4XEFA

Pyk2-fat complexed with leupaxin ld motif ld1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
136
structure length
136
Chain Sequence
MANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Protein-tyrosine kinase 2-beta
publication title Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4xefA00
2L6FA 1UFBA 3GM2A 3C8GA 1WTYA 4EBKA 1KNYA 1ZZPA 2LK4A 4XEVA 3L8JA 1OW6A 3MFNA 4EBJA 3O10A 2HSBA 3JYYA 1QVXA 2YWAA 3L8IA 3C18A 3S9OA 3GM3A 3K7DA 3RQGA 3U0CA 2JX0A 2L6HA 2Q00A 1PV3A 3GM1A 5F28E 1V4AA 3C8GB 4NQFA 1WOLA 3JZ0A 4R32A 3BRJA 3U3FA 3AJMA 1O3UA 1K04A 1K05A 1WWPA 4XEFA 3RQFA 3TULA 2KK1A 3RQEA 1OW7A 1JOGA 4XEKA 2L6GA 1OW8A 2PBEA 3B71A 3C8GD 1KTMA 2JPUA 1K40A
chains in the Genus database with same CATH superfamily
3ECSA 4I44A 1PD1A 1ZZPA 2YL1A 2G3VA 1TFOB 4NTFA 1A41A 1O5HA 2ZXRA 2HKVA 2QY9A 4CSAC 1S05A 3EZIA 2YVKA 1ZYRF 2HFIA 3EH2A 5JVEA 2NPUA 2OEXA 4MQ9F 3FAJA 1D1AA 3FOOA 3H65A 4DRIB 5EHHA 3LAYA 4HEAJ 3U5SA 1A7DA 5A6BA 1FFTC 3RH3A 3ABLC 4RDAA 4E0HA 1DOWA 2WZLA 3BRJA 2IYLD 3DMDA 3U3FA 4WGZA 1A0BA 1K04A 3Q6NA 1SF8A 3VRCA 3LNMB 4NTAA 3IQ6A 4MTGA 3SXYA 2XXAA 2M4EA 3R7CA 4E7ZA 2Y3BA 1MNDA 1MMNA 3QVYA 2ZXOA 3N0TA 1HY5A 5BQHA 4LDQA 3K1IC 4P9FA 4CDYA 3S0XA 4ULWA 5L3QA 3NMIA 4JTAB 5BUOA 2D5RB 3ZDLA 4D4XA 1APCA 2YQYA 3MFNA 1VYKA 5B1AC 2HJMA 2QNLA 2YWAA 3EG9B 4CS8A 3B0VC 2DI3A 5HSWA 4NY3A 4YJWA 4GYTA 3UR3C 3WAQA 1H6GA 1T9KA 2RSEB 4YL3A 5K0IA 3UNGC 2YL3A 5A6KA 3CZ6A 3LESA 3US6A 4K1OA 3SEOA 1GQAA 1OQCA 1FFHA 5AC4A 2Q4FA 4BJTA 3C7JA 4K7BA 1G5ZA 1HMOA 1VK5A 2XL6A 3QVZA 2XL4A 3AG4C 1R5ID 4C7OB 2R7OA 3NDBB 2YLIA 5KYUA 1SMYF 2VASA 4X0RA 4PJJA 3I5PA 3EFOA 3M79A 1Z63A 5COGA 3U8VA 3NYLA 3M15A 2CNWA 3B71A 1RKCA 3UMIA 2LIGA 2HSQA 4U5FE 1F1MA 4I1MA 1OCZC 1C17M 3L8JA 4XTKA 4IJJA 2P7VA 1T6IA 4IWBA 5T1DB 3RKOF 1Y4CA 5DS4A 4JURI 4MTFA 4LDRA 2VB6A 4PJLA 2R02A 3QMKA 1AUEA 3N2ZB 2QLAA 4YL1A 3TOMA 3EGXB 3OEOA 4NC3A 2L6HA 4NCQA 4XPXA 2WVNA 4DBRA 3B0PA 3DZAA 3ZG1A 1TQGA 4BJ1A 4CS8C 3S28A 3ZQVA 4CJGA 4YT8A 4QI0A 1ORJA 1CGNA 4U5DE 1LE4A 1YDIA 2IOQA 1WWPA 1JPNA 1Z3IX 2IXNA 4N06A 3U8PA 3NKEA 3CEXA 4EWCA 1WASA 1WATA 3NYMA 2HMQA 4PJMA 2H8AA 2LP4A 3U9MA 1E2XA 1WN0A 3FAPB 1V55C 3DXJF 2LCHA 3MX3A 2IBFA 4I3MA 3JSEO 1ZW3A 3M4CA 2Z15A 4JIOA 1NLXA 3PHF2 4HE8D 4OIQF 1JPJA 3IQCA 1D0XA 1VOMA 2A1DD 4HFKB 2J9VA 2YL0A 4OD4A 2R7VA 4UDVA 5A6BD 3GORA 3ZWIA 3LNRA 4BJ6A 1AEPA 3DD7A 3IPMO 4XQ1A 4ER9A 2EINC 3VAYA 1PD0A 4CIPA 1Z5ZA 2YLDA 1LI7A 1YARO 3AG3C 1GS9A 2YHSA 4IB4A 1J8YF 2C04A 4LLEA 3EG9A 4IAQA 4XEKA 4IGGA 5A6AA 2ZPAA 3ITFA 1OW8A 5E2QA 4DJ9A 4JVSA 1EKYA 1JRAA 2P6VA 3HTKC 4G7ZF 3EHMA 2L6FA 3L1MA 4JJGA 4Q7CA 5D92A 1TWGA 3W2WA 1WTYA 4DRHB 1VTMP 3ABKC 3G50A 3KL4A 3NRHA 4CBEA 1ORYA 2OG2A 1WGWA 2EIMC 2Y3DA 1E85A 2HSBA 3KH2A 3AGTA 2HV6A 2OJQA 3EFOB 2WVOA 4C7OA 4Q5SF 2OQMA 3BEHA 3AOUA 3DAGA 3OA1A 3T6GB 3T4RA 3O39A 3W8IA 5KYNA 3C8ZA 1N1CA 3EZHA 2WL8A 3G4ZA 1YAUO 3SYNA 3X1OA 1U6HA 4AL1A 1HW1A 2EPLX 4O6NA 3TJ5A 1K05A 4U5CE 1MMAA 4L6RA 4BJ6C 2PP4A 5BQGA 1FMWA 4CDAA 4FAPB 1Q0DA 3DAFA 3NKDA 5L0CA 2PBEA 2XRHA 4PR9A 1XZQA 1QKRA 4MVQA 4EBBA 4EBKA 3EGXA 4A2NB 2CGEA 3OWTA 3CSKA 3GM2A 4O7GA 5EGYA 4G7HF 1BBHA 2BE5F 3GANA 1D0ZA 1YYJA 2MWQA 5E33A 4KBLA 3RIPA 4MTOA 4PACA 1CPQA 4A4AA 4G0HA 3IQTA 4MNDA 3F47A 2FFHA 4J30B 3TK0A 3RVZA 2R7QA 3DKAA 4WABA 1ZHTA 4W8PA 2H7BA 4YT5A 4ANJA 1OXBA 3LS0A 4C3EA 3EGDA 2J45A 2QE9A 4BJ5A 5B3IA 4KNWA 2VH3A 3J06A 3FVYA 3H2VA 5GPGB 1O3UA 1RJ9B 3JRTA 3SZRA 1VYIA 5L0GA 2KK1A 1HE9A 1YA7O 2HUJA 2QUPA 3CAXA 1ST6A 1YJGA 4DXWA 4CIHA 1GM5A 2O9XA 4MVMA 2KQ9A 5T3TA 2R05A 4OIPF 1KTMA 2VC9A 4EKWA 4AK9A 3TQOA 4FESA 5KYWB 1YZCA 4Z9HA 1TR2A 2J0WA 2XLDA 2J9BA 4EUKB 1TWAA 2KSFA 1Q0FA 5AGFA 3S9OA 4ZLCA 1A7VA 1E86A 1HW2A 3ZVRA 3ZSUA 2R03A 4Z9IA 3RQGA 3V5YA 2FGYA 2NUTB 2XLVA 1FMVA 1PV3A 3EJNA 5L0DA 2WZFA 4AL0A 2R9RB 3UMKA 2IM8A 4J7YA 4P9TA 3TJ6A 3W2VA 3LLKA 1T6UA 1DOVA 3RQFA 3Q7GA 1A7EA 1M2OA 3V5XA 1Q0GA 2VCAA 1XZPA 5HV9A 1BR4A 2E87A 4FWVA 4MVUA 4BJ5C 1K40A 1NU7D 2KGOA 1L3PA 3V5ZA 4LERA 2KYHA 5L0HA 3AG1C 3X2QC 1ZHXA 1OCRC 1QLEC 1ZHWA 2XS8A 3EPVA 3IQ5A 1KU2A 4H54A 3C18A 3L0IA 4KI2A 4J32B 2AWCA 2P1AA 3GM3A 3FXHA 5F5FA 5DQZA 5D91A 2GDCA 2J8WA 2AWYA 1TWHA 2Q9AA 3JTLO 3HKKA 3DWWA 4YN0B 5FZTA 5DQTA 2A6HF 2OKUA 4U5BE 3HNJA 1FAPB 4O79A 2EPMX 2KC3A 3QW0A 4KNVA 5JS5A 2A6EF 3O6XA 3VYWA 2CYDA 2YZSA 3A11A 3LEOA 4MVZA 3T6BA 1CPRA 2EPNA 2G62A 4MVOA 3FMSA 4ULVA 5CI9A 5E3AA 5DLJA 3EGDB 4EHPA 4PFOA 2R7SA 1H9GA 3DE8A 1QSPA 3K33A 2KW3C 4GQHA 5KYXB 4W8KA 2LSEA 4Q4ZF 1I5NA 1I4ZA 2LK4A 4RD9A 4U5EE 1C02A 3FHDA 2L9JA 3HNKA 3AG2C 4OIRF 4JCHA 3M1CB 1RJ9A 1E83A 3LLIA 4QI2A 2NUPA 3MYFA 3U0CA 2BL2A 3JT1A 1NZEA 2L81A 4XWJA 2DB4A 5FCLA 3EHNA 3WG7C 3AJMA 1QQ3A 5KYWA 2W9YA 4JEAA 1BDJB 3ZTZA 2PFDA 3M4BA 1T01A 3IHUA 3ASOC 4JZAA 4OIOF 3JRMO 2JPUA 2NSFA 4M63A 2FAPB 2ZXPA 3MBGA 1Z23A 1ZU4A 3LS1A 4XLNF 2NUTA 3ZIBA 2NG1A 4C3BA 3S84A 4DVZA 1OXKA 3K66A 2V26A 3L8IA 4B6IA 5AC5A 3VF0A 2PX0A 4HFFB 4IAOA 4MW8A 3DJUB 1D1BA 5A69A 4YK5A 3L34A 3R2PA 2EIKC 2OEVA 1ZHZA 3GM1A 5E3CA 5TJ5E 1TFKB 2MHRA 3NG1A 4O6MA 1G4US 1PCXA 2OCCC 4DRJB 3GWLA 1VLTA 3I5QA 4JRZA 3AQCA 1RKEB 1SR2A 2XM4A 3B29A 3KYJA 4JE9A 2R7XA 4BPMA 1M6TA 4JW1A 1MQVA 1LI5A 3ZQYA 2AP3A 5L0IA 3HNLA 3SNHA 3B0UX 3QW1A 4J7TA 1LIHA 4H4KC 3DM5A 1T6QA 4CS9A 256BA 2GA0A 1RXQA 1LKXA 3C8GA 1KNYA 4JTDB 4KC9A 2Y3HA 4EBJA 2GFHA 3E70C 3O55A 3QZCA 1QVXA 4CDVA 5L3VA 4N6CA 1LS4A 4YT2A 3RYLA 1SZIA 2OU6A 1Z6AA 2HV7A 4JKVA 1IZMA 4PK4A 3S29A 3JYHA 3KKBA 1V4AA 4NQFA 1WOLA 1OKKA 3SXZA 2HMZA 3W8HA 4LACB 5B1BC 4AE4B 4ZLDA 5KYXA 5JP7A 4MVSA 2LD6A 3RF3A 2CW0F 3A9CA 3N24A 2LFFA 5L0FA 1H9TA 1GGQA 2B0HA 2NUPB 3MYIA 4E18A 1Q0KA 3C63A 1NG1A 2YLGA 2J9WA 3FDQA 1B68A 2ZD9A 1BR1A 1V54C 2KNHA 2Q9CA 3T9OA 2WB7A 2Y69C 1YLMA 3HJCA 2HS5A 4AX2A 2D4UA 1LPEA 2J7PD 3O10A 5T3WA 3WODF 2YRFA 4XPYA 3TD7A 2OOCA 5JSLA 4CS9C 4XPWA 3U2MA 3U2LA 1V74B 2XLHA 3DI5A 4ONSA 2UUHA 3H2UA 1M2VB 2EILC 3EH1A 1G4WR 5F28E 4F4BA 3MLGA 4EIYA 1R4TA 3GWNA 4N6HA 4I1OB 4GEHA 4JCZA 1I4YA 4BEMJ 3NYJA 1Q0MA 1CGOA 2RD9A 5COFA 1NFOA 2IXOA 1YVIA 1HE1A 3S90A 1JAFA 4LLCA 5B3SC 2W4MA 2JD3A 3GEEA 4U5GA 1LM3B 2ASRA 3LJBA 3LUTB 5KYYA 3GODA 1TKNA 3DE9A 5A6JA 1HMDA 1C03A 3UMHA 1O87A 4MVRA 4PFPA 4DVYP 2XLWA 2X0CA 5F5HA 2F22A 1OW6A 2J0XA 3IEEA 2XLEA 3DM9B 4NTBA 4LDKA 1BR2A 1QZXA 3NMJA 3GEHA 1RKEA 3C62A 3F46A 1LS1A 3B9QA 3FOPA 4CX9A 1CGME 2H7VC 2TMVP 4YL0A 3G4XA 3W4YA 2EPOA 4BG0A 1IW7F 1S7ZA 3C8GB 3E9VA 3ZC4A 5CIVA 1M57C 2R7RA 3SXKA 4JEBA 2CCYA 2MYSA 1G8XA 4U5HA 2GWWA 4IARA 1AVOB 1XWJA 2CDQA 3KMIA 2P61A 2AU5A 3K1HA 1E84A 3CQZA 4K0DA 1JOGA 2I15A 2L6GA 2XM0A 5IY5C 2BC5A 4YWQA 2XLOA 2ZXWC 3C8GD 4DOZA 5DS6A 3PCVA 3T6JA 2A68F 3PDMP 1MNEA 1UFBA 3VM6A 4D4NA 5COMA 2Y3GA 1LE2A 1NU9C 1NSGB 2WZGA 4OINF 1FNTc 2OJED 1QPUA 1TWCA 4WJ0A 4G7OF 2VCBA 4AE4A 2C03A 4BEJA 4JC7A 1VB5A 1JR8A 1EI7A 1YA9A 2DYSC 2J7PA 3WHNA 2G3KA 1OKKD 2IXMA 3S27A 4CJOA 2JX0A 3PMRA 3UGPA 1L7CA 2A69F 4E17A 2J9UA 2IXPA 2R25A 2M64A 2R7UA 2XSEA 2W4BA 5JT4A 3HNIA 2YEVA 3Q6MA 3POVA 4JTCB 2AVKA 2WVQA 1OR2A 4FX5A 3RW0A 4E0IA 5JRAA 3TULA 4N4WA 1SYQA 2Q3TA 4XLPF 2GAQA 1RCPA 1YYXA 1RMVA 3LEVA 3TOLA 1BZ4A 2KJGA 3V7OA 1D1CA 4CS7A 2V3CC 2EIJC 1M2VA 2LQGA 1ZHYA 2DGJA 3Q7LA 4XEVA 5CI8A 2XXAB 1H7IA 3QTHA 1ORSC 1NFNA 2HJ3A 2NSGA 2P0NA 3AGUA 2EPKX 1EQ1A 2B0JA 3K7DA 5KYYB 4P6IC 4G78A 2XL8A 2ICWG 3KYIA 2YKZA 4U9DA 5DVWA 2DYRC 2Q00A 2XS1A 1EA8A 5BQIA 3U9JA 4WGYA 2VCCA 3SP1A 4OD5A 2PX3A 4R32A 4MS2A 2PF4E 1JMWA 1NBBA 2X51A 2R7TA 1ZW2A 3ZTMA 4JJFA 3RVYA 1MMDA 2L7AA 4XEFA 1LVKA 3RFYA 2Q9BA 2PNOA 2XLMA 4QDLA 4U9EA 3ATPA 3GEIA 3AQBA 4YT4A 5DS5A 1VLSA 5JUAA 5L0JA 3SXMA 4CSAA 1OCOC 3HLZA 3EQLF 4E7SA 5KYUB 4O6YA 3JSZA 3K6BA 1T5OA 1J8MF 3NMKA 4PJNA 4RBNA 3U3BA 3JYYA 2I8BA 2Y39A 4Z9JA 4DBQA 3I4UA 2J46A 3ABMC 1MMGA 1FR0A 2ETSA 1ZU5A 2A0BA 1ZVZA 2HZ8A 1Y6DA 2LFDA 1M56C 3DJNB 2W45A 1W2WA 2A0UA 3JZ0A 1UG7A 3ASNC 1FTSA 3K1IA 1D0YA 1VMAA 2UUIA 3JCUQ 2CNWD 2Q7RA 3UGOA 2YL7A 3KPHA 4C3DA 3RQEA 1OR3A 1U89A 1OW7A 4IRUA 1U0BB 1Z7Qc 2R7WA 5EK0A 2QTVA 2H7OA 4MW3A 1OCCC 5JLIA 1YZAA
chains in the Genus database with same CATH topology
2L6FA 1UFBA 3GM2A 3C8GA 1WTYA 4EBKA 1KNYA 1ZZPA 2LK4A 4XEVA 3L8JA 1OW6A 3MFNA 4EBJA 3O10A 2HSBA 3JYYA 1QVXA 2YWAA 3L8IA 3C18A 3S9OA 3GM3A 3K7DA 3RQGA 3U0CA 2JX0A 2L6HA 2Q00A 1PV3A 3GM1A 5F28E 1V4AA 3C8GB 4NQFA 1WOLA 3JZ0A 4R32A 3BRJA 3U3FA 3AJMA 1O3UA 1K04A 1K05A 1WWPA 4XEFA 3RQFA 3TULA 2KK1A 3RQEA 1OW7A 1JOGA 4XEKA 2L6GA 1OW8A 2PBEA 3B71A 3C8GD 1KTMA 2JPUA 1K40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6F A;  1UFB A;  3GM2 A;  3C8G A;  1WTY A;  4EBK A;  1KNY A;  1ZZP A;  2LK4 A;  4XEV A;  3L8J A;  1OW6 A;  3MFN A;  4EBJ A;  3O10 A;  2HSB A;  3JYY A;  1QVX A;  2YWA A;  3L8I A;  3C18 A;  3S9O A;  3GM3 A;  3K7D A;  3RQG A;  3U0C A;  2JX0 A;  2L6H A;  2Q00 A;  1PV3 A;  3GM1 A;  5F28 E;  1V4A A;  3C8G B;  4NQF A;  1WOL A;  3JZ0 A;  4R32 A;  3BRJ A;  3U3F A;  3AJM A;  1O3U A;  1K04 A;  1K05 A;  1WWP A;  4XEF A;  3RQF A;  3TUL A;  2KK1 A;  3RQE A;  1OW7 A;  1JOG A;  4XEK A;  2L6G A;  1OW8 A;  2PBE A;  3B71 A;  3C8G D;  1KTM A;  2JPU A;  1K40 A; 
#chains in the Genus database with same CATH topology
 3ECS A;  4I44 A;  1PD1 A;  1ZZP A;  2YL1 A;  2G3V A;  1TFO B;  4NTF A;  1A41 A;  1O5H A;  2ZXR A;  2HKV A;  2QY9 A;  4CSA C;  1S05 A;  3EZI A;  2YVK A;  1ZYR F;  2HFI A;  3EH2 A;  5JVE A;  2NPU A;  2OEX A;  4MQ9 F;  3FAJ A;  1D1A A;  3FOO A;  3H65 A;  4DRI B;  5EHH A;  3LAY A;  4HEA J;  3U5S A;  1A7D A;  5A6B A;  1FFT C;  3RH3 A;  3ABL C;  4RDA A;  4E0H A;  1DOW A;  2WZL A;  3BRJ A;  2IYL D;  3DMD A;  3U3F A;  4WGZ A;  1A0B A;  1K04 A;  3Q6N A;  1SF8 A;  3VRC A;  3LNM B;  4NTA A;  3IQ6 A;  4MTG A;  3SXY A;  2XXA A;  2M4E A;  3R7C A;  4E7Z A;  2Y3B A;  1MND A;  1MMN A;  3QVY A;  2ZXO A;  3N0T A;  1HY5 A;  5BQH A;  4LDQ A;  3K1I C;  4P9F A;  4CDY A;  3S0X A;  4ULW A;  5L3Q A;  3NMI A;  4JTA B;  5BUO A;  2D5R B;  3ZDL A;  4D4X A;  1APC A;  2YQY A;  3MFN A;  1VYK A;  5B1A C;  2HJM A;  2QNL A;  2YWA A;  3EG9 B;  4CS8 A;  3B0V C;  2DI3 A;  5HSW A;  4NY3 A;  4YJW A;  4GYT A;  3UR3 C;  3WAQ A;  1H6G A;  1T9K A;  2RSE B;  4YL3 A;  5K0I A;  3UNG C;  2YL3 A;  5A6K A;  3CZ6 A;  3LES A;  3US6 A;  4K1O A;  3SEO A;  1GQA A;  1OQC A;  1FFH A;  5AC4 A;  2Q4F A;  4BJT A;  3C7J A;  4K7B A;  1G5Z A;  1HMO A;  1VK5 A;  2XL6 A;  3QVZ A;  2XL4 A;  3AG4 C;  1R5I D;  4C7O B;  2R7O A;  3NDB B;  2YLI A;  5KYU A;  1SMY F;  2VAS A;  4X0R A;  4PJJ A;  3I5P A;  3EFO A;  3M79 A;  1Z63 A;  5COG A;  3U8V A;  3NYL A;  3M15 A;  2CNW A;  3B71 A;  1RKC A;  3UMI A;  2LIG A;  2HSQ A;  4U5F E;  1F1M A;  4I1M A;  1OCZ C;  1C17 M;  3L8J A;  4XTK A;  4IJJ A;  2P7V A;  1T6I A;  4IWB A;  5T1D B;  3RKO F;  1Y4C A;  5DS4 A;  4JUR I;  4MTF A;  4LDR A;  2VB6 A;  4PJL A;  2R02 A;  3QMK A;  1AUE A;  3N2Z B;  2QLA A;  4YL1 A;  3TOM A;  3EGX B;  3OEO A;  4NC3 A;  2L6H A;  4NCQ A;  4XPX A;  2WVN A;  4DBR A;  3B0P A;  3DZA A;  3ZG1 A;  1TQG A;  4BJ1 A;  4CS8 C;  3S28 A;  3ZQV A;  4CJG A;  4YT8 A;  4QI0 A;  1ORJ A;  1CGN A;  4U5D E;  1LE4 A;  1YDI A;  2IOQ A;  1WWP A;  1JPN A;  1Z3I X;  2IXN A;  4N06 A;  3U8P A;  3NKE A;  3CEX A;  4EWC A;  1WAS A;  1WAT A;  3NYM A;  2HMQ A;  4PJM A;  2H8A A;  2LP4 A;  3U9M A;  1E2X A;  1WN0 A;  3FAP B;  1V55 C;  3DXJ F;  2LCH A;  3MX3 A;  2IBF A;  4I3M A;  3JSE O;  1ZW3 A;  3M4C A;  2Z15 A;  4JIO A;  1NLX A;  3PHF 2;  4HE8 D;  4OIQ F;  1JPJ A;  3IQC A;  1D0X A;  1VOM A;  2A1D D;  4HFK B;  2J9V A;  2YL0 A;  4OD4 A;  2R7V A;  4UDV A;  5A6B D;  3GOR A;  3ZWI A;  3LNR A;  4BJ6 A;  1AEP A;  3DD7 A;  3IPM O;  4XQ1 A;  4ER9 A;  2EIN C;  3VAY A;  1PD0 A;  4CIP A;  1Z5Z A;  2YLD A;  1LI7 A;  1YAR O;  3AG3 C;  1GS9 A;  2YHS A;  4IB4 A;  1J8Y F;  2C04 A;  4LLE A;  3EG9 A;  4IAQ A;  4XEK A;  4IGG A;  5A6A A;  2ZPA A;  3ITF A;  1OW8 A;  5E2Q A;  4DJ9 A;  4JVS A;  1EKY A;  1JRA A;  2P6V A;  3HTK C;  4G7Z F;  3EHM A;  2L6F A;  3L1M A;  4JJG A;  4Q7C A;  5D92 A;  1TWG A;  3W2W A;  1WTY A;  4DRH B;  1VTM P;  3ABK C;  3G50 A;  3KL4 A;  3NRH A;  4CBE A;  1ORY A;  2OG2 A;  1WGW A;  2EIM C;  2Y3D A;  1E85 A;  2HSB A;  3KH2 A;  3AGT A;  2HV6 A;  2OJQ A;  3EFO B;  2WVO A;  4C7O A;  4Q5S F;  2OQM A;  3BEH A;  3AOU A;  3DAG A;  3OA1 A;  3T6G B;  3T4R A;  3O39 A;  3W8I A;  5KYN A;  3C8Z A;  1N1C A;  3EZH A;  2WL8 A;  3G4Z A;  1YAU O;  3SYN A;  3X1O A;  1U6H A;  4AL1 A;  1HW1 A;  2EPL X;  4O6N A;  3TJ5 A;  1K05 A;  4U5C E;  1MMA A;  4L6R A;  4BJ6 C;  2PP4 A;  5BQG A;  1FMW A;  4CDA A;  4FAP B;  1Q0D A;  3DAF A;  3NKD A;  5L0C A;  2PBE A;  2XRH A;  4PR9 A;  1XZQ A;  1QKR A;  4MVQ A;  4EBB A;  4EBK A;  3EGX A;  4A2N B;  2CGE A;  3OWT A;  3CSK A;  3GM2 A;  4O7G A;  5EGY A;  4G7H F;  1BBH A;  2BE5 F;  3GAN A;  1D0Z A;  1YYJ A;  2MWQ A;  5E33 A;  4KBL A;  3RIP A;  4MTO A;  4PAC A;  1CPQ A;  4A4A A;  4G0H A;  3IQT A;  4MND A;  3F47 A;  2FFH A;  4J30 B;  3TK0 A;  3RVZ A;  2R7Q A;  3DKA A;  4WAB A;  1ZHT A;  4W8P A;  2H7B A;  4YT5 A;  4ANJ A;  1OXB A;  3LS0 A;  4C3E A;  3EGD A;  2J45 A;  2QE9 A;  4BJ5 A;  5B3I A;  4KNW A;  2VH3 A;  3J06 A;  3FVY A;  3H2V A;  5GPG B;  1O3U A;  1RJ9 B;  3JRT A;  3SZR A;  1VYI A;  5L0G A;  2KK1 A;  1HE9 A;  1YA7 O;  2HUJ A;  2QUP A;  3CAX A;  1ST6 A;  1YJG A;  4DXW A;  4CIH A;  1GM5 A;  2O9X A;  4MVM A;  2KQ9 A;  5T3T A;  2R05 A;  4OIP F;  1KTM A;  2VC9 A;  4EKW A;  4AK9 A;  3TQO A;  4FES A;  5KYW B;  1YZC A;  4Z9H A;  1TR2 A;  2J0W A;  2XLD A;  2J9B A;  4EUK B;  1TWA A;  2KSF A;  1Q0F A;  5AGF A;  3S9O A;  4ZLC A;  1A7V A;  1E86 A;  1HW2 A;  3ZVR A;  3ZSU A;  2R03 A;  4Z9I A;  3RQG A;  3V5Y A;  2FGY A;  2NUT B;  2XLV A;  1FMV A;  1PV3 A;  3EJN A;  5L0D A;  2WZF A;  4AL0 A;  2R9R B;  3UMK A;  2IM8 A;  4J7Y A;  4P9T A;  3TJ6 A;  3W2V A;  3LLK A;  1T6U A;  1DOV A;  3RQF A;  3Q7G A;  1A7E A;  1M2O A;  3V5X A;  1Q0G A;  2VCA A;  1XZP A;  5HV9 A;  1BR4 A;  2E87 A;  4FWV A;  4MVU A;  4BJ5 C;  1K40 A;  1NU7 D;  2KGO A;  1L3P A;  3V5Z A;  4LER A;  2KYH A;  5L0H A;  3AG1 C;  3X2Q C;  1ZHX A;  1OCR C;  1QLE C;  1ZHW A;  2XS8 A;  3EPV A;  3IQ5 A;  1KU2 A;  4H54 A;  3C18 A;  3L0I A;  4KI2 A;  4J32 B;  2AWC A;  2P1A A;  3GM3 A;  3FXH A;  5F5F A;  5DQZ A;  5D91 A;  2GDC A;  2J8W A;  2AWY A;  1TWH A;  2Q9A A;  3JTL O;  3HKK A;  3DWW A;  4YN0 B;  5FZT A;  5DQT A;  2A6H F;  2OKU A;  4U5B E;  3HNJ A;  1FAP B;  4O79 A;  2EPM X;  2KC3 A;  3QW0 A;  4KNV A;  5JS5 A;  2A6E F;  3O6X A;  3VYW A;  2CYD A;  2YZS A;  3A11 A;  3LEO A;  4MVZ A;  3T6B A;  1CPR A;  2EPN A;  2G62 A;  4MVO A;  3FMS A;  4ULV A;  5CI9 A;  5E3A A;  5DLJ A;  3EGD B;  4EHP A;  4PFO A;  2R7S A;  1H9G A;  3DE8 A;  1QSP A;  3K33 A;  2KW3 C;  4GQH A;  5KYX B;  4W8K A;  2LSE A;  4Q4Z F;  1I5N A;  1I4Z A;  2LK4 A;  4RD9 A;  4U5E E;  1C02 A;  3FHD A;  2L9J A;  3HNK A;  3AG2 C;  4OIR F;  4JCH A;  3M1C B;  1RJ9 A;  1E83 A;  3LLI A;  4QI2 A;  2NUP A;  3MYF A;  3U0C A;  2BL2 A;  3JT1 A;  1NZE A;  2L81 A;  4XWJ A;  2DB4 A;  5FCL A;  3EHN A;  3WG7 C;  3AJM A;  1QQ3 A;  5KYW A;  2W9Y A;  4JEA A;  1BDJ B;  3ZTZ A;  2PFD A;  3M4B A;  1T01 A;  3IHU A;  3ASO C;  4JZA A;  4OIO F;  3JRM O;  2JPU A;  2NSF A;  4M63 A;  2FAP B;  2ZXP A;  3MBG A;  1Z23 A;  1ZU4 A;  3LS1 A;  4XLN F;  2NUT A;  3ZIB A;  2NG1 A;  4C3B A;  3S84 A;  4DVZ A;  1OXK A;  3K66 A;  2V26 A;  3L8I A;  4B6I A;  5AC5 A;  3VF0 A;  2PX0 A;  4HFF B;  4IAO A;  4MW8 A;  3DJU B;  1D1B A;  5A69 A;  4YK5 A;  3L34 A;  3R2P A;  2EIK C;  2OEV A;  1ZHZ A;  3GM1 A;  5E3C A;  5TJ5 E;  1TFK B;  2MHR A;  3NG1 A;  4O6M A;  1G4U S;  1PCX A;  2OCC C;  4DRJ B;  3GWL A;  1VLT A;  3I5Q A;  4JRZ A;  3AQC A;  1RKE B;  1SR2 A;  2XM4 A;  3B29 A;  3KYJ A;  4JE9 A;  2R7X A;  4BPM A;  1M6T A;  4JW1 A;  1MQV A;  1LI5 A;  3ZQY A;  2AP3 A;  5L0I A;  3HNL A;  3SNH A;  3B0U X;  3QW1 A;  4J7T A;  1LIH A;  4H4K C;  3DM5 A;  1T6Q A;  4CS9 A;  256B A;  2GA0 A;  1RXQ A;  1LKX A;  3C8G A;  1KNY A;  4JTD B;  4KC9 A;  2Y3H A;  4EBJ A;  2GFH A;  3E70 C;  3O55 A;  3QZC A;  1QVX A;  4CDV A;  5L3V A;  4N6C A;  1LS4 A;  4YT2 A;  3RYL A;  1SZI A;  2OU6 A;  1Z6A A;  2HV7 A;  4JKV A;  1IZM A;  4PK4 A;  3S29 A;  3JYH A;  3KKB A;  1V4A A;  4NQF A;  1WOL A;  1OKK A;  3SXZ A;  2HMZ A;  3W8H A;  4LAC B;  5B1B C;  4AE4 B;  4ZLD A;  5KYX A;  5JP7 A;  4MVS A;  2LD6 A;  3RF3 A;  2CW0 F;  3A9C A;  3N24 A;  2LFF A;  5L0F A;  1H9T A;  1GGQ A;  2B0H A;  2NUP B;  3MYI A;  4E18 A;  1Q0K A;  3C63 A;  1NG1 A;  2YLG A;  2J9W A;  3FDQ A;  1B68 A;  2ZD9 A;  1BR1 A;  1V54 C;  2KNH A;  2Q9C A;  3T9O A;  2WB7 A;  2Y69 C;  1YLM A;  3HJC A;  2HS5 A;  4AX2 A;  2D4U A;  1LPE A;  2J7P D;  3O10 A;  5T3W A;  3WOD F;  2YRF A;  4XPY A;  3TD7 A;  2OOC A;  5JSL A;  4CS9 C;  4XPW A;  3U2M A;  3U2L A;  1V74 B;  2XLH A;  3DI5 A;  4ONS A;  2UUH A;  3H2U A;  1M2V B;  2EIL C;  3EH1 A;  1G4W R;  5F28 E;  4F4B A;  3MLG A;  4EIY A;  1R4T A;  3GWN A;  4N6H A;  4I1O B;  4GEH A;  4JCZ A;  1I4Y A;  4BEM J;  3NYJ A;  1Q0M A;  1CGO A;  2RD9 A;  5COF A;  1NFO A;  2IXO A;  1YVI A;  1HE1 A;  3S90 A;  1JAF A;  4LLC A;  5B3S C;  2W4M A;  2JD3 A;  3GEE A;  4U5G A;  1LM3 B;  2ASR A;  3LJB A;  3LUT B;  5KYY A;  3GOD A;  1TKN A;  3DE9 A;  5A6J A;  1HMD A;  1C03 A;  3UMH A;  1O87 A;  4MVR A;  4PFP A;  4DVY P;  2XLW A;  2X0C A;  5F5H A;  2F22 A;  1OW6 A;  2J0X A;  3IEE A;  2XLE A;  3DM9 B;  4NTB A;  4LDK A;  1BR2 A;  1QZX A;  3NMJ A;  3GEH A;  1RKE A;  3C62 A;  3F46 A;  1LS1 A;  3B9Q A;  3FOP A;  4CX9 A;  1CGM E;  2H7V C;  2TMV P;  4YL0 A;  3G4X A;  3W4Y A;  2EPO A;  4BG0 A;  1IW7 F;  1S7Z A;  3C8G B;  3E9V A;  3ZC4 A;  5CIV A;  1M57 C;  2R7R A;  3SXK A;  4JEB A;  2CCY A;  2MYS A;  1G8X A;  4U5H A;  2GWW A;  4IAR A;  1AVO B;  1XWJ A;  2CDQ A;  3KMI A;  2P61 A;  2AU5 A;  3K1H A;  1E84 A;  3CQZ A;  4K0D A;  1JOG A;  2I15 A;  2L6G A;  2XM0 A;  5IY5 C;  2BC5 A;  4YWQ A;  2XLO A;  2ZXW C;  3C8G D;  4DOZ A;  5DS6 A;  3PCV A;  3T6J A;  2A68 F;  3PDM P;  1MNE A;  1UFB A;  3VM6 A;  4D4N A;  5COM A;  2Y3G A;  1LE2 A;  1NU9 C;  1NSG B;  2WZG A;  4OIN F;  1FNT c;  2OJE D;  1QPU A;  1TWC A;  4WJ0 A;  4G7O F;  2VCB A;  4AE4 A;  2C03 A;  4BEJ A;  4JC7 A;  1VB5 A;  1JR8 A;  1EI7 A;  1YA9 A;  2DYS C;  2J7P A;  3WHN A;  2G3K A;  1OKK D;  2IXM A;  3S27 A;  4CJO A;  2JX0 A;  3PMR A;  3UGP A;  1L7C A;  2A69 F;  4E17 A;  2J9U A;  2IXP A;  2R25 A;  2M64 A;  2R7U A;  2XSE A;  2W4B A;  5JT4 A;  3HNI A;  2YEV A;  3Q6M A;  3POV A;  4JTC B;  2AVK A;  2WVQ A;  1OR2 A;  4FX5 A;  3RW0 A;  4E0I A;  5JRA A;  3TUL A;  4N4W A;  1SYQ A;  2Q3T A;  4XLP F;  2GAQ A;  1RCP A;  1YYX A;  1RMV A;  3LEV A;  3TOL A;  1BZ4 A;  2KJG A;  3V7O A;  1D1C A;  4CS7 A;  2V3C C;  2EIJ C;  1M2V A;  2LQG A;  1ZHY A;  2DGJ A;  3Q7L A;  4XEV A;  5CI8 A;  2XXA B;  1H7I A;  3QTH A;  1ORS C;  1NFN A;  2HJ3 A;  2NSG A;  2P0N A;  3AGU A;  2EPK X;  1EQ1 A;  2B0J A;  3K7D A;  5KYY B;  4P6I C;  4G78 A;  2XL8 A;  2ICW G;  3KYI A;  2YKZ A;  4U9D A;  5DVW A;  2DYR C;  2Q00 A;  2XS1 A;  1EA8 A;  5BQI A;  3U9J A;  4WGY A;  2VCC A;  3SP1 A;  4OD5 A;  2PX3 A;  4R32 A;  4MS2 A;  2PF4 E;  1JMW A;  1NBB A;  2X51 A;  2R7T A;  1ZW2 A;  3ZTM A;  4JJF A;  3RVY A;  1MMD A;  2L7A A;  4XEF A;  1LVK A;  3RFY A;  2Q9B A;  2PNO A;  2XLM A;  4QDL A;  4U9E A;  3ATP A;  3GEI A;  3AQB A;  4YT4 A;  5DS5 A;  1VLS A;  5JUA A;  5L0J A;  3SXM A;  4CSA A;  1OCO C;  3HLZ A;  3EQL F;  4E7S A;  5KYU B;  4O6Y A;  3JSZ A;  3K6B A;  1T5O A;  1J8M F;  3NMK A;  4PJN A;  4RBN A;  3U3B A;  3JYY A;  2I8B A;  2Y39 A;  4Z9J A;  4DBQ A;  3I4U A;  2J46 A;  3ABM C;  1MMG A;  1FR0 A;  2ETS A;  1ZU5 A;  2A0B A;  1ZVZ A;  2HZ8 A;  1Y6D A;  2LFD A;  1M56 C;  3DJN B;  2W45 A;  1W2W A;  2A0U A;  3JZ0 A;  1UG7 A;  3ASN C;  1FTS A;  3K1I A;  1D0Y A;  1VMA A;  2UUI A;  3JCU Q;  2CNW D;  2Q7R A;  3UGO A;  2YL7 A;  3KPH A;  4C3D A;  3RQE A;  1OR3 A;  1U89 A;  1OW7 A;  4IRU A;  1U0B B;  1Z7Q c;  2R7W A;  5EK0 A;  2QTV A;  2H7O A;  4MW3 A;  1OCC C;  5JLI A;  1YZA A; 
#chains in the Genus database with same CATH homology
 2L6F A;  1UFB A;  3GM2 A;  3C8G A;  1WTY A;  4EBK A;  1KNY A;  1ZZP A;  2LK4 A;  4XEV A;  3L8J A;  1OW6 A;  3MFN A;  4EBJ A;  3O10 A;  2HSB A;  3JYY A;  1QVX A;  2YWA A;  3L8I A;  3C18 A;  3S9O A;  3GM3 A;  3K7D A;  3RQG A;  3U0C A;  2JX0 A;  2L6H A;  2Q00 A;  1PV3 A;  3GM1 A;  5F28 E;  1V4A A;  3C8G B;  4NQF A;  1WOL A;  3JZ0 A;  4R32 A;  3BRJ A;  3U3F A;  3AJM A;  1O3U A;  1K04 A;  1K05 A;  1WWP A;  4XEF A;  3RQF A;  3TUL A;  2KK1 A;  3RQE A;  1OW7 A;  1JOG A;  4XEK A;  2L6G A;  1OW8 A;  2PBE A;  3B71 A;  3C8G D;  1KTM A;  2JPU A;  1K40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...