4XEFA

Pyk2-fat complexed with leupaxin ld motif ld1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
136
structure length
136
Chain Sequence
b'MANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein-tyrosine kinase 2-beta
publication title Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 56
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4xefA00
1WOLA 2LK4A 2JPUA 4EBKA 4EBJA 1OW8A 4XEFA 3U3FA 1KTMA 4XEKA 1WTYA 3GM3A 1WWPA 3K7DA 3C8GA 3L8IA 1OW6A 4R32A 1ZZPA 1KNYA 2HSBA 3RQEA 1OW7A 2L6FA 3BRJA 3B71A 3JYYA 3AJMA 1PV3A 3JZ0A 3U0CA 3S9OA 1K40A 3GM2A 2JX0A 3C18A 2L6HA 1QVXA 3C8GD 3L8JA 3O10A 1K05A 1V4AA 2L6GA 5F28E 3RQFA 4XEVA 1JOGA 3RQGA 3MFNA 3TULA 2YWAA 1K04A 3C8GB 2Q00A 4NQFA 1UFBA 3GM1A 2KK1A 2PBEA 1O3UA
chains in the Genus database with same CATH superfamily
2YZSA 4BJ6A 5L0HA 1LE4A 4YK5A 3EH1A 4NTAA 3ZDLA 1Q0DA 3FMSA 5E2QA 4QDLA 4PFOA 1LS1A 1JAFA 2A1DD 3IQ5A 2OKUA 1L3PA 2XL8A 4P9TA 1LS4A 2R7QA 5A6JA 3DJUB 2J0WA 4UDVA 2NSGA 3EGDB 2MYSA 1AUEA 4MVUA 5L0GA 1WGWA 1MMAA 3LNRA 1H7IA 2DI3A 4N06A 3RF3A 4YL1A 3MYIA 4PJLA 5KYXB 1OCRC 1CGNA 1TWAA 2HSQA 2QE9A 2Z15A 2HUJA 4IARA 1V55C 4IB4A 4XEVA 2KGOA 3ZWIA 2UUHA 1M2VA 3B0PA 4DJ9A 1J8MF 2IYLD 3RH3A 3TOMA 1G4US 4XPYA 4PJMA 3TJ6A 3L8IA 1G4WR 3ASOC 4CDYA 1NBBA 4XLPF 4DBRA 4BJ6C 1OW8A 3U9MA 4YT5A 1YZAA 1OKKD 4XQ1A 4LDKA 3S84A 1NFNA 1YVIA 5B3SC 2D4UA 1Q0MA 2HSBA 4J30B 1H6GA 4LACB 4MVZA 3RYLA 3JYYA 1GM5A 2YKZA 4DRIB 1NU7D 2R05A 2P7VA 1SYQA 2VCAA 1XWJA 2WZGA 5B1AC 2R7SA 4A2NB 4YT4A 4MTGA 2BL2A 3EQLF 4OIOF 3UMIA 3NYMA 2G3KA 3EG9B 3E9VA 4JEBA 3E70C 1YAUO 1O5HA 2PBEA 1SF8A 4Q4ZF 2Y3GA 2WB7A 1LM3B 3SXZA 5B3IA 1TWGA 1YZCA 2KNHA 4RBNA 3V5ZA 4ULWA 1MNDA 4F4BA 5A69A 2ZPAA 2WVOA 4OIPF 1NG1A 2YL3A 4MVRA 3DJNB 5JP7A 2XXAB 2P6VA 1TWHA 5A6AA 5DQTA 1NU9C 2C04A 3NKEA 4EBBA 1FTSA 3J06A 3JTLO 4K1OA 5HV9A 1C03A 3AJMA 3K66A 3T9OA 1E84A 1NLXA 1Q0KA 3O6XA 2JX0A 4L6RA 2XLEA 1YDIA 1K05A 3QZCA 1I5NA 2XLWA 3NKDA 4JURI 2ZXOA 2DB4A 2EPLX 3GWLA 3MYFA 5COGA 4AK9A 3Q6NA 5JT4A 3NYJA 4CDAA 5BUOA 2NUTB 2NUPA 5JLIA 4AE4A 1Z23A 1D0ZA 2R7RA 2IXOA 3A9CA 1Z5ZA 2AVKA 3AG3C 2ASRA 3ZQYA 4JE9A 4LLEA 2P0NA 5KYWB 4IGGA 2XLHA 3HJCA 1KTMA 3GEEA 4AL1A 3JYHA 5TJ5E 3AGUA 1D1BA 2A0UA 3N0TA 2B0HA 4U9EA 4E0HA 1I4YA 4C7OB 4MW3A 1LE2A 1LI7A 3DE9A 4MTFA 2J9BA 5BQHA 4CSAA 2G3VA 4O6NA 4O6YA 4E0IA 4EIYA 1IZMA 1PV3A 1UG7A 3C63A 3GORA 3M1CB 3O55A 2CGEA 3SNHA 3U9JA 4C3EA 4YT8A 1MQVA 2L6HA 1E86A 1BR2A 2PX3A 1VLSA 3Q7GA 3VF0A 3MLGA 3PMRA 5DQZA 4G7HF 1T6IA 4CS9C 3NMJA 4M63A 3N24A 2R7VA 2XRHA 3RKOF 1VLTA 1Z6AA 3FAPB 1CGOA 2JD3A 4RDAA 3U2MA 5E3CA 5L0CA 3UGPA 3PCVA 1ZHWA 2LSEA 1ZVZA 4X0RA 3FAJA 3EFOA 3V7OA 1WOLA 1IW7F 1D1CA 1Q0FA 2LK4A 2HZ8A 2QUPA 4G0HA 3SXMA 1D1AA 2EPKX 4CS7A 3QMKA 1OCCC 3X2QC 3EZIA 1O87A 1U6HA 4D4NA 4MS2A 2PF4E 3SEOA 1LIHA 4IRUA 2P1AA 3QVZA 2X0CA 1Y6DA 3GEHA 4CSAC 4JIOA 3ABLC 3KYIA 3LUTB 2XLOA 3IHUA 3L8JA 4XTKA 4YL0A 4B6IA 4U5HA 2MWQA 1YLMA 3H65A 1ZU5A 3NYLA 1MMGA 1ZHTA 5KYYB 2R7XA 2RSEB 3EPVA 1RJ9A 2J45A 3KPHA 5FZTA 4QI2A 1L7CA 4C3DA 1XZPA 3EGDA 3NDBB 1SZIA 2R7OA 2XSEA 1HE1A 3GM1A 5DS6A 1OCZC 1D0YA 4OIQF 5KYXA 1PD0A 3DWWA 5K0IA 3OEOA 1JRAA 3M4BA 4XEFA 2VASA 3EJNA 3LLIA 3LNMB 3QW1A 3S27A 3VM6A 3K7DA 2J9VA 4CDVA 4N6CA 4PACA 3US6A 2KQ9A 1MMDA 1EI7A 1LKXA 5JRAA 3FDQA 3JZ0A 4HFKB 1Q0GA 4GEHA 1YYJA 2QY9A 2XLMA 4U5CE 3BEHA 1NFOA 2R9RB 3EGXB 4JTCB 4ZLCA 1CGME 3POVA 3TQOA 1ZU4A 5A6BA 3VAYA 1JMWA 4HEAJ 2YQYA 2D5RB 4YWQA 1QSPA 2EIMC 3EH2A 3CSKA 1ST6A 4N6HA 5AGFA 5JSLA 4XLNF 4LLCA 3VRCA 5E3AA 1A7VA 4KBLA 2CDQA 1CPRA 4ZLDA 1T9KA 4KNVA 1HE9A 4DOZA 1ORYA 1QKRA 1WTYA 3H2VA 1M56C 3NRHA 4CIHA 2Y3BA 1APCA 4JVSA 1OW6A 2WL8A 1OR3A 3CEXA 3M79A 2Q7RA 3VYWA 5L3QA 2EIJC 1TFKB 3DM9B 3U0CA 2YHSA 4QI0A 2IXPA 3R2PA 1A7EA 1S05A 3O10A 1QVXA 4JW1A 2HJMA 5EGYA 1A7DA 1AEPA 2A6EF 1F1MA 2H8AA 2AU5A 2AWCA 3IQ6A 1RCPA 5KYNA 4LERA 2OU6A 5L0IA 2XXAA 2W45A 3M15A 3UR3C 1TFOB 1ZYRF 5KYUA 3RIPA 1LPEA 3B0VC 4BG0A 3K6BA 4PFPA 5BQIA 1JPJA 1YA9A 4J7TA 1OR2A 4HE8D 4YL3A 4PR9A 4CS8A 2J9UA 2Q9AA 4FESA 4I1MA 1T01A 1ZHYA 1S7ZA 3AOUA 1VOMA 2KW3C 2YLGA 4IWBA 2HJ3A 2A68F 2NUTA 4BJTA 5HSWA 2L9JA 2QNLA 1VTMP 4DBQA 4OD5A 4LDRA 1YARO 3SYNA 2M4EA 3RFYA 2OCCC 4JZAA 3M4CA 5KYWA 4J7YA 1QZXA 2EPMX 4NTBA 5GPGB 3AQBA 1DOWA 4EWCA 3TD7A 5DVWA 4C7OA 2HV6A 2TMVP 3RQGA 3DXJF 2HMQA 2X51A 2A69F 2L81A 1U0BB 4BEJA 2Q9CA 2IXNA 1QLEC 3C8GB 2PNOA 5EK0A 2EPOA 5DLJA 3F47A 2YLDA 3AG1C 1RKCA 4K0DA 4LDQA 5A6BD 3S0XA 2ZD9A 2W4BA 2WVNA 1RMVA 3HNIA 1LI5A 3DE8A 3G4ZA 1ORJA 3K1IA 4KC9A 4U5BE 3F46A 1JPNA 3JSEO 3IQTA 1VYKA 2VH3A 4G78A 3GANA 2XS1A 2YRFA 2W4MA 1ZZPA 1SMYF 1KNYA 3R7CA 3RQEA 3UMHA 3MBGA 2M64A 3BRJA 3L1MA 3B71A 4OINF 4Q5SF 1BBHA 3DZAA 3QTHA 5E33A 3C18A 2YVKA 3B29A 1V4AA 3HNKA 4W8KA 5L0JA 1B68A 4RD9A 2ETSA 3HTKC 3JT1A 1OXBA 2WZFA 3ZIBA 4EUKB 3X1OA 3GODA 4H4KC 5F5HA 3JSZA 1PCXA 1R4TA 3NG1A 4JCHA 4G7ZF 2NPUA 5COMA 4D4XA 4I1OB 4Q7CA 4WABA 3SXKA 3JCUQ 1LVKA 2VCCA 3HKKA 3SZRA 1E85A 3UMKA 2O9XA 3LJBA 3LS0A 2ZXRA 3ZG1A 2Y39A 1ZW3A 3FXHA 5B1BC 3WAQA 4MVOA 2PFDA 2V26A 4E18A 2UUIA 3U5SA 1N1CA 2J0XA 2OEVA 2CCYA 1J8YF 2VC9A 3L34A 2J46A 3KL4A 4R32A 5DS4A 4AE4B 4DRHB 3PHF2 2R7WA 2QLAA 2PP4A 2ICWG 2KJGA 2GDCA 2LQGA 2RD9A 2XLVA 3CZ6A 3EHMA 3LS1A 2V3CC 2IOQA 5L0DA 1H9TA 4HFFB 2Y3DA 2CNWA 2KSFA 3WHNA 1TQGA 1E83A 1EKYA 3JRMO 4ER9A 4J32B 1Z63A 2BC5A 2HKVA 4NY3A 3I4UA 3C8ZA 4YT2A 4AL0A 2OOCA 3ZC4A 4CS9A 2G62A 4IJJA 1VK5A 1QQ3A 1MMNA 3EGXA 3KH2A 4JTDB 4MQ9F 4MW8A 4EBJA 4MTOA 4XPXA 3T6JA 4BPMA 5A6KA 2OJED 5AC4A 4U9DA 1QPUA 1RKEB 4XWJA 2I8BA 4WJ0A 2EINC 5L0FA 1V74B 256BA 1WATA 2P61A 4WGZA 5CI9A 1ORSC 4P6IC 3S29A 5F5FA 3KYJA 4IAOA 3SP1A 1GGQA 1K40A 2HMZA 2OG2A 3AGTA 2L6GA 2H7VC 2Q4FA 2H7BA 4P9FA 4XPWA 1A0BA 1T6UA 3LEOA 3NMKA 2DYRC 4EHPA 2YL1A 1EQ1A 5CI8A 1C02A 3SXYA 2ZXWC 3U8PA 5COFA 4IAQA 3MFNA 4H54A 3GEIA 4OD4A 4NCQA 2Y69C 1CPQA 3U3FA 1RXQA 1U89A 2YLIA 2KYHA 4ONSA 4XEKA 1Z7Qc 3RW0A 4MVSA 2LFFA 1RJ9B 3GWNA 3EG9A 3TULA 2R7UA 2I15A 4MVQA 1R5ID 2OQMA 2ZXPA 3DD7A 3UNGC 4EKWA 1ZHXA 2H7OA 2L7AA 2GFHA 4FX5A 3S9OA 3GM2A 4ANJA 2DGJA 1H9GA 1TWCA 2GAQA 5CIVA 2J8WA 3FOPA 3RQFA 2IBFA 3I5PA 2Y3HA 1Y4CA 4ULVA 2R25A 3RVZA 1WN0A 1HMDA 3B9QA 3G4XA 3ASNC 4U5GA 4U5DE 3U8VA 4CX9A 3WG7C 2LP4A 4FAPB 3ZVRA 1C17M 1FMVA 2YEVA 4JRZA 3ATPA 3EHNA 2CNWD 2KK1A 4PK4A 1AVOB 3AQCA 2HFIA 4O7GA 4JKVA 1OQCA 3W2WA 4AX2A 1GS9A 1M57C 3GM3A 1WWPA 3TK0A 3RVYA 1FNTc 2Q3TA 4DVYP 2FFHA 3C8GA 2OEXA 2FAPB 2WZLA 3DKAA 1ZHZA 3MX3A 2PX0A 1BR4A 3TOLA 2XS8A 1M2VB 1OW7A 2MHRA 1VB5A 1T6QA 2Q9BA 1W2WA 2R03A 2XLDA 4I44A 3HNLA 2E87A 4KI2A 3ZTZA 2BE5F 2CYDA 2WVQA 2IM8A 3A11A 3LESA 4U5FE 1I4ZA 4YJWA 4OIRF 3S28A 3W2VA 3AG4C 4O6MA 1GQAA 3I5QA 3U3BA 2GA0A 3OA1A 4PJNA 2NG1A 5JS5A 1BDJB 4JTAB 4JEAA 2VCBA 5FCLA 5JUAA 4EBKA 2NSFA 3C62A 5T1DB 1BZ4A 3KKBA 1FFTC 2J7PA 4BEMJ 1T5OA 3K1HA 3V5YA 4CS8C 3W8HA 1OCOC 5EHHA 4PJJA 1PD1A 3DMDA 4N4WA 4CJGA 5KYUB 3ZSUA 4CBEA 3Q7LA 4CJOA 1YA7O 1BR1A 3G50A 1VYIA 1WASA 2QTVA 3LEVA 1MNEA 3LLKA 5F28E 2KC3A 5AC5A 5DS5A 3T4RA 3ZQVA 5KYYA 3V5XA 3U2LA 1FMWA 1YYXA 2W9YA 4FWVA 2YWAA 1Z3IX 4MVMA 4KNWA 1G5ZA 4E7ZA 2IXMA 1FR0A 2LIGA 3DM5A 3W8IA 1O3UA 2LFDA 3LAYA 4BJ5A 4JJGA 3IPMO 5JVEA 1ZW2A 4MNDA 4GYTA 2R02A 3OWTA 4Z9IA 3HNJA 4G7OF 2EIKC 2C03A 2XL6A 3FHDA 1YJGA 2EPNA 3K1IC 3NMIA 3QVYA 3ZTMA 1V54C 3T6BA 1EA8A 4A4AA 2YL7A 2NUPB 5T3TA 5IY5C 3JRTA 1FFHA 2J9WA 3ECSA 2F22A 3DAFA 2YL0A 3ABKC 3C8GD 4JCZA 1JR8A 4DXWA 1RKEA 1FAPB 4GQHA 3FVYA 4W8PA 1JOGA 2DYSC 1TR2A 2LCHA 4Z9HA 3WODF 4K7BA 1HW2A 4JJFA 3ABMC 2EILC 2A6HF 3DAGA 4I3MA 1K04A 5BQGA 4NQFA 2AP3A 3N2ZB 1DOVA 3IEEA 4YN0B 4BJ1A 4DRJB 1OKKA 1D0XA 2VB6A 4WGYA 4DVZA 3H2UA 3S90A 3FOOA 3QW0A 3O39A 3AG2C 2JPUA 2OJQA 5D91A 3HLZA 3Q6MA 5T3WA 4BJ5C 2CW0F 4E17A 4CIPA 4Z9JA 1A41A 3PDMP 4NC3A 3ITFA 4JC7A 5L3VA 3C7JA 2B0JA 1HW1A 3B0UX 2R7TA 1G8XA 1TKNA 4E7SA 3DI5A 1KU2A 4U5EE 2L6FA 2J7PD 4NTFA 2XL4A 1XZQA 3IQCA 3KMIA 3UGOA 3L0IA 3T6GB 1M6TA 3CAXA 3EFOB 3CQZA 2LD6A 3EZHA 1HY5A 1E2XA 2HS5A 2A0BA 2XM4A 3K33A 1SR2A 2FGYA 2GWWA 1NZEA 2HV7A 1NSGB 2XM0A 2Q00A 1OXKA 1UFBA 1VMAA 1HMOA 1M2OA 3TJ5A 4C3BA 5D92A 3W4YA 2AWYA 4O79A
chains in the Genus database with same CATH topology
1WOLA 2LK4A 2JPUA 4EBKA 4EBJA 1OW8A 4XEFA 3U3FA 1KTMA 4XEKA 1WTYA 3GM3A 1WWPA 3K7DA 3C8GA 3L8IA 1OW6A 4R32A 1ZZPA 1KNYA 2HSBA 3RQEA 1OW7A 2L6FA 3BRJA 3B71A 3JYYA 3AJMA 1PV3A 3JZ0A 3U0CA 3S9OA 1K40A 3GM2A 2JX0A 3C18A 2L6HA 1QVXA 3C8GD 3L8JA 3O10A 1K05A 1V4AA 2L6GA 5F28E 3RQFA 4XEVA 1JOGA 3RQGA 3MFNA 3TULA 2YWAA 1K04A 3C8GB 2Q00A 4NQFA 1UFBA 3GM1A 2KK1A 2PBEA 1O3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WOL A;  2LK4 A;  2JPU A;  4EBK A;  4EBJ A;  1OW8 A;  4XEF A;  3U3F A;  1KTM A;  4XEK A;  1WTY A;  3GM3 A;  1WWP A;  3K7D A;  3C8G A;  3L8I A;  1OW6 A;  4R32 A;  1ZZP A;  1KNY A;  2HSB A;  3RQE A;  1OW7 A;  2L6F A;  3BRJ A;  3B71 A;  3JYY A;  3AJM A;  1PV3 A;  3JZ0 A;  3U0C A;  3S9O A;  1K40 A;  3GM2 A;  2JX0 A;  3C18 A;  2L6H A;  1QVX A;  3C8G D;  3L8J A;  3O10 A;  1K05 A;  1V4A A;  2L6G A;  5F28 E;  3RQF A;  4XEV A;  1JOG A;  3RQG A;  3MFN A;  3TUL A;  2YWA A;  1K04 A;  3C8G B;  2Q00 A;  4NQF A;  1UFB A;  3GM1 A;  2KK1 A;  2PBE A;  1O3U A; 
#chains in the Genus database with same CATH topology
 2YZS A;  4BJ6 A;  5L0H A;  1LE4 A;  4YK5 A;  3EH1 A;  4NTA A;  3ZDL A;  1Q0D A;  3FMS A;  5E2Q A;  4QDL A;  4PFO A;  1LS1 A;  1JAF A;  2A1D D;  3IQ5 A;  2OKU A;  1L3P A;  2XL8 A;  4P9T A;  1LS4 A;  2R7Q A;  5A6J A;  3DJU B;  2J0W A;  4UDV A;  2NSG A;  3EGD B;  2MYS A;  1AUE A;  4MVU A;  5L0G A;  1WGW A;  1MMA A;  3LNR A;  1H7I A;  2DI3 A;  4N06 A;  3RF3 A;  4YL1 A;  3MYI A;  4PJL A;  5KYX B;  1OCR C;  1CGN A;  1TWA A;  2HSQ A;  2QE9 A;  2Z15 A;  2HUJ A;  4IAR A;  1V55 C;  4IB4 A;  4XEV A;  2KGO A;  3ZWI A;  2UUH A;  1M2V A;  3B0P A;  4DJ9 A;  1J8M F;  2IYL D;  3RH3 A;  3TOM A;  1G4U S;  4XPY A;  4PJM A;  3TJ6 A;  3L8I A;  1G4W R;  3ASO C;  4CDY A;  1NBB A;  4XLP F;  4DBR A;  4BJ6 C;  1OW8 A;  3U9M A;  4YT5 A;  1YZA A;  1OKK D;  4XQ1 A;  4LDK A;  3S84 A;  1NFN A;  1YVI A;  5B3S C;  2D4U A;  1Q0M A;  2HSB A;  4J30 B;  1H6G A;  4LAC B;  4MVZ A;  3RYL A;  3JYY A;  1GM5 A;  2YKZ A;  4DRI B;  1NU7 D;  2R05 A;  2P7V A;  1SYQ A;  2VCA A;  1XWJ A;  2WZG A;  5B1A C;  2R7S A;  4A2N B;  4YT4 A;  4MTG A;  2BL2 A;  3EQL F;  4OIO F;  3UMI A;  3NYM A;  2G3K A;  3EG9 B;  3E9V A;  4JEB A;  3E70 C;  1YAU O;  1O5H A;  2PBE A;  1SF8 A;  4Q4Z F;  2Y3G A;  2WB7 A;  1LM3 B;  3SXZ A;  5B3I A;  1TWG A;  1YZC A;  2KNH A;  4RBN A;  3V5Z A;  4ULW A;  1MND A;  4F4B A;  5A69 A;  2ZPA A;  2WVO A;  4OIP F;  1NG1 A;  2YL3 A;  4MVR A;  3DJN B;  5JP7 A;  2XXA B;  2P6V A;  1TWH A;  5A6A A;  5DQT A;  1NU9 C;  2C04 A;  3NKE A;  4EBB A;  1FTS A;  3J06 A;  3JTL O;  4K1O A;  5HV9 A;  1C03 A;  3AJM A;  3K66 A;  3T9O A;  1E84 A;  1NLX A;  1Q0K A;  3O6X A;  2JX0 A;  4L6R A;  2XLE A;  1YDI A;  1K05 A;  3QZC A;  1I5N A;  2XLW A;  3NKD A;  4JUR I;  2ZXO A;  2DB4 A;  2EPL X;  3GWL A;  3MYF A;  5COG A;  4AK9 A;  3Q6N A;  5JT4 A;  3NYJ A;  4CDA A;  5BUO A;  2NUT B;  2NUP A;  5JLI A;  4AE4 A;  1Z23 A;  1D0Z A;  2R7R A;  2IXO A;  3A9C A;  1Z5Z A;  2AVK A;  3AG3 C;  2ASR A;  3ZQY A;  4JE9 A;  4LLE A;  2P0N A;  5KYW B;  4IGG A;  2XLH A;  3HJC A;  1KTM A;  3GEE A;  4AL1 A;  3JYH A;  5TJ5 E;  3AGU A;  1D1B A;  2A0U A;  3N0T A;  2B0H A;  4U9E A;  4E0H A;  1I4Y A;  4C7O B;  4MW3 A;  1LE2 A;  1LI7 A;  3DE9 A;  4MTF A;  2J9B A;  5BQH A;  4CSA A;  2G3V A;  4O6N A;  4O6Y A;  4E0I A;  4EIY A;  1IZM A;  1PV3 A;  1UG7 A;  3C63 A;  3GOR A;  3M1C B;  3O55 A;  2CGE A;  3SNH A;  3U9J A;  4C3E A;  4YT8 A;  1MQV A;  2L6H A;  1E86 A;  1BR2 A;  2PX3 A;  1VLS A;  3Q7G A;  3VF0 A;  3MLG A;  3PMR A;  5DQZ A;  4G7H F;  1T6I A;  4CS9 C;  3NMJ A;  4M63 A;  3N24 A;  2R7V A;  2XRH A;  3RKO F;  1VLT A;  1Z6A A;  3FAP B;  1CGO A;  2JD3 A;  4RDA A;  3U2M A;  5E3C A;  5L0C A;  3UGP A;  3PCV A;  1ZHW A;  2LSE A;  1ZVZ A;  4X0R A;  3FAJ A;  3EFO A;  3V7O A;  1WOL A;  1IW7 F;  1D1C A;  1Q0F A;  2LK4 A;  2HZ8 A;  2QUP A;  4G0H A;  3SXM A;  1D1A A;  2EPK X;  4CS7 A;  3QMK A;  1OCC C;  3X2Q C;  3EZI A;  1O87 A;  1U6H A;  4D4N A;  4MS2 A;  2PF4 E;  3SEO A;  1LIH A;  4IRU A;  2P1A A;  3QVZ A;  2X0C A;  1Y6D A;  3GEH A;  4CSA C;  4JIO A;  3ABL C;  3KYI A;  3LUT B;  2XLO A;  3IHU A;  3L8J A;  4XTK A;  4YL0 A;  4B6I A;  4U5H A;  2MWQ A;  1YLM A;  3H65 A;  1ZU5 A;  3NYL A;  1MMG A;  1ZHT A;  5KYY B;  2R7X A;  2RSE B;  3EPV A;  1RJ9 A;  2J45 A;  3KPH A;  5FZT A;  4QI2 A;  1L7C A;  4C3D A;  1XZP A;  3EGD A;  3NDB B;  1SZI A;  2R7O A;  2XSE A;  1HE1 A;  3GM1 A;  5DS6 A;  1OCZ C;  1D0Y A;  4OIQ F;  5KYX A;  1PD0 A;  3DWW A;  5K0I A;  3OEO A;  1JRA A;  3M4B A;  4XEF A;  2VAS A;  3EJN A;  3LLI A;  3LNM B;  3QW1 A;  3S27 A;  3VM6 A;  3K7D A;  2J9V A;  4CDV A;  4N6C A;  4PAC A;  3US6 A;  2KQ9 A;  1MMD A;  1EI7 A;  1LKX A;  5JRA A;  3FDQ A;  3JZ0 A;  4HFK B;  1Q0G A;  4GEH A;  1YYJ A;  2QY9 A;  2XLM A;  4U5C E;  3BEH A;  1NFO A;  2R9R B;  3EGX B;  4JTC B;  4ZLC A;  1CGM E;  3POV A;  3TQO A;  1ZU4 A;  5A6B A;  3VAY A;  1JMW A;  4HEA J;  2YQY A;  2D5R B;  4YWQ A;  1QSP A;  2EIM C;  3EH2 A;  3CSK A;  1ST6 A;  4N6H A;  5AGF A;  5JSL A;  4XLN F;  4LLC A;  3VRC A;  5E3A A;  1A7V A;  4KBL A;  2CDQ A;  1CPR A;  4ZLD A;  1T9K A;  4KNV A;  1HE9 A;  4DOZ A;  1ORY A;  1QKR A;  1WTY A;  3H2V A;  1M56 C;  3NRH A;  4CIH A;  2Y3B A;  1APC A;  4JVS A;  1OW6 A;  2WL8 A;  1OR3 A;  3CEX A;  3M79 A;  2Q7R A;  3VYW A;  5L3Q A;  2EIJ C;  1TFK B;  3DM9 B;  3U0C A;  2YHS A;  4QI0 A;  2IXP A;  3R2P A;  1A7E A;  1S05 A;  3O10 A;  1QVX A;  4JW1 A;  2HJM A;  5EGY A;  1A7D A;  1AEP A;  2A6E F;  1F1M A;  2H8A A;  2AU5 A;  2AWC A;  3IQ6 A;  1RCP A;  5KYN A;  4LER A;  2OU6 A;  5L0I A;  2XXA A;  2W45 A;  3M15 A;  3UR3 C;  1TFO B;  1ZYR F;  5KYU A;  3RIP A;  1LPE A;  3B0V C;  4BG0 A;  3K6B A;  4PFP A;  5BQI A;  1JPJ A;  1YA9 A;  4J7T A;  1OR2 A;  4HE8 D;  4YL3 A;  4PR9 A;  4CS8 A;  2J9U A;  2Q9A A;  4FES A;  4I1M A;  1T01 A;  1ZHY A;  1S7Z A;  3AOU A;  1VOM A;  2KW3 C;  2YLG A;  4IWB A;  2HJ3 A;  2A68 F;  2NUT A;  4BJT A;  5HSW A;  2L9J A;  2QNL A;  1VTM P;  4DBQ A;  4OD5 A;  4LDR A;  1YAR O;  3SYN A;  2M4E A;  3RFY A;  2OCC C;  4JZA A;  3M4C A;  5KYW A;  4J7Y A;  1QZX A;  2EPM X;  4NTB A;  5GPG B;  3AQB A;  1DOW A;  4EWC A;  3TD7 A;  5DVW A;  4C7O A;  2HV6 A;  2TMV P;  3RQG A;  3DXJ F;  2HMQ A;  2X51 A;  2A69 F;  2L81 A;  1U0B B;  4BEJ A;  2Q9C A;  2IXN A;  1QLE C;  3C8G B;  2PNO A;  5EK0 A;  2EPO A;  5DLJ A;  3F47 A;  2YLD A;  3AG1 C;  1RKC A;  4K0D A;  4LDQ A;  5A6B D;  3S0X A;  2ZD9 A;  2W4B A;  2WVN A;  1RMV A;  3HNI A;  1LI5 A;  3DE8 A;  3G4Z A;  1ORJ A;  3K1I A;  4KC9 A;  4U5B E;  3F46 A;  1JPN A;  3JSE O;  3IQT A;  1VYK A;  2VH3 A;  4G78 A;  3GAN A;  2XS1 A;  2YRF A;  2W4M A;  1ZZP A;  1SMY F;  1KNY A;  3R7C A;  3RQE A;  3UMH A;  3MBG A;  2M64 A;  3BRJ A;  3L1M A;  3B71 A;  4OIN F;  4Q5S F;  1BBH A;  3DZA A;  3QTH A;  5E33 A;  3C18 A;  2YVK A;  3B29 A;  1V4A A;  3HNK A;  4W8K A;  5L0J A;  1B68 A;  4RD9 A;  2ETS A;  3HTK C;  3JT1 A;  1OXB A;  2WZF A;  3ZIB A;  4EUK B;  3X1O A;  3GOD A;  4H4K C;  5F5H A;  3JSZ A;  1PCX A;  1R4T A;  3NG1 A;  4JCH A;  4G7Z F;  2NPU A;  5COM A;  4D4X A;  4I1O B;  4Q7C A;  4WAB A;  3SXK A;  3JCU Q;  1LVK A;  2VCC A;  3HKK A;  3SZR A;  1E85 A;  3UMK A;  2O9X A;  3LJB A;  3LS0 A;  2ZXR A;  3ZG1 A;  2Y39 A;  1ZW3 A;  3FXH A;  5B1B C;  3WAQ A;  4MVO A;  2PFD A;  2V26 A;  4E18 A;  2UUI A;  3U5S A;  1N1C A;  2J0X A;  2OEV A;  2CCY A;  1J8Y F;  2VC9 A;  3L34 A;  2J46 A;  3KL4 A;  4R32 A;  5DS4 A;  4AE4 B;  4DRH B;  3PHF 2;  2R7W A;  2QLA A;  2PP4 A;  2ICW G;  2KJG A;  2GDC A;  2LQG A;  2RD9 A;  2XLV A;  3CZ6 A;  3EHM A;  3LS1 A;  2V3C C;  2IOQ A;  5L0D A;  1H9T A;  4HFF B;  2Y3D A;  2CNW A;  2KSF A;  3WHN A;  1TQG A;  1E83 A;  1EKY A;  3JRM O;  4ER9 A;  4J32 B;  1Z63 A;  2BC5 A;  2HKV A;  4NY3 A;  3I4U A;  3C8Z A;  4YT2 A;  4AL0 A;  2OOC A;  3ZC4 A;  4CS9 A;  2G62 A;  4IJJ A;  1VK5 A;  1QQ3 A;  1MMN A;  3EGX A;  3KH2 A;  4JTD B;  4MQ9 F;  4MW8 A;  4EBJ A;  4MTO A;  4XPX A;  3T6J A;  4BPM A;  5A6K A;  2OJE D;  5AC4 A;  4U9D A;  1QPU A;  1RKE B;  4XWJ A;  2I8B A;  4WJ0 A;  2EIN C;  5L0F A;  1V74 B;  256B A;  1WAT A;  2P61 A;  4WGZ A;  5CI9 A;  1ORS C;  4P6I C;  3S29 A;  5F5F A;  3KYJ A;  4IAO A;  3SP1 A;  1GGQ A;  1K40 A;  2HMZ A;  2OG2 A;  3AGT A;  2L6G A;  2H7V C;  2Q4F A;  2H7B A;  4P9F A;  4XPW A;  1A0B A;  1T6U A;  3LEO A;  3NMK A;  2DYR C;  4EHP A;  2YL1 A;  1EQ1 A;  5CI8 A;  1C02 A;  3SXY A;  2ZXW C;  3U8P A;  5COF A;  4IAQ A;  3MFN A;  4H54 A;  3GEI A;  4OD4 A;  4NCQ A;  2Y69 C;  1CPQ A;  3U3F A;  1RXQ A;  1U89 A;  2YLI A;  2KYH A;  4ONS A;  4XEK A;  1Z7Q c;  3RW0 A;  4MVS A;  2LFF A;  1RJ9 B;  3GWN A;  3EG9 A;  3TUL A;  2R7U A;  2I15 A;  4MVQ A;  1R5I D;  2OQM A;  2ZXP A;  3DD7 A;  3UNG C;  4EKW A;  1ZHX A;  2H7O A;  2L7A A;  2GFH A;  4FX5 A;  3S9O A;  3GM2 A;  4ANJ A;  2DGJ A;  1H9G A;  1TWC A;  2GAQ A;  5CIV A;  2J8W A;  3FOP A;  3RQF A;  2IBF A;  3I5P A;  2Y3H A;  1Y4C A;  4ULV A;  2R25 A;  3RVZ A;  1WN0 A;  1HMD A;  3B9Q A;  3G4X A;  3ASN C;  4U5G A;  4U5D E;  3U8V A;  4CX9 A;  3WG7 C;  2LP4 A;  4FAP B;  3ZVR A;  1C17 M;  1FMV A;  2YEV A;  4JRZ A;  3ATP A;  3EHN A;  2CNW D;  2KK1 A;  4PK4 A;  1AVO B;  3AQC A;  2HFI A;  4O7G A;  4JKV A;  1OQC A;  3W2W A;  4AX2 A;  1GS9 A;  1M57 C;  3GM3 A;  1WWP A;  3TK0 A;  3RVY A;  1FNT c;  2Q3T A;  4DVY P;  2FFH A;  3C8G A;  2OEX A;  2FAP B;  2WZL A;  3DKA A;  1ZHZ A;  3MX3 A;  2PX0 A;  1BR4 A;  3TOL A;  2XS8 A;  1M2V B;  1OW7 A;  2MHR A;  1VB5 A;  1T6Q A;  2Q9B A;  1W2W A;  2R03 A;  2XLD A;  4I44 A;  3HNL A;  2E87 A;  4KI2 A;  3ZTZ A;  2BE5 F;  2CYD A;  2WVQ A;  2IM8 A;  3A11 A;  3LES A;  4U5F E;  1I4Z A;  4YJW A;  4OIR F;  3S28 A;  3W2V A;  3AG4 C;  4O6M A;  1GQA A;  3I5Q A;  3U3B A;  2GA0 A;  3OA1 A;  4PJN A;  2NG1 A;  5JS5 A;  1BDJ B;  4JTA B;  4JEA A;  2VCB A;  5FCL A;  5JUA A;  4EBK A;  2NSF A;  3C62 A;  5T1D B;  1BZ4 A;  3KKB A;  1FFT C;  2J7P A;  4BEM J;  1T5O A;  3K1H A;  3V5Y A;  4CS8 C;  3W8H A;  1OCO C;  5EHH A;  4PJJ A;  1PD1 A;  3DMD A;  4N4W A;  4CJG A;  5KYU B;  3ZSU A;  4CBE A;  3Q7L A;  4CJO A;  1YA7 O;  1BR1 A;  3G50 A;  1VYI A;  1WAS A;  2QTV A;  3LEV A;  1MNE A;  3LLK A;  5F28 E;  2KC3 A;  5AC5 A;  5DS5 A;  3T4R A;  3ZQV A;  5KYY A;  3V5X A;  3U2L A;  1FMW A;  1YYX A;  2W9Y A;  4FWV A;  2YWA A;  1Z3I X;  4MVM A;  4KNW A;  1G5Z A;  4E7Z A;  2IXM A;  1FR0 A;  2LIG A;  3DM5 A;  3W8I A;  1O3U A;  2LFD A;  3LAY A;  4BJ5 A;  4JJG A;  3IPM O;  5JVE A;  1ZW2 A;  4MND A;  4GYT A;  2R02 A;  3OWT A;  4Z9I A;  3HNJ A;  4G7O F;  2EIK C;  2C03 A;  2XL6 A;  3FHD A;  1YJG A;  2EPN A;  3K1I C;  3NMI A;  3QVY A;  3ZTM A;  1V54 C;  3T6B A;  1EA8 A;  4A4A A;  2YL7 A;  2NUP B;  5T3T A;  5IY5 C;  3JRT A;  1FFH A;  2J9W A;  3ECS A;  2F22 A;  3DAF A;  2YL0 A;  3ABK C;  3C8G D;  4JCZ A;  1JR8 A;  4DXW A;  1RKE A;  1FAP B;  4GQH A;  3FVY A;  4W8P A;  1JOG A;  2DYS C;  1TR2 A;  2LCH A;  4Z9H A;  3WOD F;  4K7B A;  1HW2 A;  4JJF A;  3ABM C;  2EIL C;  2A6H F;  3DAG A;  4I3M A;  1K04 A;  5BQG A;  4NQF A;  2AP3 A;  3N2Z B;  1DOV A;  3IEE A;  4YN0 B;  4BJ1 A;  4DRJ B;  1OKK A;  1D0X A;  2VB6 A;  4WGY A;  4DVZ A;  3H2U A;  3S90 A;  3FOO A;  3QW0 A;  3O39 A;  3AG2 C;  2JPU A;  2OJQ A;  5D91 A;  3HLZ A;  3Q6M A;  5T3W A;  4BJ5 C;  2CW0 F;  4E17 A;  4CIP A;  4Z9J A;  1A41 A;  3PDM P;  4NC3 A;  3ITF A;  4JC7 A;  5L3V A;  3C7J A;  2B0J A;  1HW1 A;  3B0U X;  2R7T A;  1G8X A;  1TKN A;  4E7S A;  3DI5 A;  1KU2 A;  4U5E E;  2L6F A;  2J7P D;  4NTF A;  2XL4 A;  1XZQ A;  3IQC A;  3KMI A;  3UGO A;  3L0I A;  3T6G B;  1M6T A;  3CAX A;  3EFO B;  3CQZ A;  2LD6 A;  3EZH A;  1HY5 A;  1E2X A;  2HS5 A;  2A0B A;  2XM4 A;  3K33 A;  1SR2 A;  2FGY A;  2GWW A;  1NZE A;  2HV7 A;  1NSG B;  2XM0 A;  2Q00 A;  1OXK A;  1UFB A;  1VMA A;  1HMO A;  1M2O A;  3TJ5 A;  4C3B A;  5D92 A;  3W4Y A;  2AWY A;  4O79 A; 
#chains in the Genus database with same CATH homology
 1WOL A;  2LK4 A;  2JPU A;  4EBK A;  4EBJ A;  1OW8 A;  4XEF A;  3U3F A;  1KTM A;  4XEK A;  1WTY A;  3GM3 A;  1WWP A;  3K7D A;  3C8G A;  3L8I A;  1OW6 A;  4R32 A;  1ZZP A;  1KNY A;  2HSB A;  3RQE A;  1OW7 A;  2L6F A;  3BRJ A;  3B71 A;  3JYY A;  3AJM A;  1PV3 A;  3JZ0 A;  3U0C A;  3S9O A;  1K40 A;  3GM2 A;  2JX0 A;  3C18 A;  2L6H A;  1QVX A;  3C8G D;  3L8J A;  3O10 A;  1K05 A;  1V4A A;  2L6G A;  5F28 E;  3RQF A;  4XEV A;  1JOG A;  3RQG A;  3MFN A;  3TUL A;  2YWA A;  1K04 A;  3C8G B;  2Q00 A;  4NQF A;  1UFB A;  3GM1 A;  2KK1 A;  2PBE A;  1O3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...