZF 4OINF 4XLNF 3DXJF 4Q5SF 4XLPF 2CW0F 4G7HF 4OIQF
chains in the Genus database with same CATH superfamily
2LD6A 4FESA 3LS1A 4PJMA 1K40A 2CDQA 2PP4A 2VCBA 2FAPB 3NMJA 3NG1A 1NBBA 4J7YA 4JZAA 4MS2A 3W2VA 4MVQA 1FMWA 4U5FE 4U5BE 2Y3GA 4WGZA 3JSZA 2MWQA 5A6AA 4G7ZF 2XXAA 3NDBB 4PFOA 4DRJB 3GODA 3G4XA 2NUTB 1CPRA 1VLSA 2EPLX 5CI9A 4BJ6A 1ORJA 2VB6A 4NTFA 1WOLA 5A6BA 4O7GA 1U0BB 1PD0A 3GWLA 3QMKA 4JVSA 3G4ZA 2HMQA 5DVWA 4BJ1A 4UDVA 3FOPA 1VYIA 5L0DA 5BUOA 1UFBA 3DWWA 3NYLA 2LFFA 2M4EA 3TQOA 3AG1C 5KYYA 1PCXA 1DOVA 3N0TA 3Q6NA 256BA 4I1OB 1HE9A 3FXHA 2A0UA 3UMHA 1NU7D 2VC9A 3O10A 2GDCA 3AOUA 3LS0A 4E0IA 5KYYB 3MYIA 1T9KA 3VYWA 1GGQA 1G5ZA 2XL8A 3UR3C 2IXNA 4N4WA 1U89A 3OA1A 2W4BA 5L0JA 2EPNA 3KL4A 1YYXA 2LSEA 3L0IA 3OEOA 4I44A 4AX2A 5HV9A 2YL0A 4JTAB 2Y3DA 1M57C 2EPOA 3C8GD 4CDAA 2A69F 5FZTA 1J8MF 5DQTA 4A4AA 2IBFA 3C8GB 3NRHA 2YWAA 1RKEB 1OKKA 4W8PA 4LERA 3WAQA 1LI5A 1PV3A 5KYWB 4JE9A 3RW0A 2BC5A 3LNRA 3RQGA 2ZXPA 1OCOC 5AGFA 2JX0A 3RIPA 1EKYA 4MW8A 2UUIA 4I3MA 2P7VA 2PNOA 4JCHA 5DLJA 5COMA 1DOWA 2HJ3A 1MMGA 2OCCC 3GWNA 3GM3A 1WWPA 5JLIA 1H9GA 2AVKA 3JYHA 1F1MA 3DKAA 3FVYA 1BR4A 4FWVA 1ZVZA 4N6CA 4JEAA 3U2MA 3ZG1A 4F4BA 3HNIA 2R7UA 1L7CA 2PF4E 2CYDA 4J30B 5EK0A 1D1BA 1LKXA 2LQGA 2XLMA 2YHSA 1JRAA 4CBEA 3N24A 3HNLA 3MYFA 4WJ0A 3ZTMA 1GM5A 3FAJA 1S05A 1YARO 1OCRC 3EFOA 1R4TA 2WVQA 3LAYA 2X0CA 1VTMP 1UG7A 3LLIA 4YN0B 3EG9B 3VRCA 3ZSUA 5COFA 2WZGA 3AGTA 3DI5A 4WGYA 3U9JA 1RKCA 5KYUA 4J32B 4IRUA 3L8IA 3IQ5A 1N1CA 2H7VC 5JSLA 4BJ5C 3ASOC 4IAOA 2R25A 2DGJA 4OIOF 4YL1A 2ZXOA 2HJMA 4JTDB 3C18A 3PMRA 2FFHA 3CSKA 2J9UA 4EBJA 2DI3A 1AUEA 3WHNA 4MVUA 2O9XA 1K05A 2YKZA 3V5ZA 1MNEA 1Q0FA 3LUTB 4JC7A 2R7OA 4XPXA 4EBKA 5HSWA 3CEXA 1OXKA 3BRJA 2L7AA 2WVNA 1T6IA 5DS4A 2XLHA 1BZ4A 3HJCA 4OINF 3K66A 4Z9HA 1MNDA 1Z7Qc 3US6A 1BR2A 4LDKA 5L0HA 5KYNA 3HNJA 3X1OA 2NUPA 2CW0F 1HW1A 3ABMC 1QVXA 4YWQA 3RQEA 2L6FA 3K6BA 5KYXA 2XLOA 5BQGA 2R7VA 2A6HF 4U9EA 1SF8A 3EGXB 4E18A 4YT8A 4H54A 2AU5A 1LS4A 3CAXA 1FAPB 1OR2A 1Q0MA 2J0XA 2J9BA 2VH3A 4KBLA 3TK0A 3S0XA 3WODF 3EHNA 3MX3A 4PJNA 3EJNA 4CS9A 1YZAA 1H7IA 3MBGA 3EH1A 3GEHA 2DYRC 5BQIA 2ZD9A 3KYJA 1OCCC 3AG4C 2G3KA 4XQ1A 4P9FA 5DQZA 3PHF2 2I15A 4JRZA 3EZHA 2OJED 3EGDB 3ABKC 1YA9A 2NSGA 2OG2A 4YT4A 4BEJA 1OW8A 1YLMA 2CCYA 3KYIA 5A6JA 1C17M 3L34A 1LI7A 3N2ZB 4OD4A 2KSFA 2P61A 3Q7LA 3EZIA 3C7JA 4ONSA 2HS5A 1ZHWA 2A0BA 2DYSC 2L9JA 3GORA 3M4CA 3K33A 4QI0A 4E17A 5EGYA 3AQBA 5JS5A 2C03A 4OIPF 4MW3A 3AJMA 3J06A 2Y69C 3B0VC 4NTBA 4PACA 2ETSA 4G7OF 1TQGA 2QUPA 3IEEA 3O6XA 3V5XA 3F47A 2AWCA 1Q0GA 3DJNB 4GYTA 2KK1A 1HW2A 2P6VA 4DVZA 1JR8A 2OU6A 4CJOA 4OD5A 3DAGA 2UUHA 3NKEA 4CX9A 2L81A 2Q9BA 3H2VA 4RBNA 1VMAA 2PX0A 1FMVA 3DXJF 5B1BC 4O79A 4CJGA 3O39A 1TWGA 2R9RB 3ASNC 3K1IC 1ST6A 2KYHA 3SYNA 4DOZA 3LLKA 1LPEA 4DBQA 4EBBA 4LLCA 1LE4A 1OW7A 1QPUA 2KGOA 3UNGC 4EIYA 4PR9A 3LEVA 5L0GA 5F5FA 4EKWA 1A41A 1XZQA 3F46A 5B1AC 3VF0A 3IQCA 2HSQA 1Q0DA 4RDAA 3GANA 4KI2A 1Z6AA 1TKNA 3JYYA 5DS5A 5K0IA 3TJ5A 2EINC 3ITFA 4IB4A 4R32A 4DBRA 2R7XA 1OQCA 2XLEA 1NFOA 2IXPA 4OIRF 5BQHA 3AG2C 2FGYA 3NYMA 5L3VA 3MFNA 2XXAB 5L0IA 1D1CA 5A6BD 2YQYA 5E3AA 1QZXA 3I4UA 1ZW3A 1Z3IX 4CSAC 4KC9A 2WL8A 1VLTA 4O6MA 4D4XA 1ZHXA 2X51A 4WABA 1T6UA 2OOCA 3AGUA 2Y3BA 4JJGA 4IGGA 4MVOA 2JD3A 1G4US 1MQVA 4MVSA 3DMDA 1JMWA 3C62A 1RCPA 4JURI 4RD9A 4U5GA 2CNWA 2IOQA 2MHRA 3A9CA 3ABLC 4Q7CA 1Y6DA 2QY9A 2A6EF 4YJWA 2Q3TA 4YL0A 4AE4A 4U9DA 4E7ZA 2GWWA 1TFOB 1KU2A 3QVZA 2YLGA 4C7OA 1IW7F 3H2UA 3UMIA 4YT5A 2HV7A 4YK5A 2QE9A 3V7OA 4N6HA 3FDQA 1KTMA 1OR3A 2YL1A 1KNYA 1HMOA 3GM1A 4M63A 3SXZA 5L0FA 4ZLDA 2XM4A 1GS9A 4NTAA 5F5HA 4BG0A 3W8HA 4K0DA 5AC4A 1V54C 2Z15A 3ZDLA 1MMDA 3KPHA 2ZXWC 2ZXRA 3LEOA 1NFNA 1BBHA 1S7ZA 5D92A 3SNHA 3SEOA 3QZCA 1OKKD 1QSPA 5B3IA 3UGPA 1JPNA 3G50A 1MMNA 3HTKC 3GM2A 2J9WA 3V5YA 4PFPA 2C04A 2XLDA 3U5SA 2EPMX 2I8BA 2XLWA 3M4BA 1RJ9A 4U5HA 3JSEO 4JEBA 2R02A 1NLXA 2XM0A 3M15A 3E70C 3EQLF 3R2PA 3E9VA 4ULWA 2ZPAA 4AL1A 1G8XA 1M2VA 4HEAJ 4BJ5A 5EHHA 2JPUA 1V55C 3NMKA 3MLGA 4AK9A 2GA0A 2IXMA 4GQHA 3SP1A 3TOLA 1WN0A 1C03A 3M1CB 3HKKA 4E0HA 4U5EE 1EQ1A 4CDYA 3ATPA 2J7PA 3T6GB 4K1OA 1W2WA 2XS1A 2EPKX 1GQAA 1K04A 2GFHA 2YEVA 4LLEA 4ULVA 4XWJA 3U0CA 2W4MA 3EFOB 1YVIA 2OEXA 1A7DA 3DZAA 1YAUO 2QLAA 2BL2A 3K1HA 4L6RA 4BEMJ 3S29A 4ZLCA 3RQFA 5CIVA 3JRTA 4MTFA 1O5HA 1VK5A 3IPMO 2YVKA 4P6IC 5KYUB 2R7TA 4KNWA 4PJLA 3JRMO 1VB5A 1WASA 3LESA 4CDVA 2E87A 1ZU5A 1Y4CA 5T3TA 2M64A 3CQZA 3U3BA 4AL0A 5DS6A 1SZIA 3JZ0A 4MTGA 1CGNA 1FNTc 1HE1A 3U8VA 5L3QA 4Q5SF 3FHDA 2QNLA 1NSGB 3DD7A 2R05A 5JUAA 1Z63A 4GEHA 3VAYA 4E7SA 4IWBA 2NUTA 4Z9JA 3S27A 3GEIA 1BDJB 2H8AA 1B68A 1LS1A 2YL3A 2ASRA 4LDRA 1A7VA 4EHPA 3TOMA 2R7WA 2R03A 2WB7A 4DJ9A 1HY5A 5FCLA 4FX5A 3DE9A 2YL7A 4HFKB 4JW1A 4KNVA 5L0CA 3X2QC 4O6YA 3IQTA 2NUPB 2PFDA 3O55A 4HE8D 1WTYA 5T3WA 1CGME 1TFKB 1QKRA 2KC3A 3W2WA 2D4UA 3FOOA 3R7CA 1E2XA 5KYXB 3JTLO 4DRIB 4X0RA 1A0BA 2IM8A 2XL4A 3KMIA 4FAPB 5JRAA 3DE8A 3UMKA 2A68F 2OQMA 2KW3C 2LFDA 2NPUA 3U3FA 1A7EA 2P0NA 4D4NA 1E84A 1FFHA 2B0HA 2Q4FA 1TWCA 1ORSC 3ECSA 1E85A 3KH2A 4BJ6C 1WATA 1AEPA 3HNKA 4O6NA 4DXWA 2TMVP 2P1AA 3B71A 4XPYA 2XS8A 1LM3B 1ZW2A 2CGEA 3CZ6A 4J7TA 3W4YA 3QW0A 3ZQYA 2YRFA 5CI8A 2J0WA 1ZHYA 2IYLD 5T1DB 1WGWA 1Z23A 3B0PA 3C8GA 2HUJA 1RKEA 4BPMA 1BR1A 1O87A 2XSEA 3A11A 3K1IA 4NY3A 3ZWIA 3PCVA 4IJJA 5KYWA 1Q0KA 2H7BA 3I5PA 4ER9A 2AWYA 5JVEA 1I4ZA 2GAQA 3FMSA 3U9MA 1NU9C 4HFFB 1RMVA 4CS7A 3ZTZA 3IQ6A 2Y3HA 2B0JA 4IAQA 2HZ8A 1QLEC 3S9OA 3TD7A 1CPQA 2HMZA 1M2OA 4EUKB 2R7SA 2IXOA 3C63A 4QI2A 5JT4A 2KQ9A 2EILC 3QVYA 2OEVA 5COGA 4XLPF 2LK4A 4G7HF 2Y39A 4OIQF 4NC3A 4Z9IA 3NKDA 3T9OA 1D1AA 2XL6A 1E83A 1ZYRF 2BE5F 1JPJA 2D5RB 2L6GA 5GPGB 1O3UA 1M56C 2VASA 3EH2A 3RKOF 2MYSA 3ZQVA 1L3PA 3RFYA 3PDMP 3L8JA 1YZCA 5B3SC 1C02A 4CS8C 5A69A 4N06A 1R5ID 5E3CA 2LP4A 2OJQA 5TJ5E 3SZRA 3LNMB 1TWHA 3EG9A 4CSAA 4B6IA 1YJGA 1ZU4A 3SXYA 2V26A 4DVYP 3K7DA 1EI7A 1NZEA 3H65A 1V74B 1XZPA 4CS8A 3T4RA 5E33A 5E2QA 1M6TA 2RSEB 3Q6MA 4W8KA 2R7RA 2KNHA 3SXKA 1SYQA 1OXBA 1H9TA 2J9VA 2RD9A 1XWJA 3U8PA 3AG3C 4MVZA 3ZIBA 1FTSA 1LIHA 4JTCB 2LCHA 1TR2A 2PX3A 4CIPA 4IARA 4U5CE 3ZC4A 5AC5A 4A2NB 1LVKA 2WVOA 1FFTC 4DRHB 4NCQA 4QDLA 2PBEA 3B9QA 3BEHA 1ZHZA 4PJJA 4I1MA 2V3CC 2HKVA 2HFIA 3RVZA 1VYKA 2F22A 4G78A 3L1MA 1CGOA 3EGXA 2Q00A 2VCAA 4ANJA 3JCUQ 2Q9CA 1PD1A 3IHUA 3M79A 2CNWD 3NYJA 4XLNF 4C3DA 1FR0A 1T6QA 1YDIA 1ZZPA 1T5OA 4JKVA 1YA7O 4AE4B 2YLDA 1LE2A 2XLVA 1D0YA 1T01A 4XEVA 2QTVA 2L6HA 4YL3A 1IZMA 4C7OB 2ICWG 3TJ6A 1SMYF 5F28E 1JAFA 3KKBA 2H7OA 2J45A 3QTHA 3Q7GA 2DB4A 1ZHTA 1OW6A 2W9YA 3T6BA 5JP7A 2LIGA 4C3EA 4YT2A 3EGDA 3EPVA 3S28A 4MVMA 2G3VA 2OKUA 2J46A 2NG1A 3QW1A 4JCZA 3VM6A 1JOGA 3LJBA 1TWAA 2G62A 1SR2A 2Q9AA 3RF3A 2EIJC 2NSFA 1I4YA 3NMIA 3DM5A 3I5QA 4MTOA 2A1DD 4Q4ZF 1RXQA 2YZSA 3JT1A 3B0UX 4JJFA 1U6HA 4U5DE 4CIHA 2HSBA 2WZLA 3DM9B 1QQ3A 3EHMA 4CS9C 3S84A 3TULA 4MNDA 2EIMC 1RJ9B 3T6JA 4G0HA 3U2LA 2R7QA 1EA8A 1D0XA 1MMAA 3RVYA 3W8IA 3POVA 1D0ZA 3SXMA 4EWCA 4XTKA 3S90A 2YLIA 3ZVRA 1M2VB 3DAFA 1Z5ZA 3AQCA 3UGOA 4MQ9F 1HMDA 4LACB 1APCA 1V4AA 2W45A 4H4KC 3GEEA 4JIOA 1G4WR 4C3BA 4P9TA 1VOMA 1YYJA 1ORYA 2J7PD 3FAPB 4XPWA 1E86A 5A6KA 1NG1A 1I5NA 2Q7RA 1H6GA 2EIKC 3C8ZA 3DJUB 2J8WA 3OWTA 2KJGA 2HV6A 3RYLA 4K7BA 4XEFA 3B29A 4MVRA 2WZFA 4LDQA 5D91A 2XRHA 1AVOB 4NQFA 3RH3A 3WG7C 4XEKA 1J8YF 2VCCA 5IY5C 4BJTA 2AP3A 3HLZA 1OCZC 4PK4A
chains in the Genus database with same CATH topology
4FESA 3LS1A 4PJMA 2CDQA 2PP4A 4JZAA 3NG1A 3W2VA 1FMWA 4U5FE 4U5BE 2Y3GA 3JSZA 2MWQA 2XXAA 4G7ZF 3NDBB 4PFOA 3GODA 2NUTB 4BJ6A 5CI9A 2VB6A 4O7GA 1PD0A 3QMKA 4JVSA 5DVWA 4BJ1A 1VYIA 5BUOA 3NYLA 2M4EA 3AG1C 5KYYA 1PCXA 3N0TA 3Q6NA 4I1OB 3UMHA 1NU7D 3LS0A 3VYWA 3UR3C 2IXNA 3OA1A 2W4BA 3KL4A 2LSEA 3L0IA 3OEOA 4I44A 4AX2A 2Y3DA 1M57C 2A69F 1J8MF 5DQTA 3NRHA 1OKKA 4LERA 5KYWB 3LNRA 2ZXPA 1OCOC 3RIPA 4I3MA 2P7VA 5DLJA 4JCHA 2OCCC 1MMGA 3JYHA 3FVYA 4FWVA 1BR4A 4F4BA 3ZG1A 2R7UA 2PF4E 4J30B 1D1BA 1LKXA 2YHSA 4CBEA 3N24A 4WJ0A 3FAJA 1OCRC 3EFOA 2WVQA 3LAYA 3LLIA 4YN0B 3EG9B 3ZSUA 2WZGA 5KYUA 4J32B 4IRUA 1N1CA 2H7VC 4BJ5C 3ASOC 4IAOA 2DGJA 4OIOF 2ZXOA 3PMRA 2FFHA 3CSKA 2J9UA 2O9XA 1MNEA 2R7OA 5HSWA 2WVNA 5DS4A 3HJCA 4OINF 3K66A 1MNDA 1BR2A 5KYNA 3X1OA 2NUPA 2CW0F 3ABMC 4YWQA 3K6BA 5KYXA 2R7VA 2A6HF 1SF8A 3EGXB 4YT8A 2J0XA 2VH3A 4KBLA 3S0XA 3WODF 3EHNA 3MX3A 4PJNA 3EJNA 4CS9A 3EH1A 2DYRC 1OCCC 3AG4C 2G3KA 5DQZA 3PHF2 3EZHA 3EGDB 3ABKC 2OG2A 4YT4A 4BEJA 3L34A 3N2ZB 4OD4A 3Q7LA 3EZIA 1ZHWA 2DYSC 2L9JA 4QI0A 5EGYA 3K33A 3AQBA 2C03A 4OIPF 2Y69C 3B0VC 4G7OF 3IEEA 3O6XA 3F47A 4GYTA 3DJNB 2P6VA 4DVZA 4OD5A 3DAGA 3NKEA 2L81A 2Q9BA 4RBNA 1VMAA 2PX0A 1FMVA 3DXJF 5B1BC 4O79A 3O39A 1TWGA 3ASNC 3K1IC 1ST6A 3SYNA 4DOZA 3LLKA 4DBQA 4EBBA 4LLCA 2KGOA 3UNGC 3LEVA 5F5FA 3F46A 5B1AC 4RDAA 3GANA 4KI2A 1Z6AA 1TKNA 5DS5A 2EINC 3ITFA 2R7XA 4DBRA 2IXPA 4OIRF 3AG2C 2FGYA 3NYMA 5L3VA 2XXAB 1D1CA 5E3AA 1QZXA 3I4UA 1Z3IX 4CSAC 4KC9A 2WL8A 4O6MA 1ZHXA 2X51A 2Y3BA 4JJGA 2JD3A 3DMDA 4U5GA 4JURI 4RD9A 2CNWA 2IOQA 4YJWA 3ABLC 4AE4A 4Q7CA 5KYYB 2QY9A 2A6EF 2Q3TA 4E7ZA 1KU2A 4C7OA 1IW7F 3UMIA 4YT5A 2HV7A 3V7OA 3FDQA 4M63A 4ZLDA 5F5HA 4BG0A 3W8HA 4K0DA 1V54C 2Z15A 1MMDA 2ZXWC 2ZXRA 1S7ZA 5D92A 3SNHA 3SEOA 3QZCA 1OKKD 3UGPA 1JPNA 1MMNA 3HTKC 2J9WA 4PFPA 2C04A 2I8BA 1RJ9A 4U5HA 3E70C 3EQLF 4ULWA 3E9VA 2ZPAA 1G8XA 1M2VA 4HEAJ 4BJ5A 5EHHA 1V55C 3MLGA 4AK9A 2IXMA 3SP1A 3M1CB 4U5EE 2J7PA 1W2WA 2GFHA 2YEVA 4LLEA 4XWJA 2W4MA 3EFOB 3DZAA 3K1HA 4ZLCA 3S29A 3JRTA 1O5HA 1VK5A 4P6IC 5KYUB 2R7TA 4KNWA 4PJLA 3LESA 2E87A 1ZU5A 5T3TA 3CQZA 5DS6A 1SZIA 5L3QA 4Q5SF 3FHDA 3DD7A 1Z63A 4GEHA 3VAYA 4E7SA 4IWBA 2NUTA 3S27A 1LS1A 2R7WA 2WB7A 5FCLA 4FX5A 4HFKB 4JW1A 4KNVA 3X2QC 4O6YA 2NUPB 2PFDA 4HE8D 5T3WA 3W2WA 5KYXB 4X0RA 2XL4A 3KMIA 3UMKA 2A68F 2KW3C 1FFHA 1TWCA 3ECSA 3KH2A 4BJ6C 4O6NA 2CGEA 3CZ6A 5T1DB 5CI8A 2J0WA 1ZHYA 2IYLD 1WGWA 1Z23A 3B0PA 1BR1A 1O87A 2XSEA 4NY3A 4IJJA 5KYWA 3I5PA 2H7BA 1NU9C 4HFFB 4CS7A 2Y3HA 2B0JA 3TD7A 1QLEC 2R7SA 1M2OA 2IXOA 4QI2A 2KQ9A 2EILC 4XLPF 4G7HF 2Y39A 4OIQF 3NKDA 1D1AA 1ZYRF 2BE5F 1JPJA 2D5RB 3RKOF 1M56C 2VASA 3EH2A 2MYSA 3RFYA 5B3SC 4CS8C 4N06A 5E3CA 3SZRA 1TWHA 3EG9A 4CSAA 4B6IA 1ZU4A 2V26A 4DVYP 3K7DA 1NZEA 3H65A 4CS8A 3T4RA 5E33A 5E2QA 4W8KA 3Q6MA 2R7RA 2KNHA 2J9VA 3AG3C 3ZIBA 1FTSA 1TR2A 2PX3A 4U5CE 3ZC4A 4A2NB 1LVKA 2WVOA 1FFTC 4QDLA 3B9QA 1ZHZA 4PJJA 4I1MA 2V3CC 1VYKA 3EGXA 4ANJA 3JCUQ 2Q9CA 1PD1A 3NYJA 4XLNF 2CNWD 4C3DA 4AE4B 1D0YA 2QTVA 1IZMA 4C7OB 1SMYF 3KKBA 2H7OA 2J45A 3Q7GA 1ZHTA 2W9YA 3T6BA 4C3EA 4YT2A 3EGDA 3EPVA 3S28A 2G3VA 2J46A 2NG1A 3LJBA 1TWAA 2G62A 2Q9AA 2EIJC 3DM5A 3I5QA 2A1DD 4Q4ZF 2YZSA 3JT1A 3B0UX 4JJFA 4U5DE 4CIHA 2WZLA 3DM9B 3EHMA 4CS9C 4MNDA 2EIMC 1RJ9B 3T6JA 4G0HA 3W8IA 2R7QA 3POVA 1D0XA 1MMAA 1D0ZA 4EWCA 4XTKA 3ZVRA 1M2VB 3DAFA 1Z5ZA 3AQCA 3UGOA 4MQ9F 4LACB 2W45A 4H4KC 4C3BA 1VOMA 2J7PD 1NG1A 3DJUB 2EIKC 3OWTA 2KJGA 2HV6A 3RYLA 4K7BA 2WZFA 5D91A 3RH3A 2XRHA 3WG7C 1J8YF 5IY5C 4BJTA 3HLZA 1OCZC 4PK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZYR F;  2A6H F;  2BE5 F;  1SMY F;  3LEV A;  4OIP F;  3UGO A;  3UGP A;  4MQ9 F;  4OIO F;  4G7O F;  4G7Z F;  4KI2 A;  3WOD F;  2A6E F;  1KU2 A;  3LES A;  1IW7 F;  3EQL F;  4OIR F;  2A68 F;  2A69 F;  4Q4Z F;  4OIN F;  4XLN F;  3DXJ F;  4Q5S F;  4XLP F;  2CW0 F;  4G7H F;  4OIQ F; 
#chains in the Genus database with same CATH topology
 2LD6 A;  4FES A;  3LS1 A;  4PJM A;  1K40 A;  2CDQ A;  2PP4 A;  2VCB A;  2FAP B;  3NMJ A;  3NG1 A;  1NBB A;  4J7Y A;  4JZA A;  4MS2 A;  3W2V A;  4MVQ A;  1FMW A;  4U5F E;  4U5B E;  2Y3G A;  4WGZ A;  3JSZ A;  2MWQ A;  5A6A A;  4G7Z F;  2XXA A;  3NDB B;  4PFO A;  4DRJ B;  3GOD A;  3G4X A;  2NUT B;  1CPR A;  1VLS A;  2EPL X;  5CI9 A;  4BJ6 A;  1ORJ A;  2VB6 A;  4NTF A;  1WOL A;  5A6B A;  4O7G A;  1U0B B;  1PD0 A;  3GWL A;  3QMK A;  4JVS A;  3G4Z A;  2HMQ A;  5DVW A;  4BJ1 A;  4UDV A;  3FOP A;  1VYI A;  5L0D A;  5BUO A;  1UFB A;  3DWW A;  3NYL A;  2LFF A;  2M4E A;  3TQO A;  3AG1 C;  5KYY A;  1PCX A;  1DOV A;  3N0T A;  3Q6N A;  256B A;  4I1O B;  1HE9 A;  3FXH A;  2A0U A;  3UMH A;  1NU7 D;  2VC9 A;  3O10 A;  2GDC A;  3AOU A;  3LS0 A;  4E0I A;  5KYY B;  3MYI A;  1T9K A;  3VYW A;  1GGQ A;  1G5Z A;  2XL8 A;  3UR3 C;  2IXN A;  4N4W A;  1U89 A;  3OA1 A;  2W4B A;  5L0J A;  2EPN A;  3KL4 A;  1YYX A;  2LSE A;  3L0I A;  3OEO A;  4I44 A;  4AX2 A;  5HV9 A;  2YL0 A;  4JTA B;  2Y3D A;  1M57 C;  2EPO A;  3C8G D;  4CDA A;  2A69 F;  5FZT A;  1J8M F;  5DQT A;  4A4A A;  2IBF A;  3C8G B;  3NRH A;  2YWA A;  1RKE B;  1OKK A;  4W8P A;  4LER A;  3WAQ A;  1LI5 A;  1PV3 A;  5KYW B;  4JE9 A;  3RW0 A;  2BC5 A;  3LNR A;  3RQG A;  2ZXP A;  1OCO C;  5AGF A;  2JX0 A;  3RIP A;  1EKY A;  4MW8 A;  2UUI A;  4I3M A;  2P7V A;  2PNO A;  4JCH A;  5DLJ A;  5COM A;  1DOW A;  2HJ3 A;  1MMG A;  2OCC C;  3GWN A;  3GM3 A;  1WWP A;  5JLI A;  1H9G A;  2AVK A;  3JYH A;  1F1M A;  3DKA A;  3FVY A;  1BR4 A;  4FWV A;  1ZVZ A;  4N6C A;  4JEA A;  3U2M A;  3ZG1 A;  4F4B A;  3HNI A;  2R7U A;  1L7C A;  2PF4 E;  2CYD A;  4J30 B;  5EK0 A;  1D1B A;  1LKX A;  2LQG A;  2XLM A;  2YHS A;  1JRA A;  4CBE A;  3N24 A;  3HNL A;  3MYF A;  4WJ0 A;  3ZTM A;  1GM5 A;  3FAJ A;  1S05 A;  1YAR O;  1OCR C;  3EFO A;  1R4T A;  2WVQ A;  3LAY A;  2X0C A;  1VTM P;  1UG7 A;  3LLI A;  4YN0 B;  3EG9 B;  3VRC A;  3ZSU A;  5COF A;  2WZG A;  3AGT A;  3DI5 A;  4WGY A;  3U9J A;  1RKC A;  5KYU A;  4J32 B;  4IRU A;  3L8I A;  3IQ5 A;  1N1C A;  2H7V C;  5JSL A;  4BJ5 C;  3ASO C;  4IAO A;  2R25 A;  2DGJ A;  4OIO F;  4YL1 A;  2ZXO A;  2HJM A;  4JTD B;  3C18 A;  3PMR A;  2FFH A;  3CSK A;  2J9U A;  4EBJ A;  2DI3 A;  1AUE A;  3WHN A;  4MVU A;  2O9X A;  1K05 A;  2YKZ A;  3V5Z A;  1MNE A;  1Q0F A;  3LUT B;  4JC7 A;  2R7O A;  4XPX A;  4EBK A;  5HSW A;  3CEX A;  1OXK A;  3BRJ A;  2L7A A;  2WVN A;  1T6I A;  5DS4 A;  2XLH A;  1BZ4 A;  3HJC A;  4OIN F;  3K66 A;  4Z9H A;  1MND A;  1Z7Q c;  3US6 A;  1BR2 A;  4LDK A;  5L0H A;  5KYN A;  3HNJ A;  3X1O A;  2NUP A;  2CW0 F;  1HW1 A;  3ABM C;  1QVX A;  4YWQ A;  3RQE A;  2L6F A;  3K6B A;  5KYX A;  2XLO A;  5BQG A;  2R7V A;  2A6H F;  4U9E A;  1SF8 A;  3EGX B;  4E18 A;  4YT8 A;  4H54 A;  2AU5 A;  1LS4 A;  3CAX A;  1FAP B;  1OR2 A;  1Q0M A;  2J0X A;  2J9B A;  2VH3 A;  4KBL A;  3TK0 A;  3S0X A;  3WOD F;  3EHN A;  3MX3 A;  4PJN A;  3EJN A;  4CS9 A;  1YZA A;  1H7I A;  3MBG A;  3EH1 A;  3GEH A;  2DYR C;  5BQI A;  2ZD9 A;  3KYJ A;  1OCC C;  3AG4 C;  2G3K A;  4XQ1 A;  4P9F A;  5DQZ A;  3PHF 2;  2I15 A;  4JRZ A;  3EZH A;  2OJE D;  3EGD B;  3ABK C;  1YA9 A;  2NSG A;  2OG2 A;  4YT4 A;  4BEJ A;  1OW8 A;  1YLM A;  2CCY A;  3KYI A;  5A6J A;  1C17 M;  3L34 A;  1LI7 A;  3N2Z B;  4OD4 A;  2KSF A;  2P61 A;  3Q7L A;  3EZI A;  3C7J A;  4ONS A;  2HS5 A;  1ZHW A;  2A0B A;  2DYS C;  2L9J A;  3GOR A;  3M4C A;  3K33 A;  4QI0 A;  4E17 A;  5EGY A;  3AQB A;  5JS5 A;  2C03 A;  4OIP F;  4MW3 A;  3AJM A;  3J06 A;  2Y69 C;  3B0V C;  4NTB A;  4PAC A;  2ETS A;  4G7O F;  1TQG A;  2QUP A;  3IEE A;  3O6X A;  3V5X A;  3F47 A;  2AWC A;  1Q0G A;  3DJN B;  4GYT A;  2KK1 A;  1HW2 A;  2P6V A;  4DVZ A;  1JR8 A;  2OU6 A;  4CJO A;  4OD5 A;  3DAG A;  2UUH A;  3NKE A;  4CX9 A;  2L81 A;  2Q9B A;  3H2V A;  4RBN A;  1VMA A;  2PX0 A;  1FMV A;  3DXJ F;  5B1B C;  4O79 A;  4CJG A;  3O39 A;  1TWG A;  2R9R B;  3ASN C;  3K1I C;  1ST6 A;  2KYH A;  3SYN A;  4DOZ A;  3LLK A;  1LPE A;  4DBQ A;  4EBB A;  4LLC A;  1LE4 A;  1OW7 A;  1QPU A;  2KGO A;  3UNG C;  4EIY A;  4PR9 A;  3LEV A;  5L0G A;  5F5F A;  4EKW A;  1A41 A;  1XZQ A;  3F46 A;  5B1A C;  3VF0 A;  3IQC A;  2HSQ A;  1Q0D A;  4RDA A;  3GAN A;  4KI2 A;  1Z6A A;  1TKN A;  3JYY A;  5DS5 A;  5K0I A;  3TJ5 A;  2EIN C;  3ITF A;  4IB4 A;  4R32 A;  4DBR A;  2R7X A;  1OQC A;  2XLE A;  1NFO A;  2IXP A;  4OIR F;  5BQH A;  3AG2 C;  2FGY A;  3NYM A;  5L3V A;  3MFN A;  2XXA B;  5L0I A;  1D1C A;  5A6B D;  2YQY A;  5E3A A;  1QZX A;  3I4U A;  1ZW3 A;  1Z3I X;  4CSA C;  4KC9 A;  2WL8 A;  1VLT A;  4O6M A;  4D4X A;  1ZHX A;  2X51 A;  4WAB A;  1T6U A;  2OOC A;  3AGU A;  2Y3B A;  4JJG A;  4IGG A;  4MVO A;  2JD3 A;  1G4U S;  1MQV A;  4MVS A;  3DMD A;  1JMW A;  3C62 A;  1RCP A;  4JUR I;  4RD9 A;  4U5G A;  2CNW A;  2IOQ A;  2MHR A;  3A9C A;  3ABL C;  4Q7C A;  1Y6D A;  2QY9 A;  2A6E F;  4YJW A;  2Q3T A;  4YL0 A;  4AE4 A;  4U9D A;  4E7Z A;  2GWW A;  1TFO B;  1KU2 A;  3QVZ A;  2YLG A;  4C7O A;  1IW7 F;  3H2U A;  3UMI A;  4YT5 A;  2HV7 A;  4YK5 A;  2QE9 A;  3V7O A;  4N6H A;  3FDQ A;  1KTM A;  1OR3 A;  2YL1 A;  1KNY A;  1HMO A;  3GM1 A;  4M63 A;  3SXZ A;  5L0F A;  4ZLD A;  2XM4 A;  1GS9 A;  4NTA A;  5F5H A;  4BG0 A;  3W8H A;  4K0D A;  5AC4 A;  1V54 C;  2Z15 A;  3ZDL A;  1MMD A;  3KPH A;  2ZXW C;  2ZXR A;  3LEO A;  1NFN A;  1BBH A;  1S7Z A;  5D92 A;  3SNH A;  3SEO A;  3QZC A;  1OKK D;  1QSP A;  5B3I A;  3UGP A;  1JPN A;  3G50 A;  1MMN A;  3HTK C;  3GM2 A;  2J9W A;  3V5Y A;  4PFP A;  2C04 A;  2XLD A;  3U5S A;  2EPM X;  2I8B A;  2XLW A;  3M4B A;  1RJ9 A;  4U5H A;  3JSE O;  4JEB A;  2R02 A;  1NLX A;  2XM0 A;  3M15 A;  3E70 C;  3EQL F;  3R2P A;  3E9V A;  4ULW A;  2ZPA A;  4AL1 A;  1G8X A;  1M2V A;  4HEA J;  4BJ5 A;  5EHH A;  2JPU A;  1V55 C;  3NMK A;  3MLG A;  4AK9 A;  2GA0 A;  2IXM A;  4GQH A;  3SP1 A;  3TOL A;  1WN0 A;  1C03 A;  3M1C B;  3HKK A;  4E0H A;  4U5E E;  1EQ1 A;  4CDY A;  3ATP A;  2J7P A;  3T6G B;  4K1O A;  1W2W A;  2XS1 A;  2EPK X;  1GQA A;  1K04 A;  2GFH A;  2YEV A;  4LLE A;  4ULV A;  4XWJ A;  3U0C A;  2W4M A;  3EFO B;  1YVI A;  2OEX A;  1A7D A;  3DZA A;  1YAU O;  2QLA A;  2BL2 A;  3K1H A;  4L6R A;  4BEM J;  3S29 A;  4ZLC A;  3RQF A;  5CIV A;  3JRT A;  4MTF A;  1O5H A;  1VK5 A;  3IPM O;  2YVK A;  4P6I C;  5KYU B;  2R7T A;  4KNW A;  4PJL A;  3JRM O;  1VB5 A;  1WAS A;  3LES A;  4CDV A;  2E87 A;  1ZU5 A;  1Y4C A;  5T3T A;  2M64 A;  3CQZ A;  3U3B A;  4AL0 A;  5DS6 A;  1SZI A;  3JZ0 A;  4MTG A;  1CGN A;  1FNT c;  1HE1 A;  3U8V A;  5L3Q A;  4Q5S F;  3FHD A;  2QNL A;  1NSG B;  3DD7 A;  2R05 A;  5JUA A;  1Z63 A;  4GEH A;  3VAY A;  4E7S A;  4IWB A;  2NUT A;  4Z9J A;  3S27 A;  3GEI A;  1BDJ B;  2H8A A;  1B68 A;  1LS1 A;  2YL3 A;  2ASR A;  4LDR A;  1A7V A;  4EHP A;  3TOM A;  2R7W A;  2R03 A;  2WB7 A;  4DJ9 A;  1HY5 A;  5FCL A;  4FX5 A;  3DE9 A;  2YL7 A;  4HFK B;  4JW1 A;  4KNV A;  5L0C A;  3X2Q C;  4O6Y A;  3IQT A;  2NUP B;  2PFD A;  3O55 A;  4HE8 D;  1WTY A;  5T3W A;  1CGM E;  1TFK B;  1QKR A;  2KC3 A;  3W2W A;  2D4U A;  3FOO A;  3R7C A;  1E2X A;  5KYX B;  3JTL O;  4DRI B;  4X0R A;  1A0B A;  2IM8 A;  2XL4 A;  3KMI A;  4FAP B;  5JRA A;  3DE8 A;  3UMK A;  2A68 F;  2OQM A;  2KW3 C;  2LFD A;  2NPU A;  3U3F A;  1A7E A;  2P0N A;  4D4N A;  1E84 A;  1FFH A;  2B0H A;  2Q4F A;  1TWC A;  1ORS C;  3ECS A;  1E85 A;  3KH2 A;  4BJ6 C;  1WAT A;  1AEP A;  3HNK A;  4O6N A;  4DXW A;  2TMV P;  2P1A A;  3B71 A;  4XPY A;  2XS8 A;  1LM3 B;  1ZW2 A;  2CGE A;  3CZ6 A;  4J7T A;  3W4Y A;  3QW0 A;  3ZQY A;  2YRF A;  5CI8 A;  2J0W A;  1ZHY A;  2IYL D;  5T1D B;  1WGW A;  1Z23 A;  3B0P A;  3C8G A;  2HUJ A;  1RKE A;  4BPM A;  1BR1 A;  1O87 A;  2XSE A;  3A11 A;  3K1I A;  4NY3 A;  3ZWI A;  3PCV A;  4IJJ A;  5KYW A;  1Q0K A;  2H7B A;  3I5P A;  4ER9 A;  2AWY A;  5JVE A;  1I4Z A;  2GAQ A;  3FMS A;  3U9M A;  1NU9 C;  4HFF B;  1RMV A;  4CS7 A;  3ZTZ A;  3IQ6 A;  2Y3H A;  2B0J A;  4IAQ A;  2HZ8 A;  1QLE C;  3S9O A;  3TD7 A;  1CPQ A;  2HMZ A;  1M2O A;  4EUK B;  2R7S A;  2IXO A;  3C63 A;  4QI2 A;  5JT4 A;  2KQ9 A;  2EIL C;  3QVY A;  2OEV A;  5COG A;  4XLP F;  2LK4 A;  4G7H F;  2Y39 A;  4OIQ F;  4NC3 A;  4Z9I A;  3NKD A;  3T9O A;  1D1A A;  2XL6 A;  1E83 A;  1ZYR F;  2BE5 F;  1JPJ A;  2D5R B;  2L6G A;  5GPG B;  1O3U A;  1M56 C;  2VAS A;  3EH2 A;  3RKO F;  2MYS A;  3ZQV A;  1L3P A;  3RFY A;  3PDM P;  3L8J A;  1YZC A;  5B3S C;  1C02 A;  4CS8 C;  5A69 A;  4N06 A;  1R5I D;  5E3C A;  2LP4 A;  2OJQ A;  5TJ5 E;  3SZR A;  3LNM B;  1TWH A;  3EG9 A;  4CSA A;  4B6I A;  1YJG A;  1ZU4 A;  3SXY A;  2V26 A;  4DVY P;  3K7D A;  1EI7 A;  1NZE A;  3H65 A;  1V74 B;  1XZP A;  4CS8 A;  3T4R A;  5E33 A;  5E2Q A;  1M6T A;  2RSE B;  3Q6M A;  4W8K A;  2R7R A;  2KNH A;  3SXK A;  1SYQ A;  1OXB A;  1H9T A;  2J9V A;  2RD9 A;  1XWJ A;  3U8P A;  3AG3 C;  4MVZ A;  3ZIB A;  1FTS A;  1LIH A;  4JTC B;  2LCH A;  1TR2 A;  2PX3 A;  4CIP A;  4IAR A;  4U5C E;  3ZC4 A;  5AC5 A;  4A2N B;  1LVK A;  2WVO A;  1FFT C;  4DRH B;  4NCQ A;  4QDL A;  2PBE A;  3B9Q A;  3BEH A;  1ZHZ A;  4PJJ A;  4I1M A;  2V3C C;  2HKV A;  2HFI A;  3RVZ A;  1VYK A;  2F22 A;  4G78 A;  3L1M A;  1CGO A;  3EGX A;  2Q00 A;  2VCA A;  4ANJ A;  3JCU Q;  2Q9C A;  1PD1 A;  3IHU A;  3M79 A;  2CNW D;  3NYJ A;  4XLN F;  4C3D A;  1FR0 A;  1T6Q A;  1YDI A;  1ZZP A;  1T5O A;  4JKV A;  1YA7 O;  4AE4 B;  2YLD A;  1LE2 A;  2XLV A;  1D0Y A;  1T01 A;  4XEV A;  2QTV A;  2L6H A;  4YL3 A;  1IZM A;  4C7O B;  2ICW G;  3TJ6 A;  1SMY F;  5F28 E;  1JAF A;  3KKB A;  2H7O A;  2J45 A;  3QTH A;  3Q7G A;  2DB4 A;  1ZHT A;  1OW6 A;  2W9Y A;  3T6B A;  5JP7 A;  2LIG A;  4C3E A;  4YT2 A;  3EGD A;  3EPV A;  3S28 A;  4MVM A;  2G3V A;  2OKU A;  2J46 A;  2NG1 A;  3QW1 A;  4JCZ A;  3VM6 A;  1JOG A;  3LJB A;  1TWA A;  2G62 A;  1SR2 A;  2Q9A A;  3RF3 A;  2EIJ C;  2NSF A;  1I4Y A;  3NMI A;  3DM5 A;  3I5Q A;  4MTO A;  2A1D D;  4Q4Z F;  1RXQ A;  2YZS A;  3JT1 A;  3B0U X;  4JJF A;  1U6H A;  4U5D E;  4CIH A;  2HSB A;  2WZL A;  3DM9 B;  1QQ3 A;  3EHM A;  4CS9 C;  3S84 A;  3TUL A;  4MND A;  2EIM C;  1RJ9 B;  3T6J A;  4G0H A;  3U2L A;  2R7Q A;  1EA8 A;  1D0X A;  1MMA A;  3RVY A;  3W8I A;  3POV A;  1D0Z A;  3SXM A;  4EWC A;  4XTK A;  3S90 A;  2YLI A;  3ZVR A;  1M2V B;  3DAF A;  1Z5Z A;  3AQC A;  3UGO A;  4MQ9 F;  1HMD A;  4LAC B;  1APC A;  1V4A A;  2W45 A;  4H4K C;  3GEE A;  4JIO A;  1G4W R;  4C3B A;  4P9T A;  1VOM A;  1YYJ A;  1ORY A;  2J7P D;  3FAP B;  4XPW A;  1E86 A;  5A6K A;  1NG1 A;  1I5N A;  2Q7R A;  1H6G A;  2EIK C;  3C8Z A;  3DJU B;  2J8W A;  3OWT A;  2KJG A;  2HV6 A;  3RYL A;  4K7B A;  4XEF A;  3B29 A;  4MVR A;  2WZF A;  4LDQ A;  5D91 A;  2XRH A;  1AVO B;  4NQF A;  3RH3 A;  3WG7 C;  4XEK A;  1J8Y F;  2VCC A;  5IY5 C;  4BJT A;  2AP3 A;  3HLZ A;  1OCZ C;  4PK4 A; 
#chains in the Genus database with same CATH homology
 4FES A;  3LS1 A;  4PJM A;  2CDQ A;  2PP4 A;  4JZA A;  3NG1 A;  3W2V A;  1FMW A;  4U5F E;  4U5B E;  2Y3G A;  3JSZ A;  2MWQ A;  2XXA A;  4G7Z F;  3NDB B;  4PFO A;  3GOD A;  2NUT B;  4BJ6 A;  5CI9 A;  2VB6 A;  4O7G A;  1PD0 A;  3QMK A;  4JVS A;  5DVW A;  4BJ1 A;  1VYI A;  5BUO A;  3NYL A;  2M4E A;  3AG1 C;  5KYY A;  1PCX A;  3N0T A;  3Q6N A;  4I1O B;  3UMH A;  1NU7 D;  3LS0 A;  3VYW A;  3UR3 C;  2IXN A;  3OA1 A;  2W4B A;  3KL4 A;  2LSE A;  3L0I A;  3OEO A;  4I44 A;  4AX2 A;  2Y3D A;  1M57 C;  2A69 F;  1J8M F;  5DQT A;  3NRH A;  1OKK A;  4LER A;  5KYW B;  3LNR A;  2ZXP A;  1OCO C;  3RIP A;  4I3M A;  2P7V A;  5DLJ A;  4JCH A;  2OCC C;  1MMG A;  3JYH A;  3FVY A;  4FWV A;  1BR4 A;  4F4B A;  3ZG1 A;  2R7U A;  2PF4 E;  4J30 B;  1D1B A;  1LKX A;  2YHS A;  4CBE A;  3N24 A;  4WJ0 A;  3FAJ A;  1OCR C;  3EFO A;  2WVQ A;  3LAY A;  3LLI A;  4YN0 B;  3EG9 B;  3ZSU A;  2WZG A;  5KYU A;  4J32 B;  4IRU A;  1N1C A;  2H7V C;  4BJ5 C;  3ASO C;  4IAO A;  2DGJ A;  4OIO F;  2ZXO A;  3PMR A;  2FFH A;  3CSK A;  2J9U A;  2O9X A;  1MNE A;  2R7O A;  5HSW A;  2WVN A;  5DS4 A;  3HJC A;  4OIN F;  3K66 A;  1MND A;  1BR2 A;  5KYN A;  3X1O A;  2NUP A;  2CW0 F;  3ABM C;  4YWQ A;  3K6B A;  5KYX A;  2R7V A;  2A6H F;  1SF8 A;  3EGX B;  4YT8 A;  2J0X A;  2VH3 A;  4KBL A;  3S0X A;  3WOD F;  3EHN A;  3MX3 A;  4PJN A;  3EJN A;  4CS9 A;  3EH1 A;  2DYR C;  1OCC C;  3AG4 C;  2G3K A;  5DQZ A;  3PHF 2;  3EZH A;  3EGD B;  3ABK C;  2OG2 A;  4YT4 A;  4BEJ A;  3L34 A;  3N2Z B;  4OD4 A;  3Q7L A;  3EZI A;  1ZHW A;  2DYS C;  2L9J A;  4QI0 A;  5EGY A;  3K33 A;  3AQB A;  2C03 A;  4OIP F;  2Y69 C;  3B0V C;  4G7O F;  3IEE A;  3O6X A;  3F47 A;  4GYT A;  3DJN B;  2P6V A;  4DVZ A;  4OD5 A;  3DAG A;  3NKE A;  2L81 A;  2Q9B A;  4RBN A;  1VMA A;  2PX0 A;  1FMV A;  3DXJ F;  5B1B C;  4O79 A;  3O39 A;  1TWG A;  3ASN C;  3K1I C;  1ST6 A;  3SYN A;  4DOZ A;  3LLK A;  4DBQ A;  4EBB A;  4LLC A;  2KGO A;  3UNG C;  3LEV A;  5F5F A;  3F46 A;  5B1A C;  4RDA A;  3GAN A;  4KI2 A;  1Z6A A;  1TKN A;  5DS5 A;  2EIN C;  3ITF A;  2R7X A;  4DBR A;  2IXP A;  4OIR F;  3AG2 C;  2FGY A;  3NYM A;  5L3V A;  2XXA B;  1D1C A;  5E3A A;  1QZX A;  3I4U A;  1Z3I X;  4CSA C;  4KC9 A;  2WL8 A;  4O6M A;  1ZHX A;  2X51 A;  2Y3B A;  4JJG A;  2JD3 A;  3DMD A;  4U5G A;  4JUR I;  4RD9 A;  2CNW A;  2IOQ A;  4YJW A;  3ABL C;  4AE4 A;  4Q7C A;  5KYY B;  2QY9 A;  2A6E F;  2Q3T A;  4E7Z A;  1KU2 A;  4C7O A;  1IW7 F;  3UMI A;  4YT5 A;  2HV7 A;  3V7O A;  3FDQ A;  4M63 A;  4ZLD A;  5F5H A;  4BG0 A;  3W8H A;  4K0D A;  1V54 C;  2Z15 A;  1MMD A;  2ZXW C;  2ZXR A;  1S7Z A;  5D92 A;  3SNH A;  3SEO A;  3QZC A;  1OKK D;  3UGP A;  1JPN A;  1MMN A;  3HTK C;  2J9W A;  4PFP A;  2C04 A;  2I8B A;  1RJ9 A;  4U5H A;  3E70 C;  3EQL F;  4ULW A;  3E9V A;  2ZPA A;  1G8X A;  1M2V A;  4HEA J;  4BJ5 A;  5EHH A;  1V55 C;  3MLG A;  4AK9 A;  2IXM A;  3SP1 A;  3M1C B;  4U5E E;  2J7P A;  1W2W A;  2GFH A;  2YEV A;  4LLE A;  4XWJ A;  2W4M A;  3EFO B;  3DZA A;  3K1H A;  4ZLC A;  3S29 A;  3JRT A;  1O5H A;  1VK5 A;  4P6I C;  5KYU B;  2R7T A;  4KNW A;  4PJL A;  3LES A;  2E87 A;  1ZU5 A;  5T3T A;  3CQZ A;  5DS6 A;  1SZI A;  5L3Q A;  4Q5S F;  3FHD A;  3DD7 A;  1Z63 A;  4GEH A;  3VAY A;  4E7S A;  4IWB A;  2NUT A;  3S27 A;  1LS1 A;  2R7W A;  2WB7 A;  5FCL A;  4FX5 A;  4HFK B;  4JW1 A;  4KNV A;  3X2Q C;  4O6Y A;  2NUP B;  2PFD A;  4HE8 D;  5T3W A;  3W2W A;  5KYX B;  4X0R A;  2XL4 A;  3KMI A;  3UMK A;  2A68 F;  2KW3 C;  1FFH A;  1TWC A;  3ECS A;  3KH2 A;  4BJ6 C;  4O6N A;  2CGE A;  3CZ6 A;  5T1D B;  5CI8 A;  2J0W A;  1ZHY A;  2IYL D;  1WGW A;  1Z23 A;  3B0P A;  1BR1 A;  1O87 A;  2XSE A;  4NY3 A;  4IJJ A;  5KYW A;  3I5P A;  2H7B A;  1NU9 C;  4HFF B;  4CS7 A;  2Y3H A;  2B0J A;  3TD7 A;  1QLE C;  2R7S A;  1M2O A;  2IXO A;  4QI2 A;  2KQ9 A;  2EIL C;  4XLP F;  4G7H F;  2Y39 A;  4OIQ F;  3NKD A;  1D1A A;  1ZYR F;  2BE5 F;  1JPJ A;  2D5R B;  3RKO F;  1M56 C;  2VAS A;  3EH2 A;  2MYS A;  3RFY A;  5B3S C;  4CS8 C;  4N06 A;  5E3C A;  3SZR A;  1TWH A;  3EG9 A;  4CSA A;  4B6I A;  1ZU4 A;  2V26 A;  4DVY P;  3K7D A;  1NZE A;  3H65 A;  4CS8 A;  3T4R A;  5E33 A;  5E2Q A;  4W8K A;  3Q6M A;  2R7R A;  2KNH A;  2J9V A;  3AG3 C;  3ZIB A;  1FTS A;  1TR2 A;  2PX3 A;  4U5C E;  3ZC4 A;  4A2N B;  1LVK A;  2WVO A;  1FFT C;  4QDL A;  3B9Q A;  1ZHZ A;  4PJJ A;  4I1M A;  2V3C C;  1VYK A;  3EGX A;  4ANJ A;  3JCU Q;  2Q9C A;  1PD1 A;  3NYJ A;  4XLN F;  2CNW D;  4C3D A;  4AE4 B;  1D0Y A;  2QTV A;  1IZM A;  4C7O B;  1SMY F;  3KKB A;  2H7O A;  2J45 A;  3Q7G A;  1ZHT A;  2W9Y A;  3T6B A;  4C3E A;  4YT2 A;  3EGD A;  3EPV A;  3S28 A;  2G3V A;  2J46 A;  2NG1 A;  3LJB A;  1TWA A;  2G62 A;  2Q9A A;  2EIJ C;  3DM5 A;  3I5Q A;  2A1D D;  4Q4Z F;  2YZS A;  3JT1 A;  3B0U X;  4JJF A;  4U5D E;  4CIH A;  2WZL A;  3DM9 B;  3EHM A;  4CS9 C;  4MND A;  2EIM C;  1RJ9 B;  3T6J A;  4G0H A;  3W8I A;  2R7Q A;  3POV A;  1D0X A;  1MMA A;  1D0Z A;  4EWC A;  4XTK A;  3ZVR A;  1M2V B;  3DAF A;  1Z5Z A;  3AQC A;  3UGO A;  4MQ9 F;  4LAC B;  2W45 A;  4H4K C;  4C3B A;  1VOM A;  2J7P D;  1NG1 A;  3DJU B;  2EIK C;  3OWT A;  2KJG A;  2HV6 A;  3RYL A;  4K7B A;  2WZF A;  5D91 A;  3RH3 A;  2XRH A;  3WG7 C;  1J8Y F;  5IY5 C;  4BJT A;  3HLZ A;  1OCZ C;  4PK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...