4XEFA

Pyk2-fat complexed with leupaxin ld motif ld1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
136
structure length
136
Chain Sequence
MANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Protein-tyrosine kinase 2-beta
total genus 56
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4xefA00
1KNYA 2YWAA 3U0CA 3L8JA 3O10A 1PV3A 2L6HA 1OW8A 1ZZPA 3BRJA 3RQEA 1QVXA 2Q00A 2LK4A 3AJMA 2L6FA 3C18A 1WTYA 2JX0A 1K40A 1JOGA 2JPUA 1WOLA 3B71A 5F28E 4EBKA 3RQFA 3MFNA 4EBJA 1UFBA 3JYYA 3K7DA 1OW6A 3C8GB 4R32A 1O3UA 3C8GA 1K05A 3RQGA 1OW7A 3L8IA 1KTMA 4XEVA 3JZ0A 2L6GA 3S9OA 3TULA 1V4AA 2KK1A 3GM1A 3GM3A 3U3FA 4NQFA 3C8GD 2PBEA 4XEKA 1WWPA 1K04A 2HSBA 3GM2A 4XEFA
chains in the Genus database with same CATH superfamily
1KNYA 4K7BA 3FOOA 3O10A 1SF8A 4MW3A 2YLIA 4B6IA 2WZLA 3BRJA 3Q7GA 4J7YA 4Z9JA 3VF0A 4BJTA 3K1HA 3O39A 4U9EA 4G7ZF 1G4US 3KL4A 5COMA 3B71A 4OD5A 5F28E 4FX5A 5KYUA 4G0HA 4DRHB 4CBEA 1HE1A 2NG1A 2NSGA 2MWQA 3MFNA 1UFBA 1Z7Qc 3S28A 4UDVA 4QI2A 3OWTA 4N06A 3IPMO 2FAPB 4I3MA 3WG7C 2ZXRA 1VB5A 3DD7A 4MVQA 4N4WA 2IBFA 3S27A 3HJCA 2GFHA 2LP4A 3Q6NA 3G4ZA 1ZVZA 3W2WA 4MQ9F 5A6AA 2XSEA 1Z6AA 2HS5A 2C03A 2GA0A 2XLDA 4P6IC 1XZPA 1LVKA 1Y6DA 2Q9CA 3N0TA 4I1OB 3FDQA 4MW8A 2Q9AA 5KYYB 2FGYA 4MVOA 2YZSA 2XM4A 3NMKA 1E83A 2DYSC 2NUPA 1JMWA 1WTYA 2JX0A 2JPUA 1OCRC 3O55A 4X0RA 3EHNA 3AG4C 1T5OA 4XPYA 2MYSA 2EPOA 4P9TA 4PFOA 3UGPA 2HV6A 3K7DA 2KSFA 2YVKA 3JRTA 3ZQYA 5KYWA 4AL0A 1ORYA 1JAFA 1OW7A 4JEAA 2I15A 1OR2A 2O9XA 2QNLA 4XTKA 4DVZA 3CSKA 1E84A 1IW7F 1QPUA 2R7UA 1NBBA 4MTGA 4EUKB 3AG3C 3LLKA 3GM3A 1EI7A 4BJ5C 1OXBA 4JJFA 2DGJA 2QE9A 3FXHA 4IAQA 3QVYA 2IXPA 3M1CB 1NSGB 3GORA 4FWVA 5BQGA 3SP1A 4AK9A 5FCLA 3S84A 4WABA 3JSEO 4XEFA 3IQTA 2J46A 4KNWA 4G7HF 1JPJA 3FOPA 1NLXA 1U89A 2J45A 1OW8A 2L81A 2OCCC 4D4XA 5DLJA 3RQEA 4BJ1A 2ZXOA 1QVXA 2C04A 4E7SA 1I4ZA 3C63A 2LIGA 5DQZA 1J8YF 2WVOA 4KC9A 3F46A 3T9OA 1JPNA 4EBJA 2XXAB 1ZHWA 4YT5A 2NUTB 5F5HA 5T3TA 1K05A 4CS7A 5E33A 2L7AA 2IOQA 2QTVA 3W8IA 2ZD9A 3EZHA 5A6KA 2AWYA 4DOZA 2XLOA 1NU9C 1A41A 2KW3C 1L7CA 2R7QA 2XL8A 3U3FA 3DJNB 1RJ9A 2B0JA 4DVYP 3MBGA 1N1CA 5IY5C 2ZXPA 4NQFA 2KNHA 3C8GD 3E70C 5DS5A 5L0HA 2WB7A 2VB6A 4XEKA 2YL1A 4K0DA 5T1DB 2V3CC 1EKYA 3T4RA 3AGTA 1ZU5A 1ZW3A 4AE4A 4CDYA 3NKEA 3SNHA 5KYYA 1TFKB 4W8PA 1QQ3A 4PFPA 3W2VA 4BEJA 1VK5A 1WASA 2LK4A 2P61A 3AJMA 4LLCA 1BR2A 4FAPB 4E17A 1B68A 2XS8A 5EGYA 3L1MA 3QMKA 1NFOA 2OG2A 5E3AA 3LJBA 3N24A 3KH2A 4O7GA 5JVEA 4E18A 1HMOA 2EPMX 3K66A 4A2NB 1VLTA 3H65A 5JLIA 2FFHA 1LI5A 3ABLC 4QI0A 3N2ZB 1SR2A 3I4UA 4PACA 2EPNA 2J0XA 1Q0GA 1QZXA 4LDRA 1KU2A 1S7ZA 5EHHA 4JE9A 4KNVA 5GPGB 2R05A 3LNRA 2VCCA 2A0UA 3ZDLA 5COFA 1R4TA 5AC5A 2IXMA 3U2MA 2GAQA 1QSPA 2NSFA 2OKUA 3S0XA 1EQ1A 4MTOA 3L8JA 1LI7A 3GANA 4YT8A 2L9JA 1GQAA 1RKCA 1V54C 3PDMP 3QVZA 2LD6A 2ETSA 1RXQA 1SMYF 2P6VA 3LUTB 1A7VA 3SXZA 1YYJA 4J32B 2LCHA 3IEEA 4MVRA 4U5HA 1A0BA 2RSEB 2YLDA 2M4EA 5AGFA 4F4BA 2R7SA 4LLEA 2R9RB 3RVZA 2HV7A 4JRZA 4U9DA 1RMVA 2BE5F 4GYTA 5JP7A 1T6IA 2J9WA 4K1OA 5DVWA 3FAJA 2YEVA 4A4AA 3TULA 1FMVA 4JTDB 2LQGA 2HSQA 3DM9B 1M6TA 4L6RA 3DWWA 1O5HA 3K6BA 4C3EA 3VRCA 2R25A 5L3QA 2PX0A 1OKKD 3NYMA 2YWAA 3G4XA 4OD4A 2VC9A 2X0CA 4Z9HA 4CJOA 3A11A 2PX3A 2KC3A 3WAQA 4XPWA 2XL6A 4JCHA 1E85A 2CNWD 4ZLDA 5KYXB 1YARO 2NPUA 3M4BA 4C7OA 2IYLD 1MQVA 3DAGA 4O79A 3BEHA 3NMIA 4NC3A 1TWGA 1I5NA 2KJGA 3QW1A 3UMIA 1YZCA 4U5FE 4AX2A 2XL4A 4O6YA 1ZU4A 3TOLA 3GM1A 1RKEB 4LACB 2XLWA 4I44A 2W4BA 2WZFA 3DZAA 4ER9A 3K33A 3B9QA 5DS6A 4Q4ZF 2UUIA 4YJWA 1YA7O 4BG0A 1D1AA 4EKWA 4C7OB 5HV9A 2HSBA 1K04A 5D92A 3POVA 2Y3GA 3S90A 4IARA 2Y3DA 5L3VA 4XQ1A 4EBBA 3CEXA 5L0JA 1NU7D 1SZIA 3EPVA 3V5YA 1HE9A 5TJ5E 4BPMA 3B0PA 2HFIA 2PP4A 1OCCC 3U9MA 3M79A 1BBHA 4O6NA 4KBLA 3U5SA 5DS4A 5A69A 2E87A 1F1MA 2J0WA 4Q7CA 2AWCA 3ABMC 3S29A 3T6GB 2OOCA 3DKAA 3C8GA 1MMAA 2AVKA 1ZHTA 2ICWG 2WL8A 1VTMP 3U8PA 4DBQA 3LS0A 1Z63A 1LS1A 1JRAA 1MNEA 1OQCA 4J7TA 3SZRA 1FNTc 3T6JA 2OEXA 5E2QA 3PMRA 4EIYA 4E7ZA 3GEHA 1CPQA 2CYDA 2Y39A 4MVMA 1G4WR 1TR2A 5COGA 3EFOA 4YL3A 4U5CE 1MMNA 4JTAB 4XWJA 3B0UX 5CIVA 4CDAA 3UGOA 5BQHA 1OKKA 5L0GA 2PNOA 3RVYA 1H6GA 2Q4FA 2EIMC 2OJED 1M2VA 2OU6A 3NG1A 1JOGA 4RD9A 3LEVA 2J7PD 2XS1A 4BEMJ 5KYXA 4IGGA 2WZGA 3M15A 1VYIA 3ASOC 3DXJF 3QW0A 2A68F 1U0BB 3JT1A 1WATA 2DYRC 4CS8C 2UUHA 4IAOA 4XEVA 1ORJA 2WVNA 4MVUA 4N6CA 3U2LA 4ANJA 2J9BA 4BJ6C 5F5FA 3IQ5A 4O6MA 3TJ5A 1H7IA 2R02A 2W45A 3LNMB 1MNDA 2AP3A 3UMHA 1FR0A 2H7VC 3EGXB 5BUOA 3GM2A 3NDBB 4OIRF 4JEBA 1TWCA 4CIPA 5FZTA 3LEOA 2DI3A 2I8BA 2P0NA 5B1AC 1D0YA 1TWHA 2P1AA 1E86A 1HW2A 4YT4A 3RQFA 5B3IA 4NY3A 3VAYA 3A9CA 4ULWA 2VH3A 2XLMA 5L0FA 3MYIA 3KKBA 2VCBA 1HW1A 3B29A 3W4YA 2A6EF 1FTSA 2OJQA 1MMDA 2YQYA 2XLEA 1GGQA 4PJLA 1I4YA 2Q9BA 3IQ6A 4FESA 4AL1A 4CS8A 1LE2A 1SYQA 2OQMA 3DAFA 4HFFB 1YZAA 2IM8A 2HMZA 4IJJA 1YJGA 2IXNA 1V55C 3NYJA 3FMSA 1ST6A 1UG7A 5KYNA 1V74B 4YL1A 1PD1A 4C3DA 1E2XA 4CS9A 4EHPA 4YT2A 2LFFA 4GEHA 2QLAA 4PR9A 4JVSA 3WODF 2L6FA 3X2QC 2HJMA 1GM5A 3RYLA 4XLPF 1YYXA 1OCZC 4JZAA 1BR4A 3GWNA 3HKKA 3NMJA 4PJJA 5B1BC 4BJ6A 1CPRA 2EINC 3RQGA 1XZQA 3SXMA 3EG9A 3CZ6A 2R7OA 3HNLA 1LS4A 3ECSA 4NTAA 1KTMA 5JT4A 4LERA 4E0HA 256BA 3MYFA 4EWCA 1AUEA 1FAPB 3ZC4A 3J06A 3K1IC 2KK1A 4G78A 2V26A 3JSZA 2LFDA 2G62A 5DQTA 1TQGA 1D1BA 3AQCA 5CI9A 1O87A 5AC4A 2D5RB 3I5PA 1WWPA 2NUTA 5A6JA 1AEPA 4PK4A 1A7DA 2DB4A 2W4MA 4CSAA 2J9UA 4LDKA 3T6BA 1FFTC 1R5ID 3Q7LA 2YLGA 2QUPA 1BZ4A 1M2VB 4YWQA 4U5EE 4NTFA 1XWJA 2BC5A 2XLVA 2GDCA 1J8MF 1NG1A 3JYYA 1YDIA 3ATPA 1T9KA 4JCZA 4PJNA 4W8KA 1G8XA 3RFYA 3ZTZA 2IXOA 1M56C 3SYNA 3S9OA 1ORSC 2Q3TA 4G7OF 1H9TA 3FHDA 4JKVA 2A6HF 2XLHA 2BL2A 4RBNA 4XLNF 4P9FA 1C02A 3HNJA 3JCUQ 5D91A 1OCOC 1YA9A 4QDLA 3K1IA 3L0IA 3V7OA 1WGWA 1D0XA 3G50A 4E0IA 1PV3A 3PCVA 1Q0KA 2YL7A 4WGYA 2HUJA 3ZTMA 3CAXA 5KYUB 4H4KC 2YRFA 4IRUA 1LE4A 1WOLA 3GODA 4I1MA 2Q7RA 2YL3A 1Q0DA 3DE8A 4JC7A 2YKZA 1OW6A 3HLZA 2LSEA 3F47A 4R32A 3W8HA 5L0DA 3SEOA 4M63A 1VOMA 3LLIA 3LESA 1DOVA 1Z3IX 2KYHA 3M4CA 3RKOF 3DE9A 4DXWA 4MVZA 5A6BA 3H2VA 3VM6A 3X1OA 1YLMA 2A1DD 3HNIA 1C17M 2VCAA 2H7BA 1T6QA 2PBEA 2R7RA 4IB4A 1Z5ZA 1DOWA 3ASNC 2CNWA 3H2UA 3QZCA 5L0IA 1FFHA 2EPLX 2MHRA 3DJUB 1LPEA 1ZHYA 3ZG1A 3TK0A 3HNKA 1VYKA 3ITFA 4XPXA 3EGDB 2XM0A 5B3SC 3I5QA 3RIPA 4YL0A 3FAPB 2HJ3A 1PD0A 4MVSA 4CS9C 2Y3BA 4JURI 4JW1A 3U3BA 4OIOF 1Q0FA 2CW0F 4C3BA 4ZLCA 5KYWB 3KMIA 3C8GB 4NTBA 1M2OA 1O3UA 4DRJB 1LKXA 2J9VA 2ASRA 3UR3C 3OA1A 5E3CA 3V5ZA 1TKNA 1ZHZA 3EH1A 4OINF 1C03A 1TWAA 1T6UA 4WJ0A 3NKDA 1GS9A 1ZHXA 3EGDA 2F22A 3O6XA 2NUPB 1APCA 2ZXWC 1VLSA 4U5DE 3RW0A 5JRAA 5JUAA 2J7PA 5A6BD 3B0VC 3EFOB 1ZYRF 1HMDA 1LM3B 3EGXA 3IHUA 3GEEA 1EA8A 3EH2A 4RDAA 4LDQA 2L6HA 3KYIA 4HE8D 2X51A 3RF3A 1RCPA 2CDQA 1CGME 4KI2A 4DBRA 1RKEA 3C18A 3ZQVA 4CSAC 4WGZA 1CGNA 4JTCB 2Y3HA 3U8VA 3C7JA 4CIHA 3AOUA 2W9YA 2OEVA 3L8IA 3MLGA 1G5ZA 2B0HA 3QTHA 3AGUA 3JZ0A 2GWWA 2L6GA 4U5BE 1NFNA 3SXYA 3TJ6A 1V4AA 4YN0B 2EPKX 1H9GA 3RH3A 3ZVRA 4GQHA 2HKVA 1JR8A 2WVQA 5K0IA 1BDJB 1S05A 3SXKA 3AG2C 2EIJC 3U9JA 1QKRA 4CX9A 3WHNA 3EG9B 4D4NA 2ZPAA 5JS5A 5EK0A 1U6HA 1MMGA 5T3WA 2D4UA 3EHMA 2J8WA 4H54A 4HFKB 3LAYA 1OXKA 2Q00A 1Z23A 1YVIA 3L34A 2Z15A 4OIQF 2Y69C 2PFDA 3EQLF 1K40A 3HTKC 3KPHA 3V5XA 3EJNA 2R7VA 3ZSUA 5HSWA 1ZW2A 1OR3A 3OEOA 3UNGC 3DMDA 1YAUO 2P7VA 3TOMA 2EILC 2YL0A 2R03A 2EIKC 2VASA 2G3KA 4ULVA 3NYLA 4BJ5A 2H8AA 3UMKA 5CI8A 2M64A 4N6HA 1PCXA 2H7OA 3GEIA 4MNDA 2JD3A 3IQCA 1W2WA 4NCQA 2HZ8A 4OIPF 3US6A 5BQIA 3FVYA 3ZWIA 1AVOB 1TFOB 3AG1C 1NZEA 4ONSA 3EZIA 2PF4E 2R7WA 3U0CA 1A7EA 4JJGA 4J30B 2HMQA 4YK5A 4Q5SF 3E9VA 1ZZPA 4U5GA 2G3VA 3LS1A 4JIOA 3NRHA 1FMWA 3C62A 2CGEA 2RD9A 3ABKC 3GWLA 4HEAJ 1D1CA 4MTFA 1QLEC 2KQ9A 4EBKA 2YHSA 2A69F 2QY9A 3R7CA 4CDVA 2CCYA 2TMVP 2A0BA 3JRMO 3PHF2 2XXAA 3JYHA 1L3PA 1BR1A 1Y4CA 2XRHA 3AQBA 3CQZA 1VMAA 3ZIBA 2KGOA 4AE4B 3KYJA 4DJ9A 2R7TA 3DI5A 1M57C 1IZMA 3Q6MA 5L0CA 1D0ZA 3R2PA 4IWBA 3MX3A 3C8ZA 4MS2A 1CGOA 3JTLO 3DM5A 1RJ9B 1WN0A 3TD7A 1T01A 4Z9IA 2R7XA 4DRIB 1LIHA 3TQOA 1Q0MA 4PJMA 2AU5A 3VYWA 5JSLA 4CJGA 1HY5A
chains in the Genus database with same CATH topology
1KNYA 2YWAA 3U0CA 3L8JA 3O10A 1PV3A 2L6HA 1OW8A 1ZZPA 3BRJA 3RQEA 1QVXA 2Q00A 2LK4A 3AJMA 2L6FA 3C18A 1WTYA 2JX0A 1K40A 1JOGA 2JPUA 1WOLA 3B71A 5F28E 4EBKA 3RQFA 3MFNA 4EBJA 1UFBA 3JYYA 3K7DA 1OW6A 3C8GB 4R32A 1O3UA 3C8GA 1K05A 3RQGA 1OW7A 3L8IA 1KTMA 4XEVA 3JZ0A 2L6GA 3S9OA 3TULA 1V4AA 2KK1A 3GM1A 3GM3A 3U3FA 4NQFA 3C8GD 2PBEA 4XEKA 1WWPA 1K04A 2HSBA 3GM2A 4XEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNY A;  2YWA A;  3U0C A;  3L8J A;  3O10 A;  1PV3 A;  2L6H A;  1OW8 A;  1ZZP A;  3BRJ A;  3RQE A;  1QVX A;  2Q00 A;  2LK4 A;  3AJM A;  2L6F A;  3C18 A;  1WTY A;  2JX0 A;  1K40 A;  1JOG A;  2JPU A;  1WOL A;  3B71 A;  5F28 E;  4EBK A;  3RQF A;  3MFN A;  4EBJ A;  1UFB A;  3JYY A;  3K7D A;  1OW6 A;  3C8G B;  4R32 A;  1O3U A;  3C8G A;  1K05 A;  3RQG A;  1OW7 A;  3L8I A;  1KTM A;  4XEV A;  3JZ0 A;  2L6G A;  3S9O A;  3TUL A;  1V4A A;  2KK1 A;  3GM1 A;  3GM3 A;  3U3F A;  4NQF A;  3C8G D;  2PBE A;  4XEK A;  1WWP A;  1K04 A;  2HSB A;  3GM2 A;  4XEF A; 
#chains in the Genus database with same CATH topology
 1KNY A;  4K7B A;  3FOO A;  3O10 A;  1SF8 A;  4MW3 A;  2YLI A;  4B6I A;  2WZL A;  3BRJ A;  3Q7G A;  4J7Y A;  4Z9J A;  3VF0 A;  4BJT A;  3K1H A;  3O39 A;  4U9E A;  4G7Z F;  1G4U S;  3KL4 A;  5COM A;  3B71 A;  4OD5 A;  5F28 E;  4FX5 A;  5KYU A;  4G0H A;  4DRH B;  4CBE A;  1HE1 A;  2NG1 A;  2NSG A;  2MWQ A;  3MFN A;  1UFB A;  1Z7Q c;  3S28 A;  4UDV A;  4QI2 A;  3OWT A;  4N06 A;  3IPM O;  2FAP B;  4I3M A;  3WG7 C;  2ZXR A;  1VB5 A;  3DD7 A;  4MVQ A;  4N4W A;  2IBF A;  3S27 A;  3HJC A;  2GFH A;  2LP4 A;  3Q6N A;  3G4Z A;  1ZVZ A;  3W2W A;  4MQ9 F;  5A6A A;  2XSE A;  1Z6A A;  2HS5 A;  2C03 A;  2GA0 A;  2XLD A;  4P6I C;  1XZP A;  1LVK A;  1Y6D A;  2Q9C A;  3N0T A;  4I1O B;  3FDQ A;  4MW8 A;  2Q9A A;  5KYY B;  2FGY A;  4MVO A;  2YZS A;  2XM4 A;  3NMK A;  1E83 A;  2DYS C;  2NUP A;  1JMW A;  1WTY A;  2JX0 A;  2JPU A;  1OCR C;  3O55 A;  4X0R A;  3EHN A;  3AG4 C;  1T5O A;  4XPY A;  2MYS A;  2EPO A;  4P9T A;  4PFO A;  3UGP A;  2HV6 A;  3K7D A;  2KSF A;  2YVK A;  3JRT A;  3ZQY A;  5KYW A;  4AL0 A;  1ORY A;  1JAF A;  1OW7 A;  4JEA A;  2I15 A;  1OR2 A;  2O9X A;  2QNL A;  4XTK A;  4DVZ A;  3CSK A;  1E84 A;  1IW7 F;  1QPU A;  2R7U A;  1NBB A;  4MTG A;  4EUK B;  3AG3 C;  3LLK A;  3GM3 A;  1EI7 A;  4BJ5 C;  1OXB A;  4JJF A;  2DGJ A;  2QE9 A;  3FXH A;  4IAQ A;  3QVY A;  2IXP A;  3M1C B;  1NSG B;  3GOR A;  4FWV A;  5BQG A;  3SP1 A;  4AK9 A;  5FCL A;  3S84 A;  4WAB A;  3JSE O;  4XEF A;  3IQT A;  2J46 A;  4KNW A;  4G7H F;  1JPJ A;  3FOP A;  1NLX A;  1U89 A;  2J45 A;  1OW8 A;  2L81 A;  2OCC C;  4D4X A;  5DLJ A;  3RQE A;  4BJ1 A;  2ZXO A;  1QVX A;  2C04 A;  4E7S A;  1I4Z A;  3C63 A;  2LIG A;  5DQZ A;  1J8Y F;  2WVO A;  4KC9 A;  3F46 A;  3T9O A;  1JPN A;  4EBJ A;  2XXA B;  1ZHW A;  4YT5 A;  2NUT B;  5F5H A;  5T3T A;  1K05 A;  4CS7 A;  5E33 A;  2L7A A;  2IOQ A;  2QTV A;  3W8I A;  2ZD9 A;  3EZH A;  5A6K A;  2AWY A;  4DOZ A;  2XLO A;  1NU9 C;  1A41 A;  2KW3 C;  1L7C A;  2R7Q A;  2XL8 A;  3U3F A;  3DJN B;  1RJ9 A;  2B0J A;  4DVY P;  3MBG A;  1N1C A;  5IY5 C;  2ZXP A;  4NQF A;  2KNH A;  3C8G D;  3E70 C;  5DS5 A;  5L0H A;  2WB7 A;  2VB6 A;  4XEK A;  2YL1 A;  4K0D A;  5T1D B;  2V3C C;  1EKY A;  3T4R A;  3AGT A;  1ZU5 A;  1ZW3 A;  4AE4 A;  4CDY A;  3NKE A;  3SNH A;  5KYY A;  1TFK B;  4W8P A;  1QQ3 A;  4PFP A;  3W2V A;  4BEJ A;  1VK5 A;  1WAS A;  2LK4 A;  2P61 A;  3AJM A;  4LLC A;  1BR2 A;  4FAP B;  4E17 A;  1B68 A;  2XS8 A;  5EGY A;  3L1M A;  3QMK A;  1NFO A;  2OG2 A;  5E3A A;  3LJB A;  3N24 A;  3KH2 A;  4O7G A;  5JVE A;  4E18 A;  1HMO A;  2EPM X;  3K66 A;  4A2N B;  1VLT A;  3H65 A;  5JLI A;  2FFH A;  1LI5 A;  3ABL C;  4QI0 A;  3N2Z B;  1SR2 A;  3I4U A;  4PAC A;  2EPN A;  2J0X A;  1Q0G A;  1QZX A;  4LDR A;  1KU2 A;  1S7Z A;  5EHH A;  4JE9 A;  4KNV A;  5GPG B;  2R05 A;  3LNR A;  2VCC A;  2A0U A;  3ZDL A;  5COF A;  1R4T A;  5AC5 A;  2IXM A;  3U2M A;  2GAQ A;  1QSP A;  2NSF A;  2OKU A;  3S0X A;  1EQ1 A;  4MTO A;  3L8J A;  1LI7 A;  3GAN A;  4YT8 A;  2L9J A;  1GQA A;  1RKC A;  1V54 C;  3PDM P;  3QVZ A;  2LD6 A;  2ETS A;  1RXQ A;  1SMY F;  2P6V A;  3LUT B;  1A7V A;  3SXZ A;  1YYJ A;  4J32 B;  2LCH A;  3IEE A;  4MVR A;  4U5H A;  1A0B A;  2RSE B;  2YLD A;  2M4E A;  5AGF A;  4F4B A;  2R7S A;  4LLE A;  2R9R B;  3RVZ A;  2HV7 A;  4JRZ A;  4U9D A;  1RMV A;  2BE5 F;  4GYT A;  5JP7 A;  1T6I A;  2J9W A;  4K1O A;  5DVW A;  3FAJ A;  2YEV A;  4A4A A;  3TUL A;  1FMV A;  4JTD B;  2LQG A;  2HSQ A;  3DM9 B;  1M6T A;  4L6R A;  3DWW A;  1O5H A;  3K6B A;  4C3E A;  3VRC A;  2R25 A;  5L3Q A;  2PX0 A;  1OKK D;  3NYM A;  2YWA A;  3G4X A;  4OD4 A;  2VC9 A;  2X0C A;  4Z9H A;  4CJO A;  3A11 A;  2PX3 A;  2KC3 A;  3WAQ A;  4XPW A;  2XL6 A;  4JCH A;  1E85 A;  2CNW D;  4ZLD A;  5KYX B;  1YAR O;  2NPU A;  3M4B A;  4C7O A;  2IYL D;  1MQV A;  3DAG A;  4O79 A;  3BEH A;  3NMI A;  4NC3 A;  1TWG A;  1I5N A;  2KJG A;  3QW1 A;  3UMI A;  1YZC A;  4U5F E;  4AX2 A;  2XL4 A;  4O6Y A;  1ZU4 A;  3TOL A;  3GM1 A;  1RKE B;  4LAC B;  2XLW A;  4I44 A;  2W4B A;  2WZF A;  3DZA A;  4ER9 A;  3K33 A;  3B9Q A;  5DS6 A;  4Q4Z F;  2UUI A;  4YJW A;  1YA7 O;  4BG0 A;  1D1A A;  4EKW A;  4C7O B;  5HV9 A;  2HSB A;  1K04 A;  5D92 A;  3POV A;  2Y3G A;  3S90 A;  4IAR A;  2Y3D A;  5L3V A;  4XQ1 A;  4EBB A;  3CEX A;  5L0J A;  1NU7 D;  1SZI A;  3EPV A;  3V5Y A;  1HE9 A;  5TJ5 E;  4BPM A;  3B0P A;  2HFI A;  2PP4 A;  1OCC C;  3U9M A;  3M79 A;  1BBH A;  4O6N A;  4KBL A;  3U5S A;  5DS4 A;  5A69 A;  2E87 A;  1F1M A;  2J0W A;  4Q7C A;  2AWC A;  3ABM C;  3S29 A;  3T6G B;  2OOC A;  3DKA A;  3C8G A;  1MMA A;  2AVK A;  1ZHT A;  2ICW G;  2WL8 A;  1VTM P;  3U8P A;  4DBQ A;  3LS0 A;  1Z63 A;  1LS1 A;  1JRA A;  1MNE A;  1OQC A;  4J7T A;  3SZR A;  1FNT c;  3T6J A;  2OEX A;  5E2Q A;  3PMR A;  4EIY A;  4E7Z A;  3GEH A;  1CPQ A;  2CYD A;  2Y39 A;  4MVM A;  1G4W R;  1TR2 A;  5COG A;  3EFO A;  4YL3 A;  4U5C E;  1MMN A;  4JTA B;  4XWJ A;  3B0U X;  5CIV A;  4CDA A;  3UGO A;  5BQH A;  1OKK A;  5L0G A;  2PNO A;  3RVY A;  1H6G A;  2Q4F A;  2EIM C;  2OJE D;  1M2V A;  2OU6 A;  3NG1 A;  1JOG A;  4RD9 A;  3LEV A;  2J7P D;  2XS1 A;  4BEM J;  5KYX A;  4IGG A;  2WZG A;  3M15 A;  1VYI A;  3ASO C;  3DXJ F;  3QW0 A;  2A68 F;  1U0B B;  3JT1 A;  1WAT A;  2DYR C;  4CS8 C;  2UUH A;  4IAO A;  4XEV A;  1ORJ A;  2WVN A;  4MVU A;  4N6C A;  3U2L A;  4ANJ A;  2J9B A;  4BJ6 C;  5F5F A;  3IQ5 A;  4O6M A;  3TJ5 A;  1H7I A;  2R02 A;  2W45 A;  3LNM B;  1MND A;  2AP3 A;  3UMH A;  1FR0 A;  2H7V C;  3EGX B;  5BUO A;  3GM2 A;  3NDB B;  4OIR F;  4JEB A;  1TWC A;  4CIP A;  5FZT A;  3LEO A;  2DI3 A;  2I8B A;  2P0N A;  5B1A C;  1D0Y A;  1TWH A;  2P1A A;  1E86 A;  1HW2 A;  4YT4 A;  3RQF A;  5B3I A;  4NY3 A;  3VAY A;  3A9C A;  4ULW A;  2VH3 A;  2XLM A;  5L0F A;  3MYI A;  3KKB A;  2VCB A;  1HW1 A;  3B29 A;  3W4Y A;  2A6E F;  1FTS A;  2OJQ A;  1MMD A;  2YQY A;  2XLE A;  1GGQ A;  4PJL A;  1I4Y A;  2Q9B A;  3IQ6 A;  4FES A;  4AL1 A;  4CS8 A;  1LE2 A;  1SYQ A;  2OQM A;  3DAF A;  4HFF B;  1YZA A;  2IM8 A;  2HMZ A;  4IJJ A;  1YJG A;  2IXN A;  1V55 C;  3NYJ A;  3FMS A;  1ST6 A;  1UG7 A;  5KYN A;  1V74 B;  4YL1 A;  1PD1 A;  4C3D A;  1E2X A;  4CS9 A;  4EHP A;  4YT2 A;  2LFF A;  4GEH A;  2QLA A;  4PR9 A;  4JVS A;  3WOD F;  2L6F A;  3X2Q C;  2HJM A;  1GM5 A;  3RYL A;  4XLP F;  1YYX A;  1OCZ C;  4JZA A;  1BR4 A;  3GWN A;  3HKK A;  3NMJ A;  4PJJ A;  5B1B C;  4BJ6 A;  1CPR A;  2EIN C;  3RQG A;  1XZQ A;  3SXM A;  3EG9 A;  3CZ6 A;  2R7O A;  3HNL A;  1LS4 A;  3ECS A;  4NTA A;  1KTM A;  5JT4 A;  4LER A;  4E0H A;  256B A;  3MYF A;  4EWC A;  1AUE A;  1FAP B;  3ZC4 A;  3J06 A;  3K1I C;  2KK1 A;  4G78 A;  2V26 A;  3JSZ A;  2LFD A;  2G62 A;  5DQT A;  1TQG A;  1D1B A;  3AQC A;  5CI9 A;  1O87 A;  5AC4 A;  2D5R B;  3I5P A;  1WWP A;  2NUT A;  5A6J A;  1AEP A;  4PK4 A;  1A7D A;  2DB4 A;  2W4M A;  4CSA A;  2J9U A;  4LDK A;  3T6B A;  1FFT C;  1R5I D;  3Q7L A;  2YLG A;  2QUP A;  1BZ4 A;  1M2V B;  4YWQ A;  4U5E E;  4NTF A;  1XWJ A;  2BC5 A;  2XLV A;  2GDC A;  1J8M F;  1NG1 A;  3JYY A;  1YDI A;  3ATP A;  1T9K A;  4JCZ A;  4PJN A;  4W8K A;  1G8X A;  3RFY A;  3ZTZ A;  2IXO A;  1M56 C;  3SYN A;  3S9O A;  1ORS C;  2Q3T A;  4G7O F;  1H9T A;  3FHD A;  4JKV A;  2A6H F;  2XLH A;  2BL2 A;  4RBN A;  4XLN F;  4P9F A;  1C02 A;  3HNJ A;  3JCU Q;  5D91 A;  1OCO C;  1YA9 A;  4QDL A;  3K1I A;  3L0I A;  3V7O A;  1WGW A;  1D0X A;  3G50 A;  4E0I A;  1PV3 A;  3PCV A;  1Q0K A;  2YL7 A;  4WGY A;  2HUJ A;  3ZTM A;  3CAX A;  5KYU B;  4H4K C;  2YRF A;  4IRU A;  1LE4 A;  1WOL A;  3GOD A;  4I1M A;  2Q7R A;  2YL3 A;  1Q0D A;  3DE8 A;  4JC7 A;  2YKZ A;  1OW6 A;  3HLZ A;  2LSE A;  3F47 A;  4R32 A;  3W8H A;  5L0D A;  3SEO A;  4M63 A;  1VOM A;  3LLI A;  3LES A;  1DOV A;  1Z3I X;  2KYH A;  3M4C A;  3RKO F;  3DE9 A;  4DXW A;  4MVZ A;  5A6B A;  3H2V A;  3VM6 A;  3X1O A;  1YLM A;  2A1D D;  3HNI A;  1C17 M;  2VCA A;  2H7B A;  1T6Q A;  2PBE A;  2R7R A;  4IB4 A;  1Z5Z A;  1DOW A;  3ASN C;  2CNW A;  3H2U A;  3QZC A;  5L0I A;  1FFH A;  2EPL X;  2MHR A;  3DJU B;  1LPE A;  1ZHY A;  3ZG1 A;  3TK0 A;  3HNK A;  1VYK A;  3ITF A;  4XPX A;  3EGD B;  2XM0 A;  5B3S C;  3I5Q A;  3RIP A;  4YL0 A;  3FAP B;  2HJ3 A;  1PD0 A;  4MVS A;  4CS9 C;  2Y3B A;  4JUR I;  4JW1 A;  3U3B A;  4OIO F;  1Q0F A;  2CW0 F;  4C3B A;  4ZLC A;  5KYW B;  3KMI A;  3C8G B;  4NTB A;  1M2O A;  1O3U A;  4DRJ B;  1LKX A;  2J9V A;  2ASR A;  3UR3 C;  3OA1 A;  5E3C A;  3V5Z A;  1TKN A;  1ZHZ A;  3EH1 A;  4OIN F;  1C03 A;  1TWA A;  1T6U A;  4WJ0 A;  3NKD A;  1GS9 A;  1ZHX A;  3EGD A;  2F22 A;  3O6X A;  2NUP B;  1APC A;  2ZXW C;  1VLS A;  4U5D E;  3RW0 A;  5JRA A;  5JUA A;  2J7P A;  5A6B D;  3B0V C;  3EFO B;  1ZYR F;  1HMD A;  1LM3 B;  3EGX A;  3IHU A;  3GEE A;  1EA8 A;  3EH2 A;  4RDA A;  4LDQ A;  2L6H A;  3KYI A;  4HE8 D;  2X51 A;  3RF3 A;  1RCP A;  2CDQ A;  1CGM E;  4KI2 A;  4DBR A;  1RKE A;  3C18 A;  3ZQV A;  4CSA C;  4WGZ A;  1CGN A;  4JTC B;  2Y3H A;  3U8V A;  3C7J A;  4CIH A;  3AOU A;  2W9Y A;  2OEV A;  3L8I A;  3MLG A;  1G5Z A;  2B0H A;  3QTH A;  3AGU A;  3JZ0 A;  2GWW A;  2L6G A;  4U5B E;  1NFN A;  3SXY A;  3TJ6 A;  1V4A A;  4YN0 B;  2EPK X;  1H9G A;  3RH3 A;  3ZVR A;  4GQH A;  2HKV A;  1JR8 A;  2WVQ A;  5K0I A;  1BDJ B;  1S05 A;  3SXK A;  3AG2 C;  2EIJ C;  3U9J A;  1QKR A;  4CX9 A;  3WHN A;  3EG9 B;  4D4N A;  2ZPA A;  5JS5 A;  5EK0 A;  1U6H A;  1MMG A;  5T3W A;  2D4U A;  3EHM A;  2J8W A;  4H54 A;  4HFK B;  3LAY A;  1OXK A;  2Q00 A;  1Z23 A;  1YVI A;  3L34 A;  2Z15 A;  4OIQ F;  2Y69 C;  2PFD A;  3EQL F;  1K40 A;  3HTK C;  3KPH A;  3V5X A;  3EJN A;  2R7V A;  3ZSU A;  5HSW A;  1ZW2 A;  1OR3 A;  3OEO A;  3UNG C;  3DMD A;  1YAU O;  2P7V A;  3TOM A;  2EIL C;  2YL0 A;  2R03 A;  2EIK C;  2VAS A;  2G3K A;  4ULV A;  3NYL A;  4BJ5 A;  2H8A A;  3UMK A;  5CI8 A;  2M64 A;  4N6H A;  1PCX A;  2H7O A;  3GEI A;  4MND A;  2JD3 A;  3IQC A;  1W2W A;  4NCQ A;  2HZ8 A;  4OIP F;  3US6 A;  5BQI A;  3FVY A;  3ZWI A;  1AVO B;  1TFO B;  3AG1 C;  1NZE A;  4ONS A;  3EZI A;  2PF4 E;  2R7W A;  3U0C A;  1A7E A;  4JJG A;  4J30 B;  2HMQ A;  4YK5 A;  4Q5S F;  3E9V A;  1ZZP A;  4U5G A;  2G3V A;  3LS1 A;  4JIO A;  3NRH A;  1FMW A;  3C62 A;  2CGE A;  2RD9 A;  3ABK C;  3GWL A;  4HEA J;  1D1C A;  4MTF A;  1QLE C;  2KQ9 A;  4EBK A;  2YHS A;  2A69 F;  2QY9 A;  3R7C A;  4CDV A;  2CCY A;  2TMV P;  2A0B A;  3JRM O;  3PHF 2;  2XXA A;  3JYH A;  1L3P A;  1BR1 A;  1Y4C A;  2XRH A;  3AQB A;  3CQZ A;  1VMA A;  3ZIB A;  2KGO A;  4AE4 B;  3KYJ A;  4DJ9 A;  2R7T A;  3DI5 A;  1M57 C;  1IZM A;  3Q6M A;  5L0C A;  1D0Z A;  3R2P A;  4IWB A;  3MX3 A;  3C8Z A;  4MS2 A;  1CGO A;  3JTL O;  3DM5 A;  1RJ9 B;  1WN0 A;  3TD7 A;  1T01 A;  4Z9I A;  2R7X A;  4DRI B;  1LIH A;  3TQO A;  1Q0M A;  4PJM A;  2AU5 A;  3VYW A;  5JSL A;  4CJG A;  1HY5 A; 
#chains in the Genus database with same CATH homology
 1KNY A;  2YWA A;  3U0C A;  3L8J A;  3O10 A;  1PV3 A;  2L6H A;  1OW8 A;  1ZZP A;  3BRJ A;  3RQE A;  1QVX A;  2Q00 A;  2LK4 A;  3AJM A;  2L6F A;  3C18 A;  1WTY A;  2JX0 A;  1K40 A;  1JOG A;  2JPU A;  1WOL A;  3B71 A;  5F28 E;  4EBK A;  3RQF A;  3MFN A;  4EBJ A;  1UFB A;  3JYY A;  3K7D A;  1OW6 A;  3C8G B;  4R32 A;  1O3U A;  3C8G A;  1K05 A;  3RQG A;  1OW7 A;  3L8I A;  1KTM A;  4XEV A;  3JZ0 A;  2L6G A;  3S9O A;  3TUL A;  1V4A A;  2KK1 A;  3GM1 A;  3GM3 A;  3U3F A;  4NQF A;  3C8G D;  2PBE A;  4XEK A;  1WWP A;  1K04 A;  2HSB A;  3GM2 A;  4XEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...