4XEFA

Pyk2-fat complexed with leupaxin ld motif ld1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
136
structure length
136
Chain Sequence
MANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein-tyrosine kinase 2-beta
publication title Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 56
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4xefA00
2PBEA 3RQFA 3RQGA 1UFBA 3C8GB 3U0CA 5F28E 1K04A 2JPUA 2KK1A 3C18A 3TULA 1JOGA 1OW8A 3B71A 4XEVA 4NQFA 4R32A 2HSBA 2YWAA 3U3FA 1OW7A 1OW6A 1KNYA 2L6HA 3RQEA 1PV3A 1WOLA 1V4AA 3GM2A 1ZZPA 4XEFA 4EBKA 1WWPA 2L6GA 1K40A 3BRJA 3MFNA 3O10A 4EBJA 3JZ0A 1KTMA 3C8GA 3L8IA 1K05A 4XEKA 3AJMA 2L6FA 1QVXA 2JX0A 2LK4A 2Q00A 3GM3A 3JYYA 3S9OA 1O3UA 3GM1A 3K7DA 3L8JA 1WTYA 3C8GD
chains in the Genus database with same CATH superfamily
2KJGA 4I1MA 4JZAA 1NLXA 1UFBA 5JSLA 3QVYA 1GGQA 2YEVA 4Q7CA 4XQ1A 3TULA 2GFHA 2L81A 4FAPB 1YA7O 2FAPB 1HW2A 3UGOA 4MW3A 1E85A 1MMGA 3ATPA 1T6QA 3K1IC 5DS4A 2NPUA 4YK5A 2J9UA 1OKKD 3C63A 3TOLA 4LDKA 2OEXA 3QW1A 1L7CA 1LM3B 1WOLA 2KNHA 3W2WA 3GWLA 1TKNA 2ZD9A 4AX2A 1Q0DA 4BJ5C 1S05A 3EG9A 3UMHA 4CIHA 2G62A 3W2VA 3I4UA 3AG4C 2HKVA 4CJOA 1YA9A 5B3IA 5JP7A 4O6MA 5KYWA 2YL7A 1LI7A 4JIOA 4YT4A 4G7HF 1C02A 5T1DB 4DVZA 4GYTA 1D0YA 4MW8A 2NSFA 3K7DA 3O39A 1WTYA 4D4XA 1Y4CA 1F1MA 1MNDA 2IOQA 4YL3A 1QSPA 2YLDA 2B0JA 3VF0A 4K1OA 3W4YA 4PJNA 3ZWIA 5DS5A 3FMSA 2OKUA 2HS5A 3SYNA 3ECSA 1Z5ZA 3R7CA 2GDCA 3EPVA 2Y3DA 3DD7A 4AE4A 3M1CB 1PCXA 3F46A 5KYUB 4O7GA 5T3WA 1YZCA 3F47A 3PMRA 2XLHA 1TFKB 3BEHA 1OXBA 2QTVA 1HMOA 1FAPB 1TWGA 3G4XA 4JTCB 3MYFA 4JE9A 3N0TA 2NUTB 3V7OA 2LD6A 4YT8A 2TMVP 2YHSA 1L3PA 2J46A 3KPHA 1NG1A 1FMWA 1QLEC 2XLMA 3C62A 3JTLO 4UDVA 1VOMA 2OQMA 3O6XA 4JC7A 4CSAC 2R7VA 3Q6MA 3EZHA 1SYQA 2DYRC 2A1DD 4W8KA 4GQHA 4HE8D 3NDBB 1NU9C 4AL1A 5K0IA 2C04A 3KYIA 1MQVA 1OCOC 4WJ0A 1T6IA 1QZXA 3NYMA 4YWQA 5FCLA 4C3DA 1FNTc 3X1OA 3R2PA 4BJ6A 2CNWA 4U5EE 2X51A 5BQHA 2AU5A 3DJNB 3EJNA 3U2LA 3T6GB 1ZW2A 1WWPA 2ZPAA 4WABA 2P61A 1JPJA 1LS1A 2VASA 2OJQA 1G5ZA 2M4EA 3ASNC 3OA1A 3LNMB 4ONSA 5E2QA 3SXKA 3U9JA 2EINC 2PNOA 4KBLA 3POVA 4JCHA 1KTMA 5DVWA 3SZRA 2L9JA 3MX3A 4ZLDA 2VCCA 2EPKX 4DOZA 2YVKA 1M2VB 3AGTA 3LUTB 4YL1A 4ZLCA 1A7VA 3ABLC 4OIQF 4DXWA 3EZIA 4MVUA 1V54C 4P9FA 2R7QA 1ZHXA 3DE9A 3DJUB 3RQFA 2R7TA 1ORJA 3H65A 3C8GB 4IJJA 3RQGA 2VB6A 3K1HA 1H6GA 2R9RB 3O55A 4JJFA 3RKOF 1D0XA 5KYUA 4EWCA 3FVYA 2I15A 4MS2A 5BQIA 1Y6DA 5FZTA 2ZXPA 3U3FA 1PV3A 2Z15A 2WZFA 1MMAA 4N06A 3TJ5A 5A6BA 2R7UA 1VB5A 4LLEA 1ZZPA 4MVSA 1XZQA 2CNWD 4U5BE 3U8PA 1HY5A 4HFFB 4YT5A 1E86A 3QTHA 1H9TA 4CS7A 5HV9A 3LESA 3AOUA 4FESA 5L0HA 3HNKA 2WVQA 3S28A 4Q4ZF 1U89A 3S84A 4H54A 3WG7C 3J06A 2FFHA 4JTDB 4QI2A 1IZMA 3X2QC 4OIRF 1VTMP 4XPYA 1LI5A 4NTBA 3AQCA 4OD4A 2A0UA 3VYWA 2XSEA 1TFOB 1VYIA 1TWHA 5KYWB 2JPUA 2BL2A 2KK1A 1APCA 1HW1A 3T6JA 4QDLA 3LEOA 2XLDA 5L0IA 2HSBA 2XM4A 2YWAA 2Q9AA 4EHPA 1OR3A 2HMQA 2LFFA 2R05A 1WN0A 3JT1A 3NYJA 4HEAJ 4JVSA 4MVMA 4XTKA 3TQOA 3CZ6A 2J9WA 1M2VA 4IGGA 4EBKA 1K40A 3CAXA 3G4ZA 2QLAA 1ZW3A 3NMJA 1ST6A 5A6BD 2YLGA 3OWTA 2M64A 1OCRC 4U9DA 4E18A 3TJ6A 5BQGA 3ITFA 5T3TA 2XRHA 4PK4A 4G7OF 1QVXA 2HFIA 1ORYA 1ZVZA 1WATA 2R25A 3EQLF 4AE4B 4PJLA 4CX9A 4EIYA 2V3CC 2W45A 2ZXOA 4I3MA 2GAQA 4CDYA 2R03A 4KI2A 3B0UX 4P9TA 4IRUA 4P6IC 1RKCA 1VLTA 1ZHWA 1ZHTA 1Q0MA 2PX0A 3NKEA 5CI9A 2AWCA 3ZTMA 2HV7A 2DYSC 4CSAA 3ABMC 3S27A 3IQCA 256BA 3VM6A 1UG7A 2EPOA 2OJED 3V5ZA 2HSQA 3MLGA 1I4ZA 1VMAA 3HNLA 2YL0A 4U5DE 4DJ9A 3M15A 3U9MA 4CDAA 3E70C 3O10A 2PFDA 2J9VA 1R4TA 2IM8A 2PP4A 3E9VA 4EBJA 1OR2A 1C03A 5L0JA 2ASRA 4LDQA 4C7OA 5E3CA 3WAQA 2V26A 5HSWA 3NMKA 4FX5A 2XM0A 1NBBA 3GM1A 3NRHA 2A6EF 1RKEA 2YQYA 4EBBA 3C8GD 1BZ4A 1SF8A 3OEOA 3EHMA 3EGXA 1JPNA 2Q3TA 1YYJA 4BPMA 3U0CA 2IXOA 3W8IA 2HJMA 4X0RA 2YLIA 3RIPA 1I4YA 5B1BC 2IXMA 2AWYA 3JYHA 2W4MA 3RQEA 3B0PA 3VRCA 2YRFA 4MVQA 5JT4A 4Z9HA 2W9YA 1RMVA 1FR0A 3GEEA 1AUEA 5B3SC 3C8ZA 4MNDA 3BRJA 4BEJA 1NFOA 1T5OA 3DE8A 3HNJA 4MVRA 1D1CA 2EILC 5AC5A 2XLVA 3HLZA 3GM3A 2OCCC 3ZC4A 1ZU4A 1OQCA 4NTFA 3S9OA 4Q5SF 1O87A 3DMDA 3ZDLA 2HUJA 1DOWA 4OIOF 4B6IA 3KL4A 1FFHA 1A41A 4DRIB 3RVZA 1LKXA 1J8YF 1YYXA 4MTOA 1DOVA 3TOMA 2LQGA 5F28E 4ANJA 4BEMJ 4XWJA 2Q7RA 1E84A 2OU6A 4WGZA 3ZG1A 4NQFA 3FOOA 1M6TA 1TR2A 2IBFA 4MVOA 4PR9A 5L3QA 1AEPA 3GODA 3IEEA 3U2MA 1GQAA 2P6VA 3LJBA 3KMIA 4CDVA 5COFA 4K0DA 5E3AA 5KYXB 2E87A 1QQ3A 1Z3IX 4JJGA 4CIPA 4JW1A 5DS6A 1K05A 3JCUQ 4RD9A 1U0BB 2BC5A 3B0VC 4W8PA 2C03A 1Q0KA 2PX3A 2XLOA 2LK4A 4I44A 1D0ZA 1JAFA 1RJ9B 2B0HA 2OOCA 4LACB 4DRJB 5BUOA 1S7ZA 4G7ZF 4YJWA 3L8IA 1WGWA 3Q7LA 1MNEA 2EIMC 2J7PA 4LDRA 2J0WA 3Q6NA 1JOGA 2GA0A 1RXQA 3RH3A 3V5XA 4CS9A 4GEHA 3U5SA 4J7YA 2KC3A 2R7OA 2R02A 2VC9A 2WL8A 3DAGA 1Z23A 3M4CA 1EKYA 3I5PA 3JRTA 1LPEA 4ULVA 3K33A 4PJJA 1YLMA 4DBRA 2Y69C 3DI5A 3NYLA 3JZ0A 4CS8A 5L3VA 1MMNA 4O6YA 5JLIA 3AQBA 3HTKC 4G0HA 2DI3A 3CSKA 2UUHA 3QVZA 2JX0A 4FWVA 5KYYA 5JS5A 3JYYA 2JD3A 4I1OB 1FFTC 5DQZA 4NCQA 1TQGA 4C7OB 1FMVA 4ULWA 2UUIA 5F5FA 1BR2A 4ER9A 5KYXA 3UNGC 3RYLA 5DQTA 1HMDA 1RKEB 3IQ6A 1CGNA 1OW7A 1VLSA 2J7PD 3LS0A 1TWCA 3LS1A 3SEOA 3EGXB 3TK0A 4BJ5A 4BJ6C 1EI7A 1LE4A 2EPMX 2H8AA 1ZHZA 2XL6A 1J8MF 1E2XA 3I5QA 1G4US 2A6HF 2J9BA 3C7JA 4YN0B 4BJ1A 1RJ9A 3CQZA 1W2WA 4E7SA 3EH2A 2R7SA 4N6HA 1EQ1A 5L0DA 2MHRA 3ASOC 4XEKA 3RF3A 4CBEA 1OCZC 2ZXWC 3LLKA 2XXAB 4KNVA 1PD0A 1ZHYA 3NMIA 3AGUA 4C3BA 1LE2A 2HV6A 2DGJA 2EPLX 3ZVRA 3HKKA 4MTGA 5E33A 1D1BA 4DRHB 4DBQA 3M79A 4PFOA 4XEVA 1YAUO 4IWBA 4JEAA 4M63A 1JR8A 2QNLA 1NZEA 3G50A 1KNYA 4OINF 3GEIA 3SXZA 3UMKA 4CS9C 5L0FA 2X0CA 1XZPA 1V4AA 1T6UA 3GM2A 3IQTA 3WHNA 4MQ9F 4XPWA 1CPQA 1XWJA 3FOPA 3MFNA 5DLJA 3FAPB 4J7TA 4K7BA 4EUKB 1LS4A 4MTFA 3ZSUA 1HE1A 2YL1A 2WVNA 2IXPA 3LEVA 4LERA 4CS8C 4JRZA 3K6BA 3U8VA 1TWAA 2Q9BA 3LAYA 4U9EA 3V5YA 3ZIBA 1NU7D 1R5ID 1M56C 2I8BA 2KSFA 3L0IA 4L6RA 4JCZA 1CGOA 3L1MA 1V55C 3N24A 4E17A 2DB4A 4A4AA 1A0BA 2NG1A 4D4NA 2OEVA 4LLCA 2ETSA 1NSGB 4YT2A 3ZTZA 2Y3HA 1H7IA 4E0IA 4R32A 3HJCA 1BBHA 2CCYA 1BDJB 3KKBA 4Z9IA 1U6HA 3UMIA 2Y39A 1M2OA 1O5HA 2XXAA 2BE5F 2KGOA 3QMKA 4AK9A 4RDAA 2Y3BA 4DVYP 3K66A 3AG1C 4XPXA 1CGME 1YZAA 4QI0A 2GWWA 2Q9CA 1B68A 3QZCA 2NSGA 4N6CA 4E0HA 3KH2A 4G78A 1JMWA 2L6FA 1N1CA 2Q00A 3T6BA 1KU2A 3RVYA 3UR3C 2Y3GA 2G3VA 4IB4A 3GANA 2J0XA 5KYNA 1EA8A 1LVKA 3N2ZB 3RFYA 2LCHA 2YZSA 2RD9A 2L7AA 1GS9A 3GEHA 1T9KA 4YL0A 3U3BA 2XL4A 5COMA 2CYDA 3C18A 3NKDA 3WODF 1OW8A 3B71A 5L0GA 5KYYB 1NFNA 5A69A 2O9XA 2NUPA 2FGYA 2J45A 2P0NA 3PCVA 4H4KC 2VCAA 4C3EA 2LIGA 5COGA 4EKWA 5EGYA 1A7DA 4BG0A 3FXHA 4J32B 4NTAA 1ORSC 4U5CE 2L6GA 3GORA 4CJGA 3SP1A 3MYIA 2LP4A 2EPNA 2RSEB 5CIVA 2WZLA 1E83A 1SR2A 1Z6AA 2KQ9A 2OG2A 5B1AC 3AJMA 4RBNA 4OIPF 1WASA 3CEXA 5F5HA 2D5RB 2HJ3A 3DM5A 3IQ5A 2LFDA 1V74B 4OD5A 3JRMO 2F22A 2HMZA 2QY9A 2KW3C 3DZAA 3DXJF 1LIHA 3FAJA 3T9OA 1YDIA 4U5HA 2P1AA 3EFOB 1SZIA 2XLWA 4N4WA 5EK0A 4AL0A 5JVEA 2R7WA 1FTSA 2MYSA 4NY3A 2W4BA 3US6A 1OW6A 3EH1A 2L6HA 1Z7Qc 3SXYA 3HNIA 4XEFA 3ZQYA 4BJTA 1Q0GA 2R7XA 4XLNF 4U5FE 5D91A 4HFKB 3L34A 2H7VC 2H7OA 3JSZA 5AC4A 2XS8A 3MBGA 1H9GA 4IARA 2R7RA 3FHDA 4O79A 3ABKC 1YJGA 1AVOB 2A68F 1GM5A 3Q7GA 3SNHA 2QE9A 2MWQA 3TD7A 2CDQA 3RW0A 3IHUA 4IAOA 4PJMA 2YL3A 1Q0FA 1YARO 2IXNA 3B9QA 5TJ5E 3A9CA 2Q4FA 4PFPA 1PD1A 5JRAA 3EGDB 3K1IA 2XLEA 3AG3C 5EHHA 4MVZA 1IW7F 2VH3A 1BR4A 3DM9B 2HZ8A 3AG2C 2NUTA 4Z9JA 1T01A 4JEBA 1QKRA 2WZGA 3DWWA 3FDQA 3M4BA 2G3KA 2YKZA 4KNWA 2A0BA 1VK5A 5D92A 3LLIA 2D4UA 2A69F 1MMDA 4WGYA 2LSEA 3EHNA 3PHF2 2ZXRA 4XLPF 2EIKC 5CI8A 3S0XA 3NG1A 5AGFA 2J8WA 2AP3A 3EFOA 3ZQVA 3EG9B 5A6KA 3VAYA 3L8JA 2XL8A 3A11A 1HE9A 2KYHA 1RCPA 2PBEA 1C17M 3H2UA 3S90A 3QW0A 2CW0F 2QUPA 1OKKA 1A7EA 1K04A 4KC9A 4PACA 3W8HA 3LNRA 4A2NB 4JTAB 3T4RA 2H7BA 1BR1A 2CGEA 1YVIA 3GWNA 4NC3A 5IY5C 5JUAA 1OCCC 2XS1A 1SMYF 1G4WR 5L0CA 5GPGB 2VCBA 1QPUA 3DAFA 4J30B 4O6NA 1JRAA 1ZU5A 5A6JA 3SXMA 3PDMP 2P7VA 1M57C 3H2VA 2NUPB 3UGPA 1CPRA 2EIJC 4IAQA 2IYLD 1G8XA 1OXKA 5A6AA 3C8GA 3JSEO 3KYJA 1D1AA 4JKVA 3S29A 2AVKA 1ZYRF 3IPMO 4JURI 1I5NA 3EGDA 1VYKA 1O3UA 2ICWG 2WVOA 3DKAA 2WB7A 4F4BA 4E7ZA 4U5GA 1Z63A 2PF4E 3B29A
chains in the Genus database with same CATH topology
2PBEA 3RQFA 3RQGA 1UFBA 3C8GB 3U0CA 5F28E 1K04A 2JPUA 2KK1A 3C18A 3TULA 1JOGA 1OW8A 3B71A 4XEVA 4NQFA 4R32A 2HSBA 2YWAA 3U3FA 1OW7A 1OW6A 1KNYA 2L6HA 3RQEA 1PV3A 1WOLA 1V4AA 3GM2A 1ZZPA 4XEFA 4EBKA 1WWPA 2L6GA 1K40A 3BRJA 3MFNA 3O10A 4EBJA 3JZ0A 1KTMA 3C8GA 3L8IA 1K05A 4XEKA 3AJMA 2L6FA 1QVXA 2JX0A 2LK4A 2Q00A 3GM3A 3JYYA 3S9OA 1O3UA 3GM1A 3K7DA 3L8JA 1WTYA 3C8GD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBE A;  3RQF A;  3RQG A;  1UFB A;  3C8G B;  3U0C A;  5F28 E;  1K04 A;  2JPU A;  2KK1 A;  3C18 A;  3TUL A;  1JOG A;  1OW8 A;  3B71 A;  4XEV A;  4NQF A;  4R32 A;  2HSB A;  2YWA A;  3U3F A;  1OW7 A;  1OW6 A;  1KNY A;  2L6H A;  3RQE A;  1PV3 A;  1WOL A;  1V4A A;  3GM2 A;  1ZZP A;  4XEF A;  4EBK A;  1WWP A;  2L6G A;  1K40 A;  3BRJ A;  3MFN A;  3O10 A;  4EBJ A;  3JZ0 A;  1KTM A;  3C8G A;  3L8I A;  1K05 A;  4XEK A;  3AJM A;  2L6F A;  1QVX A;  2JX0 A;  2LK4 A;  2Q00 A;  3GM3 A;  3JYY A;  3S9O A;  1O3U A;  3GM1 A;  3K7D A;  3L8J A;  1WTY A;  3C8G D; 
#chains in the Genus database with same CATH topology
 2KJG A;  4I1M A;  4JZA A;  1NLX A;  1UFB A;  5JSL A;  3QVY A;  1GGQ A;  2YEV A;  4Q7C A;  4XQ1 A;  3TUL A;  2GFH A;  2L81 A;  4FAP B;  1YA7 O;  2FAP B;  1HW2 A;  3UGO A;  4MW3 A;  1E85 A;  1MMG A;  3ATP A;  1T6Q A;  3K1I C;  5DS4 A;  2NPU A;  4YK5 A;  2J9U A;  1OKK D;  3C63 A;  3TOL A;  4LDK A;  2OEX A;  3QW1 A;  1L7C A;  1LM3 B;  1WOL A;  2KNH A;  3W2W A;  3GWL A;  1TKN A;  2ZD9 A;  4AX2 A;  1Q0D A;  4BJ5 C;  1S05 A;  3EG9 A;  3UMH A;  4CIH A;  2G62 A;  3W2V A;  3I4U A;  3AG4 C;  2HKV A;  4CJO A;  1YA9 A;  5B3I A;  5JP7 A;  4O6M A;  5KYW A;  2YL7 A;  1LI7 A;  4JIO A;  4YT4 A;  4G7H F;  1C02 A;  5T1D B;  4DVZ A;  4GYT A;  1D0Y A;  4MW8 A;  2NSF A;  3K7D A;  3O39 A;  1WTY A;  4D4X A;  1Y4C A;  1F1M A;  1MND A;  2IOQ A;  4YL3 A;  1QSP A;  2YLD A;  2B0J A;  3VF0 A;  4K1O A;  3W4Y A;  4PJN A;  3ZWI A;  5DS5 A;  3FMS A;  2OKU A;  2HS5 A;  3SYN A;  3ECS A;  1Z5Z A;  3R7C A;  2GDC A;  3EPV A;  2Y3D A;  3DD7 A;  4AE4 A;  3M1C B;  1PCX A;  3F46 A;  5KYU B;  4O7G A;  5T3W A;  1YZC A;  3F47 A;  3PMR A;  2XLH A;  1TFK B;  3BEH A;  1OXB A;  2QTV A;  1HMO A;  1FAP B;  1TWG A;  3G4X A;  4JTC B;  3MYF A;  4JE9 A;  3N0T A;  2NUT B;  3V7O A;  2LD6 A;  4YT8 A;  2TMV P;  2YHS A;  1L3P A;  2J46 A;  3KPH A;  1NG1 A;  1FMW A;  1QLE C;  2XLM A;  3C62 A;  3JTL O;  4UDV A;  1VOM A;  2OQM A;  3O6X A;  4JC7 A;  4CSA C;  2R7V A;  3Q6M A;  3EZH A;  1SYQ A;  2DYR C;  2A1D D;  4W8K A;  4GQH A;  4HE8 D;  3NDB B;  1NU9 C;  4AL1 A;  5K0I A;  2C04 A;  3KYI A;  1MQV A;  1OCO C;  4WJ0 A;  1T6I A;  1QZX A;  3NYM A;  4YWQ A;  5FCL A;  4C3D A;  1FNT c;  3X1O A;  3R2P A;  4BJ6 A;  2CNW A;  4U5E E;  2X51 A;  5BQH A;  2AU5 A;  3DJN B;  3EJN A;  3U2L A;  3T6G B;  1ZW2 A;  1WWP A;  2ZPA A;  4WAB A;  2P61 A;  1JPJ A;  1LS1 A;  2VAS A;  2OJQ A;  1G5Z A;  2M4E A;  3ASN C;  3OA1 A;  3LNM B;  4ONS A;  5E2Q A;  3SXK A;  3U9J A;  2EIN C;  2PNO A;  4KBL A;  3POV A;  4JCH A;  1KTM A;  5DVW A;  3SZR A;  2L9J A;  3MX3 A;  4ZLD A;  2VCC A;  2EPK X;  4DOZ A;  2YVK A;  1M2V B;  3AGT A;  3LUT B;  4YL1 A;  4ZLC A;  1A7V A;  3ABL C;  4OIQ F;  4DXW A;  3EZI A;  4MVU A;  1V54 C;  4P9F A;  2R7Q A;  1ZHX A;  3DE9 A;  3DJU B;  3RQF A;  2R7T A;  1ORJ A;  3H65 A;  3C8G B;  4IJJ A;  3RQG A;  2VB6 A;  3K1H A;  1H6G A;  2R9R B;  3O55 A;  4JJF A;  3RKO F;  1D0X A;  5KYU A;  4EWC A;  3FVY A;  2I15 A;  4MS2 A;  5BQI A;  1Y6D A;  5FZT A;  2ZXP A;  3U3F A;  1PV3 A;  2Z15 A;  2WZF A;  1MMA A;  4N06 A;  3TJ5 A;  5A6B A;  2R7U A;  1VB5 A;  4LLE A;  1ZZP A;  4MVS A;  1XZQ A;  2CNW D;  4U5B E;  3U8P A;  1HY5 A;  4HFF B;  4YT5 A;  1E86 A;  3QTH A;  1H9T A;  4CS7 A;  5HV9 A;  3LES A;  3AOU A;  4FES A;  5L0H A;  3HNK A;  2WVQ A;  3S28 A;  4Q4Z F;  1U89 A;  3S84 A;  4H54 A;  3WG7 C;  3J06 A;  2FFH A;  4JTD B;  4QI2 A;  1IZM A;  3X2Q C;  4OIR F;  1VTM P;  4XPY A;  1LI5 A;  4NTB A;  3AQC A;  4OD4 A;  2A0U A;  3VYW A;  2XSE A;  1TFO B;  1VYI A;  1TWH A;  5KYW B;  2JPU A;  2BL2 A;  2KK1 A;  1APC A;  1HW1 A;  3T6J A;  4QDL A;  3LEO A;  2XLD A;  5L0I A;  2HSB A;  2XM4 A;  2YWA A;  2Q9A A;  4EHP A;  1OR3 A;  2HMQ A;  2LFF A;  2R05 A;  1WN0 A;  3JT1 A;  3NYJ A;  4HEA J;  4JVS A;  4MVM A;  4XTK A;  3TQO A;  3CZ6 A;  2J9W A;  1M2V A;  4IGG A;  4EBK A;  1K40 A;  3CAX A;  3G4Z A;  2QLA A;  1ZW3 A;  3NMJ A;  1ST6 A;  5A6B D;  2YLG A;  3OWT A;  2M64 A;  1OCR C;  4U9D A;  4E18 A;  3TJ6 A;  5BQG A;  3ITF A;  5T3T A;  2XRH A;  4PK4 A;  4G7O F;  1QVX A;  2HFI A;  1ORY A;  1ZVZ A;  1WAT A;  2R25 A;  3EQL F;  4AE4 B;  4PJL A;  4CX9 A;  4EIY A;  2V3C C;  2W45 A;  2ZXO A;  4I3M A;  2GAQ A;  4CDY A;  2R03 A;  4KI2 A;  3B0U X;  4P9T A;  4IRU A;  4P6I C;  1RKC A;  1VLT A;  1ZHW A;  1ZHT A;  1Q0M A;  2PX0 A;  3NKE A;  5CI9 A;  2AWC A;  3ZTM A;  2HV7 A;  2DYS C;  4CSA A;  3ABM C;  3S27 A;  3IQC A;  256B A;  3VM6 A;  1UG7 A;  2EPO A;  2OJE D;  3V5Z A;  2HSQ A;  3MLG A;  1I4Z A;  1VMA A;  3HNL A;  2YL0 A;  4U5D E;  4DJ9 A;  3M15 A;  3U9M A;  4CDA A;  3E70 C;  3O10 A;  2PFD A;  2J9V A;  1R4T A;  2IM8 A;  2PP4 A;  3E9V A;  4EBJ A;  1OR2 A;  1C03 A;  5L0J A;  2ASR A;  4LDQ A;  4C7O A;  5E3C A;  3WAQ A;  2V26 A;  5HSW A;  3NMK A;  4FX5 A;  2XM0 A;  1NBB A;  3GM1 A;  3NRH A;  2A6E F;  1RKE A;  2YQY A;  4EBB A;  3C8G D;  1BZ4 A;  1SF8 A;  3OEO A;  3EHM A;  3EGX A;  1JPN A;  2Q3T A;  1YYJ A;  4BPM A;  3U0C A;  2IXO A;  3W8I A;  2HJM A;  4X0R A;  2YLI A;  3RIP A;  1I4Y A;  5B1B C;  2IXM A;  2AWY A;  3JYH A;  2W4M A;  3RQE A;  3B0P A;  3VRC A;  2YRF A;  4MVQ A;  5JT4 A;  4Z9H A;  2W9Y A;  1RMV A;  1FR0 A;  3GEE A;  1AUE A;  5B3S C;  3C8Z A;  4MND A;  3BRJ A;  4BEJ A;  1NFO A;  1T5O A;  3DE8 A;  3HNJ A;  4MVR A;  1D1C A;  2EIL C;  5AC5 A;  2XLV A;  3HLZ A;  3GM3 A;  2OCC C;  3ZC4 A;  1ZU4 A;  1OQC A;  4NTF A;  3S9O A;  4Q5S F;  1O87 A;  3DMD A;  3ZDL A;  2HUJ A;  1DOW A;  4OIO F;  4B6I A;  3KL4 A;  1FFH A;  1A41 A;  4DRI B;  3RVZ A;  1LKX A;  1J8Y F;  1YYX A;  4MTO A;  1DOV A;  3TOM A;  2LQG A;  5F28 E;  4ANJ A;  4BEM J;  4XWJ A;  2Q7R A;  1E84 A;  2OU6 A;  4WGZ A;  3ZG1 A;  4NQF A;  3FOO A;  1M6T A;  1TR2 A;  2IBF A;  4MVO A;  4PR9 A;  5L3Q A;  1AEP A;  3GOD A;  3IEE A;  3U2M A;  1GQA A;  2P6V A;  3LJB A;  3KMI A;  4CDV A;  5COF A;  4K0D A;  5E3A A;  5KYX B;  2E87 A;  1QQ3 A;  1Z3I X;  4JJG A;  4CIP A;  4JW1 A;  5DS6 A;  1K05 A;  3JCU Q;  4RD9 A;  1U0B B;  2BC5 A;  3B0V C;  4W8P A;  2C03 A;  1Q0K A;  2PX3 A;  2XLO A;  2LK4 A;  4I44 A;  1D0Z A;  1JAF A;  1RJ9 B;  2B0H A;  2OOC A;  4LAC B;  4DRJ B;  5BUO A;  1S7Z A;  4G7Z F;  4YJW A;  3L8I A;  1WGW A;  3Q7L A;  1MNE A;  2EIM C;  2J7P A;  4LDR A;  2J0W A;  3Q6N A;  1JOG A;  2GA0 A;  1RXQ A;  3RH3 A;  3V5X A;  4CS9 A;  4GEH A;  3U5S A;  4J7Y A;  2KC3 A;  2R7O A;  2R02 A;  2VC9 A;  2WL8 A;  3DAG A;  1Z23 A;  3M4C A;  1EKY A;  3I5P A;  3JRT A;  1LPE A;  4ULV A;  3K33 A;  4PJJ A;  1YLM A;  4DBR A;  2Y69 C;  3DI5 A;  3NYL A;  3JZ0 A;  4CS8 A;  5L3V A;  1MMN A;  4O6Y A;  5JLI A;  3AQB A;  3HTK C;  4G0H A;  2DI3 A;  3CSK A;  2UUH A;  3QVZ A;  2JX0 A;  4FWV A;  5KYY A;  5JS5 A;  3JYY A;  2JD3 A;  4I1O B;  1FFT C;  5DQZ A;  4NCQ A;  1TQG A;  4C7O B;  1FMV A;  4ULW A;  2UUI A;  5F5F A;  1BR2 A;  4ER9 A;  5KYX A;  3UNG C;  3RYL A;  5DQT A;  1HMD A;  1RKE B;  3IQ6 A;  1CGN A;  1OW7 A;  1VLS A;  2J7P D;  3LS0 A;  1TWC A;  3LS1 A;  3SEO A;  3EGX B;  3TK0 A;  4BJ5 A;  4BJ6 C;  1EI7 A;  1LE4 A;  2EPM X;  2H8A A;  1ZHZ A;  2XL6 A;  1J8M F;  1E2X A;  3I5Q A;  1G4U S;  2A6H F;  2J9B A;  3C7J A;  4YN0 B;  4BJ1 A;  1RJ9 A;  3CQZ A;  1W2W A;  4E7S A;  3EH2 A;  2R7S A;  4N6H A;  1EQ1 A;  5L0D A;  2MHR A;  3ASO C;  4XEK A;  3RF3 A;  4CBE A;  1OCZ C;  2ZXW C;  3LLK A;  2XXA B;  4KNV A;  1PD0 A;  1ZHY A;  3NMI A;  3AGU A;  4C3B A;  1LE2 A;  2HV6 A;  2DGJ A;  2EPL X;  3ZVR A;  3HKK A;  4MTG A;  5E33 A;  1D1B A;  4DRH B;  4DBQ A;  3M79 A;  4PFO A;  4XEV A;  1YAU O;  4IWB A;  4JEA A;  4M63 A;  1JR8 A;  2QNL A;  1NZE A;  3G50 A;  1KNY A;  4OIN F;  3GEI A;  3SXZ A;  3UMK A;  4CS9 C;  5L0F A;  2X0C A;  1XZP A;  1V4A A;  1T6U A;  3GM2 A;  3IQT A;  3WHN A;  4MQ9 F;  4XPW A;  1CPQ A;  1XWJ A;  3FOP A;  3MFN A;  5DLJ A;  3FAP B;  4J7T A;  4K7B A;  4EUK B;  1LS4 A;  4MTF A;  3ZSU A;  1HE1 A;  2YL1 A;  2WVN A;  2IXP A;  3LEV A;  4LER A;  4CS8 C;  4JRZ A;  3K6B A;  3U8V A;  1TWA A;  2Q9B A;  3LAY A;  4U9E A;  3V5Y A;  3ZIB A;  1NU7 D;  1R5I D;  1M56 C;  2I8B A;  2KSF A;  3L0I A;  4L6R A;  4JCZ A;  1CGO A;  3L1M A;  1V55 C;  3N24 A;  4E17 A;  2DB4 A;  4A4A A;  1A0B A;  2NG1 A;  4D4N A;  2OEV A;  4LLC A;  2ETS A;  1NSG B;  4YT2 A;  3ZTZ A;  2Y3H A;  1H7I A;  4E0I A;  4R32 A;  3HJC A;  1BBH A;  2CCY A;  1BDJ B;  3KKB A;  4Z9I A;  1U6H A;  3UMI A;  2Y39 A;  1M2O A;  1O5H A;  2XXA A;  2BE5 F;  2KGO A;  3QMK A;  4AK9 A;  4RDA A;  2Y3B A;  4DVY P;  3K66 A;  3AG1 C;  4XPX A;  1CGM E;  1YZA A;  4QI0 A;  2GWW A;  2Q9C A;  1B68 A;  3QZC A;  2NSG A;  4N6C A;  4E0H A;  3KH2 A;  4G78 A;  1JMW A;  2L6F A;  1N1C A;  2Q00 A;  3T6B A;  1KU2 A;  3RVY A;  3UR3 C;  2Y3G A;  2G3V A;  4IB4 A;  3GAN A;  2J0X A;  5KYN A;  1EA8 A;  1LVK A;  3N2Z B;  3RFY A;  2LCH A;  2YZS A;  2RD9 A;  2L7A A;  1GS9 A;  3GEH A;  1T9K A;  4YL0 A;  3U3B A;  2XL4 A;  5COM A;  2CYD A;  3C18 A;  3NKD A;  3WOD F;  1OW8 A;  3B71 A;  5L0G A;  5KYY B;  1NFN A;  5A69 A;  2O9X A;  2NUP A;  2FGY A;  2J45 A;  2P0N A;  3PCV A;  4H4K C;  2VCA A;  4C3E A;  2LIG A;  5COG A;  4EKW A;  5EGY A;  1A7D A;  4BG0 A;  3FXH A;  4J32 B;  4NTA A;  1ORS C;  4U5C E;  2L6G A;  3GOR A;  4CJG A;  3SP1 A;  3MYI A;  2LP4 A;  2EPN A;  2RSE B;  5CIV A;  2WZL A;  1E83 A;  1SR2 A;  1Z6A A;  2KQ9 A;  2OG2 A;  5B1A C;  3AJM A;  4RBN A;  4OIP F;  1WAS A;  3CEX A;  5F5H A;  2D5R B;  2HJ3 A;  3DM5 A;  3IQ5 A;  2LFD A;  1V74 B;  4OD5 A;  3JRM O;  2F22 A;  2HMZ A;  2QY9 A;  2KW3 C;  3DZA A;  3DXJ F;  1LIH A;  3FAJ A;  3T9O A;  1YDI A;  4U5H A;  2P1A A;  3EFO B;  1SZI A;  2XLW A;  4N4W A;  5EK0 A;  4AL0 A;  5JVE A;  2R7W A;  1FTS A;  2MYS A;  4NY3 A;  2W4B A;  3US6 A;  1OW6 A;  3EH1 A;  2L6H A;  1Z7Q c;  3SXY A;  3HNI A;  4XEF A;  3ZQY A;  4BJT A;  1Q0G A;  2R7X A;  4XLN F;  4U5F E;  5D91 A;  4HFK B;  3L34 A;  2H7V C;  2H7O A;  3JSZ A;  5AC4 A;  2XS8 A;  3MBG A;  1H9G A;  4IAR A;  2R7R A;  3FHD A;  4O79 A;  3ABK C;  1YJG A;  1AVO B;  2A68 F;  1GM5 A;  3Q7G A;  3SNH A;  2QE9 A;  2MWQ A;  3TD7 A;  2CDQ A;  3RW0 A;  3IHU A;  4IAO A;  4PJM A;  2YL3 A;  1Q0F A;  1YAR O;  2IXN A;  3B9Q A;  5TJ5 E;  3A9C A;  2Q4F A;  4PFP A;  1PD1 A;  5JRA A;  3EGD B;  3K1I A;  2XLE A;  3AG3 C;  5EHH A;  4MVZ A;  1IW7 F;  2VH3 A;  1BR4 A;  3DM9 B;  2HZ8 A;  3AG2 C;  2NUT A;  4Z9J A;  1T01 A;  4JEB A;  1QKR A;  2WZG A;  3DWW A;  3FDQ A;  3M4B A;  2G3K A;  2YKZ A;  4KNW A;  2A0B A;  1VK5 A;  5D92 A;  3LLI A;  2D4U A;  2A69 F;  1MMD A;  4WGY A;  2LSE A;  3EHN A;  3PHF 2;  2ZXR A;  4XLP F;  2EIK C;  5CI8 A;  3S0X A;  3NG1 A;  5AGF A;  2J8W A;  2AP3 A;  3EFO A;  3ZQV A;  3EG9 B;  5A6K A;  3VAY A;  3L8J A;  2XL8 A;  3A11 A;  1HE9 A;  2KYH A;  1RCP A;  2PBE A;  1C17 M;  3H2U A;  3S90 A;  3QW0 A;  2CW0 F;  2QUP A;  1OKK A;  1A7E A;  1K04 A;  4KC9 A;  4PAC A;  3W8H A;  3LNR A;  4A2N B;  4JTA B;  3T4R A;  2H7B A;  1BR1 A;  2CGE A;  1YVI A;  3GWN A;  4NC3 A;  5IY5 C;  5JUA A;  1OCC C;  2XS1 A;  1SMY F;  1G4W R;  5L0C A;  5GPG B;  2VCB A;  1QPU A;  3DAF A;  4J30 B;  4O6N A;  1JRA A;  1ZU5 A;  5A6J A;  3SXM A;  3PDM P;  2P7V A;  1M57 C;  3H2V A;  2NUP B;  3UGP A;  1CPR A;  2EIJ C;  4IAQ A;  2IYL D;  1G8X A;  1OXK A;  5A6A A;  3C8G A;  3JSE O;  3KYJ A;  1D1A A;  4JKV A;  3S29 A;  2AVK A;  1ZYR F;  3IPM O;  4JUR I;  1I5N A;  3EGD A;  1VYK A;  1O3U A;  2ICW G;  2WVO A;  3DKA A;  2WB7 A;  4F4B A;  4E7Z A;  4U5G A;  1Z63 A;  2PF4 E;  3B29 A; 
#chains in the Genus database with same CATH homology
 2PBE A;  3RQF A;  3RQG A;  1UFB A;  3C8G B;  3U0C A;  5F28 E;  1K04 A;  2JPU A;  2KK1 A;  3C18 A;  3TUL A;  1JOG A;  1OW8 A;  3B71 A;  4XEV A;  4NQF A;  4R32 A;  2HSB A;  2YWA A;  3U3F A;  1OW7 A;  1OW6 A;  1KNY A;  2L6H A;  3RQE A;  1PV3 A;  1WOL A;  1V4A A;  3GM2 A;  1ZZP A;  4XEF A;  4EBK A;  1WWP A;  2L6G A;  1K40 A;  3BRJ A;  3MFN A;  3O10 A;  4EBJ A;  3JZ0 A;  1KTM A;  3C8G A;  3L8I A;  1K05 A;  4XEK A;  3AJM A;  2L6F A;  1QVX A;  2JX0 A;  2LK4 A;  2Q00 A;  3GM3 A;  3JYY A;  3S9O A;  1O3U A;  3GM1 A;  3K7D A;  3L8J A;  1WTY A;  3C8G D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...