3UGOA

Crystal structure of rna-polymerase sigma subunit domain 2 complexed with -10 promoter element ssdna oligo (tacaat)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
180
structure length
180
Chain Sequence
TSDPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTARIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords RNA polymerase sigma factor
publication title Structural basis for promoter-10 element recognition by the bacterial RNA polymerase sigma subunit.
pubmed doi rcsb
source organism Thermus aquaticus
total genus 72
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00140 Sigma70_r1_2 Sigma-70 factor, region 1.2
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1810 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ugoA00
1ZYRF 2A6HF 4MQ9F 4Q4ZF 4XLPF 2CW0F 3UGPA 4XLNF 3DXJF 2BE5F 3EQLF 1SMYF 1IW7F 4KI2A 4G7HF 2A6EF 4G7ZF 3WODF 2A69F 3LESA 4Q5SF 2A68F 4G7OF 3LEVA 4OIPF 4OIOF 4OIQF 4OINF 3UGOA 1KU2A 4OIRF
chains in the Genus database with same CATH superfamily
3DZAA 3NYMA 5CI9A 2VB6A 5A6BD 2A1DD 3MYIA 3RQGA 2XLWA 4E0IA 4XLPF 2YLDA 1WASA 1K04A 4GEHA 3B0UX 3A9CA 3KMIA 1ZHXA 3AG3C 2WZLA 3NKDA 4IAOA 4Z9IA 3ZG1A 4WGYA 2A6EF 3JCUQ 3I5PA 1OXBA 3DWWA 3SP1A 3GODA 4NCQA 3PDMP 4MTFA 4PR9A 4JZAA 3JZ0A 2M64A 4IARA 4QDLA 1LPEA 3U5SA 3Q7LA 4GYTA 1OW8A 2LSEA 2PBEA 3VF0A 2H8AA 2NG1A 1V74B 4JJGA 1ZZPA 2R05A 2NUPB 3ZQYA 1T9KA 2XL6A 4CS9C 2OEVA 1APCA 5L0DA 5KYNA 4C3EA 1Y6DA 3I5QA 3AG2C 1FAPB 2G3KA 1MMDA 1Q0MA 5EGYA 2IXMA 3HTKC 4JRZA 1I4YA 1PD1A 5K0IA 3UGPA 2XLHA 3RH3A 3IEEA 1SR2A 1Q0GA 4K1OA 1M57C 1ZHYA 4NTBA 3T6JA 2IOQA 3HJCA 4EIYA 3ZVRA 5KYYA 1YZCA 4J7TA 5DS6A 4E18A 1E86A 4DRIB 3DJUB 1G4WR 3EH1A 3SZRA 3NYJA 2VCAA 4PJNA 2Y39A 5B3IA 4CIHA 2R7UA 4DVZA 3KKBA 3HKKA 2W45A 2VC9A 3AGTA 2L81A 2ZD9A 3O39A 3C62A 3GWLA 3TD7A 4PJMA 1MMGA 4D4XA 5AGFA 3GM1A 1FR0A 2R7XA 2Q3TA 1A7DA 1LI7A 1S7ZA 3FOPA 3WG7C 2Z15A 5A6JA 3B29A 2R02A 1I5NA 3ASNC 1BR2A 3DAFA 1UG7A 3LS0A 2W4BA 4I44A 4XEVA 4YT5A 3QMKA 2NUTA 3U9MA 2MWQA 3ATPA 4YN0B 5COFA 4U9EA 3UMHA 2EPLX 4AE4A 3V7OA 1KTMA 2JPUA 1H9TA 5JSLA 2Q4FA 3GEEA 4ULVA 4WGZA 2L9JA 2GDCA 2PP4A 3DE9A 3HNJA 1E2XA 1LM3B 4G7ZF 1ZU5A 2A69F 2C04A 2Q9CA 3B71A 4J32B 1WATA 1FMVA 3AQBA 4KNVA 4MVRA 4L6RA 2GAQA 2NPUA 3RVZA 2YLIA 4CS8A 1MMAA 2AWCA 3S29A 1GQAA 1ZU4A 1Z5ZA 2HSBA 4BEMJ 4JEBA 3HLZA 3GANA 3ZSUA 3B0PA 1FFTC 4CDYA 1QVXA 1U6HA 3Q6NA 1CPRA 1V4AA 2RD9A 2QNLA 2W4MA 3NG1A 2OU6A 1RKEB 3JYYA 4IWBA 5DVWA 3SNHA 3EFOB 2XL4A 3GM3A 1OKKA 2XLEA 4IRUA 3GORA 3VM6A 1EA8A 3W8IA 2A6HF 3C8ZA 3MLGA 1NBBA 1TFKB 2I8BA 1C03A 2ZPAA 3X1OA 2CW0F 4DOZA 2F22A 3K7DA 3TK0A 3EG9B 4H4KC 1BR1A 1T6IA 4LERA 5DQTA 2P0NA 4JKVA 2VCBA 3KYIA 1Y4CA 4E7SA 3UNGC 5F5HA 2LFFA 1D1BA 3VRCA 3E9VA 2DB4A 1QZXA 2W9YA 4J30B 1MQVA 1J8MF 3RF3A 1T6QA 2J0WA 3AG1C 5COGA 4DBRA 3CAXA 4O6NA 5F28E 3PHF2 3L8IA 3DM9B 1AUEA 3LEVA 5CI8A 2UUHA 1JRAA 1RJ9A 4YL0A 2EIMC 1XZQA 2OEXA 2DYSC 4ANJA 2LK4A 3U9JA 4LDRA 3O10A 4WABA 1MNDA 3FOOA 3RVYA 4U5GA 1EKYA 4U5DE 3B9QA 4JC7A 4XLNF 4C7OB 1D0XA 1YZAA 1NFNA 4MS2A 2Y3BA 3K1IC 5FCLA 1PCXA 1ST6A 2G62A 2J9UA 1SMYF 2J9BA 2KNHA 1Q0KA 2NSGA 3LLKA 3OEOA 4W8PA 1VTMP 5IY5C 3CSKA 2OJQA 1O87A 3W2WA 5AC4A 5CIVA 1FFHA 4JTAB 3SXZA 2L6GA 1WTYA 1QSPA 3ASOC 4BJ6A 2H7OA 3FAPB 2R7QA 3EZIA 1YARO 4Z9HA 1VOMA 1TWGA 2CCYA 1OR3A 1BZ4A 2H7BA 2PFDA 2YZSA 3M15A 3F46A 4JTCB 4FAPB 4OIOF 2HJ3A 3HNLA 1E84A 1HMDA 5L0HA 3F47A 4CS8C 2D5RB 4AX2A 5BQHA 3SYNA 3S90A 1CGNA 2XLMA 5FZTA 2HV7A 2HS5A 2C03A 2KYHA 4DRHB 4CX9A 3C8GA 4KC9A 3T4RA 2XXAB 4N6CA 1YJGA 1GM5A 2X0CA 3POVA 3C63A 1OXKA 1QLEC 3AJMA 1IW7F 2V26A 2LIGA 4KI2A 1NSGB 3EPVA 1EQ1A 1OCOC 1KNYA 3LESA 2QUPA 3JYHA 1M2VB 5BUOA 1LE2A 2YRFA 5EK0A 2J45A 1FMWA 3N0TA 1R5ID 3AG4C 3PCVA 3OWTA 1LVKA 4YK5A 5JP7A 3W4YA 5JVEA 5L0JA 2YL3A 3DMDA 3M1CB 4RD9A 1A0BA 1D1AA 2FFHA 2P1AA 2RSEB 4X0RA 2R7VA 1TWAA 2QY9A 2KK1A 2XM4A 4EBKA 4XTKA 1D0ZA 1TWHA 1EI7A 4RDAA 5T3WA 4KBLA 4OD4A 3LNRA 3G4ZA 1Z63A 2KJGA 2NSFA 2X51A 3K6BA 3ZWIA 3DE8A 4CS7A 5D92A 3CEXA 2CYDA 4BJTA 5A6KA 4YT4A 4I3MA 1E83A 1YA7O 2PF4E 2PNOA 3J06A 4MVSA 3DJNB 1H6GA 1IZMA 1MMNA 2ICWG 4U5CE 3SEOA 3TOMA 1ZVZA 4CDVA 2VH3A 4AL1A 2WVOA 2YL0A 3G50A 5B1AC 5KYXA 3IQ5A 2GWWA 4JTDB 3TULA 2L7AA 3M4BA 3HNIA 4XPWA 5DS5A 5DS4A 4JVSA 3A11A 5JRAA 2P61A 2LP4A 2BL2A 4BJ6C 2KGOA 3QTHA 3CZ6A 4OINF 1NU9C 2H7VC 3K33A 3CQZA 3TJ5A 1G8XA 5T1DB 5KYUB 4FWVA 1ZYRF 1AEPA 5KYYB 4O79A 3LUTB 2IYLD 5TJ5E 2IXNA 3EJNA 4MVQA 3LEOA 4XWJA 4R32A 1M56C 4NQFA 4P9FA 4BG0A 4CJGA 4QI0A 4F4BA 4MVOA 3MBGA 1B68A 2AWYA 2OG2A 4XPYA 2A68F 1OQCA 4HE8D 3FAJA 1A7VA 1V54C 4Q7CA 3FVYA 1YVIA 2XS1A 1JPJA 1VB5A 2J7PA 1NLXA 3RYLA 2XSEA 1Z3IX 2CNWA 5JT4A 3EGDA 4JURI 3V5ZA 2NUTB 2R7WA 3C7JA 1RCPA 5A69A 1TKNA 4BJ5A 4AE4B 5L0GA 3SXKA 4ZLDA 2P6VA 1VLTA 2YHSA 2IXOA 4XEKA 4ONSA 2JD3A 1UFBA 3L0IA 1NFOA 2KQ9A 2EPOA 3DXJF 3NRHA 4LLCA 3EGXA 3EQLF 1DOVA 3NYLA 3FDQA 1R4TA 2CGEA 3O6XA 2Y3HA 3NDBB 2YLGA 3G4XA 3KH2A 4JE9A 3WODF 5KYWB 1OW6A 2DI3A 4G78A 1HE1A 1L3PA 2FGYA 2R7OA 3U3BA 4DXWA 4H54A 4BPMA 2HSQA 4YL1A 4DBQA 3LLIA 1OCRC 3GM2A 1NZEA 1YYXA 4ULWA 2AVKA 3ZTZA 4G7OF 1K05A 4MW8A 1Q0FA 5DLJA 3RW0A 4CBEA 3ABKC 1GS9A 3JRTA 2J8WA 4FX5A 4OIPF 1SZIA 1ZHZA 2OKUA 3JSZA 3V5XA 1OKKD 1JR8A 2YL7A 1ORYA 2YWAA 1JAFA 1VYIA 4NY3A 2ASRA 2HJMA 1YYJA 4U9DA 1XWJA 1TR2A 4U5EE 2HV6A 2KSFA 1D0YA 2OOCA 3ABLC 2XRHA 4G7HF 2Q00A 2OJED 3O55A 1WOLA 2YEVA 2O9XA 3US6A 2A0BA 2ZXRA 4IJJA 4P9TA 1RJ9B 1Z7Qc 4CS9A 2WVNA 3QW1A 4XEFA 4PFOA 3C18A 3RKOF 5L3VA 1A41A 3MYFA 4PFPA 5A6BA 3JT1A 3V5YA 3FMSA 3NMKA 3ZC4A 1HW1A 2IM8A 3L1MA 1W2WA 4MVMA 1TFOB 3ABMC 4EBJA 3JRMO 1PD0A 3K66A 3Q6MA 2HUJA 2YQYA 4EKWA 4LLEA 1ZHTA 2GA0A 3ECSA 4CJOA 3H2VA 2CDQA 4BEJA 2XM0A 3KL4A 2Q9AA 1FTSA 2KW3C 2P7VA 1NG1A 1ORJA 2R9RB 4BJ5C 2MYSA 2WVQA 2GFHA 3HNKA 5L0IA 1SYQA 2G3VA 1WGWA 2WL8A 3K1HA 1HE9A 1JMWA 2J9WA 2QE9A 1S05A 4GQHA 5D91A 3QZCA 3TJ6A 4N4WA 1HY5A 4EHPA 3T6GB 3AQCA 1BBHA 5HV9A 4MTOA 1HW2A 2J9VA 2Y3GA 4CDAA 2FAPB 4O6MA 2V3CC 5E3AA 3LAYA 4JJFA 5JUAA 3KYJA 3TQOA 2R7SA 2DYRC 3DKAA 3ITFA 1ZW2A 2PX0A 3DD7A 4ZLCA 5BQIA 4JIOA 1XZPA 1AVOB 3C8GD 2ZXPA 1DOWA 1YA9A 1BR4A 1G4US 1NU7D 2NUPA 2OCCC 1OW7A 1N1CA 4PACA 3ZQVA 1J8YF 4AK9A 4YT2A 2XLOA 1Z23A 5L0CA 2TMVP 1T6UA 2Y69C 2UUIA 3EHNA 1C02A 1C17M 4KNWA 3NMJA 3R2PA 1K40A 4PJLA 1D1CA 3RFYA 4NTAA 1VK5A 2VASA 2ZXWC 4YL3A 3S84A 3GWNA 4I1OB 4O7GA 4UDVA 3UMKA 4FESA 4OIQF 3S9OA 4MVZA 1MNEA 5BQGA 3X2QC 1ZHWA 4ER9A 2EPMX 4EBBA 3H2UA 3BRJA 5T3TA 3E70C 2EILC 2LFDA 5E3CA 3IQCA 3I4UA 3LS1A 4MQ9F 4Q4ZF 4OD5A 4I1MA 4HEAJ 4MNDA 3FHDA 4IAQA 2JX0A 2YKZA 4EWCA 1YAUO 4YWQA 2R7TA 4C3DA 3KPHA 5KYUA 3IQ6A 5KYXB 3QVZA 3U0CA 1LS1A 1RKCA 1U0BB 1T5OA 2BC5A 2WZFA 5COMA 3U2MA 2E87A 1VLSA 4PJJA 3RQEA 2YVKA 3EZHA 4CSAA 2ZXOA 1LIHA 3EHMA 5JS5A 4IGGA 1A7EA 1O3UA 2R7RA 1CGOA 2XS8A 1CPQA 1VMAA 2AU5A 2B0JA 2HFIA 1LKXA 1PV3A 2M4EA 3K1IA 4P6IC 3T6BA 1BDJB 2HMZA 2R03A 3VAYA 5L0FA 4OIRF 5KYWA 3S28A 5E2QA 2DGJA 1F1MA 1JOGA 3M79A 2HMQA 4E17A 2B0HA 2HZ8A 1TQGA 1RKEA 3N24A 2Q9BA 3EFOA 1I4ZA 2BE5F 3R7CA 3TOLA 4NC3A 2J0XA 3MFNA 5AC5A 3QVYA 4M63A 2D4UA 4JW1A 4CIPA 2ETSA 4QI2A 2KC3A 1ZW3A 3EH2A 2EINC 3QW0A 2WB7A 2HKVA 3EGDB 3EG9A 3U8PA 4A2NB 5A6AA 2VCCA 1V55C 5B1BC 4JEAA 2QLAA 4JCHA 2J7PD 4NTFA 3WAQA 3AOUA 3DI5A 2CNWD 4LDKA 3IHUA 5F5FA 1H9GA 1QKRA 2R25A 3L8JA 4E7ZA 2L6FA 4XPXA 2YL1A 4O6YA 1JPNA 3GEIA 1WN0A 3EGXB 4E0HA 3VYWA 3DAGA 1E85A 2QTVA 5GPGB 3LNMB 4K7BA 2IBFA 4G0HA 3T9OA 4EUKB 1ORSC 4RBNA 2I15A 2AP3A 4HFFB 4D4NA 2EPNA 2XLVA 3NKEA 3S27A 4B6IA 3M4CA 4J7YA 4N06A 3ZTMA 4A4AA 2WZGA 5DQZA 3FXHA 3B0VC 1Z6AA 4C7OA 3U2LA 2J46A 1LS4A 2EPKX 4Q5SF 3N2ZB 3WHNA 1VYKA 3L34A 4XQ1A 3RQFA 4YT8A 5JLIA 1M2OA 3RIPA 3LJBA 4PK4A 4U5FE 3S0XA 1OR2A 3GEHA 3PMRA 4K0DA 1FNTc 4W8KA 3BEHA 1WWPA 3SXYA 1LE4A 4MW3A 2LCHA 1QPUA 2XLDA 4CSAC 4LACB 4LDQA 2MHRA 2EIJC 4BJ1A 1OCCC 3UMIA 4YJWA 1T01A 4WJ0A 256BA 2LQGA 1YDIA 4C3BA 5B3SC 4MVUA 3ZIBA 2EIKC 1L7CA 1YLMA 2PX3A 3JSEO 3Q7GA 3W2VA 3IPMO 1RXQA 2LD6A 4DJ9A 3SXMA 2XXAA 4IB4A 3W8HA 1QQ3A 2L6HA 3H65A 5HSWA 1TWCA 2IXPA 3AGUA 4DRJB 5EHHA 1H7IA 1LI5A 1M6TA 1OCZC 3DM5A 4MTGA 4U5HA 1SF8A 1G5ZA 2OQMA 4N6HA 3OA1A 4Z9JA 4JCZA 1Q0DA 3U8VA 1CGME 1GGQA 1M2VA 3U3FA 1O5HA 2A0UA 5E33A 1RMVA 3MX3A 4DVYP 1HMOA 4AL0A 3C8GB 1U89A 3IQTA 2Q7RA 4U5BE 1KU2A 3ZDLA 3UR3C 3NMIA 3UGOA 2Y3DA 4HFKB 3JTLO 5L3QA 2XL8A
chains in the Genus database with same CATH topology
3DZAA 3NYMA 5CI9A 2VB6A 2A1DD 4XLPF 4GEHA 3B0UX 3KMIA 1ZHXA 3AG3C 2WZLA 3NKDA 4IAOA 3ZG1A 2A6EF 3JCUQ 3I5PA 3SP1A 3GODA 4JZAA 4QDLA 3Q7LA 4GYTA 2LSEA 2NG1A 4JJGA 2NUPB 4CS9C 5KYNA 4C3EA 3I5QA 3AG2C 2G3KA 1MMDA 5EGYA 2IXMA 3HTKC 1PD1A 3UGPA 3RH3A 3IEEA 1M57C 1ZHYA 3T6JA 2IOQA 3HJCA 3ZVRA 5KYYA 5DS6A 3DJUB 3EH1A 3SZRA 3NYJA 4PJNA 2Y39A 4CIHA 2R7UA 4DVZA 3KKBA 2W45A 2L81A 3O39A 3TD7A 4PJMA 1MMGA 2R7XA 2Q3TA 1S7ZA 3WG7C 2Z15A 3DAFA 3ASNC 3LS0A 1BR2A 4I44A 4YT5A 2W4BA 3QMKA 2NUTA 2MWQA 4YN0B 3UMHA 4AE4A 3V7OA 2L9JA 2PP4A 4G7ZF 1ZU5A 2A69F 2C04A 2Q9CA 4J32B 1FMVA 3AQBA 4KNVA 4CS8A 1MMAA 3S29A 5KYWB 1ZU4A 1Z5ZA 3HLZA 3GANA 3ZSUA 3B0PA 1FFTC 3Q6NA 2W4MA 4IWBA 3SNHA 3NG1A 5DVWA 3EFOB 2XL4A 1OKKA 4IRUA 3W8IA 2A6HF 3X1OA 3MLGA 4DOZA 2I8BA 2ZPAA 2CW0F 3K7DA 3EG9B 4H4KC 1BR1A 4LERA 5DQTA 4E7SA 3UNGC 5F5HA 1D1BA 3E9VA 1QZXA 2W9YA 4J30B 1J8MF 2J0WA 3AG1C 4DBRA 4O6NA 3PHF2 3DM9B 3LEVA 5CI8A 1RJ9A 2EIMC 4ANJA 2DYSC 1MNDA 4U5GA 4U5DE 3B9QA 4XLNF 4C7OB 1D0XA 5FCLA 2Y3BA 3K1IC 1PCXA 1ST6A 2G62A 2J9UA 1SMYF 2KNHA 3OEOA 3LLKA 5IY5C 3CSKA 1O87A 3W2WA 1FFHA 3ASOC 4BJ6A 2H7OA 2R7QA 3EZIA 1VOMA 1TWGA 2H7BA 2YZSA 2PFDA 3F46A 4OIOF 3F47A 4CS8C 2D5RB 4AX2A 3SYNA 2HV7A 2C03A 2XXAB 4KC9A 3T4RA 3POVA 1QLEC 1IW7F 2V26A 4KI2A 3EPVA 1OCOC 3LESA 3JYHA 1M2VB 5BUOA 2J45A 1FMWA 3N0TA 3AG4C 3OWTA 1LVKA 3DMDA 3M1CB 4RD9A 1D1AA 2FFHA 2R7VA 4X0RA 1TWAA 2QY9A 4XTKA 1D0ZA 1TWHA 4RDAA 5T3WA 4KBLA 4OD4A 3LNRA 1Z63A 2KJGA 3K6BA 2X51A 4CS7A 5D92A 4BJTA 4YT4A 4I3MA 2PF4E 3DJNB 4U5CE 1IZMA 1MMNA 3SEOA 3S0XA 2VH3A 2WVOA 5B1AC 5KYXA 5DS5A 5DS4A 4JVSA 4BJ6C 2KGOA 3CZ6A 4OINF 1NU9C 2H7VC 3K33A 3CQZA 1G8XA 5T1DB 5KYUB 4FWVA 1ZYRF 5KYYB 4O79A 2IYLD 2IXNA 3EJNA 4XWJA 1M56C 4BG0A 4QI0A 4F4BA 2OG2A 2A68F 4HE8D 3FAJA 1V54C 4Q7CA 3FVYA 1JPJA 2J7PA 3RYLA 2XSEA 1Z3IX 2CNWA 3EGDA 4JURI 2NUTB 2R7WA 1TKNA 4BJ5A 4AE4B 4ZLDA 2P6VA 2YHSA 2IXOA 2JD3A 3L0IA 2KQ9A 3DXJF 3NRHA 4LLCA 3EGXA 3EQLF 3NYLA 3FDQA 2CGEA 3O6XA 2Y3HA 3NDBB 3KH2A 3WODF 2FGYA 2R7OA 4DBQA 3LLIA 1OCRC 1NZEA 4ULWA 4G7OF 5DLJA 4CBEA 4OIPF 3ABKC 3JRTA 4FX5A 2R7TA 1SZIA 1ZHZA 3JSZA 1OKKD 4NY3A 1VYIA 1TR2A 4U5EE 2HV6A 1D0YA 3ABLC 2XRHA 4G7HF 2YEVA 2O9XA 4CS9A 2ZXRA 4IJJA 1RJ9B 2WVNA 4PFOA 3RKOF 5L3VA 4PFPA 3JT1A 3ZC4A 1W2WA 3ABMC 1PD0A 3K66A 3Q6MA 4LLEA 1ZHTA 3ECSA 2CDQA 4BEJA 3KL4A 2Q9AA 1FTSA 2KW3C 2P7VA 1NG1A 4BJ5C 2MYSA 2WVQA 2GFHA 2G3VA 1WGWA 2WL8A 3K1HA 2J9WA 5D91A 3QZCA 3AQCA 2J9VA 2Y3GA 4O6MA 2V3CC 5E3AA 3LAYA 4JJFA 2R7SA 2DYRC 3ITFA 2PX0A 3DD7A 4ZLCA 2ZXPA 2NUPA 1BR4A 1NU7D 2OCCC 4AK9A 1N1CA 1J8YF 4YT2A 1Z23A 2Y69C 3EHNA 4KNWA 4PJLA 1D1CA 3RFYA 1VK5A 2VASA 2ZXWC 4I1OB 4O7GA 3UMKA 4FESA 4OIQF 1MNEA 3X2QC 1ZHWA 4EBBA 5T3TA 3E70C 2EILC 5E3CA 3I4UA 3LS1A 4MQ9F 4Q4ZF 4OD5A 4I1MA 4HEAJ 4MNDA 3FHDA 4EWCA 4YWQA 4C3DA 5KYUA 5KYXB 1LS1A 2WZFA 2E87A 4PJJA 3EZHA 4CSAA 2ZXOA 3EHMA 2R7RA 1VMAA 2B0JA 2M4EA 1LKXA 3T6BA 4P6IC 5KYWA 3VAYA 4OIRF 3S28A 5E2QA 2DGJA 3N24A 2Q9BA 3EFOA 2BE5F 2J0XA 4M63A 4JW1A 4QI2A 3EH2A 4A2NB 2EINC 2WB7A 3EGDB 3EG9A 5B1BC 1V55C 4JCHA 2J7PD 5F5FA 2CNWD 4E7ZA 4O6YA 1JPNA 3EGXB 3VYWA 3DAGA 2QTVA 4K7BA 4G0HA 4RBNA 4HFFB 3NKEA 3S27A 4B6IA 4N06A 2WZGA 5DQZA 4C7OA 3B0VC 1Z6AA 2J46A 4Q5SF 3N2ZB 1VYKA 3L34A 4YT8A 1M2OA 3RIPA 3LJBA 4PK4A 4U5FE 4K0DA 3PMRA 4W8KA 4CSAC 4LACB 2EIJC 4BJ1A 1OCCC 3UMIA 4YJWA 4WJ0A 4C3BA 5B3SC 3ZIBA 2EIKC 2PX3A 3Q7GA 3W2VA 2XXAA 3W8HA 3H65A 5HSWA 1TWCA 2IXPA 5EHHA 1OCZC 3DM5A 4U5HA 1SF8A 3OA1A 1M2VA 1O5HA 5E33A 3MX3A 4DVYP 3UGOA 4U5BE 1KU2A 3UR3C 2Y3DA 4HFKB 5L3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZYR F;  2A6H F;  4MQ9 F;  4Q4Z F;  4XLP F;  2CW0 F;  3UGP A;  4XLN F;  3DXJ F;  2BE5 F;  3EQL F;  1SMY F;  1IW7 F;  4KI2 A;  4G7H F;  2A6E F;  4G7Z F;  3WOD F;  2A69 F;  3LES A;  4Q5S F;  2A68 F;  4G7O F;  3LEV A;  4OIP F;  4OIO F;  4OIQ F;  4OIN F;  3UGO A;  1KU2 A;  4OIR F; 
#chains in the Genus database with same CATH topology
 3DZA A;  3NYM A;  5CI9 A;  2VB6 A;  5A6B D;  2A1D D;  3MYI A;  3RQG A;  2XLW A;  4E0I A;  4XLP F;  2YLD A;  1WAS A;  1K04 A;  4GEH A;  3B0U X;  3A9C A;  3KMI A;  1ZHX A;  3AG3 C;  2WZL A;  3NKD A;  4IAO A;  4Z9I A;  3ZG1 A;  4WGY A;  2A6E F;  3JCU Q;  3I5P A;  1OXB A;  3DWW A;  3SP1 A;  3GOD A;  4NCQ A;  3PDM P;  4MTF A;  4PR9 A;  4JZA A;  3JZ0 A;  2M64 A;  4IAR A;  4QDL A;  1LPE A;  3U5S A;  3Q7L A;  4GYT A;  1OW8 A;  2LSE A;  2PBE A;  3VF0 A;  2H8A A;  2NG1 A;  1V74 B;  4JJG A;  1ZZP A;  2R05 A;  2NUP B;  3ZQY A;  1T9K A;  2XL6 A;  4CS9 C;  2OEV A;  1APC A;  5L0D A;  5KYN A;  4C3E A;  1Y6D A;  3I5Q A;  3AG2 C;  1FAP B;  2G3K A;  1MMD A;  1Q0M A;  5EGY A;  2IXM A;  3HTK C;  4JRZ A;  1I4Y A;  1PD1 A;  5K0I A;  3UGP A;  2XLH A;  3RH3 A;  3IEE A;  1SR2 A;  1Q0G A;  4K1O A;  1M57 C;  1ZHY A;  4NTB A;  3T6J A;  2IOQ A;  3HJC A;  4EIY A;  3ZVR A;  5KYY A;  1YZC A;  4J7T A;  5DS6 A;  4E18 A;  1E86 A;  4DRI B;  3DJU B;  1G4W R;  3EH1 A;  3SZR A;  3NYJ A;  2VCA A;  4PJN A;  2Y39 A;  5B3I A;  4CIH A;  2R7U A;  4DVZ A;  3KKB A;  3HKK A;  2W45 A;  2VC9 A;  3AGT A;  2L81 A;  2ZD9 A;  3O39 A;  3C62 A;  3GWL A;  3TD7 A;  4PJM A;  1MMG A;  4D4X A;  5AGF A;  3GM1 A;  1FR0 A;  2R7X A;  2Q3T A;  1A7D A;  1LI7 A;  1S7Z A;  3FOP A;  3WG7 C;  2Z15 A;  5A6J A;  3B29 A;  2R02 A;  1I5N A;  3ASN C;  1BR2 A;  3DAF A;  1UG7 A;  3LS0 A;  2W4B A;  4I44 A;  4XEV A;  4YT5 A;  3QMK A;  2NUT A;  3U9M A;  2MWQ A;  3ATP A;  4YN0 B;  5COF A;  4U9E A;  3UMH A;  2EPL X;  4AE4 A;  3V7O A;  1KTM A;  2JPU A;  1H9T A;  5JSL A;  2Q4F A;  3GEE A;  4ULV A;  4WGZ A;  2L9J A;  2GDC A;  2PP4 A;  3DE9 A;  3HNJ A;  1E2X A;  1LM3 B;  4G7Z F;  1ZU5 A;  2A69 F;  2C04 A;  2Q9C A;  3B71 A;  4J32 B;  1WAT A;  1FMV A;  3AQB A;  4KNV A;  4MVR A;  4L6R A;  2GAQ A;  2NPU A;  3RVZ A;  2YLI A;  4CS8 A;  1MMA A;  2AWC A;  3S29 A;  1GQA A;  1ZU4 A;  1Z5Z A;  2HSB A;  4BEM J;  4JEB A;  3HLZ A;  3GAN A;  3ZSU A;  3B0P A;  1FFT C;  4CDY A;  1QVX A;  1U6H A;  3Q6N A;  1CPR A;  1V4A A;  2RD9 A;  2QNL A;  2W4M A;  3NG1 A;  2OU6 A;  1RKE B;  3JYY A;  4IWB A;  5DVW A;  3SNH A;  3EFO B;  2XL4 A;  3GM3 A;  1OKK A;  2XLE A;  4IRU A;  3GOR A;  3VM6 A;  1EA8 A;  3W8I A;  2A6H F;  3C8Z A;  3MLG A;  1NBB A;  1TFK B;  2I8B A;  1C03 A;  2ZPA A;  3X1O A;  2CW0 F;  4DOZ A;  2F22 A;  3K7D A;  3TK0 A;  3EG9 B;  4H4K C;  1BR1 A;  1T6I A;  4LER A;  5DQT A;  2P0N A;  4JKV A;  2VCB A;  3KYI A;  1Y4C A;  4E7S A;  3UNG C;  5F5H A;  2LFF A;  1D1B A;  3VRC A;  3E9V A;  2DB4 A;  1QZX A;  2W9Y A;  4J30 B;  1MQV A;  1J8M F;  3RF3 A;  1T6Q A;  2J0W A;  3AG1 C;  5COG A;  4DBR A;  3CAX A;  4O6N A;  5F28 E;  3PHF 2;  3L8I A;  3DM9 B;  1AUE A;  3LEV A;  5CI8 A;  2UUH A;  1JRA A;  1RJ9 A;  4YL0 A;  2EIM C;  1XZQ A;  2OEX A;  2DYS C;  4ANJ A;  2LK4 A;  3U9J A;  4LDR A;  3O10 A;  4WAB A;  1MND A;  3FOO A;  3RVY A;  4U5G A;  1EKY A;  4U5D E;  3B9Q A;  4JC7 A;  4XLN F;  4C7O B;  1D0X A;  1YZA A;  1NFN A;  4MS2 A;  2Y3B A;  3K1I C;  5FCL A;  1PCX A;  1ST6 A;  2G62 A;  2J9U A;  1SMY F;  2J9B A;  2KNH A;  1Q0K A;  2NSG A;  3LLK A;  3OEO A;  4W8P A;  1VTM P;  5IY5 C;  3CSK A;  2OJQ A;  1O87 A;  3W2W A;  5AC4 A;  5CIV A;  1FFH A;  4JTA B;  3SXZ A;  2L6G A;  1WTY A;  1QSP A;  3ASO C;  4BJ6 A;  2H7O A;  3FAP B;  2R7Q A;  3EZI A;  1YAR O;  4Z9H A;  1VOM A;  1TWG A;  2CCY A;  1OR3 A;  1BZ4 A;  2H7B A;  2PFD A;  2YZS A;  3M15 A;  3F46 A;  4JTC B;  4FAP B;  4OIO F;  2HJ3 A;  3HNL A;  1E84 A;  1HMD A;  5L0H A;  3F47 A;  4CS8 C;  2D5R B;  4AX2 A;  5BQH A;  3SYN A;  3S90 A;  1CGN A;  2XLM A;  5FZT A;  2HV7 A;  2HS5 A;  2C03 A;  2KYH A;  4DRH B;  4CX9 A;  3C8G A;  4KC9 A;  3T4R A;  2XXA B;  4N6C A;  1YJG A;  1GM5 A;  2X0C A;  3POV A;  3C63 A;  1OXK A;  1QLE C;  3AJM A;  1IW7 F;  2V26 A;  2LIG A;  4KI2 A;  1NSG B;  3EPV A;  1EQ1 A;  1OCO C;  1KNY A;  3LES A;  2QUP A;  3JYH A;  1M2V B;  5BUO A;  1LE2 A;  2YRF A;  5EK0 A;  2J45 A;  1FMW A;  3N0T A;  1R5I D;  3AG4 C;  3PCV A;  3OWT A;  1LVK A;  4YK5 A;  5JP7 A;  3W4Y A;  5JVE A;  5L0J A;  2YL3 A;  3DMD A;  3M1C B;  4RD9 A;  1A0B A;  1D1A A;  2FFH A;  2P1A A;  2RSE B;  4X0R A;  2R7V A;  1TWA A;  2QY9 A;  2KK1 A;  2XM4 A;  4EBK A;  4XTK A;  1D0Z A;  1TWH A;  1EI7 A;  4RDA A;  5T3W A;  4KBL A;  4OD4 A;  3LNR A;  3G4Z A;  1Z63 A;  2KJG A;  2NSF A;  2X51 A;  3K6B A;  3ZWI A;  3DE8 A;  4CS7 A;  5D92 A;  3CEX A;  2CYD A;  4BJT A;  5A6K A;  4YT4 A;  4I3M A;  1E83 A;  1YA7 O;  2PF4 E;  2PNO A;  3J06 A;  4MVS A;  3DJN B;  1H6G A;  1IZM A;  1MMN A;  2ICW G;  4U5C E;  3SEO A;  3TOM A;  1ZVZ A;  4CDV A;  2VH3 A;  4AL1 A;  2WVO A;  2YL0 A;  3G50 A;  5B1A C;  5KYX A;  3IQ5 A;  2GWW A;  4JTD B;  3TUL A;  2L7A A;  3M4B A;  3HNI A;  4XPW A;  5DS5 A;  5DS4 A;  4JVS A;  3A11 A;  5JRA A;  2P61 A;  2LP4 A;  2BL2 A;  4BJ6 C;  2KGO A;  3QTH A;  3CZ6 A;  4OIN F;  1NU9 C;  2H7V C;  3K33 A;  3CQZ A;  3TJ5 A;  1G8X A;  5T1D B;  5KYU B;  4FWV A;  1ZYR F;  1AEP A;  5KYY B;  4O79 A;  3LUT B;  2IYL D;  5TJ5 E;  2IXN A;  3EJN A;  4MVQ A;  3LEO A;  4XWJ A;  4R32 A;  1M56 C;  4NQF A;  4P9F A;  4BG0 A;  4CJG A;  4QI0 A;  4F4B A;  4MVO A;  3MBG A;  1B68 A;  2AWY A;  2OG2 A;  4XPY A;  2A68 F;  1OQC A;  4HE8 D;  3FAJ A;  1A7V A;  1V54 C;  4Q7C A;  3FVY A;  1YVI A;  2XS1 A;  1JPJ A;  1VB5 A;  2J7P A;  1NLX A;  3RYL A;  2XSE A;  1Z3I X;  2CNW A;  5JT4 A;  3EGD A;  4JUR I;  3V5Z A;  2NUT B;  2R7W A;  3C7J A;  1RCP A;  5A69 A;  1TKN A;  4BJ5 A;  4AE4 B;  5L0G A;  3SXK A;  4ZLD A;  2P6V A;  1VLT A;  2YHS A;  2IXO A;  4XEK A;  4ONS A;  2JD3 A;  1UFB A;  3L0I A;  1NFO A;  2KQ9 A;  2EPO A;  3DXJ F;  3NRH A;  4LLC A;  3EGX A;  3EQL F;  1DOV A;  3NYL A;  3FDQ A;  1R4T A;  2CGE A;  3O6X A;  2Y3H A;  3NDB B;  2YLG A;  3G4X A;  3KH2 A;  4JE9 A;  3WOD F;  5KYW B;  1OW6 A;  2DI3 A;  4G78 A;  1HE1 A;  1L3P A;  2FGY A;  2R7O A;  3U3B A;  4DXW A;  4H54 A;  4BPM A;  2HSQ A;  4YL1 A;  4DBQ A;  3LLI A;  1OCR C;  3GM2 A;  1NZE A;  1YYX A;  4ULW A;  2AVK A;  3ZTZ A;  4G7O F;  1K05 A;  4MW8 A;  1Q0F A;  5DLJ A;  3RW0 A;  4CBE A;  3ABK C;  1GS9 A;  3JRT A;  2J8W A;  4FX5 A;  4OIP F;  1SZI A;  1ZHZ A;  2OKU A;  3JSZ A;  3V5X A;  1OKK D;  1JR8 A;  2YL7 A;  1ORY A;  2YWA A;  1JAF A;  1VYI A;  4NY3 A;  2ASR A;  2HJM A;  1YYJ A;  4U9D A;  1XWJ A;  1TR2 A;  4U5E E;  2HV6 A;  2KSF A;  1D0Y A;  2OOC A;  3ABL C;  2XRH A;  4G7H F;  2Q00 A;  2OJE D;  3O55 A;  1WOL A;  2YEV A;  2O9X A;  3US6 A;  2A0B A;  2ZXR A;  4IJJ A;  4P9T A;  1RJ9 B;  1Z7Q c;  4CS9 A;  2WVN A;  3QW1 A;  4XEF A;  4PFO A;  3C18 A;  3RKO F;  5L3V A;  1A41 A;  3MYF A;  4PFP A;  5A6B A;  3JT1 A;  3V5Y A;  3FMS A;  3NMK A;  3ZC4 A;  1HW1 A;  2IM8 A;  3L1M A;  1W2W A;  4MVM A;  1TFO B;  3ABM C;  4EBJ A;  3JRM O;  1PD0 A;  3K66 A;  3Q6M A;  2HUJ A;  2YQY A;  4EKW A;  4LLE A;  1ZHT A;  2GA0 A;  3ECS A;  4CJO A;  3H2V A;  2CDQ A;  4BEJ A;  2XM0 A;  3KL4 A;  2Q9A A;  1FTS A;  2KW3 C;  2P7V A;  1NG1 A;  1ORJ A;  2R9R B;  4BJ5 C;  2MYS A;  2WVQ A;  2GFH A;  3HNK A;  5L0I A;  1SYQ A;  2G3V A;  1WGW A;  2WL8 A;  3K1H A;  1HE9 A;  1JMW A;  2J9W A;  2QE9 A;  1S05 A;  4GQH A;  5D91 A;  3QZC A;  3TJ6 A;  4N4W A;  1HY5 A;  4EHP A;  3T6G B;  3AQC A;  1BBH A;  5HV9 A;  4MTO A;  1HW2 A;  2J9V A;  2Y3G A;  4CDA A;  2FAP B;  4O6M A;  2V3C C;  5E3A A;  3LAY A;  4JJF A;  5JUA A;  3KYJ A;  3TQO A;  2R7S A;  2DYR C;  3DKA A;  3ITF A;  1ZW2 A;  2PX0 A;  3DD7 A;  4ZLC A;  5BQI A;  4JIO A;  1XZP A;  1AVO B;  3C8G D;  2ZXP A;  1DOW A;  1YA9 A;  1BR4 A;  1G4U S;  1NU7 D;  2NUP A;  2OCC C;  1OW7 A;  1N1C A;  4PAC A;  3ZQV A;  1J8Y F;  4AK9 A;  4YT2 A;  2XLO A;  1Z23 A;  5L0C A;  2TMV P;  1T6U A;  2Y69 C;  2UUI A;  3EHN A;  1C02 A;  1C17 M;  4KNW A;  3NMJ A;  3R2P A;  1K40 A;  4PJL A;  1D1C A;  3RFY A;  4NTA A;  1VK5 A;  2VAS A;  2ZXW C;  4YL3 A;  3S84 A;  3GWN A;  4I1O B;  4O7G A;  4UDV A;  3UMK A;  4FES A;  4OIQ F;  3S9O A;  4MVZ A;  1MNE A;  5BQG A;  3X2Q C;  1ZHW A;  4ER9 A;  2EPM X;  4EBB A;  3H2U A;  3BRJ A;  5T3T A;  3E70 C;  2EIL C;  2LFD A;  5E3C A;  3IQC A;  3I4U A;  3LS1 A;  4MQ9 F;  4Q4Z F;  4OD5 A;  4I1M A;  4HEA J;  4MND A;  3FHD A;  4IAQ A;  2JX0 A;  2YKZ A;  4EWC A;  1YAU O;  4YWQ A;  2R7T A;  4C3D A;  3KPH A;  5KYU A;  3IQ6 A;  5KYX B;  3QVZ A;  3U0C A;  1LS1 A;  1RKC A;  1U0B B;  1T5O A;  2BC5 A;  2WZF A;  5COM A;  3U2M A;  2E87 A;  1VLS A;  4PJJ A;  3RQE A;  2YVK A;  3EZH A;  4CSA A;  2ZXO A;  1LIH A;  3EHM A;  5JS5 A;  4IGG A;  1A7E A;  1O3U A;  2R7R A;  1CGO A;  2XS8 A;  1CPQ A;  1VMA A;  2AU5 A;  2B0J A;  2HFI A;  1LKX A;  1PV3 A;  2M4E A;  3K1I A;  4P6I C;  3T6B A;  1BDJ B;  2HMZ A;  2R03 A;  3VAY A;  5L0F A;  4OIR F;  5KYW A;  3S28 A;  5E2Q A;  2DGJ A;  1F1M A;  1JOG A;  3M79 A;  2HMQ A;  4E17 A;  2B0H A;  2HZ8 A;  1TQG A;  1RKE A;  3N24 A;  2Q9B A;  3EFO A;  1I4Z A;  2BE5 F;  3R7C A;  3TOL A;  4NC3 A;  2J0X A;  3MFN A;  5AC5 A;  3QVY A;  4M63 A;  2D4U A;  4JW1 A;  4CIP A;  2ETS A;  4QI2 A;  2KC3 A;  1ZW3 A;  3EH2 A;  2EIN C;  3QW0 A;  2WB7 A;  2HKV A;  3EGD B;  3EG9 A;  3U8P A;  4A2N B;  5A6A A;  2VCC A;  1V55 C;  5B1B C;  4JEA A;  2QLA A;  4JCH A;  2J7P D;  4NTF A;  3WAQ A;  3AOU A;  3DI5 A;  2CNW D;  4LDK A;  3IHU A;  5F5F A;  1H9G A;  1QKR A;  2R25 A;  3L8J A;  4E7Z A;  2L6F A;  4XPX A;  2YL1 A;  4O6Y A;  1JPN A;  3GEI A;  1WN0 A;  3EGX B;  4E0H A;  3VYW A;  3DAG A;  1E85 A;  2QTV A;  5GPG B;  3LNM B;  4K7B A;  2IBF A;  4G0H A;  3T9O A;  4EUK B;  1ORS C;  4RBN A;  2I15 A;  2AP3 A;  4HFF B;  4D4N A;  2EPN A;  2XLV A;  3NKE A;  3S27 A;  4B6I A;  3M4C A;  4J7Y A;  4N06 A;  3ZTM A;  4A4A A;  2WZG A;  5DQZ A;  3FXH A;  3B0V C;  1Z6A A;  4C7O A;  3U2L A;  2J46 A;  1LS4 A;  2EPK X;  4Q5S F;  3N2Z B;  3WHN A;  1VYK A;  3L34 A;  4XQ1 A;  3RQF A;  4YT8 A;  5JLI A;  1M2O A;  3RIP A;  3LJB A;  4PK4 A;  4U5F E;  3S0X A;  1OR2 A;  3GEH A;  3PMR A;  4K0D A;  1FNT c;  4W8K A;  3BEH A;  1WWP A;  3SXY A;  1LE4 A;  4MW3 A;  2LCH A;  1QPU A;  2XLD A;  4CSA C;  4LAC B;  4LDQ A;  2MHR A;  2EIJ C;  4BJ1 A;  1OCC C;  3UMI A;  4YJW A;  1T01 A;  4WJ0 A;  256B A;  2LQG A;  1YDI A;  4C3B A;  5B3S C;  4MVU A;  3ZIB A;  2EIK C;  1L7C A;  1YLM A;  2PX3 A;  3JSE O;  3Q7G A;  3W2V A;  3IPM O;  1RXQ A;  2LD6 A;  4DJ9 A;  3SXM A;  2XXA A;  4IB4 A;  3W8H A;  1QQ3 A;  2L6H A;  3H65 A;  5HSW A;  1TWC A;  2IXP A;  3AGU A;  4DRJ B;  5EHH A;  1H7I A;  1LI5 A;  1M6T A;  1OCZ C;  3DM5 A;  4MTG A;  4U5H A;  1SF8 A;  1G5Z A;  2OQM A;  4N6H A;  3OA1 A;  4Z9J A;  4JCZ A;  1Q0D A;  3U8V A;  1CGM E;  1GGQ A;  1M2V A;  3U3F A;  1O5H A;  2A0U A;  5E33 A;  1RMV A;  3MX3 A;  4DVY P;  1HMO A;  4AL0 A;  3C8G B;  1U89 A;  3IQT A;  2Q7R A;  4U5B E;  1KU2 A;  3ZDL A;  3UR3 C;  3NMI A;  3UGO A;  2Y3D A;  4HFK B;  3JTL O;  5L3Q A;  2XL8 A; 
#chains in the Genus database with same CATH homology
 3DZA A;  3NYM A;  5CI9 A;  2VB6 A;  2A1D D;  4XLP F;  4GEH A;  3B0U X;  3KMI A;  1ZHX A;  3AG3 C;  2WZL A;  3NKD A;  4IAO A;  3ZG1 A;  2A6E F;  3JCU Q;  3I5P A;  3SP1 A;  3GOD A;  4JZA A;  4QDL A;  3Q7L A;  4GYT A;  2LSE A;  2NG1 A;  4JJG A;  2NUP B;  4CS9 C;  5KYN A;  4C3E A;  3I5Q A;  3AG2 C;  2G3K A;  1MMD A;  5EGY A;  2IXM A;  3HTK C;  1PD1 A;  3UGP A;  3RH3 A;  3IEE A;  1M57 C;  1ZHY A;  3T6J A;  2IOQ A;  3HJC A;  3ZVR A;  5KYY A;  5DS6 A;  3DJU B;  3EH1 A;  3SZR A;  3NYJ A;  4PJN A;  2Y39 A;  4CIH A;  2R7U A;  4DVZ A;  3KKB A;  2W45 A;  2L81 A;  3O39 A;  3TD7 A;  4PJM A;  1MMG A;  2R7X A;  2Q3T A;  1S7Z A;  3WG7 C;  2Z15 A;  3DAF A;  3ASN C;  3LS0 A;  1BR2 A;  4I44 A;  4YT5 A;  2W4B A;  3QMK A;  2NUT A;  2MWQ A;  4YN0 B;  3UMH A;  4AE4 A;  3V7O A;  2L9J A;  2PP4 A;  4G7Z F;  1ZU5 A;  2A69 F;  2C04 A;  2Q9C A;  4J32 B;  1FMV A;  3AQB A;  4KNV A;  4CS8 A;  1MMA A;  3S29 A;  5KYW B;  1ZU4 A;  1Z5Z A;  3HLZ A;  3GAN A;  3ZSU A;  3B0P A;  1FFT C;  3Q6N A;  2W4M A;  4IWB A;  3SNH A;  3NG1 A;  5DVW A;  3EFO B;  2XL4 A;  1OKK A;  4IRU A;  3W8I A;  2A6H F;  3X1O A;  3MLG A;  4DOZ A;  2I8B A;  2ZPA A;  2CW0 F;  3K7D A;  3EG9 B;  4H4K C;  1BR1 A;  4LER A;  5DQT A;  4E7S A;  3UNG C;  5F5H A;  1D1B A;  3E9V A;  1QZX A;  2W9Y A;  4J30 B;  1J8M F;  2J0W A;  3AG1 C;  4DBR A;  4O6N A;  3PHF 2;  3DM9 B;  3LEV A;  5CI8 A;  1RJ9 A;  2EIM C;  4ANJ A;  2DYS C;  1MND A;  4U5G A;  4U5D E;  3B9Q A;  4XLN F;  4C7O B;  1D0X A;  5FCL A;  2Y3B A;  3K1I C;  1PCX A;  1ST6 A;  2G62 A;  2J9U A;  1SMY F;  2KNH A;  3OEO A;  3LLK A;  5IY5 C;  3CSK A;  1O87 A;  3W2W A;  1FFH A;  3ASO C;  4BJ6 A;  2H7O A;  2R7Q A;  3EZI A;  1VOM A;  1TWG A;  2H7B A;  2YZS A;  2PFD A;  3F46 A;  4OIO F;  3F47 A;  4CS8 C;  2D5R B;  4AX2 A;  3SYN A;  2HV7 A;  2C03 A;  2XXA B;  4KC9 A;  3T4R A;  3POV A;  1QLE C;  1IW7 F;  2V26 A;  4KI2 A;  3EPV A;  1OCO C;  3LES A;  3JYH A;  1M2V B;  5BUO A;  2J45 A;  1FMW A;  3N0T A;  3AG4 C;  3OWT A;  1LVK A;  3DMD A;  3M1C B;  4RD9 A;  1D1A A;  2FFH A;  2R7V A;  4X0R A;  1TWA A;  2QY9 A;  4XTK A;  1D0Z A;  1TWH A;  4RDA A;  5T3W A;  4KBL A;  4OD4 A;  3LNR A;  1Z63 A;  2KJG A;  3K6B A;  2X51 A;  4CS7 A;  5D92 A;  4BJT A;  4YT4 A;  4I3M A;  2PF4 E;  3DJN B;  4U5C E;  1IZM A;  1MMN A;  3SEO A;  3S0X A;  2VH3 A;  2WVO A;  5B1A C;  5KYX A;  5DS5 A;  5DS4 A;  4JVS A;  4BJ6 C;  2KGO A;  3CZ6 A;  4OIN F;  1NU9 C;  2H7V C;  3K33 A;  3CQZ A;  1G8X A;  5T1D B;  5KYU B;  4FWV A;  1ZYR F;  5KYY B;  4O79 A;  2IYL D;  2IXN A;  3EJN A;  4XWJ A;  1M56 C;  4BG0 A;  4QI0 A;  4F4B A;  2OG2 A;  2A68 F;  4HE8 D;  3FAJ A;  1V54 C;  4Q7C A;  3FVY A;  1JPJ A;  2J7P A;  3RYL A;  2XSE A;  1Z3I X;  2CNW A;  3EGD A;  4JUR I;  2NUT B;  2R7W A;  1TKN A;  4BJ5 A;  4AE4 B;  4ZLD A;  2P6V A;  2YHS A;  2IXO A;  2JD3 A;  3L0I A;  2KQ9 A;  3DXJ F;  3NRH A;  4LLC A;  3EGX A;  3EQL F;  3NYL A;  3FDQ A;  2CGE A;  3O6X A;  2Y3H A;  3NDB B;  3KH2 A;  3WOD F;  2FGY A;  2R7O A;  4DBQ A;  3LLI A;  1OCR C;  1NZE A;  4ULW A;  4G7O F;  5DLJ A;  4CBE A;  4OIP F;  3ABK C;  3JRT A;  4FX5 A;  2R7T A;  1SZI A;  1ZHZ A;  3JSZ A;  1OKK D;  4NY3 A;  1VYI A;  1TR2 A;  4U5E E;  2HV6 A;  1D0Y A;  3ABL C;  2XRH A;  4G7H F;  2YEV A;  2O9X A;  4CS9 A;  2ZXR A;  4IJJ A;  1RJ9 B;  2WVN A;  4PFO A;  3RKO F;  5L3V A;  4PFP A;  3JT1 A;  3ZC4 A;  1W2W A;  3ABM C;  1PD0 A;  3K66 A;  3Q6M A;  4LLE A;  1ZHT A;  3ECS A;  2CDQ A;  4BEJ A;  3KL4 A;  2Q9A A;  1FTS A;  2KW3 C;  2P7V A;  1NG1 A;  4BJ5 C;  2MYS A;  2WVQ A;  2GFH A;  2G3V A;  1WGW A;  2WL8 A;  3K1H A;  2J9W A;  5D91 A;  3QZC A;  3AQC A;  2J9V A;  2Y3G A;  4O6M A;  2V3C C;  5E3A A;  3LAY A;  4JJF A;  2R7S A;  2DYR C;  3ITF A;  2PX0 A;  3DD7 A;  4ZLC A;  2ZXP A;  2NUP A;  1BR4 A;  1NU7 D;  2OCC C;  4AK9 A;  1N1C A;  1J8Y F;  4YT2 A;  1Z23 A;  2Y69 C;  3EHN A;  4KNW A;  4PJL A;  1D1C A;  3RFY A;  1VK5 A;  2VAS A;  2ZXW C;  4I1O B;  4O7G A;  3UMK A;  4FES A;  4OIQ F;  1MNE A;  3X2Q C;  1ZHW A;  4EBB A;  5T3T A;  3E70 C;  2EIL C;  5E3C A;  3I4U A;  3LS1 A;  4MQ9 F;  4Q4Z F;  4OD5 A;  4I1M A;  4HEA J;  4MND A;  3FHD A;  4EWC A;  4YWQ A;  4C3D A;  5KYU A;  5KYX B;  1LS1 A;  2WZF A;  2E87 A;  4PJJ A;  3EZH A;  4CSA A;  2ZXO A;  3EHM A;  2R7R A;  1VMA A;  2B0J A;  2M4E A;  1LKX A;  3T6B A;  4P6I C;  5KYW A;  3VAY A;  4OIR F;  3S28 A;  5E2Q A;  2DGJ A;  3N24 A;  2Q9B A;  3EFO A;  2BE5 F;  2J0X A;  4M63 A;  4JW1 A;  4QI2 A;  3EH2 A;  4A2N B;  2EIN C;  2WB7 A;  3EGD B;  3EG9 A;  5B1B C;  1V55 C;  4JCH A;  2J7P D;  5F5F A;  2CNW D;  4E7Z A;  4O6Y A;  1JPN A;  3EGX B;  3VYW A;  3DAG A;  2QTV A;  4K7B A;  4G0H A;  4RBN A;  4HFF B;  3NKE A;  3S27 A;  4B6I A;  4N06 A;  2WZG A;  5DQZ A;  4C7O A;  3B0V C;  1Z6A A;  2J46 A;  4Q5S F;  3N2Z B;  1VYK A;  3L34 A;  4YT8 A;  1M2O A;  3RIP A;  3LJB A;  4PK4 A;  4U5F E;  4K0D A;  3PMR A;  4W8K A;  4CSA C;  4LAC B;  2EIJ C;  4BJ1 A;  1OCC C;  3UMI A;  4YJW A;  4WJ0 A;  4C3B A;  5B3S C;  3ZIB A;  2EIK C;  2PX3 A;  3Q7G A;  3W2V A;  2XXA A;  3W8H A;  3H65 A;  5HSW A;  1TWC A;  2IXP A;  5EHH A;  1OCZ C;  3DM5 A;  4U5H A;  1SF8 A;  3OA1 A;  1M2V A;  1O5H A;  5E33 A;  3MX3 A;  4DVY P;  3UGO A;  4U5B E;  1KU2 A;  3UR3 C;  2Y3D A;  4HFK B;  5L3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...