4XEFA

Pyk2-fat complexed with leupaxin ld motif ld1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
136
structure length
136
Chain Sequence
MANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Protein-tyrosine kinase 2-beta
total genus 56
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4xefA00
3AJMA 3C8GD 1KTMA 1QVXA 2YWAA 3GM2A 4R32A 3L8JA 2LK4A 4XEKA 4EBJA 2JX0A 3GM1A 1K40A 3TULA 2KK1A 3JYYA 1ZZPA 3C18A 3B71A 3RQGA 1WWPA 1KNYA 2Q00A 4XEFA 3S9OA 1K05A 2JPUA 1OW8A 2L6HA 3L8IA 1V4AA 1WTYA 4NQFA 3U3FA 3O10A 3RQFA 4XEVA 1JOGA 1UFBA 2PBEA 3C8GB 2L6FA 3MFNA 3U0CA 3C8GA 3BRJA 1OW6A 1PV3A 5F28E 3RQEA 1WOLA 3GM3A 3K7DA 1O3UA 4EBKA 1OW7A 2HSBA 3JZ0A 2L6GA 1K04A
chains in the Genus database with same CATH superfamily
3SXMA 1NBBA 1VOMA 3B9QA 2VH3A 3K33A 3UMHA 3VYWA 4MTFA 4KI2A 4XEKA 4C7OA 2G3KA 1WN0A 5E3AA 1MNEA 2L9JA 3V7OA 1T6IA 3EFOA 4JJGA 1T6UA 4P9TA 1YA9A 3S28A 2DI3A 4E18A 1EQ1A 2Q00A 3PMRA 4U5BE 4JTAB 1ORSC 4DJ9A 2XS1A 4HFFB 4MS2A 4G7ZF 4LACB 3SYNA 3FOOA 4XEVA 2L81A 1UFBA 4JE9A 4CS8C 1O87A 4C3BA 1W2WA 2FFHA 2L6FA 1LE2A 3LEOA 4IARA 3U2MA 4EKWA 5IY5C 2WVOA 4ZLDA 4P9FA 2Y3HA 3TJ6A 2W4MA 1NG1A 4YJWA 4C3DA 2BE5F 3SZRA 1YARO 3IEEA 1Z5ZA 2YL1A 3I5PA 1I5NA 3ASNC 1RCPA 1APCA 1LS1A 1Q0KA 3QZCA 3V5XA 5B3SC 3VAYA 3GANA 4JCHA 5JS5A 2J9BA 2YWAA 3K66A 3LS0A 1G4WR 1JPJA 1DOWA 2NUPA 3RKOF 4J32B 5DLJA 2Q9BA 3L0IA 3Q6NA 2RSEB 2X51A 4Z9JA 3C7JA 4CDYA 2XL8A 1WATA 1WTYA 1U89A 3A11A 1ZHZA 2CNWA 3IQCA 4NQFA 5EHHA 1NLXA 5COGA 1JOGA 1D1AA 3F46A 2J0WA 4PJJA 3MFNA 5DS5A 4XLPF 3ZSUA 5E2QA 3NMKA 4EBBA 3UMIA 3GWNA 2GA0A 1A41A 1T01A 2Z15A 5CIVA 2Y69C 2AU5A 3EGXA 1IZMA 1GS9A 2KJGA 3IQ5A 4I44A 1QLEC 1QVXA 3IQTA 1JRAA 2GFHA 1A7EA 4U5GA 3ECSA 3B29A 4JCZA 4MVUA 1K40A 1VYIA 4KNVA 3KL4A 4YL1A 3J06A 5L3QA 3IPMO 3DE9A 3X2QC 2XLVA 4XEFA 5COFA 4CX9A 2OU6A 3L8IA 1NFNA 2R7TA 3EZIA 4WJ0A 4AL0A 4BJ5A 3LUTB 3MYFA 1C03A 1Z3IX 2QY9A 4D4NA 1WASA 2Q9AA 3DM5A 2NSFA 3AQCA 1T6QA 4JRZA 3RF3A 3LLKA 3TK0A 3OWTA 4AE4B 3NYMA 4IAQA 1MMNA 4JIOA 2LP4A 3AGTA 4BJ1A 1EI7A 3JRTA 4X0RA 2OQMA 2W45A 2WB7A 3M79A 2OEVA 1ZU4A 3RYLA 1VK5A 2KNHA 4WGZA 2P1AA 2YL0A 4J7TA 2GWWA 4MTOA 4MVQA 4O7GA 4BG0A 2Q7RA 4HEAJ 4IJJA 3C8GD 3RIPA 2WZLA 5AGFA 3WHNA 3H2UA 3GODA 4JJFA 3ZQVA 1MQVA 1VMAA 2A1DD 2YLGA 3NRHA 1ZU5A 1ZHYA 3RQGA 3M4CA 3W8HA 3SEOA 1WWPA 5HV9A 1FTSA 3HNLA 4PJMA 1OW8A 2YQYA 1C17M 3CZ6A 3PCVA 3LEVA 4U9DA 1TWAA 3FAJA 4PK4A 2UUHA 2A68F 3S27A 4CS7A 5BQHA 2YL3A 4RBNA 3G4ZA 1FFHA 2WVQA 3KMIA 4JEAA 5KYNA 5A6KA 2YKZA 3C8GA 1PV3A 3BEHA 1Y4CA 3QW1A 2HMZA 3TQOA 5JT4A 4FESA 3U9JA 4EBKA 2I8BA 2WVNA 4G7HF 1LI5A 1D1CA 4U5DE 1D0YA 4EIYA 1OR3A 3QTHA 3B0PA 5JSLA 2HZ8A 4JTCB 1N1CA 2HSQA 5GPGB 1E83A 4NC3A 4XWJA 3QMKA 2R7XA 1XZPA 1RMVA 3JRMO 1FFTC 3M15A 3T6JA 3ZTMA 3RVZA 1ZW3A 1J8MF 4MVRA 4BEMJ 4Q5SF 2EPKX 2EIKC 2ICWG 1R5ID 1SZIA 2W4BA 3Q7GA 2VB6A 3EFOB 4FWVA 2XLDA 4Z9IA 4DRIB 3NKDA 4A2NB 2YRFA 3EGXB 4NTFA 1GQAA 1CGME 3U0CA 1HE1A 2PF4E 5E33A 2XL4A 4XQ1A 3V5ZA 2VC9A 4CS9C 2QNLA 5BUOA 4XPYA 3HTKC 2J9UA 1FNTc 4PR9A 3JTLO 1E85A 3H2VA 2PBEA 1V55C 5L0IA 3HJCA 4LDKA 4Z9HA 3CAXA 2IYLD 2HJ3A 1NFOA 1OCOC 1OQCA 2KW3C 2Y3DA 3AGUA 4W8KA 3LESA 3NDBB 1ZZPA 2Q3TA 2XM4A 3JSZA 4C3EA 5BQIA 1K05A 4IWBA 1I4YA 3S84A 1YJGA 4O79A 1XZQA 4ANJA 1RJ9B 2IXMA 3EHNA 4LERA 2H7BA 4G0HA 4CJOA 4Q4ZF 3FOPA 3ZVRA 3K1HA 1VLTA 1AVOB 3K1IC 1RJ9A 1LI7A 1PCXA 2EPMX 3FAPB 1QSPA 1CPQA 4L6RA 2FGYA 3ZC4A 4AK9A 3RVYA 4MW8A 2D4UA 3IHUA 4F4BA 1RKEA 2F22A 5B1BC 1HMDA 1RKCA 1QZXA 4U9EA 1JMWA 2QTVA 3EPVA 2R7WA 2ZPAA 2J46A 3I5QA 4XPXA 4OIOF 3L1MA 4PFOA 1G8XA 4K0DA 3EH1A 1TWGA 4PJLA 2JX0A 4EUKB 4HE8D 4PJNA 2WZGA 2R25A 2M64A 2FAPB 3O55A 2XLEA 1HE9A 1I4ZA 2C04A 2P7VA 3KPHA 4MNDA 2R7QA 3UMKA 3U3FA 3HNKA 5L0FA 1FMVA 3UGPA 1PD1A 2YLIA 2JD3A 4YWQA 1BR4A 1V54C 4JW1A 5EK0A 4B6IA 3NMIA 3U8PA 3U3BA 4JZAA 2H8AA 3GEIA 3FVYA 4FX5A 5B3IA 4I1OB 5L0HA 2YHSA 4J30B 1O3UA 3N0TA 1BZ4A 2KGOA 2ASRA 3ITFA 4YT4A 3EGDA 3DAFA 3HNJA 3ZDLA 4E7ZA 4CS8A 2HFIA 3VRCA 1VYKA 1E86A 3T6GB 4J7YA 1H9TA 3CEXA 1KU2A 4IGGA 2J45A 2I15A 2P6VA 3IQ6A 5E3CA 2XLWA 4I1MA 3WAQA 3ABMC 1GGQA 3Q6MA 3MBGA 3KKBA 5A6AA 2A6EF 2HJMA 1H7IA 4CSAC 5KYYA 3TJ5A 3W2VA 5TJ5E 2YEVA 1YAUO 3O6XA 5T3TA 2XLOA 1BBHA 4CIPA 3ATPA 2CGEA 1M56C 2MHRA 5T3WA 3S90A 4YL3A 1Z7Qc 5KYWB 1QPUA 3DAGA 5KYXA 2UUIA 2ZXRA 1LE4A 2P61A 1KTMA 2DYSC 3L34A 4JKVA 1EKYA 3FXHA 4N06A 3GM2A 4YT5A 4MQ9F 4DVZA 2KYHA 3GM1A 3I4UA 2LFFA 4MW3A 2R03A 2LD6A 2OJQA 4CJGA 2OJED 1YLMA 2YLDA 1XWJA 2IXOA 3DKAA 4BJ6C 4N4WA 4E0HA 1S7ZA 3K1IA 4XPWA 1MMGA 5L0JA 2OEXA 4G78A 2Y39A 2XXAB 1Z23A 1OCZC 2NPUA 1Z6AA 2R7OA 2YVKA 1PD0A 2LCHA 3K6BA 5COMA 3BRJA 1OW6A 2Q4FA 4WABA 3RQEA 2XXAA 4XLNF 2A0BA 3JYHA 1H6GA 3RH3A 3DMDA 3MX3A 4MTGA 2OOCA 2HSBA 1ZVZA 2DGJA 1YZAA 2C03A 3KH2A 5L3VA 1FAPB 2ZD9A 1A7VA 1SR2A 4H4KC 1HW2A 2XRHA 1R4TA 1TR2A 3FHDA 3G4XA 4OINF 2TMVP 4MVZA 4OIPF 3NYJA 5A69A 3B0UX 4BJ6A 1OKKD 1YA7O 1YZCA 4NY3A 4EWCA 3ZG1A 3MLGA 5A6JA 3AQBA 1LS4A 3GWLA 1Y6DA 2A0UA 4ER9A 3U5SA 5KYWA 3SXZA 2EILC 1UG7A 1Z63A 2OG2A 3EH2A 3NKEA 4E0IA 2XSEA 2LQGA 3KYJA 1E84A 4OIQF 1YYJA 2VCAA 3DD7A 1D0XA 1HW1A 2BC5A 2ETSA 4CBEA 3OA1A 3NG1A 3H65A 1SF8A 1HY5A 4YL0A 3X1OA 5F5HA 4KC9A 1ZHWA 1ZHTA 4JTDB 3F47A 2NUPB 4O6MA 3WODF 1MMAA 4MVMA 3VF0A 2CNWD 2XLHA 3TULA 1C02A 3JYYA 4MVOA 3W8IA 1IW7F 4LDRA 3B71A 1JR8A 2J8WA 5DS4A 2OCCC 3M1CB 3M4BA 4JURI 5DQZA 4CIHA 1YVIA 1LVKA 3EJNA 1V4AA 1U6HA 1M57C 4YN0B 3Q7LA 2V26A 4O6NA 5T1DB 4QI0A 2IOQA 3QW0A 3DZAA 3UR3C 3W4YA 1Q0GA 5FCLA 1VLSA 3S29A 2XL6A 3SXKA 3VM6A 2WL8A 4E17A 3NMJA 4LLCA 5F28E 3GM3A 2LSEA 2QUPA 3ASOC 3NYLA 3T6BA 2L7AA 4BJTA 3ABLC 4DRJB 1YYXA 4DVYP 1G4US 1G5ZA 3C63A 4P6IC 1Q0FA 2NSGA 5JVEA 5JUAA 1ORJA 1OW7A 1LM3B 4U5CE 2B0JA 4NTBA 1LIHA 4JVSA 1SYQA 4U5HA 3ZIBA 1NSGB 3AJMA 1T5OA 2YL7A 3OEOA 4JC7A 2M4EA 1CPRA 4N6HA 2HV6A 1E2XA 4ONSA 4CDVA 1ZYRF 1L3PA 1RXQA 5F5FA 2IBFA 1FR0A 1U0BB 4ZLCA 2EIJC 3C18A 4DOZA 2J9WA 1TWCA 1HMOA 2QLAA 1KNYA 3AG1C 3E70C 3N24A 4OD5A 4FAPB 2NUTA 1NU7D 2X0CA 2CDQA 1OKKA 2LIGA 2WZFA 3LJBA 3RQFA 1DOVA 4XTKA 2NUTB 4AE4A 3DJNB 4BJ5C 3ZQYA 2LFDA 2P0NA 1ZHXA 2R7RA 4UDVA 1WOLA 4PFPA 3N2ZB 3TOMA 5JLIA 2PP4A 2HV7A 4HFKB 2MWQA 2ZXWC 4DBQA 5EGYA 1WGWA 3DJUB 2NG1A 2HMQA 2L6GA 3AOUA 3GEEA 4CSAA 1YDIA 2O9XA 2VASA 2HUJA 4BPMA 4K7BA 2Y3GA 5JP7A 3L8JA 2GAQA 1O5HA 2W9YA 3HLZA 3JSEO 4EBJA 1OCRC 2R7VA 3RW0A 2G3VA 3T4RA 3T9OA 1EA8A 5HSWA 4RD9A 3FDQA 3ZWIA 3EG9B 4ULWA 2PNOA 4D4XA 1NZEA 2L6HA 3TD7A 1M2VB 3R2PA 3EHMA 3UNGC 4AX2A 3SXYA 4E7SA 3JCUQ 4GYTA 1T9KA 5FZTA 3DM9B 3E9VA 4BEJA 1CGNA 1GM5A 2DB4A 2V3CC 1FMWA 2IXNA 1OXBA 1LKXA 1A7DA 1S05A 1TKNA 4NTAA 3K7DA 3TOLA 2CYDA 3POVA 3R7CA 3LNRA 5JRAA 4EHPA 4CDAA 1M2OA 4IAOA 4IRUA 4OIRF 4C7OB 1QQ3A 3ABKC 2IM8A 1A0BA 1H9GA 4RDAA 5KYYB 5AC5A 3GORA 4YT2A 3FMSA 2Q9CA 3G50A 5CI9A 3SP1A 3DE8A 5D91A 4G7OF 1BDJB 1Q0MA 2KK1A 2BL2A 2PX3A 3UGOA 3AG3C 3PHF2 2J9VA 1ZW2A 2VCBA 5KYUA 2IXPA 3O10A 5KYXB 5K0IA 3SNHA 4YT8A 4LLEA 4GEHA 4O6YA 4U5EE 1VTMP 4H54A 4GQHA 2G62A 3HNIA 1TFKB 2H7VC 3C8ZA 2VCCA 1SMYF 3DI5A 4YK5A 3S0XA 3AG2C 3DXJF 2HS5A 4NCQA 3U2LA 3JT1A 3O39A 5B1AC 2J0XA 2ZXOA 1NU9C 3RFYA 1BR1A 3CSKA 2XM0A 4ULVA 4I3MA 3W2WA 1AUEA 4N6CA 2CCYA 4R32A 1QKRA 2CW0F 3QVZA 3CQZA 5CI8A 1V74B 1OXKA 3B0VC 3EZHA 2DYRC 4U5FE 1AEPA 4IB4A 2YZSA 2R7UA 2XS8A 1D1BA 2GDCA 256BA 2J7PD 2PX0A 3DWWA 3EQLF 4PACA 3U9MA 3U8VA 4AL1A 4KBLA 1J8YF 3WG7C 2A6HF 5L0DA 5DQTA 4DRHB 4Q7CA 5BQGA 5L0GA 2B0HA 4DXWA 5L0CA 3LNMB 1RKEB 1D0ZA 3HKKA 1MNDA 1MMDA 2R9RB 1LPEA 1TFOB 4MVSA 3A9CA 5A6BD 2KQ9A 2AWCA 4KNWA 4JEBA 2R02A 4K1OA 4DBRA 2A69F 2XLMA 3EG9A 2KC3A 3ZTZA 2E87A 4A4AA 2H7OA 1K04A 2RD9A 1JAFA 3PDMP 1ORYA 1M2VA 4QDLA 4M63A 4CS9A 4WGYA 5DS6A 2LK4A 5KYUB 5A6BA 1L7CA 1B68A 2KSFA 5D92A 1ST6A 3US6A 1JPNA 2EPLX 3AG4C 3LAYA 3MYIA 2AVKA 3S9OA 2EINC 2JPUA 1BR2A 1OR2A 2EPOA 3C62A 2R05A 3GEHA 2D5RB 1VB5A 5DVWA 3V5YA 3LS1A 4OD4A 2QE9A 2MYSA 1TQGA 2HKVA 3C8GB 2J7PA 1TWHA 2ZXPA 1OCCC 1F1MA 2AP3A 1Q0DA 4QI2A 4LDQA 3EGDB 2R7SA 3LLIA 3KYIA 2EIMC 2Y3BA 5AC4A 1M6TA 1CGOA 2EPNA 3JZ0A 3QVYA 2PFDA 2AWYA 4W8PA 2OKUA
chains in the Genus database with same CATH topology
3AJMA 3C8GD 1KTMA 1QVXA 2YWAA 3GM2A 4R32A 3L8JA 2LK4A 4XEKA 4EBJA 2JX0A 3GM1A 1K40A 3TULA 2KK1A 3JYYA 1ZZPA 3C18A 3B71A 3RQGA 1WWPA 1KNYA 2Q00A 4XEFA 3S9OA 1K05A 2JPUA 1OW8A 2L6HA 3L8IA 1V4AA 1WTYA 4NQFA 3U3FA 3O10A 3RQFA 4XEVA 1JOGA 1UFBA 2PBEA 3C8GB 2L6FA 3MFNA 3U0CA 3C8GA 3BRJA 1OW6A 1PV3A 5F28E 3RQEA 1WOLA 3GM3A 3K7DA 1O3UA 4EBKA 1OW7A 2HSBA 3JZ0A 2L6GA 1K04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AJM A;  3C8G D;  1KTM A;  1QVX A;  2YWA A;  3GM2 A;  4R32 A;  3L8J A;  2LK4 A;  4XEK A;  4EBJ A;  2JX0 A;  3GM1 A;  1K40 A;  3TUL A;  2KK1 A;  3JYY A;  1ZZP A;  3C18 A;  3B71 A;  3RQG A;  1WWP A;  1KNY A;  2Q00 A;  4XEF A;  3S9O A;  1K05 A;  2JPU A;  1OW8 A;  2L6H A;  3L8I A;  1V4A A;  1WTY A;  4NQF A;  3U3F A;  3O10 A;  3RQF A;  4XEV A;  1JOG A;  1UFB A;  2PBE A;  3C8G B;  2L6F A;  3MFN A;  3U0C A;  3C8G A;  3BRJ A;  1OW6 A;  1PV3 A;  5F28 E;  3RQE A;  1WOL A;  3GM3 A;  3K7D A;  1O3U A;  4EBK A;  1OW7 A;  2HSB A;  3JZ0 A;  2L6G A;  1K04 A; 
#chains in the Genus database with same CATH topology
 3SXM A;  1NBB A;  1VOM A;  3B9Q A;  2VH3 A;  3K33 A;  3UMH A;  3VYW A;  4MTF A;  4KI2 A;  4XEK A;  4C7O A;  2G3K A;  1WN0 A;  5E3A A;  1MNE A;  2L9J A;  3V7O A;  1T6I A;  3EFO A;  4JJG A;  1T6U A;  4P9T A;  1YA9 A;  3S28 A;  2DI3 A;  4E18 A;  1EQ1 A;  2Q00 A;  3PMR A;  4U5B E;  4JTA B;  1ORS C;  4DJ9 A;  2XS1 A;  4HFF B;  4MS2 A;  4G7Z F;  4LAC B;  3SYN A;  3FOO A;  4XEV A;  2L81 A;  1UFB A;  4JE9 A;  4CS8 C;  1O87 A;  4C3B A;  1W2W A;  2FFH A;  2L6F A;  1LE2 A;  3LEO A;  4IAR A;  3U2M A;  4EKW A;  5IY5 C;  2WVO A;  4ZLD A;  4P9F A;  2Y3H A;  3TJ6 A;  2W4M A;  1NG1 A;  4YJW A;  4C3D A;  2BE5 F;  3SZR A;  1YAR O;  3IEE A;  1Z5Z A;  2YL1 A;  3I5P A;  1I5N A;  3ASN C;  1RCP A;  1APC A;  1LS1 A;  1Q0K A;  3QZC A;  3V5X A;  5B3S C;  3VAY A;  3GAN A;  4JCH A;  5JS5 A;  2J9B A;  2YWA A;  3K66 A;  3LS0 A;  1G4W R;  1JPJ A;  1DOW A;  2NUP A;  3RKO F;  4J32 B;  5DLJ A;  2Q9B A;  3L0I A;  3Q6N A;  2RSE B;  2X51 A;  4Z9J A;  3C7J A;  4CDY A;  2XL8 A;  1WAT A;  1WTY A;  1U89 A;  3A11 A;  1ZHZ A;  2CNW A;  3IQC A;  4NQF A;  5EHH A;  1NLX A;  5COG A;  1JOG A;  1D1A A;  3F46 A;  2J0W A;  4PJJ A;  3MFN A;  5DS5 A;  4XLP F;  3ZSU A;  5E2Q A;  3NMK A;  4EBB A;  3UMI A;  3GWN A;  2GA0 A;  1A41 A;  1T01 A;  2Z15 A;  5CIV A;  2Y69 C;  2AU5 A;  3EGX A;  1IZM A;  1GS9 A;  2KJG A;  3IQ5 A;  4I44 A;  1QLE C;  1QVX A;  3IQT A;  1JRA A;  2GFH A;  1A7E A;  4U5G A;  3ECS A;  3B29 A;  4JCZ A;  4MVU A;  1K40 A;  1VYI A;  4KNV A;  3KL4 A;  4YL1 A;  3J06 A;  5L3Q A;  3IPM O;  3DE9 A;  3X2Q C;  2XLV A;  4XEF A;  5COF A;  4CX9 A;  2OU6 A;  3L8I A;  1NFN A;  2R7T A;  3EZI A;  4WJ0 A;  4AL0 A;  4BJ5 A;  3LUT B;  3MYF A;  1C03 A;  1Z3I X;  2QY9 A;  4D4N A;  1WAS A;  2Q9A A;  3DM5 A;  2NSF A;  3AQC A;  1T6Q A;  4JRZ A;  3RF3 A;  3LLK A;  3TK0 A;  3OWT A;  4AE4 B;  3NYM A;  4IAQ A;  1MMN A;  4JIO A;  2LP4 A;  3AGT A;  4BJ1 A;  1EI7 A;  3JRT A;  4X0R A;  2OQM A;  2W45 A;  2WB7 A;  3M79 A;  2OEV A;  1ZU4 A;  3RYL A;  1VK5 A;  2KNH A;  4WGZ A;  2P1A A;  2YL0 A;  4J7T A;  2GWW A;  4MTO A;  4MVQ A;  4O7G A;  4BG0 A;  2Q7R A;  4HEA J;  4IJJ A;  3C8G D;  3RIP A;  2WZL A;  5AGF A;  3WHN A;  3H2U A;  3GOD A;  4JJF A;  3ZQV A;  1MQV A;  1VMA A;  2A1D D;  2YLG A;  3NRH A;  1ZU5 A;  1ZHY A;  3RQG A;  3M4C A;  3W8H A;  3SEO A;  1WWP A;  5HV9 A;  1FTS A;  3HNL A;  4PJM A;  1OW8 A;  2YQY A;  1C17 M;  3CZ6 A;  3PCV A;  3LEV A;  4U9D A;  1TWA A;  3FAJ A;  4PK4 A;  2UUH A;  2A68 F;  3S27 A;  4CS7 A;  5BQH A;  2YL3 A;  4RBN A;  3G4Z A;  1FFH A;  2WVQ A;  3KMI A;  4JEA A;  5KYN A;  5A6K A;  2YKZ A;  3C8G A;  1PV3 A;  3BEH A;  1Y4C A;  3QW1 A;  2HMZ A;  3TQO A;  5JT4 A;  4FES A;  3U9J A;  4EBK A;  2I8B A;  2WVN A;  4G7H F;  1LI5 A;  1D1C A;  4U5D E;  1D0Y A;  4EIY A;  1OR3 A;  3QTH A;  3B0P A;  5JSL A;  2HZ8 A;  4JTC B;  1N1C A;  2HSQ A;  5GPG B;  1E83 A;  4NC3 A;  4XWJ A;  3QMK A;  2R7X A;  1XZP A;  1RMV A;  3JRM O;  1FFT C;  3M15 A;  3T6J A;  3ZTM A;  3RVZ A;  1ZW3 A;  1J8M F;  4MVR A;  4BEM J;  4Q5S F;  2EPK X;  2EIK C;  2ICW G;  1R5I D;  1SZI A;  2W4B A;  3Q7G A;  2VB6 A;  3EFO B;  4FWV A;  2XLD A;  4Z9I A;  4DRI B;  3NKD A;  4A2N B;  2YRF A;  3EGX B;  4NTF A;  1GQA A;  1CGM E;  3U0C A;  1HE1 A;  2PF4 E;  5E33 A;  2XL4 A;  4XQ1 A;  3V5Z A;  2VC9 A;  4CS9 C;  2QNL A;  5BUO A;  4XPY A;  3HTK C;  2J9U A;  1FNT c;  4PR9 A;  3JTL O;  1E85 A;  3H2V A;  2PBE A;  1V55 C;  5L0I A;  3HJC A;  4LDK A;  4Z9H A;  3CAX A;  2IYL D;  2HJ3 A;  1NFO A;  1OCO C;  1OQC A;  2KW3 C;  2Y3D A;  3AGU A;  4W8K A;  3LES A;  3NDB B;  1ZZP A;  2Q3T A;  2XM4 A;  3JSZ A;  4C3E A;  5BQI A;  1K05 A;  4IWB A;  1I4Y A;  3S84 A;  1YJG A;  4O79 A;  1XZQ A;  4ANJ A;  1RJ9 B;  2IXM A;  3EHN A;  4LER A;  2H7B A;  4G0H A;  4CJO A;  4Q4Z F;  3FOP A;  3ZVR A;  3K1H A;  1VLT A;  1AVO B;  3K1I C;  1RJ9 A;  1LI7 A;  1PCX A;  2EPM X;  3FAP B;  1QSP A;  1CPQ A;  4L6R A;  2FGY A;  3ZC4 A;  4AK9 A;  3RVY A;  4MW8 A;  2D4U A;  3IHU A;  4F4B A;  1RKE A;  2F22 A;  5B1B C;  1HMD A;  1RKC A;  1QZX A;  4U9E A;  1JMW A;  2QTV A;  3EPV A;  2R7W A;  2ZPA A;  2J46 A;  3I5Q A;  4XPX A;  4OIO F;  3L1M A;  4PFO A;  1G8X A;  4K0D A;  3EH1 A;  1TWG A;  4PJL A;  2JX0 A;  4EUK B;  4HE8 D;  4PJN A;  2WZG A;  2R25 A;  2M64 A;  2FAP B;  3O55 A;  2XLE A;  1HE9 A;  1I4Z A;  2C04 A;  2P7V A;  3KPH A;  4MND A;  2R7Q A;  3UMK A;  3U3F A;  3HNK A;  5L0F A;  1FMV A;  3UGP A;  1PD1 A;  2YLI A;  2JD3 A;  4YWQ A;  1BR4 A;  1V54 C;  4JW1 A;  5EK0 A;  4B6I A;  3NMI A;  3U8P A;  3U3B A;  4JZA A;  2H8A A;  3GEI A;  3FVY A;  4FX5 A;  5B3I A;  4I1O B;  5L0H A;  2YHS A;  4J30 B;  1O3U A;  3N0T A;  1BZ4 A;  2KGO A;  2ASR A;  3ITF A;  4YT4 A;  3EGD A;  3DAF A;  3HNJ A;  3ZDL A;  4E7Z A;  4CS8 A;  2HFI A;  3VRC A;  1VYK A;  1E86 A;  3T6G B;  4J7Y A;  1H9T A;  3CEX A;  1KU2 A;  4IGG A;  2J45 A;  2I15 A;  2P6V A;  3IQ6 A;  5E3C A;  2XLW A;  4I1M A;  3WAQ A;  3ABM C;  1GGQ A;  3Q6M A;  3MBG A;  3KKB A;  5A6A A;  2A6E F;  2HJM A;  1H7I A;  4CSA C;  5KYY A;  3TJ5 A;  3W2V A;  5TJ5 E;  2YEV A;  1YAU O;  3O6X A;  5T3T A;  2XLO A;  1BBH A;  4CIP A;  3ATP A;  2CGE A;  1M56 C;  2MHR A;  5T3W A;  3S90 A;  4YL3 A;  1Z7Q c;  5KYW B;  1QPU A;  3DAG A;  5KYX A;  2UUI A;  2ZXR A;  1LE4 A;  2P61 A;  1KTM A;  2DYS C;  3L34 A;  4JKV A;  1EKY A;  3FXH A;  4N06 A;  3GM2 A;  4YT5 A;  4MQ9 F;  4DVZ A;  2KYH A;  3GM1 A;  3I4U A;  2LFF A;  4MW3 A;  2R03 A;  2LD6 A;  2OJQ A;  4CJG A;  2OJE D;  1YLM A;  2YLD A;  1XWJ A;  2IXO A;  3DKA A;  4BJ6 C;  4N4W A;  4E0H A;  1S7Z A;  3K1I A;  4XPW A;  1MMG A;  5L0J A;  2OEX A;  4G78 A;  2Y39 A;  2XXA B;  1Z23 A;  1OCZ C;  2NPU A;  1Z6A A;  2R7O A;  2YVK A;  1PD0 A;  2LCH A;  3K6B A;  5COM A;  3BRJ A;  1OW6 A;  2Q4F A;  4WAB A;  3RQE A;  2XXA A;  4XLN F;  2A0B A;  3JYH A;  1H6G A;  3RH3 A;  3DMD A;  3MX3 A;  4MTG A;  2OOC A;  2HSB A;  1ZVZ A;  2DGJ A;  1YZA A;  2C03 A;  3KH2 A;  5L3V A;  1FAP B;  2ZD9 A;  1A7V A;  1SR2 A;  4H4K C;  1HW2 A;  2XRH A;  1R4T A;  1TR2 A;  3FHD A;  3G4X A;  4OIN F;  2TMV P;  4MVZ A;  4OIP F;  3NYJ A;  5A69 A;  3B0U X;  4BJ6 A;  1OKK D;  1YA7 O;  1YZC A;  4NY3 A;  4EWC A;  3ZG1 A;  3MLG A;  5A6J A;  3AQB A;  1LS4 A;  3GWL A;  1Y6D A;  2A0U A;  4ER9 A;  3U5S A;  5KYW A;  3SXZ A;  2EIL C;  1UG7 A;  1Z63 A;  2OG2 A;  3EH2 A;  3NKE A;  4E0I A;  2XSE A;  2LQG A;  3KYJ A;  1E84 A;  4OIQ F;  1YYJ A;  2VCA A;  3DD7 A;  1D0X A;  1HW1 A;  2BC5 A;  2ETS A;  4CBE A;  3OA1 A;  3NG1 A;  3H65 A;  1SF8 A;  1HY5 A;  4YL0 A;  3X1O A;  5F5H A;  4KC9 A;  1ZHW A;  1ZHT A;  4JTD B;  3F47 A;  2NUP B;  4O6M A;  3WOD F;  1MMA A;  4MVM A;  3VF0 A;  2CNW D;  2XLH A;  3TUL A;  1C02 A;  3JYY A;  4MVO A;  3W8I A;  1IW7 F;  4LDR A;  3B71 A;  1JR8 A;  2J8W A;  5DS4 A;  2OCC C;  3M1C B;  3M4B A;  4JUR I;  5DQZ A;  4CIH A;  1YVI A;  1LVK A;  3EJN A;  1V4A A;  1U6H A;  1M57 C;  4YN0 B;  3Q7L A;  2V26 A;  4O6N A;  5T1D B;  4QI0 A;  2IOQ A;  3QW0 A;  3DZA A;  3UR3 C;  3W4Y A;  1Q0G A;  5FCL A;  1VLS A;  3S29 A;  2XL6 A;  3SXK A;  3VM6 A;  2WL8 A;  4E17 A;  3NMJ A;  4LLC A;  5F28 E;  3GM3 A;  2LSE A;  2QUP A;  3ASO C;  3NYL A;  3T6B A;  2L7A A;  4BJT A;  3ABL C;  4DRJ B;  1YYX A;  4DVY P;  1G4U S;  1G5Z A;  3C63 A;  4P6I C;  1Q0F A;  2NSG A;  5JVE A;  5JUA A;  1ORJ A;  1OW7 A;  1LM3 B;  4U5C E;  2B0J A;  4NTB A;  1LIH A;  4JVS A;  1SYQ A;  4U5H A;  3ZIB A;  1NSG B;  3AJM A;  1T5O A;  2YL7 A;  3OEO A;  4JC7 A;  2M4E A;  1CPR A;  4N6H A;  2HV6 A;  1E2X A;  4ONS A;  4CDV A;  1ZYR F;  1L3P A;  1RXQ A;  5F5F A;  2IBF A;  1FR0 A;  1U0B B;  4ZLC A;  2EIJ C;  3C18 A;  4DOZ A;  2J9W A;  1TWC A;  1HMO A;  2QLA A;  1KNY A;  3AG1 C;  3E70 C;  3N24 A;  4OD5 A;  4FAP B;  2NUT A;  1NU7 D;  2X0C A;  2CDQ A;  1OKK A;  2LIG A;  2WZF A;  3LJB A;  3RQF A;  1DOV A;  4XTK A;  2NUT B;  4AE4 A;  3DJN B;  4BJ5 C;  3ZQY A;  2LFD A;  2P0N A;  1ZHX A;  2R7R A;  4UDV A;  1WOL A;  4PFP A;  3N2Z B;  3TOM A;  5JLI A;  2PP4 A;  2HV7 A;  4HFK B;  2MWQ A;  2ZXW C;  4DBQ A;  5EGY A;  1WGW A;  3DJU B;  2NG1 A;  2HMQ A;  2L6G A;  3AOU A;  3GEE A;  4CSA A;  1YDI A;  2O9X A;  2VAS A;  2HUJ A;  4BPM A;  4K7B A;  2Y3G A;  5JP7 A;  3L8J A;  2GAQ A;  1O5H A;  2W9Y A;  3HLZ A;  3JSE O;  4EBJ A;  1OCR C;  2R7V A;  3RW0 A;  2G3V A;  3T4R A;  3T9O A;  1EA8 A;  5HSW A;  4RD9 A;  3FDQ A;  3ZWI A;  3EG9 B;  4ULW A;  2PNO A;  4D4X A;  1NZE A;  2L6H A;  3TD7 A;  1M2V B;  3R2P A;  3EHM A;  3UNG C;  4AX2 A;  3SXY A;  4E7S A;  3JCU Q;  4GYT A;  1T9K A;  5FZT A;  3DM9 B;  3E9V A;  4BEJ A;  1CGN A;  1GM5 A;  2DB4 A;  2V3C C;  1FMW A;  2IXN A;  1OXB A;  1LKX A;  1A7D A;  1S05 A;  1TKN A;  4NTA A;  3K7D A;  3TOL A;  2CYD A;  3POV A;  3R7C A;  3LNR A;  5JRA A;  4EHP A;  4CDA A;  1M2O A;  4IAO A;  4IRU A;  4OIR F;  4C7O B;  1QQ3 A;  3ABK C;  2IM8 A;  1A0B A;  1H9G A;  4RDA A;  5KYY B;  5AC5 A;  3GOR A;  4YT2 A;  3FMS A;  2Q9C A;  3G50 A;  5CI9 A;  3SP1 A;  3DE8 A;  5D91 A;  4G7O F;  1BDJ B;  1Q0M A;  2KK1 A;  2BL2 A;  2PX3 A;  3UGO A;  3AG3 C;  3PHF 2;  2J9V A;  1ZW2 A;  2VCB A;  5KYU A;  2IXP A;  3O10 A;  5KYX B;  5K0I A;  3SNH A;  4YT8 A;  4LLE A;  4GEH A;  4O6Y A;  4U5E E;  1VTM P;  4H54 A;  4GQH A;  2G62 A;  3HNI A;  1TFK B;  2H7V C;  3C8Z A;  2VCC A;  1SMY F;  3DI5 A;  4YK5 A;  3S0X A;  3AG2 C;  3DXJ F;  2HS5 A;  4NCQ A;  3U2L A;  3JT1 A;  3O39 A;  5B1A C;  2J0X A;  2ZXO A;  1NU9 C;  3RFY A;  1BR1 A;  3CSK A;  2XM0 A;  4ULV A;  4I3M A;  3W2W A;  1AUE A;  4N6C A;  2CCY A;  4R32 A;  1QKR A;  2CW0 F;  3QVZ A;  3CQZ A;  5CI8 A;  1V74 B;  1OXK A;  3B0V C;  3EZH A;  2DYR C;  4U5F E;  1AEP A;  4IB4 A;  2YZS A;  2R7U A;  2XS8 A;  1D1B A;  2GDC A;  256B A;  2J7P D;  2PX0 A;  3DWW A;  3EQL F;  4PAC A;  3U9M A;  3U8V A;  4AL1 A;  4KBL A;  1J8Y F;  3WG7 C;  2A6H F;  5L0D A;  5DQT A;  4DRH B;  4Q7C A;  5BQG A;  5L0G A;  2B0H A;  4DXW A;  5L0C A;  3LNM B;  1RKE B;  1D0Z A;  3HKK A;  1MND A;  1MMD A;  2R9R B;  1LPE A;  1TFO B;  4MVS A;  3A9C A;  5A6B D;  2KQ9 A;  2AWC A;  4KNW A;  4JEB A;  2R02 A;  4K1O A;  4DBR A;  2A69 F;  2XLM A;  3EG9 A;  2KC3 A;  3ZTZ A;  2E87 A;  4A4A A;  2H7O A;  1K04 A;  2RD9 A;  1JAF A;  3PDM P;  1ORY A;  1M2V A;  4QDL A;  4M63 A;  4CS9 A;  4WGY A;  5DS6 A;  2LK4 A;  5KYU B;  5A6B A;  1L7C A;  1B68 A;  2KSF A;  5D92 A;  1ST6 A;  3US6 A;  1JPN A;  2EPL X;  3AG4 C;  3LAY A;  3MYI A;  2AVK A;  3S9O A;  2EIN C;  2JPU A;  1BR2 A;  1OR2 A;  2EPO A;  3C62 A;  2R05 A;  3GEH A;  2D5R B;  1VB5 A;  5DVW A;  3V5Y A;  3LS1 A;  4OD4 A;  2QE9 A;  2MYS A;  1TQG A;  2HKV A;  3C8G B;  2J7P A;  1TWH A;  2ZXP A;  1OCC C;  1F1M A;  2AP3 A;  1Q0D A;  4QI2 A;  4LDQ A;  3EGD B;  2R7S A;  3LLI A;  3KYI A;  2EIM C;  2Y3B A;  5AC4 A;  1M6T A;  1CGO A;  2EPN A;  3JZ0 A;  3QVY A;  2PFD A;  2AWY A;  4W8P A;  2OKU A; 
#chains in the Genus database with same CATH homology
 3AJM A;  3C8G D;  1KTM A;  1QVX A;  2YWA A;  3GM2 A;  4R32 A;  3L8J A;  2LK4 A;  4XEK A;  4EBJ A;  2JX0 A;  3GM1 A;  1K40 A;  3TUL A;  2KK1 A;  3JYY A;  1ZZP A;  3C18 A;  3B71 A;  3RQG A;  1WWP A;  1KNY A;  2Q00 A;  4XEF A;  3S9O A;  1K05 A;  2JPU A;  1OW8 A;  2L6H A;  3L8I A;  1V4A A;  1WTY A;  4NQF A;  3U3F A;  3O10 A;  3RQF A;  4XEV A;  1JOG A;  1UFB A;  2PBE A;  3C8G B;  2L6F A;  3MFN A;  3U0C A;  3C8G A;  3BRJ A;  1OW6 A;  1PV3 A;  5F28 E;  3RQE A;  1WOL A;  3GM3 A;  3K7D A;  1O3U A;  4EBK A;  1OW7 A;  2HSB A;  3JZ0 A;  2L6G A;  1K04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...