4CX9A

The 5-coordinate proximal no complex of cytochrome c prime from shewanella frigidimarina
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
128
structure length
128
Chain Sequence
NFEEPADAIEYRQAAFGLIAYNFGDMGAMLKGKKPFDAAVFSTRADNVAALSKIPHEGFIAGSDKGDTEALAKIWQDKADFDSKMTAFQDNAAALAVAAKSSDQNNIKQAFANTGKSCKGCHDVYKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Control of the Binding of Diatomic Gases to Cytochrome C'.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Electron transport
molecule keywords CYTOCHROME C, CLASS II
total genus 55
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4cx9A00
1MQVA 5JSLA 3TOLA 4IARA 5JVEA 2XLDA 5AGFA 1E84A 1YZAA 3M4BA 4WGZA 3QW0A 5JS5A 4IAQA 4JEAA 2J9BA 2XL6A 4JEBA 3QW1A 5JUAA 2XLOA 2YLDA 1E83A 1NBBA 3M15A 3NMJA 3DE8A 2XM4A 4CIPA 4ULVA 2XLMA 4D4NA 1LM3B 3M79A 1EKYA 4U9DA 4IB4A 2J8WA 2XLWA 4D4XA 1E85A 3IQ5A 4N6HA 3M4CA 2BC5A 3VRCA 2YLGA 3NMKA 1YYJA 4U9EA 4WGYA 5JP7A 4CJGA 3HNKA 1YZCA 1RCPA 2YLIA 2YL0A 3FOPA 4CJOA 1S05A 2YKZA 2XLVA 1QPUA 3QVZA 2XL8A 1BBHA 1CGNA 3TOMA 3ZTMA 4EIYA 2XLHA 5JRAA 4JKVA 256BA 4ER9A 3C62A 1E86A 1JAFA 3L1MA 1CPRA 3DE9A 4CX9A 4CDAA 5B3IA 3HNJA 3FOOA 1M6TA 1YYXA 3QVYA 4CDYA 2XM0A 5JT4A 3ZQVA 2YL7A 2QLAA 4N4WA 2CCYA 4NC3A 5JLIA 3ZQYA 4JE9A 3ZTZA 1CGOA 1APCA 3HNLA 1GQAA 2YL3A 3U8PA 3IQ6A 1QQ3A 3C63A 3NMIA 4L6RA 4CDVA 3ZWIA 2XLEA 1CPQA 3HNIA 1A7VA 2YL1A
chains in the Genus database with same CATH superfamily
2A0UA 1D0XA 1Q0GA 2BL2A 4IARA 5JVEA 4FWVA 5AGFA 2M64A 3A9CA 1RKCA 1YZAA 2L9JA 2MWQA 2R7TA 1ZZPA 1AUEA 4WGZA 1RMVA 2YWAA 1LKXA 2D5RB 3QW0A 3B71A 1AVOB 5A6BD 2A69F 2GFHA 3RF3A 1HW2A 3VYWA 2YRFA 1OKKA 3NKEA 4PJJA 1SR2A 1TWHA 2AU5A 5AC5A 2R7UA 4BJ6A 3QW1A 4MW8A 2FAPB 1U6HA 2HSBA 4O79A 4BPMA 1T6UA 4YT4A 3U9JA 3VAYA 3B0VC 5DVWA 1XZPA 4N6CA 1NBBA 4RBNA 1QVXA 2XL4A 3M15A 3AOUA 3NMJA 1D0ZA 3B0PA 3SP1A 3DE8A 3T6GB 2MHRA 4DRJB 1V55C 3ITFA 5F5FA 3H2UA 4AE4A 4MVZA 4W8PA 1BZ4A 1QZXA 2WZLA 3RVZA 1FNTc 2P1AA 1LPEA 3GODA 3FAPB 4IB4A 2J0XA 5F5HA 4BJ1A 3UGPA 1XWJA 4OIRF 1IW7F 2EPKX 1E85A 1G4US 2B0JA 2ZXWC 3QZCA 1YDIA 2BC5A 2GAQA 3H65A 4PJNA 4U9EA 3AJMA 5JP7A 3K66A 4CJGA 2R7OA 3GEIA 4G7OF 2F22A 1ZHTA 3CSKA 1T6IA 2J45A 4XTKA 1Z63A 3R2PA 4LDQA 4MVOA 4JC7A 2VASA 2JX0A 3WODF 3IHUA 2OEVA 3IEEA 4LDKA 2H7BA 5DS5A 3DMDA 3FOPA 2IOQA 4MVRA 4NQFA 2IXOA 2YZSA 4CJOA 2CYDA 3I5QA 2L6FA 2LIGA 3ZDLA 2PF4E 4DVZA 2KW3C 2BE5F 4YL0A 2J0WA 3ZVRA 1C03A 4R32A 3QVZA 3S27A 3RIPA 1CGNA 2AVKA 3TOMA 2R05A 1WN0A 5L3QA 5L0DA 2EPLX 3AGTA 3C8GD 1RKEA 1BDJB 3MYFA 2XLHA 3M1CB 3W8IA 1G4WR 1KTMA 3VF0A 4PJMA 1R5ID 3J06A 3LESA 4OIQF 3EFOB 3S90A 1Z3IX 256BA 4MVSA 4NY3A 3W4YA 3K1HA 3U5SA 3LLIA 3U9MA 1E86A 1CPRA 1DOWA 3EQLF 4NCQA 1FFTC 1EA8A 1M2VB 4JTDB 4NTAA 4H54A 2XXAB 3B0UX 3TULA 3HNJA 5BQGA 2W4BA 3X2QC 4J7YA 4CBEA 5CI8A 4PR9A 2W45A 4H4KC 4OD5A 1L3PA 3HKKA 4B6IA 3QVYA 1M56C 2KJGA 4CSAC 2L6HA 1FR0A 3T6JA 2HZ8A 2XM0A 3ZQVA 1B68A 2C04A 2CNWD 1A0BA 4XEFA 1T6QA 2QUPA 4E18A 3ZQYA 1HE9A 1CGOA 1KU2A 3ABLC 3N0TA 4CSAA 1NLXA 2PBEA 3HNLA 4CS8A 4IWBA 1GQAA 3EPVA 1PCXA 3U8PA 3IQ6A 2DGJA 3TK0A 1OXBA 4P9TA 1VTMP 1HW1A 2PX3A 2VCCA 1HMOA 4C7OB 2R7VA 2Q3TA 1FFHA 3DAGA 2CW0F 3ZWIA 5A6AA 2XLEA 2ZPAA 3KYJA 1G8XA 2KQ9A 4WJ0A 3CZ6A 1A7VA 3RYLA 1EI7A 1T01A 4MTGA 2OQMA 2YQYA 4MNDA 2LP4A 5JSLA 3GEEA 2HJMA 2G3KA 3BRJA 1LE4A 3QTHA 5B3SC 1E84A 2A0BA 3U3FA 1HY5A 1UG7A 4O6YA 3SZRA 1ORSC 3C7JA 2KSFA 3V5ZA 5A6BA 1ZHYA 1LS1A 4XEVA 1RJ9B 2ZXRA 4AK9A 5JS5A 4J7TA 4YT2A 5KYUB 4YT5A 2D4UA 3JCUQ 4HE8D 5IY5C 2OKUA 1Q0DA 4JEBA 4Q4ZF 2YLDA 1E83A 2IBFA 1ZHXA 3G4ZA 3DWWA 4O7GA 4O6MA 1Z23A 3SNHA 2YEVA 4ZLDA 3U0CA 2G62A 4HFKB 1OCOC 1YLMA 3AG4C 1ZW3A 2W9YA 1L7CA 3K1IA 5L0CA 2HFIA 2ZXOA 1RJ9A 2WVOA 2XLMA 4ULVA 5L0IA 4BEJA 1LM3B 3E70C 4XPWA 1YA9A 4QDLA 2Q7RA 1PV3A 4RDAA 5A6KA 3MFNA 2XLWA 1VOMA 2RSEB 3O10A 1RXQA 2DI3A 4M63A 3EH1A 1ZHWA 2ZXPA 3NMKA 1YYJA 1OR3A 2IYLD 3LAYA 4U5BE 3SXZA 1U0BB 1A41A 3C18A 2NG1A 3FXHA 2Y3BA 1NSGB 1HMDA 4PACA 1RCPA 1M2VA 1TWAA 2YVKA 3V5YA 2GDCA 2B0HA 2W4MA 2R7QA 1H7IA 1J8MF 1C02A 3UMHA 5CIVA 3EG9A 5E33A 1QKRA 1TR2A 1IZMA 3RQGA 2Z15A 1LI7A 4LLCA 4NTBA 5E3AA 1MMAA 2M4EA 1R4TA 2EIKC 3B9QA 3JT1A 1YARO 4LDRA 4LLEA 4XLNF 3DAFA 1BBHA 1WOLA 2HSQA 3KH2A 2UUIA 3Q6NA 3ZTMA 4CIHA 2CGEA 3NYMA 4O6NA 2H7OA 3AG3C 2XS8A 1JMWA 5DQZA 5COFA 5B1BC 4E7ZA 2R7SA 3L8IA 4OD4A 1SF8A 3SYNA 1NFOA 1JAFA 5FZTA 2EINC 1BR1A 2Q4FA 4JCZA 2IXMA 5D92A 2YHSA 4CX9A 2KNHA 4CDAA 4JJFA 2AP3A 2VH3A 4DBQA 3C8GB 5L0HA 4P6IC 1M6TA 1CGME 3HTKC 3LEOA 3E9VA 4LERA 2CDQA 2EIJC 2V3CC 5L3VA 3AGUA 2P7VA 2MYSA 2Q9CA 4C3DA 5COMA 3JRMO 3GEHA 5JT4A 2NPUA 2EIMC 2QLAA 2L7AA 2A1DD 2CCYA 1ZYRF 3F46A 3F47A 3ASNC 3MYIA 4NC3A 4XWJA 4YK5A 1Y4CA 4JE9A 1AEPA 2PNOA 1I5NA 3PCVA 4K7BA 4KNWA 1JRAA 3DD7A 3KPHA 3RKOF 1MMGA 4U5CE 3ZTZA 1APCA 4C3EA 4MTOA 1JPNA 3DKAA 4AL0A 1QSPA 2HJ3A 4HEAJ 5KYUA 2VCAA 4U5EE 1OKKD 5F28E 3OEOA 1VYIA 4L6RA 3RVYA 4CS9A 3US6A 3FMSA 3W8HA 2VCBA 4Q7CA 4JRZA 3R7CA 4U5GA 4ANJA 1I4ZA 4X0RA 2AWCA 1VYKA 2YL1A 2WZFA 1JOGA 1XZQA 3EZHA 2NUTA 3X1OA 4K0DA 2R7XA 4J30B 4G7HF 3TOLA 2CNWA 2LQGA 1DOVA 3K33A 4CS9C 4PJLA 4CS7A 2QE9A 2OU6A 2OJED 3DXJF 3I5PA 5FCLA 3JRTA 2Y3GA 3DZAA 3IQCA 2OEXA 1I4YA 2ZD9A 1U89A 3GM3A 4JEAA 2J9BA 4F4BA 2ASRA 2XRHA 3EGXB 2WB7A 3MBGA 2OCCC 2XL6A 5JUAA 1H6GA 2XLOA 2IXNA 3ABMC 1E2XA 4DVYP 4GEHA 4Q5SF 2FFHA 4J32B 3LJBA 1QLEC 1WATA 3FVYA 4YJWA 4DXWA 2Y39A 2I15A 4A2NB 4BJ6C 2R9RB 4IAOA 2HS5A 4KC9A 2A6EF 3VM6A 1TQGA 4MQ9F 4D4NA 3EG9B 2KGOA 1MNEA 4EBKA 1FTSA 3RH3A 1K04A 2QTVA 3G50A 3JSZA 4U9DA 5TJ5E 3QMKA 2P6VA 1EKYA 4I3MA 2J8WA 3S28A 3U8VA 4LACB 5CI9A 3GWNA 4G78A 2DYSC 2Y3HA 5DQTA 3K7DA 4N6HA 3M4CA 1VLTA 4DOZA 3U3BA 1D1CA 2LFDA 4JIOA 4EKWA 2ICWG 3HNKA 1T9KA 3RFYA 2ETSA 2IM8A 1YZCA 3UMIA 1LI5A 1YVIA 2Y3DA 2YLIA 3ASOC 3UGOA 4QI2A 2GWWA 1MMDA 1ORYA 2YL0A 3C8GA 5A69A 3JYYA 3GM1A 1S05A 2JD3A 1VLSA 1ZU4A 2YKZA 2J9UA 3UR3C 5BQIA 3NG1A 1G5ZA 3NYJA 2R25A 4MVQA 5KYNA 4EHPA 3K6BA 3EH2A 4DRIB 1TWGA 1SZIA 2GA0A 3AG2C 4I44A 3SXYA 3EGDA 1OW6A 1VMAA 2PP4A 5JRAA 2WVQA 4JKVA 5HSWA 5T3WA 4ULWA 4E7SA 4ER9A 1K05A 2WVNA 3C62A 4P9FA 2A6HF 2KC3A 4YT8A 3G4XA 3OA1A 3POVA 5L0GA 3KMIA 4C7OA 3PMRA 1VB5A 4JTCB 4BG0A 3AQBA 1WGWA 3N2ZB 3SEOA 4OIPF 3EJNA 3CEXA 4RD9A 3FOOA 4K1OA 4PFOA 2HMZA 3GM2A 3SXMA 1YYXA 1FMVA 3KL4A 4MVMA 5T1DB 2HV7A 3L8JA 3WG7C 3WAQA 5EGYA 3FDQA 4CDYA 4MVUA 3MLGA 1W2WA 3JZ0A 1EQ1A 2EPMX 3GANA 2VB6A 5DS6A 1BR4A 1D1BA 1TFOB 2NUPB 1OQCA 4N4WA 2LCHA 4QI0A 4IJJA 5GPGB 1GS9A 2NSFA 3DJUB 3EHNA 3DJNB 1MNDA 3RQFA 2FGYA 2R7WA 4FX5A 3EZIA 3W2WA 4A4AA 3LS1A 4W8KA 5EK0A 3ATPA 3Q7GA 3PHF2 4EUKB 1M57C 1RKEB 1C17M 5HV9A 1JR8A 4EBJA 4XEKA 1JPJA 1FMWA 3ZC4A 3FHDA 3S9OA 5DS4A 4KI2A 3CAXA 1NU9C 3C63A 2R02A 4FAPB 1YJGA 4U5DE 3W2VA 5EHHA 4MW3A 2J9WA 4CS8C 4CDVA 2XXAA 5AC4A 4IRUA 5L0FA 2NUPA 2UUHA 1T5OA 3NYLA 3V5XA 3U2LA 1CPQA 5L0JA 3KYIA 2EPNA 1MQVA 5BUOA 2XLDA 3DM9B 1NFNA 4C3BA 1ZW2A 3DM5A 5A6JA 3M4BA 1GM5A 1OCRC 2G3VA 3OWTA 1V54C 2RD9A 1V74B 4YL1A 1O3UA 1WTYA 4MTFA 4Z9JA 2NSGA 1HE1A 3ECSA 3EHMA 3C8ZA 5T3TA 3TQOA 4IAQA 2LSEA 1YAUO 1ZVZA 2J46A 3LNRA 1F1MA 2VC9A 3GORA 4AX2A 4U5HA 3RW0A 4DBRA 1Z5ZA 4G0HA 3K1IC 5KYYB 4JZAA 1A7EA 1O5HA 2HMQA 3LS0A 2EPOA 2Q00A 5BQHA 2R7RA 2J7PD 4E17A 3T6BA 2A68F 3T9OA 2I8BA 4AL1A 3TJ5A 2X0CA 4GQHA 4JURI 2JPUA 3AG1C 5KYYA 3JYHA 3UMKA 1YA7O 1OXKA 1ST6A 2XM4A 3ABKC 3DI5A 4DJ9A 4G7ZF 4CIPA 1OW8A 2KK1A 1H9GA 3CQZA 2WL8A 3HJCA 1K40A 3M79A 3NRHA 2H7VC 3AQCA 3S29A 4JCHA 3O39A 1NZEA 4XLPF 1LS4A 4OIOF 2LD6A 3V7OA 2Q9AA 4D4XA 3LNMB 2X51A 4KBLA 1WASA 3H2VA 4N06A 3IQ5A 2J9VA 3RQEA 3UNGC 4JTAB 3VRCA 3KKBA 1OR2A 2YLGA 3EGDB 3N24A 1BR2A 4WGYA 1D1AA 3ZSUA 1WWPA 4JJGA 5KYWB 2TMVP 3MX3A 1O87A 4HFFB 2LFFA 4XPXA 1NU7D 4UDVA 1UFBA 4MS2A 1LE2A 2DYRC 3LUTB 3IPMO 1Y6DA 4E0HA 3GWLA 1FAPB 1M2OA 2HKVA 3U2MA 3A11A 5K0IA 3IQTA 4Z9IA 3LEVA 1MMNA 1ZU5A 2OOCA 1Q0KA 2V26A 1Z6AA 1ZHZA 3T4RA 4AE4B 2XLVA 2XS1A 2Q9BA 2DB4A 3JSEO 3Q6MA 1QPUA 3WHNA 4BEMJ 4E0IA 2XL8A 4FESA 1V4AA 3PDMP 5KYWA 4EIYA 2O9XA 2PFDA 4YWQA 3FAJA 4OINF 3O6XA 2HUJA 3TJ6A 2E87A 3TD7A 2QY9A 4Z9HA 4GYTA 4ZLCA 4U5FE 2IXPA 1PD1A 3HLZA 3NDBB 1Q0FA 3L1MA 3DE9A 4NTFA 4I1OB 1Q0MA 3ZG1A 3I4UA 5D91A 1TWCA 3L0IA 1LIHA 5B3IA 2AWYA 4I1MA 4XPYA 1J8YF 3LLKA 1VK5A 4KNVA 2P61A 4JW1A 1OCCC 4YN0B 2NUTB 1KNYA 1D0YA 1NG1A 4IGGA 1H9TA 2R03A 3S0XA 2PX0A 2L6GA 5B1AC 2HV6A 4YL3A 1SYQA 2C03A 4PK4A 5KYXB 3BEHA 1TKNA 1OW7A 2YL7A 1N1CA 3EGXA 4WABA 4DRHB 1OCZC 3JTLO 3O55A 4BJ5A 5JLIA 1PD0A 5E3CA 3EFOA 3Q7LA 4JVSA 1TFKB 2J7PA 2Y69C 4EWCA 2QNLA 1Z7Qc 2L81A 2YL3A 2EILC 2OJQA 3SXKA 4EBBA 4BJ5C 1QQ3A 3NKDA 2OG2A 2WZGA 3L34A 1S7ZA 3NMIA 1SMYF 5E2QA 2XSEA 2H8AA 5KYXA 1ORJA 2KYHA 4PFPA 4BJTA 4ONSA 4XQ1A 3ZIBA 3B29A 1GGQA 1LVKA 2LK4A 5COGA 5DLJA 3S84A 3HNIA 2P0NA 1A7DA
chains in the Genus database with same CATH topology
1MQVA 5JSLA 3TOLA 4IARA 5JVEA 2XLDA 5AGFA 1E84A 1YZAA 3M4BA 4WGZA 3QW0A 5JS5A 4IAQA 4JEAA 2J9BA 2XL6A 4JEBA 3QW1A 5JUAA 2XLOA 2YLDA 1E83A 1NBBA 3M15A 3NMJA 3DE8A 2XM4A 4CIPA 4ULVA 2XLMA 4D4NA 1LM3B 3M79A 1EKYA 4U9DA 4IB4A 2J8WA 2XLWA 4D4XA 1E85A 3IQ5A 4N6HA 3M4CA 2BC5A 3VRCA 2YLGA 3NMKA 1YYJA 4U9EA 4WGYA 5JP7A 4CJGA 3HNKA 1YZCA 1RCPA 2YLIA 2YL0A 3FOPA 4CJOA 1S05A 2YKZA 2XLVA 1QPUA 3QVZA 2XL8A 1BBHA 1CGNA 3TOMA 3ZTMA 4EIYA 2XLHA 5JRAA 4JKVA 256BA 4ER9A 3C62A 1E86A 1JAFA 3L1MA 1CPRA 3DE9A 4CX9A 4CDAA 5B3IA 3HNJA 3FOOA 1M6TA 1YYXA 3QVYA 4CDYA 2XM0A 5JT4A 3ZQVA 2YL7A 2QLAA 4N4WA 2CCYA 4NC3A 5JLIA 3ZQYA 4JE9A 3ZTZA 1CGOA 1APCA 3HNLA 1GQAA 2YL3A 3U8PA 3IQ6A 1QQ3A 3C63A 3NMIA 4L6RA 4CDVA 3ZWIA 2XLEA 1CPQA 3HNIA 1A7VA 2YL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MQV A;  5JSL A;  3TOL A;  4IAR A;  5JVE A;  2XLD A;  5AGF A;  1E84 A;  1YZA A;  3M4B A;  4WGZ A;  3QW0 A;  5JS5 A;  4IAQ A;  4JEA A;  2J9B A;  2XL6 A;  4JEB A;  3QW1 A;  5JUA A;  2XLO A;  2YLD A;  1E83 A;  1NBB A;  3M15 A;  3NMJ A;  3DE8 A;  2XM4 A;  4CIP A;  4ULV A;  2XLM A;  4D4N A;  1LM3 B;  3M79 A;  1EKY A;  4U9D A;  4IB4 A;  2J8W A;  2XLW A;  4D4X A;  1E85 A;  3IQ5 A;  4N6H A;  3M4C A;  2BC5 A;  3VRC A;  2YLG A;  3NMK A;  1YYJ A;  4U9E A;  4WGY A;  5JP7 A;  4CJG A;  3HNK A;  1YZC A;  1RCP A;  2YLI A;  2YL0 A;  3FOP A;  4CJO A;  1S05 A;  2YKZ A;  2XLV A;  1QPU A;  3QVZ A;  2XL8 A;  1BBH A;  1CGN A;  3TOM A;  3ZTM A;  4EIY A;  2XLH A;  5JRA A;  4JKV A;  256B A;  4ER9 A;  3C62 A;  1E86 A;  1JAF A;  3L1M A;  1CPR A;  3DE9 A;  4CX9 A;  4CDA A;  5B3I A;  3HNJ A;  3FOO A;  1M6T A;  1YYX A;  3QVY A;  4CDY A;  2XM0 A;  5JT4 A;  3ZQV A;  2YL7 A;  2QLA A;  4N4W A;  2CCY A;  4NC3 A;  5JLI A;  3ZQY A;  4JE9 A;  3ZTZ A;  1CGO A;  1APC A;  3HNL A;  1GQA A;  2YL3 A;  3U8P A;  3IQ6 A;  1QQ3 A;  3C63 A;  3NMI A;  4L6R A;  4CDV A;  3ZWI A;  2XLE A;  1CPQ A;  3HNI A;  1A7V A;  2YL1 A; 
#chains in the Genus database with same CATH topology
 2A0U A;  1D0X A;  1Q0G A;  2BL2 A;  4IAR A;  5JVE A;  4FWV A;  5AGF A;  2M64 A;  3A9C A;  1RKC A;  1YZA A;  2L9J A;  2MWQ A;  2R7T A;  1ZZP A;  1AUE A;  4WGZ A;  1RMV A;  2YWA A;  1LKX A;  2D5R B;  3QW0 A;  3B71 A;  1AVO B;  5A6B D;  2A69 F;  2GFH A;  3RF3 A;  1HW2 A;  3VYW A;  2YRF A;  1OKK A;  3NKE A;  4PJJ A;  1SR2 A;  1TWH A;  2AU5 A;  5AC5 A;  2R7U A;  4BJ6 A;  3QW1 A;  4MW8 A;  2FAP B;  1U6H A;  2HSB A;  4O79 A;  4BPM A;  1T6U A;  4YT4 A;  3U9J A;  3VAY A;  3B0V C;  5DVW A;  1XZP A;  4N6C A;  1NBB A;  4RBN A;  1QVX A;  2XL4 A;  3M15 A;  3AOU A;  3NMJ A;  1D0Z A;  3B0P A;  3SP1 A;  3DE8 A;  3T6G B;  2MHR A;  4DRJ B;  1V55 C;  3ITF A;  5F5F A;  3H2U A;  4AE4 A;  4MVZ A;  4W8P A;  1BZ4 A;  1QZX A;  2WZL A;  3RVZ A;  1FNT c;  2P1A A;  1LPE A;  3GOD A;  3FAP B;  4IB4 A;  2J0X A;  5F5H A;  4BJ1 A;  3UGP A;  1XWJ A;  4OIR F;  1IW7 F;  2EPK X;  1E85 A;  1G4U S;  2B0J A;  2ZXW C;  3QZC A;  1YDI A;  2BC5 A;  2GAQ A;  3H65 A;  4PJN A;  4U9E A;  3AJM A;  5JP7 A;  3K66 A;  4CJG A;  2R7O A;  3GEI A;  4G7O F;  2F22 A;  1ZHT A;  3CSK A;  1T6I A;  2J45 A;  4XTK A;  1Z63 A;  3R2P A;  4LDQ A;  4MVO A;  4JC7 A;  2VAS A;  2JX0 A;  3WOD F;  3IHU A;  2OEV A;  3IEE A;  4LDK A;  2H7B A;  5DS5 A;  3DMD A;  3FOP A;  2IOQ A;  4MVR A;  4NQF A;  2IXO A;  2YZS A;  4CJO A;  2CYD A;  3I5Q A;  2L6F A;  2LIG A;  3ZDL A;  2PF4 E;  4DVZ A;  2KW3 C;  2BE5 F;  4YL0 A;  2J0W A;  3ZVR A;  1C03 A;  4R32 A;  3QVZ A;  3S27 A;  3RIP A;  1CGN A;  2AVK A;  3TOM A;  2R05 A;  1WN0 A;  5L3Q A;  5L0D A;  2EPL X;  3AGT A;  3C8G D;  1RKE A;  1BDJ B;  3MYF A;  2XLH A;  3M1C B;  3W8I A;  1G4W R;  1KTM A;  3VF0 A;  4PJM A;  1R5I D;  3J06 A;  3LES A;  4OIQ F;  3EFO B;  3S90 A;  1Z3I X;  256B A;  4MVS A;  4NY3 A;  3W4Y A;  3K1H A;  3U5S A;  3LLI A;  3U9M A;  1E86 A;  1CPR A;  1DOW A;  3EQL F;  4NCQ A;  1FFT C;  1EA8 A;  1M2V B;  4JTD B;  4NTA A;  4H54 A;  2XXA B;  3B0U X;  3TUL A;  3HNJ A;  5BQG A;  2W4B A;  3X2Q C;  4J7Y A;  4CBE A;  5CI8 A;  4PR9 A;  2W45 A;  4H4K C;  4OD5 A;  1L3P A;  3HKK A;  4B6I A;  3QVY A;  1M56 C;  2KJG A;  4CSA C;  2L6H A;  1FR0 A;  3T6J A;  2HZ8 A;  2XM0 A;  3ZQV A;  1B68 A;  2C04 A;  2CNW D;  1A0B A;  4XEF A;  1T6Q A;  2QUP A;  4E18 A;  3ZQY A;  1HE9 A;  1CGO A;  1KU2 A;  3ABL C;  3N0T A;  4CSA A;  1NLX A;  2PBE A;  3HNL A;  4CS8 A;  4IWB A;  1GQA A;  3EPV A;  1PCX A;  3U8P A;  3IQ6 A;  2DGJ A;  3TK0 A;  1OXB A;  4P9T A;  1VTM P;  1HW1 A;  2PX3 A;  2VCC A;  1HMO A;  4C7O B;  2R7V A;  2Q3T A;  1FFH A;  3DAG A;  2CW0 F;  3ZWI A;  5A6A A;  2XLE A;  2ZPA A;  3KYJ A;  1G8X A;  2KQ9 A;  4WJ0 A;  3CZ6 A;  1A7V A;  3RYL A;  1EI7 A;  1T01 A;  4MTG A;  2OQM A;  2YQY A;  4MND A;  2LP4 A;  5JSL A;  3GEE A;  2HJM A;  2G3K A;  3BRJ A;  1LE4 A;  3QTH A;  5B3S C;  1E84 A;  2A0B A;  3U3F A;  1HY5 A;  1UG7 A;  4O6Y A;  3SZR A;  1ORS C;  3C7J A;  2KSF A;  3V5Z A;  5A6B A;  1ZHY A;  1LS1 A;  4XEV A;  1RJ9 B;  2ZXR A;  4AK9 A;  5JS5 A;  4J7T A;  4YT2 A;  5KYU B;  4YT5 A;  2D4U A;  3JCU Q;  4HE8 D;  5IY5 C;  2OKU A;  1Q0D A;  4JEB A;  4Q4Z F;  2YLD A;  1E83 A;  2IBF A;  1ZHX A;  3G4Z A;  3DWW A;  4O7G A;  4O6M A;  1Z23 A;  3SNH A;  2YEV A;  4ZLD A;  3U0C A;  2G62 A;  4HFK B;  1OCO C;  1YLM A;  3AG4 C;  1ZW3 A;  2W9Y A;  1L7C A;  3K1I A;  5L0C A;  2HFI A;  2ZXO A;  1RJ9 A;  2WVO A;  2XLM A;  4ULV A;  5L0I A;  4BEJ A;  1LM3 B;  3E70 C;  4XPW A;  1YA9 A;  4QDL A;  2Q7R A;  1PV3 A;  4RDA A;  5A6K A;  3MFN A;  2XLW A;  1VOM A;  2RSE B;  3O10 A;  1RXQ A;  2DI3 A;  4M63 A;  3EH1 A;  1ZHW A;  2ZXP A;  3NMK A;  1YYJ A;  1OR3 A;  2IYL D;  3LAY A;  4U5B E;  3SXZ A;  1U0B B;  1A41 A;  3C18 A;  2NG1 A;  3FXH A;  2Y3B A;  1NSG B;  1HMD A;  4PAC A;  1RCP A;  1M2V A;  1TWA A;  2YVK A;  3V5Y A;  2GDC A;  2B0H A;  2W4M A;  2R7Q A;  1H7I A;  1J8M F;  1C02 A;  3UMH A;  5CIV A;  3EG9 A;  5E33 A;  1QKR A;  1TR2 A;  1IZM A;  3RQG A;  2Z15 A;  1LI7 A;  4LLC A;  4NTB A;  5E3A A;  1MMA A;  2M4E A;  1R4T A;  2EIK C;  3B9Q A;  3JT1 A;  1YAR O;  4LDR A;  4LLE A;  4XLN F;  3DAF A;  1BBH A;  1WOL A;  2HSQ A;  3KH2 A;  2UUI A;  3Q6N A;  3ZTM A;  4CIH A;  2CGE A;  3NYM A;  4O6N A;  2H7O A;  3AG3 C;  2XS8 A;  1JMW A;  5DQZ A;  5COF A;  5B1B C;  4E7Z A;  2R7S A;  3L8I A;  4OD4 A;  1SF8 A;  3SYN A;  1NFO A;  1JAF A;  5FZT A;  2EIN C;  1BR1 A;  2Q4F A;  4JCZ A;  2IXM A;  5D92 A;  2YHS A;  4CX9 A;  2KNH A;  4CDA A;  4JJF A;  2AP3 A;  2VH3 A;  4DBQ A;  3C8G B;  5L0H A;  4P6I C;  1M6T A;  1CGM E;  3HTK C;  3LEO A;  3E9V A;  4LER A;  2CDQ A;  2EIJ C;  2V3C C;  5L3V A;  3AGU A;  2P7V A;  2MYS A;  2Q9C A;  4C3D A;  5COM A;  3JRM O;  3GEH A;  5JT4 A;  2NPU A;  2EIM C;  2QLA A;  2L7A A;  2A1D D;  2CCY A;  1ZYR F;  3F46 A;  3F47 A;  3ASN C;  3MYI A;  4NC3 A;  4XWJ A;  4YK5 A;  1Y4C A;  4JE9 A;  1AEP A;  2PNO A;  1I5N A;  3PCV A;  4K7B A;  4KNW A;  1JRA A;  3DD7 A;  3KPH A;  3RKO F;  1MMG A;  4U5C E;  3ZTZ A;  1APC A;  4C3E A;  4MTO A;  1JPN A;  3DKA A;  4AL0 A;  1QSP A;  2HJ3 A;  4HEA J;  5KYU A;  2VCA A;  4U5E E;  1OKK D;  5F28 E;  3OEO A;  1VYI A;  4L6R A;  3RVY A;  4CS9 A;  3US6 A;  3FMS A;  3W8H A;  2VCB A;  4Q7C A;  4JRZ A;  3R7C A;  4U5G A;  4ANJ A;  1I4Z A;  4X0R A;  2AWC A;  1VYK A;  2YL1 A;  2WZF A;  1JOG A;  1XZQ A;  3EZH A;  2NUT A;  3X1O A;  4K0D A;  2R7X A;  4J30 B;  4G7H F;  3TOL A;  2CNW A;  2LQG A;  1DOV A;  3K33 A;  4CS9 C;  4PJL A;  4CS7 A;  2QE9 A;  2OU6 A;  2OJE D;  3DXJ F;  3I5P A;  5FCL A;  3JRT A;  2Y3G A;  3DZA A;  3IQC A;  2OEX A;  1I4Y A;  2ZD9 A;  1U89 A;  3GM3 A;  4JEA A;  2J9B A;  4F4B A;  2ASR A;  2XRH A;  3EGX B;  2WB7 A;  3MBG A;  2OCC C;  2XL6 A;  5JUA A;  1H6G A;  2XLO A;  2IXN A;  3ABM C;  1E2X A;  4DVY P;  4GEH A;  4Q5S F;  2FFH A;  4J32 B;  3LJB A;  1QLE C;  1WAT A;  3FVY A;  4YJW A;  4DXW A;  2Y39 A;  2I15 A;  4A2N B;  4BJ6 C;  2R9R B;  4IAO A;  2HS5 A;  4KC9 A;  2A6E F;  3VM6 A;  1TQG A;  4MQ9 F;  4D4N A;  3EG9 B;  2KGO A;  1MNE A;  4EBK A;  1FTS A;  3RH3 A;  1K04 A;  2QTV A;  3G50 A;  3JSZ A;  4U9D A;  5TJ5 E;  3QMK A;  2P6V A;  1EKY A;  4I3M A;  2J8W A;  3S28 A;  3U8V A;  4LAC B;  5CI9 A;  3GWN A;  4G78 A;  2DYS C;  2Y3H A;  5DQT A;  3K7D A;  4N6H A;  3M4C A;  1VLT A;  4DOZ A;  3U3B A;  1D1C A;  2LFD A;  4JIO A;  4EKW A;  2ICW G;  3HNK A;  1T9K A;  3RFY A;  2ETS A;  2IM8 A;  1YZC A;  3UMI A;  1LI5 A;  1YVI A;  2Y3D A;  2YLI A;  3ASO C;  3UGO A;  4QI2 A;  2GWW A;  1MMD A;  1ORY A;  2YL0 A;  3C8G A;  5A69 A;  3JYY A;  3GM1 A;  1S05 A;  2JD3 A;  1VLS A;  1ZU4 A;  2YKZ A;  2J9U A;  3UR3 C;  5BQI A;  3NG1 A;  1G5Z A;  3NYJ A;  2R25 A;  4MVQ A;  5KYN A;  4EHP A;  3K6B A;  3EH2 A;  4DRI B;  1TWG A;  1SZI A;  2GA0 A;  3AG2 C;  4I44 A;  3SXY A;  3EGD A;  1OW6 A;  1VMA A;  2PP4 A;  5JRA A;  2WVQ A;  4JKV A;  5HSW A;  5T3W A;  4ULW A;  4E7S A;  4ER9 A;  1K05 A;  2WVN A;  3C62 A;  4P9F A;  2A6H F;  2KC3 A;  4YT8 A;  3G4X A;  3OA1 A;  3POV A;  5L0G A;  3KMI A;  4C7O A;  3PMR A;  1VB5 A;  4JTC B;  4BG0 A;  3AQB A;  1WGW A;  3N2Z B;  3SEO A;  4OIP F;  3EJN A;  3CEX A;  4RD9 A;  3FOO A;  4K1O A;  4PFO A;  2HMZ A;  3GM2 A;  3SXM A;  1YYX A;  1FMV A;  3KL4 A;  4MVM A;  5T1D B;  2HV7 A;  3L8J A;  3WG7 C;  3WAQ A;  5EGY A;  3FDQ A;  4CDY A;  4MVU A;  3MLG A;  1W2W A;  3JZ0 A;  1EQ1 A;  2EPM X;  3GAN A;  2VB6 A;  5DS6 A;  1BR4 A;  1D1B A;  1TFO B;  2NUP B;  1OQC A;  4N4W A;  2LCH A;  4QI0 A;  4IJJ A;  5GPG B;  1GS9 A;  2NSF A;  3DJU B;  3EHN A;  3DJN B;  1MND A;  3RQF A;  2FGY A;  2R7W A;  4FX5 A;  3EZI A;  3W2W A;  4A4A A;  3LS1 A;  4W8K A;  5EK0 A;  3ATP A;  3Q7G A;  3PHF 2;  4EUK B;  1M57 C;  1RKE B;  1C17 M;  5HV9 A;  1JR8 A;  4EBJ A;  4XEK A;  1JPJ A;  1FMW A;  3ZC4 A;  3FHD A;  3S9O A;  5DS4 A;  4KI2 A;  3CAX A;  1NU9 C;  3C63 A;  2R02 A;  4FAP B;  1YJG A;  4U5D E;  3W2V A;  5EHH A;  4MW3 A;  2J9W A;  4CS8 C;  4CDV A;  2XXA A;  5AC4 A;  4IRU A;  5L0F A;  2NUP A;  2UUH A;  1T5O A;  3NYL A;  3V5X A;  3U2L A;  1CPQ A;  5L0J A;  3KYI A;  2EPN A;  1MQV A;  5BUO A;  2XLD A;  3DM9 B;  1NFN A;  4C3B A;  1ZW2 A;  3DM5 A;  5A6J A;  3M4B A;  1GM5 A;  1OCR C;  2G3V A;  3OWT A;  1V54 C;  2RD9 A;  1V74 B;  4YL1 A;  1O3U A;  1WTY A;  4MTF A;  4Z9J A;  2NSG A;  1HE1 A;  3ECS A;  3EHM A;  3C8Z A;  5T3T A;  3TQO A;  4IAQ A;  2LSE A;  1YAU O;  1ZVZ A;  2J46 A;  3LNR A;  1F1M A;  2VC9 A;  3GOR A;  4AX2 A;  4U5H A;  3RW0 A;  4DBR A;  1Z5Z A;  4G0H A;  3K1I C;  5KYY B;  4JZA A;  1A7E A;  1O5H A;  2HMQ A;  3LS0 A;  2EPO A;  2Q00 A;  5BQH A;  2R7R A;  2J7P D;  4E17 A;  3T6B A;  2A68 F;  3T9O A;  2I8B A;  4AL1 A;  3TJ5 A;  2X0C A;  4GQH A;  4JUR I;  2JPU A;  3AG1 C;  5KYY A;  3JYH A;  3UMK A;  1YA7 O;  1OXK A;  1ST6 A;  2XM4 A;  3ABK C;  3DI5 A;  4DJ9 A;  4G7Z F;  4CIP A;  1OW8 A;  2KK1 A;  1H9G A;  3CQZ A;  2WL8 A;  3HJC A;  1K40 A;  3M79 A;  3NRH A;  2H7V C;  3AQC A;  3S29 A;  4JCH A;  3O39 A;  1NZE A;  4XLP F;  1LS4 A;  4OIO F;  2LD6 A;  3V7O A;  2Q9A A;  4D4X A;  3LNM B;  2X51 A;  4KBL A;  1WAS A;  3H2V A;  4N06 A;  3IQ5 A;  2J9V A;  3RQE A;  3UNG C;  4JTA B;  3VRC A;  3KKB A;  1OR2 A;  2YLG A;  3EGD B;  3N24 A;  1BR2 A;  4WGY A;  1D1A A;  3ZSU A;  1WWP A;  4JJG A;  5KYW B;  2TMV P;  3MX3 A;  1O87 A;  4HFF B;  2LFF A;  4XPX A;  1NU7 D;  4UDV A;  1UFB A;  4MS2 A;  1LE2 A;  2DYR C;  3LUT B;  3IPM O;  1Y6D A;  4E0H A;  3GWL A;  1FAP B;  1M2O A;  2HKV A;  3U2M A;  3A11 A;  5K0I A;  3IQT A;  4Z9I A;  3LEV A;  1MMN A;  1ZU5 A;  2OOC A;  1Q0K A;  2V26 A;  1Z6A A;  1ZHZ A;  3T4R A;  4AE4 B;  2XLV A;  2XS1 A;  2Q9B A;  2DB4 A;  3JSE O;  3Q6M A;  1QPU A;  3WHN A;  4BEM J;  4E0I A;  2XL8 A;  4FES A;  1V4A A;  3PDM P;  5KYW A;  4EIY A;  2O9X A;  2PFD A;  4YWQ A;  3FAJ A;  4OIN F;  3O6X A;  2HUJ A;  3TJ6 A;  2E87 A;  3TD7 A;  2QY9 A;  4Z9H A;  4GYT A;  4ZLC A;  4U5F E;  2IXP A;  1PD1 A;  3HLZ A;  3NDB B;  1Q0F A;  3L1M A;  3DE9 A;  4NTF A;  4I1O B;  1Q0M A;  3ZG1 A;  3I4U A;  5D91 A;  1TWC A;  3L0I A;  1LIH A;  5B3I A;  2AWY A;  4I1M A;  4XPY A;  1J8Y F;  3LLK A;  1VK5 A;  4KNV A;  2P61 A;  4JW1 A;  1OCC C;  4YN0 B;  2NUT B;  1KNY A;  1D0Y A;  1NG1 A;  4IGG A;  1H9T A;  2R03 A;  3S0X A;  2PX0 A;  2L6G A;  5B1A C;  2HV6 A;  4YL3 A;  1SYQ A;  2C03 A;  4PK4 A;  5KYX B;  3BEH A;  1TKN A;  1OW7 A;  2YL7 A;  1N1C A;  3EGX A;  4WAB A;  4DRH B;  1OCZ C;  3JTL O;  3O55 A;  4BJ5 A;  5JLI A;  1PD0 A;  5E3C A;  3EFO A;  3Q7L A;  4JVS A;  1TFK B;  2J7P A;  2Y69 C;  4EWC A;  2QNL A;  1Z7Q c;  2L81 A;  2YL3 A;  2EIL C;  2OJQ A;  3SXK A;  4EBB A;  4BJ5 C;  1QQ3 A;  3NKD A;  2OG2 A;  2WZG A;  3L34 A;  1S7Z A;  3NMI A;  1SMY F;  5E2Q A;  2XSE A;  2H8A A;  5KYX A;  1ORJ A;  2KYH A;  4PFP A;  4BJT A;  4ONS A;  4XQ1 A;  3ZIB A;  3B29 A;  1GGQ A;  1LVK A;  2LK4 A;  5COG A;  5DLJ A;  3S84 A;  3HNI A;  2P0N A;  1A7D A; 
#chains in the Genus database with same CATH homology
 1MQV A;  5JSL A;  3TOL A;  4IAR A;  5JVE A;  2XLD A;  5AGF A;  1E84 A;  1YZA A;  3M4B A;  4WGZ A;  3QW0 A;  5JS5 A;  4IAQ A;  4JEA A;  2J9B A;  2XL6 A;  4JEB A;  3QW1 A;  5JUA A;  2XLO A;  2YLD A;  1E83 A;  1NBB A;  3M15 A;  3NMJ A;  3DE8 A;  2XM4 A;  4CIP A;  4ULV A;  2XLM A;  4D4N A;  1LM3 B;  3M79 A;  1EKY A;  4U9D A;  4IB4 A;  2J8W A;  2XLW A;  4D4X A;  1E85 A;  3IQ5 A;  4N6H A;  3M4C A;  2BC5 A;  3VRC A;  2YLG A;  3NMK A;  1YYJ A;  4U9E A;  4WGY A;  5JP7 A;  4CJG A;  3HNK A;  1YZC A;  1RCP A;  2YLI A;  2YL0 A;  3FOP A;  4CJO A;  1S05 A;  2YKZ A;  2XLV A;  1QPU A;  3QVZ A;  2XL8 A;  1BBH A;  1CGN A;  3TOM A;  3ZTM A;  4EIY A;  2XLH A;  5JRA A;  4JKV A;  256B A;  4ER9 A;  3C62 A;  1E86 A;  1JAF A;  3L1M A;  1CPR A;  3DE9 A;  4CX9 A;  4CDA A;  5B3I A;  3HNJ A;  3FOO A;  1M6T A;  1YYX A;  3QVY A;  4CDY A;  2XM0 A;  5JT4 A;  3ZQV A;  2YL7 A;  2QLA A;  4N4W A;  2CCY A;  4NC3 A;  5JLI A;  3ZQY A;  4JE9 A;  3ZTZ A;  1CGO A;  1APC A;  3HNL A;  1GQA A;  2YL3 A;  3U8P A;  3IQ6 A;  1QQ3 A;  3C63 A;  3NMI A;  4L6R A;  4CDV A;  3ZWI A;  2XLE A;  1CPQ A;  3HNI A;  1A7V A;  2YL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...