4CX9A

The 5-coordinate proximal no complex of cytochrome c prime from shewanella frigidimarina
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
128
structure length
128
Chain Sequence
NFEEPADAIEYRQAAFGLIAYNFGDMGAMLKGKKPFDAAVFSTRADNVAALSKIPHEGFIAGSDKGDTEALAKIWQDKADFDSKMTAFQDNAAALAVAAKSSDQNNIKQAFANTGKSCKGCHDVYKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C, CLASS II
publication title Conformational Control of the Binding of Diatomic Gases to Cytochrome C'.
pubmed doi rcsb
source organism Shewanella frigidimarina
total genus 55
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4cx9A00
3M79A 5JUAA 4CX9A 2J9BA 4JEAA 4CDYA 3M15A 1S05A 1YZCA 2XM0A 1QPUA 4U9DA 2XL6A 4CJOA 3M4BA 3ZTMA 3HNIA 5B3IA 4CIPA 3DE9A 5JS5A 2XLEA 4CDVA 1E85A 2XLHA 1CPRA 3HNLA 4U9EA 2XLOA 2YL7A 1YZAA 3QVYA 2XLMA 5JLIA 1APCA 3NMJA 1GQAA 4JE9A 5JVEA 3DE8A 2XL8A 3TOLA 5JRAA 4ULVA 4CDAA 4CJGA 1BBHA 3ZQYA 3M4CA 2YLIA 3VRCA 1E86A 4WGYA 3QW0A 2YLGA 1MQVA 4IARA 3FOPA 4EIYA 2QLAA 3IQ6A 2XM4A 3ZTZA 3L1MA 2YL3A 3QVZA 4JEBA 4IB4A 2YL1A 2XLDA 1CGOA 3C62A 3HNKA 5JSLA 2BC5A 1YYXA 4ER9A 3ZQVA 4WGZA 1E83A 2YKZA 1LM3B 256BA 2CCYA 3NMIA 1RCPA 2XLVA 2J8WA 1E84A 4N6HA 1YYJA 1A7VA 1CPQA 4N4WA 3IQ5A 2XLWA 3C63A 1M6TA 4D4NA 3NMKA 1JAFA 1CGNA 4NC3A 1EKYA 2YLDA 4IAQA 3FOOA 5JP7A 3ZWIA 4D4XA 1NBBA 3TOMA 1QQ3A 5AGFA 3HNJA 3QW1A 4JKVA 2YL0A 4L6RA 3U8PA 5JT4A
chains in the Genus database with same CATH superfamily
1T5OA 4B6IA 1HE9A 4BJTA 3OEOA 2X0CA 5HSWA 1VB5A 1Y4CA 3M79A 2A6HF 2IXPA 3GM2A 3AG1C 4C3EA 4E0HA 2J9BA 3CQZA 1Q0FA 4JEAA 3HLZA 4QDLA 4NY3A 1TWAA 4DRJB 1WN0A 1PD0A 1YZCA 5F5HA 4BJ6A 2EIJC 2EPOA 2JPUA 3MYIA 4OD4A 2J9UA 4BJ6C 2OG2A 5EK0A 2G3KA 4U9DA 4DRHB 3K66A 1UG7A 3DWWA 2Z15A 1TWHA 3KYIA 3US6A 3WHNA 5B3IA 4OIPF 3Q6NA 1AVOB 2OU6A 2W4MA 3K6BA 2WVOA 3C8GA 4IWBA 1VOMA 2YEVA 1K05A 1AUEA 4G0HA 4PFPA 4KI2A 1Y6DA 3DM9B 1T9KA 3TQOA 2R7TA 2RD9A 1V55C 1YZAA 1N1CA 3EH1A 1O87A 1OW7A 2BE5F 4MW3A 1FNTc 2CDQA 5COMA 5JLIA 4DBRA 5A6JA 4JTCB 4MTOA 3LLKA 1GQAA 3W8IA 2E87A 4JRZA 2KSFA 4JE9A 3NKDA 2R7XA 1OCOC 2OEVA 3HTKC 2J9VA 3A9CA 1O5HA 1TQGA 2XL8A 4NTBA 4LLEA 3MLGA 3I5PA 3RQGA 1GM5A 3LEOA 4CJGA 5A6BA 4P9TA 1LI7A 1RJ9B 4RBNA 1BR2A 3GEHA 1WOLA 2W45A 3C7JA 3LS0A 3RVYA 3UMHA 3AG3C 5T3TA 5CI9A 1LVKA 1TR2A 1J8MF 4Q7CA 4M63A 3AJMA 4E17A 3M4CA 2R03A 4A2NB 1E86A 1U6HA 4E18A 2EPNA 5IY5C 4I3MA 3DD7A 3ABKC 2IXNA 3POVA 1NU7D 3E9VA 4JCZA 3ZDLA 4EIYA 3T9OA 2Y39A 1U89A 3CSKA 4P9FA 2X51A 3EFOA 4GQHA 3L0IA 3IQ6A 2OEXA 5E33A 5F28E 3SZRA 1KNYA 5JT4A 1YVIA 4U5CE 1QVXA 2R7RA 4IAOA 3X2QC 1S7ZA 4E0IA 2L7AA 2GA0A 5T1DB 4E7SA 1C17M 4H54A 5A6AA 2PFDA 2WZFA 2P7VA 3AQCA 3F47A 3I5QA 4QI0A 2HFIA 3ASOC 4MVMA 4YT4A 3RH3A 3GEIA 1SMYF 2PBEA 4RDAA 2R7UA 3OWTA 1RKCA 2JX0A 3VM6A 2KNHA 2AU5A 1H7IA 3IEEA 1YYXA 4ER9A 1E83A 1BR1A 3ZG1A 3RKOF 2HV7A 2C04A 4XQ1A 1NZEA 4WABA 4I1OB 1TWCA 4W8PA 3RYLA 3G50A 2J8WA 3UNGC 1QSPA 2OOCA 4CSAA 2KK1A 5EGYA 4RD9A 4YT2A 2EIMC 3EHMA 4CSAC 2ZXOA 1A7VA 2IXMA 3LAYA 4XPYA 4BG0A 1T01A 2H7VC 1D1CA 1HMOA 1LS1A 3EGDA 3SXMA 4J7TA 3VYWA 5FZTA 4CS9A 3O6XA 1M6TA 1HY5A 1JPNA 2EPMX 3I4UA 1G4WR 4CS9C 3LESA 4QI2A 1ZZPA 5CIVA 1XWJA 4MW8A 2EINC 1CGNA 5L0HA 1ZHZA 5BUOA 2HV6A 4HEAJ 1M56C 4F4BA 2YLDA 3CEXA 3ECSA 3FOOA 3O10A 5JP7A 3DXJF 5L0JA 1QQ3A 2ETSA 1Z23A 2LP4A 3HNJA 2P0NA 1ORYA 1A7EA 2XS8A 3FVYA 3CAXA 4JKVA 2M4EA 2Q9BA 4LACB 5AGFA 2WVQA 1NSGB 4Z9IA 4BJ5A 2R7WA 2LCHA 3NKEA 1SYQA 2B0HA 2OJQA 4BJ5C 2QE9A 2CGEA 3PHF2 3S29A 3H65A 3JYHA 1U0BB 5JUAA 3B71A 4CX9A 3ATPA 4P6IC 2EIKC 2HMQA 1M57C 4ULWA 2Y3GA 3M15A 1IZMA 1QZXA 1S05A 1HE1A 5KYYB 1FFHA 4W8KA 2XM0A 3ZC4A 1VYIA 1QPUA 2GWWA 3B0PA 5DLJA 3Q7GA 1ORJA 4I44A 1DOVA 2Q9CA 4YT8A 3C8GB 3LUTB 4BPMA 5A6BD 4N6CA 3JTLO 4J7YA 1RKEA 2HJMA 4HFKB 3WG7C 1LE2A 2W4BA 1OR2A 2Q00A 3LEVA 5JS5A 2LD6A 5CI8A 2XLEA 5B1AC 1OXKA 2NUPA 1O3UA 1E85A 2XLHA 1CPRA 2FAPB 4IJJA 4U9EA 1T6UA 2J46A 2XLOA 4JTAB 5DQTA 5HV9A 1VLSA 4U5HA 4CS7A 3AOUA 4NC3A 1D0XA 1JMWA 3LJBA 4ZLCA 3J06A 3TK0A 3QVYA 2XLMA 1ZHYA 4AX2A 2XXAA 4K7BA 4K0DA 5JVEA 3C8ZA 4I1MA 5BQGA 2R02A 3DE8A 4JZAA 5L0FA 2G3VA 1Z6AA 3S0XA 2KJGA 2Q3TA 5JRAA 2TMVP 1R4TA 1I4YA 3SYNA 3MFNA 3LLIA 5L0GA 3R2PA 1OW6A 4EBKA 4HE8D 2R9RB 3ZQYA 4CS8A 4FAPB 1E2XA 4CS8C 2HJ3A 1ZU5A 4MQ9F 2P6VA 5KYNA 2YLIA 3VRCA 3K33A 2NPUA 4WGYA 1IW7F 2AWYA 3EFOB 3QTHA 3RFYA 2Q4FA 4IARA 2WB7A 3U9JA 5A6KA 3GEEA 2OKUA 1GGQA 1XZQA 4DVZA 4JC7A 3ZVRA 1Z63A 3DAFA 2YQYA 4O6YA 4OD5A 3T6BA 2QLAA 2VB6A 3MYFA 3SNHA 2B0JA 1V4AA 1ZW3A 2HUJA 3TJ6A 2Y3BA 3QVZA 4YL1A 3PDMP 3ITFA 3ZSUA 1MNDA 4OIQF 1SR2A 4DBQA 3W2WA 2H7OA 3HJCA 5KYXA 3GANA 2FFHA 4IB4A 4C3DA 2YL1A 2KC3A 1YJGA 1OW8A 1CGOA 2J0WA 5JSLA 4Q4ZF 1VK5A 2HS5A 2CNWA 2R05A 2YWAA 3JT1A 4U5BE 2UUHA 3ABMC 1MNEA 3ZQVA 4WGZA 2DGJA 2GDCA 4DRIB 3TULA 2YKZA 2J0XA 1A41A 5L0IA 1B68A 3B29A 1OXBA 3L8JA 256BA 4G78A 2XS1A 3K1HA 1RCPA 3SEOA 3EGDB 1E84A 1TWGA 4U5GA 2OCCC 2MHRA 4BEMJ 4N6HA 1ZHXA 1YA7O 3B0UX 2DYSC 4N4WA 3ZIBA 2VH3A 3C63A 3IPMO 1RXQA 1VYKA 4O7GA 3EJNA 2NUTA 2L6GA 1EI7A 3NMKA 2VCCA 1D0YA 2D5RB 3DZAA 4KNWA 1LE4A 2L6HA 2R7SA 1EKYA 1MMNA 1LPEA 4D4XA 1NBBA 3L34A 3GM1A 4K1OA 3JYYA 2MYSA 4NCQA 1BR4A 2A0BA 2P1AA 3U9MA 3FDQA 2CYDA 1WASA 2PF4E 2QY9A 4L6RA 1TFKB 3GORA 3SP1A 3NDBB 3KYJA 1MMDA 2EPLX 4ZLDA 2NG1A 2LQGA 1J8YF 2NSFA 2KGOA 2P61A 4IRUA 1YDIA 3NYMA 4U5FE 4EUKB 3EZHA 3FMSA 4XEFA 1CGME 3VAYA 3UGPA 1MMGA 2C03A 1OCCC 2PX3A 3DJNB 1I4ZA 2A69F 3KL4A 1M2VA 3MBGA 1H6GA 3GWNA 3R7CA 4IGGA 2Q7RA 2D4UA 1RKEB 1KTMA 2PNOA 2XL6A 3B9QA 4CJOA 4PACA 3N2ZB 2Y3HA 4DOZA 3M4BA 5GPGB 1K04A 2Y3DA 1OCZC 3ZTMA 4CIHA 1Z7Qc 1ZHTA 3V7OA 3UMKA 3K1IA 4ANJA 3RQFA 4MTGA 3K1IC 2HZ8A 4G7HF 3L8IA 3S90A 1JOGA 4X0RA 5DS5A 1FFTC 2YL7A 3FAPB 1ZVZA 2LFDA 4YT5A 4LLCA 1R5ID 4JIOA 3T4RA 4J30B 4WJ0A 4YN0B 1H9TA 2QNLA 1Z5ZA 3DI5A 1T6QA 4LDQA 1L3PA 3JSZA 2ZPAA 3G4XA 5DS6A 3K7DA 1A7DA 1NG1A 3TOLA 2EILC 2I8BA 2JD3A 3G4ZA 5FCLA 2AVKA 4FWVA 3U2MA 2VASA 3V5XA 3H2VA 4MVZA 4XTKA 4FX5A 4BJ1A 3EH2A 2CNWD 2KYHA 3KKBA 1G4US 4LERA 3V5ZA 5A69A 2Q9AA 2QTVA 1BDJB 4NTFA 2LFFA 3LS1A 3C18A 1WWPA 3GM3A 3S28A 1C03A 4XWJA 3KPHA 4DJ9A 2IOQA 5TJ5E 3WODF 2YLGA 1MQVA 4DXWA 3EZIA 3W4YA 4C7OA 1K40A 3T6GB 1OQCA 3B0VC 3KH2A 3DKAA 4XLNF 3U3BA 3ZTZA 5BQIA 4MVUA 3BRJA 1NU9C 2YL3A 4MVOA 1LI5A 4J32B 3SXYA 2HKVA 4JEBA 4Z9HA 1F1MA 1D1BA 1JPJA 5L3VA 3AGTA 3W8HA 2PX0A 1HW1A 1QLEC 5E3AA 3U8VA 4NQFA 3LNMB 4OIRF 5L3QA 2BC5A 3UMIA 2RSEB 1YARO 3PCVA 4PR9A 4AE4A 2R7QA 1NLXA 1SZIA 3NRHA 2DI3A 2M64A 1YA9A 3IQCA 1SF8A 2CCYA 3NMIA 1FAPB 5DVWA 2Y69C 3UGOA 3KMIA 3DM5A 4LDRA 4U5DE 3U3FA 4EBBA 5KYUA 5T3WA 4XLPF 3RVZA 2WL8A 2NUTB 1YYJA 2EPKX 2J9WA 2XL4A 2BL2A 3JSEO 3O39A 4XEKA 2A0UA 4UDVA 3IQ5A 5KYWA 2IM8A 2ZD9A 3GWLA 3FXHA 3U5SA 2F22A 4JVSA 3RW0A 4D4NA 4EHPA 5F5FA 4XPWA 5KYYA 2AWCA 3AQBA 4E7ZA 2WVNA 4Q5SF 1JAFA 1GS9A 2VC9A 2VCBA 2WZGA 3NYLA 2IXOA 1M2OA 1QKRA 4H4KC 1Q0DA 1V54C 4IAQA 4GEHA 3OA1A 3Q6MA 3TOMA 3ASNC 4R32A 4EBJA 1Z3IX 2J7PA 1EA8A 2HSBA 3QW1A 1FMVA 4GYTA 1C02A 5E2QA 2VCAA 2LIGA 3EG9A 3HKKA 1A0BA 5AC4A 5K0IA 1JRAA 2LK4A 2LSEA 3EGXA 4JJGA 3AG4C 1Q0MA 2L81A 1M2VB 2UUIA 3JRTA 3S9OA 4MVRA 3SXKA 3V5YA 2L6FA 3CZ6A 4NTAA 3RIPA 3U2LA 4AL1A 1HW2A 3AG2C 4CDYA 1LKXA 3PMRA 3IHUA 2H7BA 1OKKA 2G62A 3BEHA 3TD7A 4G7OF 5COGA 1W2WA 4YL3A 3MX3A 3NG1A 1RMVA 1FR0A 1T6IA 5D92A 3TJ5A 1BZ4A 2KQ9A 3SXZA 2GFHA 4JW1A 5DS4A 3H2UA 2CW0F 1G8XA 3HNIA 1ZW2A 1VMAA 3DE9A 2XSEA 1DOWA 3JRMO 4N06A 1UFBA 4XEVA 5AC5A 4CIPA 2DYRC 4YK5A 4CDVA 2XRHA 3FHDA 4MTFA 4DVYP 3HNLA 2R25A 4EKWA 1G5ZA 1FMWA 1L7CA 3NYJA 4JTDB 5B3SC 1MMAA 3AGUA 1LIHA 4O6NA 1VLTA 2FGYA 5L0DA 4OIOF 1APCA 1ZYRF 3NMJA 1ST6A 4LDKA 3EQLF 1I5NA 3Q7LA 2YZSA 4FESA 4JCHA 4KC9A 5B1BC 1TKNA 2MWQA 1FTSA 2A68F 2QUPA 4MNDA 4ULVA 1Q0GA 4XPXA 4OINF 3WAQA 4CDAA 2ZXWC 1EQ1A 4PJJA 2HSQA 3DJUB 1WATA 2NUPB 3E70C 3M1CB 2R7OA 4PJMA 1BBHA 3RQEA 4YL0A 3W2VA 1PD1A 3X1OA 4AK9A 5L0CA 3T6JA 3RF3A 3DAGA 1RJ9A 2ICWG 2HMZA 4KNVA 1ZHWA 2KW3C 3JCUQ 1HMDA 4CBEA 3QW0A 3S84A 4C7OB 4PK4A 2R7VA 3FOPA 1D1AA 2WZLA 3LNRA 3DMDA 1JR8A 2GAQA 3F46A 3U0CA 2XXAB 5D91A 1D0ZA 5E3CA 2DB4A 1KU2A 1ORSC 2XM4A 4U5EE 4HFFB 4G7ZF 3L1MA 1YAUO 2V3CC 1NFNA 1YLMA 3N24A 4MVQA 1VTMP 2NSGA 2H8AA 4O79A 1WGWA 2A1DD 3N0TA 2J45A 2YHSA 3EHNA 5DQZA 3C8GD 4A4AA 4AL0A 2L9JA 2YRFA 4YJWA 2A6EF 2XLDA 4MVSA 5COFA 2J7PD 3C62A 3HNKA 4AE4B 1XZPA 1V74B 3FAJA 4PJLA 4C3BA 4EWCA 5BQHA 1NFOA 4KBLA 2OJED 4YWQA 5EHHA 2ASRA 2IBFA 4O6MA 1LM3B 1PCXA 1ZU4A 3EPVA 3IQTA 5KYUB 3A11A 3QZCA 2V26A 2XLVA 5KYWB 3GODA 4JURI 1LS4A 3VF0A 1OKKD 1CPQA 1OR3A 1WTYA 2OQMA 4Z9JA 4BEJA 2ZXPA 3O55A 2XLWA 5KYXB 1AEPA 4MS2A 3QMKA 4PJNA 2I15A 4JJFA 2YVKA 4ONSA 1TFOB 2PP4A 4PFOA 2O9XA 1OCRC 2ZXRA 2IYLD 3ZWIA 3S27A 3EG9B 1Q0KA 2AP3A 2W9YA 3JZ0A 3UR3C 3ABLC 3EGXB 2YL0A 1PV3A 3U8PA 1H9GA
chains in the Genus database with same CATH topology
3M79A 5JUAA 4CX9A 2J9BA 4JEAA 4CDYA 3M15A 1S05A 1YZCA 2XM0A 1QPUA 4U9DA 2XL6A 4CJOA 3M4BA 3ZTMA 3HNIA 5B3IA 4CIPA 3DE9A 5JS5A 2XLEA 4CDVA 1E85A 2XLHA 1CPRA 3HNLA 4U9EA 2XLOA 2YL7A 1YZAA 3QVYA 2XLMA 5JLIA 1APCA 3NMJA 1GQAA 4JE9A 5JVEA 3DE8A 2XL8A 3TOLA 5JRAA 4ULVA 4CDAA 4CJGA 1BBHA 3ZQYA 3M4CA 2YLIA 3VRCA 1E86A 4WGYA 3QW0A 2YLGA 1MQVA 4IARA 3FOPA 4EIYA 2QLAA 3IQ6A 2XM4A 3ZTZA 3L1MA 2YL3A 3QVZA 4JEBA 4IB4A 2YL1A 2XLDA 1CGOA 3C62A 3HNKA 5JSLA 2BC5A 1YYXA 4ER9A 3ZQVA 4WGZA 1E83A 2YKZA 1LM3B 256BA 2CCYA 3NMIA 1RCPA 2XLVA 2J8WA 1E84A 4N6HA 1YYJA 1A7VA 1CPQA 4N4WA 3IQ5A 2XLWA 3C63A 1M6TA 4D4NA 3NMKA 1JAFA 1CGNA 4NC3A 1EKYA 2YLDA 4IAQA 3FOOA 5JP7A 3ZWIA 4D4XA 1NBBA 3TOMA 1QQ3A 5AGFA 3HNJA 3QW1A 4JKVA 2YL0A 4L6RA 3U8PA 5JT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M79 A;  5JUA A;  4CX9 A;  2J9B A;  4JEA A;  4CDY A;  3M15 A;  1S05 A;  1YZC A;  2XM0 A;  1QPU A;  4U9D A;  2XL6 A;  4CJO A;  3M4B A;  3ZTM A;  3HNI A;  5B3I A;  4CIP A;  3DE9 A;  5JS5 A;  2XLE A;  4CDV A;  1E85 A;  2XLH A;  1CPR A;  3HNL A;  4U9E A;  2XLO A;  2YL7 A;  1YZA A;  3QVY A;  2XLM A;  5JLI A;  1APC A;  3NMJ A;  1GQA A;  4JE9 A;  5JVE A;  3DE8 A;  2XL8 A;  3TOL A;  5JRA A;  4ULV A;  4CDA A;  4CJG A;  1BBH A;  3ZQY A;  3M4C A;  2YLI A;  3VRC A;  1E86 A;  4WGY A;  3QW0 A;  2YLG A;  1MQV A;  4IAR A;  3FOP A;  4EIY A;  2QLA A;  3IQ6 A;  2XM4 A;  3ZTZ A;  3L1M A;  2YL3 A;  3QVZ A;  4JEB A;  4IB4 A;  2YL1 A;  2XLD A;  1CGO A;  3C62 A;  3HNK A;  5JSL A;  2BC5 A;  1YYX A;  4ER9 A;  3ZQV A;  4WGZ A;  1E83 A;  2YKZ A;  1LM3 B;  256B A;  2CCY A;  3NMI A;  1RCP A;  2XLV A;  2J8W A;  1E84 A;  4N6H A;  1YYJ A;  1A7V A;  1CPQ A;  4N4W A;  3IQ5 A;  2XLW A;  3C63 A;  1M6T A;  4D4N A;  3NMK A;  1JAF A;  1CGN A;  4NC3 A;  1EKY A;  2YLD A;  4IAQ A;  3FOO A;  5JP7 A;  3ZWI A;  4D4X A;  1NBB A;  3TOM A;  1QQ3 A;  5AGF A;  3HNJ A;  3QW1 A;  4JKV A;  2YL0 A;  4L6R A;  3U8P A;  5JT4 A; 
#chains in the Genus database with same CATH topology
 1T5O A;  4B6I A;  1HE9 A;  4BJT A;  3OEO A;  2X0C A;  5HSW A;  1VB5 A;  1Y4C A;  3M79 A;  2A6H F;  2IXP A;  3GM2 A;  3AG1 C;  4C3E A;  4E0H A;  2J9B A;  3CQZ A;  1Q0F A;  4JEA A;  3HLZ A;  4QDL A;  4NY3 A;  1TWA A;  4DRJ B;  1WN0 A;  1PD0 A;  1YZC A;  5F5H A;  4BJ6 A;  2EIJ C;  2EPO A;  2JPU A;  3MYI A;  4OD4 A;  2J9U A;  4BJ6 C;  2OG2 A;  5EK0 A;  2G3K A;  4U9D A;  4DRH B;  3K66 A;  1UG7 A;  3DWW A;  2Z15 A;  1TWH A;  3KYI A;  3US6 A;  3WHN A;  5B3I A;  4OIP F;  3Q6N A;  1AVO B;  2OU6 A;  2W4M A;  3K6B A;  2WVO A;  3C8G A;  4IWB A;  1VOM A;  2YEV A;  1K05 A;  1AUE A;  4G0H A;  4PFP A;  4KI2 A;  1Y6D A;  3DM9 B;  1T9K A;  3TQO A;  2R7T A;  2RD9 A;  1V55 C;  1YZA A;  1N1C A;  3EH1 A;  1O87 A;  1OW7 A;  2BE5 F;  4MW3 A;  1FNT c;  2CDQ A;  5COM A;  5JLI A;  4DBR A;  5A6J A;  4JTC B;  4MTO A;  3LLK A;  1GQA A;  3W8I A;  2E87 A;  4JRZ A;  2KSF A;  4JE9 A;  3NKD A;  2R7X A;  1OCO C;  2OEV A;  3HTK C;  2J9V A;  3A9C A;  1O5H A;  1TQG A;  2XL8 A;  4NTB A;  4LLE A;  3MLG A;  3I5P A;  3RQG A;  1GM5 A;  3LEO A;  4CJG A;  5A6B A;  4P9T A;  1LI7 A;  1RJ9 B;  4RBN A;  1BR2 A;  3GEH A;  1WOL A;  2W45 A;  3C7J A;  3LS0 A;  3RVY A;  3UMH A;  3AG3 C;  5T3T A;  5CI9 A;  1LVK A;  1TR2 A;  1J8M F;  4Q7C A;  4M63 A;  3AJM A;  4E17 A;  3M4C A;  2R03 A;  4A2N B;  1E86 A;  1U6H A;  4E18 A;  2EPN A;  5IY5 C;  4I3M A;  3DD7 A;  3ABK C;  2IXN A;  3POV A;  1NU7 D;  3E9V A;  4JCZ A;  3ZDL A;  4EIY A;  3T9O A;  2Y39 A;  1U89 A;  3CSK A;  4P9F A;  2X51 A;  3EFO A;  4GQH A;  3L0I A;  3IQ6 A;  2OEX A;  5E33 A;  5F28 E;  3SZR A;  1KNY A;  5JT4 A;  1YVI A;  4U5C E;  1QVX A;  2R7R A;  4IAO A;  3X2Q C;  1S7Z A;  4E0I A;  2L7A A;  2GA0 A;  5T1D B;  4E7S A;  1C17 M;  4H54 A;  5A6A A;  2PFD A;  2WZF A;  2P7V A;  3AQC A;  3F47 A;  3I5Q A;  4QI0 A;  2HFI A;  3ASO C;  4MVM A;  4YT4 A;  3RH3 A;  3GEI A;  1SMY F;  2PBE A;  4RDA A;  2R7U A;  3OWT A;  1RKC A;  2JX0 A;  3VM6 A;  2KNH A;  2AU5 A;  1H7I A;  3IEE A;  1YYX A;  4ER9 A;  1E83 A;  1BR1 A;  3ZG1 A;  3RKO F;  2HV7 A;  2C04 A;  4XQ1 A;  1NZE A;  4WAB A;  4I1O B;  1TWC A;  4W8P A;  3RYL A;  3G50 A;  2J8W A;  3UNG C;  1QSP A;  2OOC A;  4CSA A;  2KK1 A;  5EGY A;  4RD9 A;  4YT2 A;  2EIM C;  3EHM A;  4CSA C;  2ZXO A;  1A7V A;  2IXM A;  3LAY A;  4XPY A;  4BG0 A;  1T01 A;  2H7V C;  1D1C A;  1HMO A;  1LS1 A;  3EGD A;  3SXM A;  4J7T A;  3VYW A;  5FZT A;  4CS9 A;  3O6X A;  1M6T A;  1HY5 A;  1JPN A;  2EPM X;  3I4U A;  1G4W R;  4CS9 C;  3LES A;  4QI2 A;  1ZZP A;  5CIV A;  1XWJ A;  4MW8 A;  2EIN C;  1CGN A;  5L0H A;  1ZHZ A;  5BUO A;  2HV6 A;  4HEA J;  1M56 C;  4F4B A;  2YLD A;  3CEX A;  3ECS A;  3FOO A;  3O10 A;  5JP7 A;  3DXJ F;  5L0J A;  1QQ3 A;  2ETS A;  1Z23 A;  2LP4 A;  3HNJ A;  2P0N A;  1ORY A;  1A7E A;  2XS8 A;  3FVY A;  3CAX A;  4JKV A;  2M4E A;  2Q9B A;  4LAC B;  5AGF A;  2WVQ A;  1NSG B;  4Z9I A;  4BJ5 A;  2R7W A;  2LCH A;  3NKE A;  1SYQ A;  2B0H A;  2OJQ A;  4BJ5 C;  2QE9 A;  2CGE A;  3PHF 2;  3S29 A;  3H65 A;  3JYH A;  1U0B B;  5JUA A;  3B71 A;  4CX9 A;  3ATP A;  4P6I C;  2EIK C;  2HMQ A;  1M57 C;  4ULW A;  2Y3G A;  3M15 A;  1IZM A;  1QZX A;  1S05 A;  1HE1 A;  5KYY B;  1FFH A;  4W8K A;  2XM0 A;  3ZC4 A;  1VYI A;  1QPU A;  2GWW A;  3B0P A;  5DLJ A;  3Q7G A;  1ORJ A;  4I44 A;  1DOV A;  2Q9C A;  4YT8 A;  3C8G B;  3LUT B;  4BPM A;  5A6B D;  4N6C A;  3JTL O;  4J7Y A;  1RKE A;  2HJM A;  4HFK B;  3WG7 C;  1LE2 A;  2W4B A;  1OR2 A;  2Q00 A;  3LEV A;  5JS5 A;  2LD6 A;  5CI8 A;  2XLE A;  5B1A C;  1OXK A;  2NUP A;  1O3U A;  1E85 A;  2XLH A;  1CPR A;  2FAP B;  4IJJ A;  4U9E A;  1T6U A;  2J46 A;  2XLO A;  4JTA B;  5DQT A;  5HV9 A;  1VLS A;  4U5H A;  4CS7 A;  3AOU A;  4NC3 A;  1D0X A;  1JMW A;  3LJB A;  4ZLC A;  3J06 A;  3TK0 A;  3QVY A;  2XLM A;  1ZHY A;  4AX2 A;  2XXA A;  4K7B A;  4K0D A;  5JVE A;  3C8Z A;  4I1M A;  5BQG A;  2R02 A;  3DE8 A;  4JZA A;  5L0F A;  2G3V A;  1Z6A A;  3S0X A;  2KJG A;  2Q3T A;  5JRA A;  2TMV P;  1R4T A;  1I4Y A;  3SYN A;  3MFN A;  3LLI A;  5L0G A;  3R2P A;  1OW6 A;  4EBK A;  4HE8 D;  2R9R B;  3ZQY A;  4CS8 A;  4FAP B;  1E2X A;  4CS8 C;  2HJ3 A;  1ZU5 A;  4MQ9 F;  2P6V A;  5KYN A;  2YLI A;  3VRC A;  3K33 A;  2NPU A;  4WGY A;  1IW7 F;  2AWY A;  3EFO B;  3QTH A;  3RFY A;  2Q4F A;  4IAR A;  2WB7 A;  3U9J A;  5A6K A;  3GEE A;  2OKU A;  1GGQ A;  1XZQ A;  4DVZ A;  4JC7 A;  3ZVR A;  1Z63 A;  3DAF A;  2YQY A;  4O6Y A;  4OD5 A;  3T6B A;  2QLA A;  2VB6 A;  3MYF A;  3SNH A;  2B0J A;  1V4A A;  1ZW3 A;  2HUJ A;  3TJ6 A;  2Y3B A;  3QVZ A;  4YL1 A;  3PDM P;  3ITF A;  3ZSU A;  1MND A;  4OIQ F;  1SR2 A;  4DBQ A;  3W2W A;  2H7O A;  3HJC A;  5KYX A;  3GAN A;  2FFH A;  4IB4 A;  4C3D A;  2YL1 A;  2KC3 A;  1YJG A;  1OW8 A;  1CGO A;  2J0W A;  5JSL A;  4Q4Z F;  1VK5 A;  2HS5 A;  2CNW A;  2R05 A;  2YWA A;  3JT1 A;  4U5B E;  2UUH A;  3ABM C;  1MNE A;  3ZQV A;  4WGZ A;  2DGJ A;  2GDC A;  4DRI B;  3TUL A;  2YKZ A;  2J0X A;  1A41 A;  5L0I A;  1B68 A;  3B29 A;  1OXB A;  3L8J A;  256B A;  4G78 A;  2XS1 A;  3K1H A;  1RCP A;  3SEO A;  3EGD B;  1E84 A;  1TWG A;  4U5G A;  2OCC C;  2MHR A;  4BEM J;  4N6H A;  1ZHX A;  1YA7 O;  3B0U X;  2DYS C;  4N4W A;  3ZIB A;  2VH3 A;  3C63 A;  3IPM O;  1RXQ A;  1VYK A;  4O7G A;  3EJN A;  2NUT A;  2L6G A;  1EI7 A;  3NMK A;  2VCC A;  1D0Y A;  2D5R B;  3DZA A;  4KNW A;  1LE4 A;  2L6H A;  2R7S A;  1EKY A;  1MMN A;  1LPE A;  4D4X A;  1NBB A;  3L34 A;  3GM1 A;  4K1O A;  3JYY A;  2MYS A;  4NCQ A;  1BR4 A;  2A0B A;  2P1A A;  3U9M A;  3FDQ A;  2CYD A;  1WAS A;  2PF4 E;  2QY9 A;  4L6R A;  1TFK B;  3GOR A;  3SP1 A;  3NDB B;  3KYJ A;  1MMD A;  2EPL X;  4ZLD A;  2NG1 A;  2LQG A;  1J8Y F;  2NSF A;  2KGO A;  2P61 A;  4IRU A;  1YDI A;  3NYM A;  4U5F E;  4EUK B;  3EZH A;  3FMS A;  4XEF A;  1CGM E;  3VAY A;  3UGP A;  1MMG A;  2C03 A;  1OCC C;  2PX3 A;  3DJN B;  1I4Z A;  2A69 F;  3KL4 A;  1M2V A;  3MBG A;  1H6G A;  3GWN A;  3R7C A;  4IGG A;  2Q7R A;  2D4U A;  1RKE B;  1KTM A;  2PNO A;  2XL6 A;  3B9Q A;  4CJO A;  4PAC A;  3N2Z B;  2Y3H A;  4DOZ A;  3M4B A;  5GPG B;  1K04 A;  2Y3D A;  1OCZ C;  3ZTM A;  4CIH A;  1Z7Q c;  1ZHT A;  3V7O A;  3UMK A;  3K1I A;  4ANJ A;  3RQF A;  4MTG A;  3K1I C;  2HZ8 A;  4G7H F;  3L8I A;  3S90 A;  1JOG A;  4X0R A;  5DS5 A;  1FFT C;  2YL7 A;  3FAP B;  1ZVZ A;  2LFD A;  4YT5 A;  4LLC A;  1R5I D;  4JIO A;  3T4R A;  4J30 B;  4WJ0 A;  4YN0 B;  1H9T A;  2QNL A;  1Z5Z A;  3DI5 A;  1T6Q A;  4LDQ A;  1L3P A;  3JSZ A;  2ZPA A;  3G4X A;  5DS6 A;  3K7D A;  1A7D A;  1NG1 A;  3TOL A;  2EIL C;  2I8B A;  2JD3 A;  3G4Z A;  5FCL A;  2AVK A;  4FWV A;  3U2M A;  2VAS A;  3V5X A;  3H2V A;  4MVZ A;  4XTK A;  4FX5 A;  4BJ1 A;  3EH2 A;  2CNW D;  2KYH A;  3KKB A;  1G4U S;  4LER A;  3V5Z A;  5A69 A;  2Q9A A;  2QTV A;  1BDJ B;  4NTF A;  2LFF A;  3LS1 A;  3C18 A;  1WWP A;  3GM3 A;  3S28 A;  1C03 A;  4XWJ A;  3KPH A;  4DJ9 A;  2IOQ A;  5TJ5 E;  3WOD F;  2YLG A;  1MQV A;  4DXW A;  3EZI A;  3W4Y A;  4C7O A;  1K40 A;  3T6G B;  1OQC A;  3B0V C;  3KH2 A;  3DKA A;  4XLN F;  3U3B A;  3ZTZ A;  5BQI A;  4MVU A;  3BRJ A;  1NU9 C;  2YL3 A;  4MVO A;  1LI5 A;  4J32 B;  3SXY A;  2HKV A;  4JEB A;  4Z9H A;  1F1M A;  1D1B A;  1JPJ A;  5L3V A;  3AGT A;  3W8H A;  2PX0 A;  1HW1 A;  1QLE C;  5E3A A;  3U8V A;  4NQF A;  3LNM B;  4OIR F;  5L3Q A;  2BC5 A;  3UMI A;  2RSE B;  1YAR O;  3PCV A;  4PR9 A;  4AE4 A;  2R7Q A;  1NLX A;  1SZI A;  3NRH A;  2DI3 A;  2M64 A;  1YA9 A;  3IQC A;  1SF8 A;  2CCY A;  3NMI A;  1FAP B;  5DVW A;  2Y69 C;  3UGO A;  3KMI A;  3DM5 A;  4LDR A;  4U5D E;  3U3F A;  4EBB A;  5KYU A;  5T3W A;  4XLP F;  3RVZ A;  2WL8 A;  2NUT B;  1YYJ A;  2EPK X;  2J9W A;  2XL4 A;  2BL2 A;  3JSE O;  3O39 A;  4XEK A;  2A0U A;  4UDV A;  3IQ5 A;  5KYW A;  2IM8 A;  2ZD9 A;  3GWL A;  3FXH A;  3U5S A;  2F22 A;  4JVS A;  3RW0 A;  4D4N A;  4EHP A;  5F5F A;  4XPW A;  5KYY A;  2AWC A;  3AQB A;  4E7Z A;  2WVN A;  4Q5S F;  1JAF A;  1GS9 A;  2VC9 A;  2VCB A;  2WZG A;  3NYL A;  2IXO A;  1M2O A;  1QKR A;  4H4K C;  1Q0D A;  1V54 C;  4IAQ A;  4GEH A;  3OA1 A;  3Q6M A;  3TOM A;  3ASN C;  4R32 A;  4EBJ A;  1Z3I X;  2J7P A;  1EA8 A;  2HSB A;  3QW1 A;  1FMV A;  4GYT A;  1C02 A;  5E2Q A;  2VCA A;  2LIG A;  3EG9 A;  3HKK A;  1A0B A;  5AC4 A;  5K0I A;  1JRA A;  2LK4 A;  2LSE A;  3EGX A;  4JJG A;  3AG4 C;  1Q0M A;  2L81 A;  1M2V B;  2UUI A;  3JRT A;  3S9O A;  4MVR A;  3SXK A;  3V5Y A;  2L6F A;  3CZ6 A;  4NTA A;  3RIP A;  3U2L A;  4AL1 A;  1HW2 A;  3AG2 C;  4CDY A;  1LKX A;  3PMR A;  3IHU A;  2H7B A;  1OKK A;  2G62 A;  3BEH A;  3TD7 A;  4G7O F;  5COG A;  1W2W A;  4YL3 A;  3MX3 A;  3NG1 A;  1RMV A;  1FR0 A;  1T6I A;  5D92 A;  3TJ5 A;  1BZ4 A;  2KQ9 A;  3SXZ A;  2GFH A;  4JW1 A;  5DS4 A;  3H2U A;  2CW0 F;  1G8X A;  3HNI A;  1ZW2 A;  1VMA A;  3DE9 A;  2XSE A;  1DOW A;  3JRM O;  4N06 A;  1UFB A;  4XEV A;  5AC5 A;  4CIP A;  2DYR C;  4YK5 A;  4CDV A;  2XRH A;  3FHD A;  4MTF A;  4DVY P;  3HNL A;  2R25 A;  4EKW A;  1G5Z A;  1FMW A;  1L7C A;  3NYJ A;  4JTD B;  5B3S C;  1MMA A;  3AGU A;  1LIH A;  4O6N A;  1VLT A;  2FGY A;  5L0D A;  4OIO F;  1APC A;  1ZYR F;  3NMJ A;  1ST6 A;  4LDK A;  3EQL F;  1I5N A;  3Q7L A;  2YZS A;  4FES A;  4JCH A;  4KC9 A;  5B1B C;  1TKN A;  2MWQ A;  1FTS A;  2A68 F;  2QUP A;  4MND A;  4ULV A;  1Q0G A;  4XPX A;  4OIN F;  3WAQ A;  4CDA A;  2ZXW C;  1EQ1 A;  4PJJ A;  2HSQ A;  3DJU B;  1WAT A;  2NUP B;  3E70 C;  3M1C B;  2R7O A;  4PJM A;  1BBH A;  3RQE A;  4YL0 A;  3W2V A;  1PD1 A;  3X1O A;  4AK9 A;  5L0C A;  3T6J A;  3RF3 A;  3DAG A;  1RJ9 A;  2ICW G;  2HMZ A;  4KNV A;  1ZHW A;  2KW3 C;  3JCU Q;  1HMD A;  4CBE A;  3QW0 A;  3S84 A;  4C7O B;  4PK4 A;  2R7V A;  3FOP A;  1D1A A;  2WZL A;  3LNR A;  3DMD A;  1JR8 A;  2GAQ A;  3F46 A;  3U0C A;  2XXA B;  5D91 A;  1D0Z A;  5E3C A;  2DB4 A;  1KU2 A;  1ORS C;  2XM4 A;  4U5E E;  4HFF B;  4G7Z F;  3L1M A;  1YAU O;  2V3C C;  1NFN A;  1YLM A;  3N24 A;  4MVQ A;  1VTM P;  2NSG A;  2H8A A;  4O79 A;  1WGW A;  2A1D D;  3N0T A;  2J45 A;  2YHS A;  3EHN A;  5DQZ A;  3C8G D;  4A4A A;  4AL0 A;  2L9J A;  2YRF A;  4YJW A;  2A6E F;  2XLD A;  4MVS A;  5COF A;  2J7P D;  3C62 A;  3HNK A;  4AE4 B;  1XZP A;  1V74 B;  3FAJ A;  4PJL A;  4C3B A;  4EWC A;  5BQH A;  1NFO A;  4KBL A;  2OJE D;  4YWQ A;  5EHH A;  2ASR A;  2IBF A;  4O6M A;  1LM3 B;  1PCX A;  1ZU4 A;  3EPV A;  3IQT A;  5KYU B;  3A11 A;  3QZC A;  2V26 A;  2XLV A;  5KYW B;  3GOD A;  4JUR I;  1LS4 A;  3VF0 A;  1OKK D;  1CPQ A;  1OR3 A;  1WTY A;  2OQM A;  4Z9J A;  4BEJ A;  2ZXP A;  3O55 A;  2XLW A;  5KYX B;  1AEP A;  4MS2 A;  3QMK A;  4PJN A;  2I15 A;  4JJF A;  2YVK A;  4ONS A;  1TFO B;  2PP4 A;  4PFO A;  2O9X A;  1OCR C;  2ZXR A;  2IYL D;  3ZWI A;  3S27 A;  3EG9 B;  1Q0K A;  2AP3 A;  2W9Y A;  3JZ0 A;  3UR3 C;  3ABL C;  3EGX B;  2YL0 A;  1PV3 A;  3U8P A;  1H9G A; 
#chains in the Genus database with same CATH homology
 3M79 A;  5JUA A;  4CX9 A;  2J9B A;  4JEA A;  4CDY A;  3M15 A;  1S05 A;  1YZC A;  2XM0 A;  1QPU A;  4U9D A;  2XL6 A;  4CJO A;  3M4B A;  3ZTM A;  3HNI A;  5B3I A;  4CIP A;  3DE9 A;  5JS5 A;  2XLE A;  4CDV A;  1E85 A;  2XLH A;  1CPR A;  3HNL A;  4U9E A;  2XLO A;  2YL7 A;  1YZA A;  3QVY A;  2XLM A;  5JLI A;  1APC A;  3NMJ A;  1GQA A;  4JE9 A;  5JVE A;  3DE8 A;  2XL8 A;  3TOL A;  5JRA A;  4ULV A;  4CDA A;  4CJG A;  1BBH A;  3ZQY A;  3M4C A;  2YLI A;  3VRC A;  1E86 A;  4WGY A;  3QW0 A;  2YLG A;  1MQV A;  4IAR A;  3FOP A;  4EIY A;  2QLA A;  3IQ6 A;  2XM4 A;  3ZTZ A;  3L1M A;  2YL3 A;  3QVZ A;  4JEB A;  4IB4 A;  2YL1 A;  2XLD A;  1CGO A;  3C62 A;  3HNK A;  5JSL A;  2BC5 A;  1YYX A;  4ER9 A;  3ZQV A;  4WGZ A;  1E83 A;  2YKZ A;  1LM3 B;  256B A;  2CCY A;  3NMI A;  1RCP A;  2XLV A;  2J8W A;  1E84 A;  4N6H A;  1YYJ A;  1A7V A;  1CPQ A;  4N4W A;  3IQ5 A;  2XLW A;  3C63 A;  1M6T A;  4D4N A;  3NMK A;  1JAF A;  1CGN A;  4NC3 A;  1EKY A;  2YLD A;  4IAQ A;  3FOO A;  5JP7 A;  3ZWI A;  4D4X A;  1NBB A;  3TOM A;  1QQ3 A;  5AGF A;  3HNJ A;  3QW1 A;  4JKV A;  2YL0 A;  4L6R A;  3U8P A;  5JT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...