4CX9A

The 5-coordinate proximal no complex of cytochrome c prime from shewanella frigidimarina
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
128
structure length
128
Chain Sequence
NFEEPADAIEYRQAAFGLIAYNFGDMGAMLKGKKPFDAAVFSTRADNVAALSKIPHEGFIAGSDKGDTEALAKIWQDKADFDSKMTAFQDNAAALAVAAKSSDQNNIKQAFANTGKSCKGCHDVYKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C, CLASS II
publication title Conformational Control of the Binding of Diatomic Gases to Cytochrome C'.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Electron transport
total genus 55
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4cx9A00
4WGYA 3M4CA 5JLIA 2XLEA 4CDAA 4ULVA 4JEBA 3M79A 2XL8A 2XLHA 3HNKA 4IAQA 3VRCA 4JKVA 3QVYA 2J9BA 2YLGA 1E83A 1E86A 2XLVA 5B3IA 2XM4A 2XLDA 4CIPA 1YYXA 3DE8A 4JEAA 1RCPA 4D4XA 4CJGA 4JE9A 1A7VA 1CGOA 1YYJA 3HNIA 4D4NA 3C62A 1CPQA 5AGFA 5JS5A 2YL1A 2XLOA 4U9EA 5JP7A 3HNJA 2XLWA 4IARA 1EKYA 3IQ5A 1BBHA 1E84A 5JSLA 1MQVA 4U9DA 3ZQYA 4CDVA 5JRAA 1GQAA 4CX9A 1LM3B 3TOMA 3DE9A 3HNLA 1NBBA 3FOOA 2CCYA 5JVEA 4CDYA 2YLIA 2XM0A 4L6RA 4N4WA 1JAFA 2XL6A 1APCA 1YZCA 2J8WA 2YLDA 1QQ3A 3FOPA 3L1MA 3QW0A 3QVZA 1M6TA 2BC5A 2QLAA 2YKZA 1S05A 1CPRA 4EIYA 3ZTMA 3M15A 3ZWIA 3ZTZA 2YL0A 3M4BA 3TOLA 1CGNA 1QPUA 5JT4A 3NMIA 4WGZA 1E85A 2YL7A 256BA 4IB4A 3U8PA 5JUAA 3NMKA 3C63A 3QW1A 3IQ6A 3NMJA 4N6HA 4ER9A 4NC3A 1YZAA 2YL3A 2XLMA 4CJOA 3ZQVA
chains in the Genus database with same CATH superfamily
2KK1A 5DS6A 4ZLDA 1V54C 4LLEA 1TWHA 2J7PA 1O3UA 4J7TA 2XLEA 4CS9A 2DYSC 5L0DA 4FWVA 3EG9A 2H7BA 5FZTA 1Z23A 2J0WA 3LEOA 4DRJB 5L0JA 1BR1A 3US6A 3EJNA 2Y3GA 4E7SA 2GWWA 3VRCA 3CQZA 1MMDA 3L0IA 2JD3A 2ZXWC 3G4XA 4A2NB 1Z7Qc 2HMQA 1JOGA 3S0XA 2JX0A 2XLDA 4O79A 1YYXA 3MYFA 5B3SC 5HSWA 2A1DD 1VYIA 4Z9JA 4MVQA 3C8GB 3OEOA 3A9CA 1UFBA 3LNRA 4JEAA 3V5XA 3DAFA 1RCPA 1OW8A 3DD7A 4LDQA 3SZRA 2HUJA 4I1OB 1HW2A 4CS8A 1E2XA 1V55C 3RFYA 2KJGA 2ZD9A 4IGGA 2LSEA 3ITFA 4LLCA 1FMWA 1T01A 3R7CA 3RVZA 3SNHA 4E17A 4IAOA 3GORA 4BJ6C 1DOVA 2FFHA 3WAQA 3NYLA 1U89A 2XLOA 4IRUA 1JPJA 1FFHA 2DI3A 4AX2A 1RMVA 1OCCC 3EFOB 4BEMJ 2OJQA 3E9VA 4XPYA 3DM5A 3HNJA 3TULA 1HE1A 3IQ5A 4MW8A 3EH2A 3NG1A 2L81A 5JSLA 3U2LA 3LNMB 4JTAB 4EUKB 2GA0A 2LD6A 2EPLX 1XWJA 3W8HA 2ZXOA 2VB6A 1YJGA 3GM3A 4Z9HA 3ZVRA 4WABA 2XSEA 1A41A 3DKAA 5E33A 4RD9A 5BQHA 3NDBB 4MVUA 3ABMC 4GEHA 5AC4A 5EGYA 5F28E 1Q0DA 4JTCB 1Z5ZA 3FDQA 2J9WA 1D0ZA 4EKWA 3KH2A 4BJ6A 2VCBA 2Y69C 2CDQA 4GQHA 2AWCA 5E3AA 3EPVA 3RQGA 4E0HA 4Q5SF 2R7RA 3AQCA 2XXAB 3JT1A 3SP1A 4F4BA 4AL0A 2KW3C 1MMNA 1Q0KA 4BJ5A 1EA8A 1GS9A 2R7XA 4MS2A 3BEHA 1XZPA 2PNOA 3S9OA 1NU9C 2XL6A 3NYMA 3TJ6A 2CNWA 4U5DE 3B29A 4CSAC 4YL0A 4A4AA 4FESA 3W2VA 2ZXRA 3LS0A 4MTFA 3QW0A 3ECSA 4FX5A 1M6TA 2QY9A 4XWJA 1MNEA 2EIMC 2NG1A 1QSPA 1NLXA 3ABKC 2Y39A 2LCHA 2P7VA 2QTVA 1G5ZA 1VLTA 2O9XA 2WVQA 1FTSA 1T5OA 3M15A 5T1DB 3TOLA 1JMWA 3KL4A 5A6JA 2YRFA 1OW7A 4AE4A 1ZHXA 3KYJA 3JSEO 4QI0A 1E85A 1OXBA 1XZQA 4O6YA 5B1BC 5KYYA 256BA 5KYXB 3Q6MA 5DQZA 2LQGA 5EK0A 3U8PA 2P1AA 1TKNA 2R7OA 5T3TA 4KNWA 2IBFA 3O10A 1ORYA 2VCAA 3DZAA 2KQ9A 1LS4A 2NUTA 2D4UA 2EILC 2PBEA 3MYIA 3HTKC 4NC3A 2XLMA 2WVNA 3J06A 2HV7A 2B0HA 4JRZA 4JVSA 3K33A 2HV6A 1LVKA 4WGYA 2HFIA 5DVWA 4XEVA 3HLZA 4CS9C 4HFKB 2H7OA 5D91A 5KYWA 1YAUO 2J0XA 2LP4A 4XEFA 4JEBA 4K0DA 1FR0A 3IQTA 2A0BA 2PFDA 1ZW2A 2L6FA 1YA7O 1V74B 1ZHZA 2J9VA 2OKUA 2XLHA 4EHPA 5EHHA 1LS1A 5E2QA 2IM8A 3FMSA 3TQOA 1QZXA 3GODA 1OCRC 2YLGA 3T4RA 1E83A 5A6BD 3C18A 4JCZA 2VASA 3SEOA 4Q7CA 2QE9A 3K66A 1PD0A 2XLVA 2XM4A 1N1CA 3RVYA 2IXPA 3X1OA 3K1IA 1KTMA 4K7BA 2R7QA 3EGXA 4DJ9A 2HJ3A 1KNYA 1ZHTA 1ST6A 1T6QA 2YVKA 4CS8C 3SXYA 4N6CA 3RF3A 4D4XA 4MTGA 4BJTA 4CJGA 5D92A 4YL1A 2DYRC 1CGOA 4P6IC 2ICWG 3ZDLA 2VCCA 1RKEB 4OIQF 3UGPA 1R4TA 1Y4CA 1TWCA 5AGFA 2YL1A 3H2UA 3Q7LA 5CI9A 4U9EA 1HE9A 1I4ZA 5JP7A 4U5EE 4YWQA 4I44A 3S29A 3VM6A 2P61A 2CGEA 1K05A 4IARA 1Z63A 3EQLF 1EKYA 3ZG1A 2B0JA 1BBHA 4PJMA 4O6NA 2IOQA 4NTBA 3L8IA 2HJMA 4KBLA 4RBNA 1IZMA 2HSBA 3QMKA 2MYSA 3W8IA 4YT8A 2P0NA 1VK5A 3EZIA 4K1OA 3L34A 1J8MF 1LI5A 1T9KA 3CZ6A 2G3VA 3NKEA 3QTHA 2OJED 3LJBA 3MX3A 1LI7A 1ZVZA 1M2VA 2Y3DA 4N06A 1OKKA 5KYUA 2W9YA 1FAPB 2OEXA 2YEVA 4I1MA 4CX9A 1OR3A 3AG1C 4H4KC 2A6EF 1G4US 2L9JA 1NZEA 3JCUQ 4O6MA 5L0IA 1NG1A 3F47A 2LFDA 2MHRA 3FOOA 5JVEA 4G7HF 3KKBA 1M57C 1ZHWA 4BJ5C 4XPXA 4CIHA 5KYNA 2P6VA 3K7DA 4CDYA 2KGOA 2VC9A 4YJWA 2NUPA 2Y3BA 3S28A 1APCA 1NU7D 3HKKA 3U0CA 1Q0FA 1YZCA 3LS1A 2NUTB 2WL8A 5K0IA 3H65A 4YK5A 1L7CA 4BPMA 2DGJA 3DWWA 3EHNA 2A68F 2QLAA 2YKZA 2V26A 1C17M 4CBEA 1BR2A 4MW3A 2R7UA 1S05A 1CPRA 4EIYA 5KYWB 1YARO 3T6GB 4JTDB 2J7PD 2NPUA 2AVKA 1QVXA 3NKDA 4PFOA 3ZTZA 3IQCA 4YT4A 1QPUA 1BZ4A 2L6HA 5JT4A 3B71A 4OIPF 3ASNC 2ETSA 1JRAA 4U5BE 4OD5A 2YL7A 3OWTA 4IB4A 5DQTA 2R05A 3UMKA 1H6GA 5JUAA 1TFOB 1AUEA 1RXQA 3GEEA 3EGXB 3L8JA 3FHDA 2QUPA 4ER9A 1C03A 2Q4FA 4NTFA 5BQGA 3PHF2 3EHMA 2R9RB 2GAQA 4MQ9F 3ATPA 3AQBA 5COFA 3U9JA 3U9MA 4MNDA 1SMYF 2YQYA 1HY5A 2GDCA 3I4UA 2R7TA 4YN0B 1MMAA 4EBJA 1OKKD 4G78A 4ULVA 5COGA 3N2ZB 1OQCA 1ORJA 3AGUA 3NYJA 5L0HA 5DS4A 3KYIA 4H54A 4KC9A 1T6UA 3EG9B 1UG7A 4IAQA 4IJJA 3UMHA 2JPUA 1H7IA 4JKVA 3QVYA 3GANA 3ZSUA 1FMVA 3RH3A 4RDAA 1HMOA 1D0XA 1NFOA 2PX3A 2WZGA 1OW6A 3MBGA 3GM2A 5DLJA 3K1IC 4G0HA 3R2PA 5F5HA 2EIJC 1YVIA 1YLMA 3C8GA 3LEVA 1DOWA 4CIPA 4OIOF 4XQ1A 2W4MA 2IYLD 1OCOC 3DE8A 2BL2A 1R5ID 2J9UA 2GFHA 3EH1A 2IXMA 3T6JA 4UDVA 1OR2A 1PCXA 2H7VC 4MVOA 4JE9A 1A7EA 3UGOA 4JURI 2J46A 2WVOA 3CSKA 1A0BA 1HW1A 1YYJA 2Q9AA 3ABLC 3C62A 1M2VB 2NSGA 4D4NA 5KYUB 3LLKA 3DJNB 2KNHA 3JZ0A 3LESA 3RIPA 5JS5A 2FAPB 1M2OA 2EPKX 1F1MA 4NQFA 1TWAA 2AWYA 4EBKA 4XEKA 2KC3A 4PR9A 2HSQA 4DOZA 3FAJA 1I5NA 4ZLCA 2OEVA 3GM1A 4I3MA 5BUOA 3MFNA 3GEHA 1GGQA 1D1AA 2H8AA 1H9TA 2V3CC 3SXZA 3G4ZA 1MNDA 4OINF 4WJ0A 1MQVA 3AGTA 1SZIA 2WZFA 4DVZA 1VYKA 3V5ZA 3WODF 4JIOA 3JSZA 4U9DA 2L6GA 3ZQYA 4CDVA 5F5FA 2Q9BA 2CNWD 3RQEA 3RQFA 5JRAA 1S7ZA 5CI8A 3U8VA 5GPGB 2R7WA 4MVMA 3JTLO 3GWNA 4KI2A 3ZC4A 1LIHA 1LM3B 3Q7GA 3TOMA 2UUIA 5L3VA 4XPWA 1HMDA 3I5PA 3WG7C 2C04A 1NBBA 4X0RA 3ZIBA 2G62A 4AL1A 4YT2A 2CCYA 2HZ8A 2LIGA 1ORSC 4JZAA 4QI2A 2R25A 2WZLA 3LAYA 3UR3C 1BDJB 1H9GA 1TFKB 2EIKC 4GYTA 4NCQA 4AK9A 3U5SA 4U5HA 3IHUA 4N4WA 1WATA 1JAFA 4MTOA 1T6IA 2A0UA 4ULWA 2HKVA 3T6BA 3IEEA 3C7JA 2HMZA 2M4EA 1RJ9A 2X51A 4O7GA 5AC5A 5A69A 2J8WA 3B9QA 1QQ3A 3TK0A 4JJFA 2MWQA 1OXKA 3VAYA 4DBRA 1W2WA 2W4BA 2BC5A 2OG2A 2F22A 2Z15A 4M63A 4XLNF 4DRHB 3RKOF 3PDMP 1SYQA 3OA1A 3S27A 3FVYA 3DMDA 3QZCA 2LK4A 2XL4A 3JRTA 4YT5A 2XS8A 4C3BA 3PCVA 2I15A 3AOUA 5A6KA 1VTMP 4MVRA 3W4YA 2Y3HA 1VB5A 2Q7RA 2BE5F 2HS5A 2IXOA 3ZTMA 1CGME 1YDIA 3N24A 3SXMA 1AEPA 1O5HA 2Q00A 4PFPA 3KMIA 3WHNA 1CGNA 3EZHA 4LACB 4YL3A 4NY3A 5KYXA 3NMIA 3JYYA 4AE4B 1ZZPA 2EPMX 3S90A 4G7ZF 4B6IA 5KYYB 4XTKA 2ZXPA 4BG0A 4PJLA 2EPNA 2WB7A 3NMJA 2D5RB 3EGDA 3A11A 4QDLA 1YA9A 2YL3A 3M1CB 1JR8A 4CDAA 2FGYA 4R32A 3BRJA 1U6HA 1EQ1A 3M4CA 4Z9IA 2C03A 2RSEB 4JC7A 5JLIA 1ZU5A 3LLIA 1LPEA 1VMAA 2J45A 4MVZA 5COMA 2E87A 1B68A 3AG3C 2XL8A 1FFTC 3F46A 3K6BA 3M79A 2QNLA 2YWAA 3FAPB 3O55A 4IWBA 4P9TA 5L0CA 3HNKA 4DBQA 4ONSA 3W2WA 1NSGB 3C8ZA 2J9BA 1GM5A 1LKXA 2XS1A 4JCHA 1FNTc 4C7OA 4U5CE 4KNVA 2Q3TA 1E86A 5B3IA 2XRHA 4CS7A 5A6AA 4PJNA 1K40A 4C3DA 1D1CA 5L0FA 3V7OA 3Q6NA 4C3EA 5DS5A 2PF4E 1U0BB 3T9OA 3U2MA 1A7VA 4Q4ZF 1PV3A 1RKEA 2OU6A 2R7SA 3PMRA 3HNIA 4HFFB 1WASA 1CPQA 2DB4A 2R02A 3CAXA 3DI5A 3LUTB 5B1AC 3KPHA 2A6HF 1C02A 2VH3A 3K1HA 3DJUB 3B0VC 2CYDA 3NRHA 4JJGA 2G3KA 2KSFA 4E18A 3JRMO 4HE8D 1ZHYA 5FCLA 2ASRA 3DAGA 2XLWA 4JW1A 4LERA 5A6BA 3V5YA 4BJ1A 1M56C 2Q9CA 1E84A 1A7DA 1Z6AA 1V4AA 4EWCA 1ZU4A 1Q0GA 1WN0A 2AP3A 3B0PA 1Z3IX 2IXNA 4NTAA 4OD4A 3DXJF 3RYLA 1RJ9B 3UNGC 3H2VA 1K04A 2KYHA 2X0CA 2UUHA 1O87A 3U3FA 4DVYP 3S84A 1GQAA 5L0GA 1BR4A 1D1BA 4MVSA 3GEIA 1QKRA 4ANJA 1PD1A 1D0YA 1SF8A 4U5GA 3DE9A 5E3CA 3HNLA 3G50A 2R7VA 3O6XA 3EFOA 3E70C 1NFNA 4FAPB 2L7AA 3O39A 3X2QC 3POVA 2W45A 4E7ZA 2ZPAA 1VLSA 1IW7F 4XLPF 5T3WA 4PACA 4LDRA 5TJ5E 2M64A 2NSFA 3DM9B 1TR2A 2PX0A 2YLIA 2XM0A 4BEJA 2R03A 4L6RA 1AVOB 1G8XA 3IPMO 4E0IA 3SYNA 2YZSA 4J32B 1L3PA 3N0TA 5CIVA 4EBBA 4DXWA 3AJMA 1JPNA 2EINC 1QLEC 3FXHA 2NUPB 2A69F 3AG4C 1MMGA 3I5QA 3MLGA 1SR2A 1Y6DA 2I8BA 2YLDA 1RKCA 2RD9A 3FOPA 4PJJA 3L1MA 4CSAA 3EGDB 3QVZA 3HJCA 4P9FA 1ZYRF 1WTYA 3UMIA 2LFFA 5IY5C 3TD7A 1KU2A 3VYWA 2OQMA 2TMVP 4OIRF 1J8YF 2OCCC 2OOCA 1LE4A 3AG2C 3TJ5A 3VF0A 2EPOA 3JYHA 3ZWIA 1WOLA 2YL0A 3GWLA 3M4BA 4J30B 4U5FE 1OCZC 1Q0MA 1ZW3A 4PK4A 2AU5A 1WWPA 4HEAJ 2XXAA 4G7OF 4J7YA 2CW0F 5L3QA 3U3BA 4LDKA 4WGZA 3RW0A 3CEXA 5HV9A 4C7OB 4W8KA 4DRIB 3B0UX 3SXKA 1TWGA 2PP4A 1EI7A 3NMKA 1I4YA 1G4WR 3C63A 3QW1A 4W8PA 3IQ6A 3C8GD 3ASOC 4N6HA 5BQIA 1LE2A 1WGWA 2YHSA 1TQGA 1YZAA 4CJOA 1VOMA 3ZQVA
chains in the Genus database with same CATH topology
4WGYA 3M4CA 5JLIA 2XLEA 4CDAA 4ULVA 4JEBA 3M79A 2XL8A 2XLHA 3HNKA 4IAQA 3VRCA 4JKVA 3QVYA 2J9BA 2YLGA 1E83A 1E86A 2XLVA 5B3IA 2XM4A 2XLDA 4CIPA 1YYXA 3DE8A 4JEAA 1RCPA 4D4XA 4CJGA 4JE9A 1A7VA 1CGOA 1YYJA 3HNIA 4D4NA 3C62A 1CPQA 5AGFA 5JS5A 2YL1A 2XLOA 4U9EA 5JP7A 3HNJA 2XLWA 4IARA 1EKYA 3IQ5A 1BBHA 1E84A 5JSLA 1MQVA 4U9DA 3ZQYA 4CDVA 5JRAA 1GQAA 4CX9A 1LM3B 3TOMA 3DE9A 3HNLA 1NBBA 3FOOA 2CCYA 5JVEA 4CDYA 2YLIA 2XM0A 4L6RA 4N4WA 1JAFA 2XL6A 1APCA 1YZCA 2J8WA 2YLDA 1QQ3A 3FOPA 3L1MA 3QW0A 3QVZA 1M6TA 2BC5A 2QLAA 2YKZA 1S05A 1CPRA 4EIYA 3ZTMA 3M15A 3ZWIA 3ZTZA 2YL0A 3M4BA 3TOLA 1CGNA 1QPUA 5JT4A 3NMIA 4WGZA 1E85A 2YL7A 256BA 4IB4A 3U8PA 5JUAA 3NMKA 3C63A 3QW1A 3IQ6A 3NMJA 4N6HA 4ER9A 4NC3A 1YZAA 2YL3A 2XLMA 4CJOA 3ZQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WGY A;  3M4C A;  5JLI A;  2XLE A;  4CDA A;  4ULV A;  4JEB A;  3M79 A;  2XL8 A;  2XLH A;  3HNK A;  4IAQ A;  3VRC A;  4JKV A;  3QVY A;  2J9B A;  2YLG A;  1E83 A;  1E86 A;  2XLV A;  5B3I A;  2XM4 A;  2XLD A;  4CIP A;  1YYX A;  3DE8 A;  4JEA A;  1RCP A;  4D4X A;  4CJG A;  4JE9 A;  1A7V A;  1CGO A;  1YYJ A;  3HNI A;  4D4N A;  3C62 A;  1CPQ A;  5AGF A;  5JS5 A;  2YL1 A;  2XLO A;  4U9E A;  5JP7 A;  3HNJ A;  2XLW A;  4IAR A;  1EKY A;  3IQ5 A;  1BBH A;  1E84 A;  5JSL A;  1MQV A;  4U9D A;  3ZQY A;  4CDV A;  5JRA A;  1GQA A;  4CX9 A;  1LM3 B;  3TOM A;  3DE9 A;  3HNL A;  1NBB A;  3FOO A;  2CCY A;  5JVE A;  4CDY A;  2YLI A;  2XM0 A;  4L6R A;  4N4W A;  1JAF A;  2XL6 A;  1APC A;  1YZC A;  2J8W A;  2YLD A;  1QQ3 A;  3FOP A;  3L1M A;  3QW0 A;  3QVZ A;  1M6T A;  2BC5 A;  2QLA A;  2YKZ A;  1S05 A;  1CPR A;  4EIY A;  3ZTM A;  3M15 A;  3ZWI A;  3ZTZ A;  2YL0 A;  3M4B A;  3TOL A;  1CGN A;  1QPU A;  5JT4 A;  3NMI A;  4WGZ A;  1E85 A;  2YL7 A;  256B A;  4IB4 A;  3U8P A;  5JUA A;  3NMK A;  3C63 A;  3QW1 A;  3IQ6 A;  3NMJ A;  4N6H A;  4ER9 A;  4NC3 A;  1YZA A;  2YL3 A;  2XLM A;  4CJO A;  3ZQV A; 
#chains in the Genus database with same CATH topology
 2KK1 A;  5DS6 A;  4ZLD A;  1V54 C;  4LLE A;  1TWH A;  2J7P A;  1O3U A;  4J7T A;  2XLE A;  4CS9 A;  2DYS C;  5L0D A;  4FWV A;  3EG9 A;  2H7B A;  5FZT A;  1Z23 A;  2J0W A;  3LEO A;  4DRJ B;  5L0J A;  1BR1 A;  3US6 A;  3EJN A;  2Y3G A;  4E7S A;  2GWW A;  3VRC A;  3CQZ A;  1MMD A;  3L0I A;  2JD3 A;  2ZXW C;  3G4X A;  4A2N B;  1Z7Q c;  2HMQ A;  1JOG A;  3S0X A;  2JX0 A;  2XLD A;  4O79 A;  1YYX A;  3MYF A;  5B3S C;  5HSW A;  2A1D D;  1VYI A;  4Z9J A;  4MVQ A;  3C8G B;  3OEO A;  3A9C A;  1UFB A;  3LNR A;  4JEA A;  3V5X A;  3DAF A;  1RCP A;  1OW8 A;  3DD7 A;  4LDQ A;  3SZR A;  2HUJ A;  4I1O B;  1HW2 A;  4CS8 A;  1E2X A;  1V55 C;  3RFY A;  2KJG A;  2ZD9 A;  4IGG A;  2LSE A;  3ITF A;  4LLC A;  1FMW A;  1T01 A;  3R7C A;  3RVZ A;  3SNH A;  4E17 A;  4IAO A;  3GOR A;  4BJ6 C;  1DOV A;  2FFH A;  3WAQ A;  3NYL A;  1U89 A;  2XLO A;  4IRU A;  1JPJ A;  1FFH A;  2DI3 A;  4AX2 A;  1RMV A;  1OCC C;  3EFO B;  4BEM J;  2OJQ A;  3E9V A;  4XPY A;  3DM5 A;  3HNJ A;  3TUL A;  1HE1 A;  3IQ5 A;  4MW8 A;  3EH2 A;  3NG1 A;  2L81 A;  5JSL A;  3U2L A;  3LNM B;  4JTA B;  4EUK B;  2GA0 A;  2LD6 A;  2EPL X;  1XWJ A;  3W8H A;  2ZXO A;  2VB6 A;  1YJG A;  3GM3 A;  4Z9H A;  3ZVR A;  4WAB A;  2XSE A;  1A41 A;  3DKA A;  5E33 A;  4RD9 A;  5BQH A;  3NDB B;  4MVU A;  3ABM C;  4GEH A;  5AC4 A;  5EGY A;  5F28 E;  1Q0D A;  4JTC B;  1Z5Z A;  3FDQ A;  2J9W A;  1D0Z A;  4EKW A;  3KH2 A;  4BJ6 A;  2VCB A;  2Y69 C;  2CDQ A;  4GQH A;  2AWC A;  5E3A A;  3EPV A;  3RQG A;  4E0H A;  4Q5S F;  2R7R A;  3AQC A;  2XXA B;  3JT1 A;  3SP1 A;  4F4B A;  4AL0 A;  2KW3 C;  1MMN A;  1Q0K A;  4BJ5 A;  1EA8 A;  1GS9 A;  2R7X A;  4MS2 A;  3BEH A;  1XZP A;  2PNO A;  3S9O A;  1NU9 C;  2XL6 A;  3NYM A;  3TJ6 A;  2CNW A;  4U5D E;  3B29 A;  4CSA C;  4YL0 A;  4A4A A;  4FES A;  3W2V A;  2ZXR A;  3LS0 A;  4MTF A;  3QW0 A;  3ECS A;  4FX5 A;  1M6T A;  2QY9 A;  4XWJ A;  1MNE A;  2EIM C;  2NG1 A;  1QSP A;  1NLX A;  3ABK C;  2Y39 A;  2LCH A;  2P7V A;  2QTV A;  1G5Z A;  1VLT A;  2O9X A;  2WVQ A;  1FTS A;  1T5O A;  3M15 A;  5T1D B;  3TOL A;  1JMW A;  3KL4 A;  5A6J A;  2YRF A;  1OW7 A;  4AE4 A;  1ZHX A;  3KYJ A;  3JSE O;  4QI0 A;  1E85 A;  1OXB A;  1XZQ A;  4O6Y A;  5B1B C;  5KYY A;  256B A;  5KYX B;  3Q6M A;  5DQZ A;  2LQG A;  5EK0 A;  3U8P A;  2P1A A;  1TKN A;  2R7O A;  5T3T A;  4KNW A;  2IBF A;  3O10 A;  1ORY A;  2VCA A;  3DZA A;  2KQ9 A;  1LS4 A;  2NUT A;  2D4U A;  2EIL C;  2PBE A;  3MYI A;  3HTK C;  4NC3 A;  2XLM A;  2WVN A;  3J06 A;  2HV7 A;  2B0H A;  4JRZ A;  4JVS A;  3K33 A;  2HV6 A;  1LVK A;  4WGY A;  2HFI A;  5DVW A;  4XEV A;  3HLZ A;  4CS9 C;  4HFK B;  2H7O A;  5D91 A;  5KYW A;  1YAU O;  2J0X A;  2LP4 A;  4XEF A;  4JEB A;  4K0D A;  1FR0 A;  3IQT A;  2A0B A;  2PFD A;  1ZW2 A;  2L6F A;  1YA7 O;  1V74 B;  1ZHZ A;  2J9V A;  2OKU A;  2XLH A;  4EHP A;  5EHH A;  1LS1 A;  5E2Q A;  2IM8 A;  3FMS A;  3TQO A;  1QZX A;  3GOD A;  1OCR C;  2YLG A;  3T4R A;  1E83 A;  5A6B D;  3C18 A;  4JCZ A;  2VAS A;  3SEO A;  4Q7C A;  2QE9 A;  3K66 A;  1PD0 A;  2XLV A;  2XM4 A;  1N1C A;  3RVY A;  2IXP A;  3X1O A;  3K1I A;  1KTM A;  4K7B A;  2R7Q A;  3EGX A;  4DJ9 A;  2HJ3 A;  1KNY A;  1ZHT A;  1ST6 A;  1T6Q A;  2YVK A;  4CS8 C;  3SXY A;  4N6C A;  3RF3 A;  4D4X A;  4MTG A;  4BJT A;  4CJG A;  5D92 A;  4YL1 A;  2DYR C;  1CGO A;  4P6I C;  2ICW G;  3ZDL A;  2VCC A;  1RKE B;  4OIQ F;  3UGP A;  1R4T A;  1Y4C A;  1TWC A;  5AGF A;  2YL1 A;  3H2U A;  3Q7L A;  5CI9 A;  4U9E A;  1HE9 A;  1I4Z A;  5JP7 A;  4U5E E;  4YWQ A;  4I44 A;  3S29 A;  3VM6 A;  2P61 A;  2CGE A;  1K05 A;  4IAR A;  1Z63 A;  3EQL F;  1EKY A;  3ZG1 A;  2B0J A;  1BBH A;  4PJM A;  4O6N A;  2IOQ A;  4NTB A;  3L8I A;  2HJM A;  4KBL A;  4RBN A;  1IZM A;  2HSB A;  3QMK A;  2MYS A;  3W8I A;  4YT8 A;  2P0N A;  1VK5 A;  3EZI A;  4K1O A;  3L34 A;  1J8M F;  1LI5 A;  1T9K A;  3CZ6 A;  2G3V A;  3NKE A;  3QTH A;  2OJE D;  3LJB A;  3MX3 A;  1LI7 A;  1ZVZ A;  1M2V A;  2Y3D A;  4N06 A;  1OKK A;  5KYU A;  2W9Y A;  1FAP B;  2OEX A;  2YEV A;  4I1M A;  4CX9 A;  1OR3 A;  3AG1 C;  4H4K C;  2A6E F;  1G4U S;  2L9J A;  1NZE A;  3JCU Q;  4O6M A;  5L0I A;  1NG1 A;  3F47 A;  2LFD A;  2MHR A;  3FOO A;  5JVE A;  4G7H F;  3KKB A;  1M57 C;  1ZHW A;  4BJ5 C;  4XPX A;  4CIH A;  5KYN A;  2P6V A;  3K7D A;  4CDY A;  2KGO A;  2VC9 A;  4YJW A;  2NUP A;  2Y3B A;  3S28 A;  1APC A;  1NU7 D;  3HKK A;  3U0C A;  1Q0F A;  1YZC A;  3LS1 A;  2NUT B;  2WL8 A;  5K0I A;  3H65 A;  4YK5 A;  1L7C A;  4BPM A;  2DGJ A;  3DWW A;  3EHN A;  2A68 F;  2QLA A;  2YKZ A;  2V26 A;  1C17 M;  4CBE A;  1BR2 A;  4MW3 A;  2R7U A;  1S05 A;  1CPR A;  4EIY A;  5KYW B;  1YAR O;  3T6G B;  4JTD B;  2J7P D;  2NPU A;  2AVK A;  1QVX A;  3NKD A;  4PFO A;  3ZTZ A;  3IQC A;  4YT4 A;  1QPU A;  1BZ4 A;  2L6H A;  5JT4 A;  3B71 A;  4OIP F;  3ASN C;  2ETS A;  1JRA A;  4U5B E;  4OD5 A;  2YL7 A;  3OWT A;  4IB4 A;  5DQT A;  2R05 A;  3UMK A;  1H6G A;  5JUA A;  1TFO B;  1AUE A;  1RXQ A;  3GEE A;  3EGX B;  3L8J A;  3FHD A;  2QUP A;  4ER9 A;  1C03 A;  2Q4F A;  4NTF A;  5BQG A;  3PHF 2;  3EHM A;  2R9R B;  2GAQ A;  4MQ9 F;  3ATP A;  3AQB A;  5COF A;  3U9J A;  3U9M A;  4MND A;  1SMY F;  2YQY A;  1HY5 A;  2GDC A;  3I4U A;  2R7T A;  4YN0 B;  1MMA A;  4EBJ A;  1OKK D;  4G78 A;  4ULV A;  5COG A;  3N2Z B;  1OQC A;  1ORJ A;  3AGU A;  3NYJ A;  5L0H A;  5DS4 A;  3KYI A;  4H54 A;  4KC9 A;  1T6U A;  3EG9 B;  1UG7 A;  4IAQ A;  4IJJ A;  3UMH A;  2JPU A;  1H7I A;  4JKV A;  3QVY A;  3GAN A;  3ZSU A;  1FMV A;  3RH3 A;  4RDA A;  1HMO A;  1D0X A;  1NFO A;  2PX3 A;  2WZG A;  1OW6 A;  3MBG A;  3GM2 A;  5DLJ A;  3K1I C;  4G0H A;  3R2P A;  5F5H A;  2EIJ C;  1YVI A;  1YLM A;  3C8G A;  3LEV A;  1DOW A;  4CIP A;  4OIO F;  4XQ1 A;  2W4M A;  2IYL D;  1OCO C;  3DE8 A;  2BL2 A;  1R5I D;  2J9U A;  2GFH A;  3EH1 A;  2IXM A;  3T6J A;  4UDV A;  1OR2 A;  1PCX A;  2H7V C;  4MVO A;  4JE9 A;  1A7E A;  3UGO A;  4JUR I;  2J46 A;  2WVO A;  3CSK A;  1A0B A;  1HW1 A;  1YYJ A;  2Q9A A;  3ABL C;  3C62 A;  1M2V B;  2NSG A;  4D4N A;  5KYU B;  3LLK A;  3DJN B;  2KNH A;  3JZ0 A;  3LES A;  3RIP A;  5JS5 A;  2FAP B;  1M2O A;  2EPK X;  1F1M A;  4NQF A;  1TWA A;  2AWY A;  4EBK A;  4XEK A;  2KC3 A;  4PR9 A;  2HSQ A;  4DOZ A;  3FAJ A;  1I5N A;  4ZLC A;  2OEV A;  3GM1 A;  4I3M A;  5BUO A;  3MFN A;  3GEH A;  1GGQ A;  1D1A A;  2H8A A;  1H9T A;  2V3C C;  3SXZ A;  3G4Z A;  1MND A;  4OIN F;  4WJ0 A;  1MQV A;  3AGT A;  1SZI A;  2WZF A;  4DVZ A;  1VYK A;  3V5Z A;  3WOD F;  4JIO A;  3JSZ A;  4U9D A;  2L6G A;  3ZQY A;  4CDV A;  5F5F A;  2Q9B A;  2CNW D;  3RQE A;  3RQF A;  5JRA A;  1S7Z A;  5CI8 A;  3U8V A;  5GPG B;  2R7W A;  4MVM A;  3JTL O;  3GWN A;  4KI2 A;  3ZC4 A;  1LIH A;  1LM3 B;  3Q7G A;  3TOM A;  2UUI A;  5L3V A;  4XPW A;  1HMD A;  3I5P A;  3WG7 C;  2C04 A;  1NBB A;  4X0R A;  3ZIB A;  2G62 A;  4AL1 A;  4YT2 A;  2CCY A;  2HZ8 A;  2LIG A;  1ORS C;  4JZA A;  4QI2 A;  2R25 A;  2WZL A;  3LAY A;  3UR3 C;  1BDJ B;  1H9G A;  1TFK B;  2EIK C;  4GYT A;  4NCQ A;  4AK9 A;  3U5S A;  4U5H A;  3IHU A;  4N4W A;  1WAT A;  1JAF A;  4MTO A;  1T6I A;  2A0U A;  4ULW A;  2HKV A;  3T6B A;  3IEE A;  3C7J A;  2HMZ A;  2M4E A;  1RJ9 A;  2X51 A;  4O7G A;  5AC5 A;  5A69 A;  2J8W A;  3B9Q A;  1QQ3 A;  3TK0 A;  4JJF A;  2MWQ A;  1OXK A;  3VAY A;  4DBR A;  1W2W A;  2W4B A;  2BC5 A;  2OG2 A;  2F22 A;  2Z15 A;  4M63 A;  4XLN F;  4DRH B;  3RKO F;  3PDM P;  1SYQ A;  3OA1 A;  3S27 A;  3FVY A;  3DMD A;  3QZC A;  2LK4 A;  2XL4 A;  3JRT A;  4YT5 A;  2XS8 A;  4C3B A;  3PCV A;  2I15 A;  3AOU A;  5A6K A;  1VTM P;  4MVR A;  3W4Y A;  2Y3H A;  1VB5 A;  2Q7R A;  2BE5 F;  2HS5 A;  2IXO A;  3ZTM A;  1CGM E;  1YDI A;  3N24 A;  3SXM A;  1AEP A;  1O5H A;  2Q00 A;  4PFP A;  3KMI A;  3WHN A;  1CGN A;  3EZH A;  4LAC B;  4YL3 A;  4NY3 A;  5KYX A;  3NMI A;  3JYY A;  4AE4 B;  1ZZP A;  2EPM X;  3S90 A;  4G7Z F;  4B6I A;  5KYY B;  4XTK A;  2ZXP A;  4BG0 A;  4PJL A;  2EPN A;  2WB7 A;  3NMJ A;  2D5R B;  3EGD A;  3A11 A;  4QDL A;  1YA9 A;  2YL3 A;  3M1C B;  1JR8 A;  4CDA A;  2FGY A;  4R32 A;  3BRJ A;  1U6H A;  1EQ1 A;  3M4C A;  4Z9I A;  2C03 A;  2RSE B;  4JC7 A;  5JLI A;  1ZU5 A;  3LLI A;  1LPE A;  1VMA A;  2J45 A;  4MVZ A;  5COM A;  2E87 A;  1B68 A;  3AG3 C;  2XL8 A;  1FFT C;  3F46 A;  3K6B A;  3M79 A;  2QNL A;  2YWA A;  3FAP B;  3O55 A;  4IWB A;  4P9T A;  5L0C A;  3HNK A;  4DBQ A;  4ONS A;  3W2W A;  1NSG B;  3C8Z A;  2J9B A;  1GM5 A;  1LKX A;  2XS1 A;  4JCH A;  1FNT c;  4C7O A;  4U5C E;  4KNV A;  2Q3T A;  1E86 A;  5B3I A;  2XRH A;  4CS7 A;  5A6A A;  4PJN A;  1K40 A;  4C3D A;  1D1C A;  5L0F A;  3V7O A;  3Q6N A;  4C3E A;  5DS5 A;  2PF4 E;  1U0B B;  3T9O A;  3U2M A;  1A7V A;  4Q4Z F;  1PV3 A;  1RKE A;  2OU6 A;  2R7S A;  3PMR A;  3HNI A;  4HFF B;  1WAS A;  1CPQ A;  2DB4 A;  2R02 A;  3CAX A;  3DI5 A;  3LUT B;  5B1A C;  3KPH A;  2A6H F;  1C02 A;  2VH3 A;  3K1H A;  3DJU B;  3B0V C;  2CYD A;  3NRH A;  4JJG A;  2G3K A;  2KSF A;  4E18 A;  3JRM O;  4HE8 D;  1ZHY A;  5FCL A;  2ASR A;  3DAG A;  2XLW A;  4JW1 A;  4LER A;  5A6B A;  3V5Y A;  4BJ1 A;  1M56 C;  2Q9C A;  1E84 A;  1A7D A;  1Z6A A;  1V4A A;  4EWC A;  1ZU4 A;  1Q0G A;  1WN0 A;  2AP3 A;  3B0P A;  1Z3I X;  2IXN A;  4NTA A;  4OD4 A;  3DXJ F;  3RYL A;  1RJ9 B;  3UNG C;  3H2V A;  1K04 A;  2KYH A;  2X0C A;  2UUH A;  1O87 A;  3U3F A;  4DVY P;  3S84 A;  1GQA A;  5L0G A;  1BR4 A;  1D1B A;  4MVS A;  3GEI A;  1QKR A;  4ANJ A;  1PD1 A;  1D0Y A;  1SF8 A;  4U5G A;  3DE9 A;  5E3C A;  3HNL A;  3G50 A;  2R7V A;  3O6X A;  3EFO A;  3E70 C;  1NFN A;  4FAP B;  2L7A A;  3O39 A;  3X2Q C;  3POV A;  2W45 A;  4E7Z A;  2ZPA A;  1VLS A;  1IW7 F;  4XLP F;  5T3W A;  4PAC A;  4LDR A;  5TJ5 E;  2M64 A;  2NSF A;  3DM9 B;  1TR2 A;  2PX0 A;  2YLI A;  2XM0 A;  4BEJ A;  2R03 A;  4L6R A;  1AVO B;  1G8X A;  3IPM O;  4E0I A;  3SYN A;  2YZS A;  4J32 B;  1L3P A;  3N0T A;  5CIV A;  4EBB A;  4DXW A;  3AJM A;  1JPN A;  2EIN C;  1QLE C;  3FXH A;  2NUP B;  2A69 F;  3AG4 C;  1MMG A;  3I5Q A;  3MLG A;  1SR2 A;  1Y6D A;  2I8B A;  2YLD A;  1RKC A;  2RD9 A;  3FOP A;  4PJJ A;  3L1M A;  4CSA A;  3EGD B;  3QVZ A;  3HJC A;  4P9F A;  1ZYR F;  1WTY A;  3UMI A;  2LFF A;  5IY5 C;  3TD7 A;  1KU2 A;  3VYW A;  2OQM A;  2TMV P;  4OIR F;  1J8Y F;  2OCC C;  2OOC A;  1LE4 A;  3AG2 C;  3TJ5 A;  3VF0 A;  2EPO A;  3JYH A;  3ZWI A;  1WOL A;  2YL0 A;  3GWL A;  3M4B A;  4J30 B;  4U5F E;  1OCZ C;  1Q0M A;  1ZW3 A;  4PK4 A;  2AU5 A;  1WWP A;  4HEA J;  2XXA A;  4G7O F;  4J7Y A;  2CW0 F;  5L3Q A;  3U3B A;  4LDK A;  4WGZ A;  3RW0 A;  3CEX A;  5HV9 A;  4C7O B;  4W8K A;  4DRI B;  3B0U X;  3SXK A;  1TWG A;  2PP4 A;  1EI7 A;  3NMK A;  1I4Y A;  1G4W R;  3C63 A;  3QW1 A;  4W8P A;  3IQ6 A;  3C8G D;  3ASO C;  4N6H A;  5BQI A;  1LE2 A;  1WGW A;  2YHS A;  1TQG A;  1YZA A;  4CJO A;  1VOM A;  3ZQV A; 
#chains in the Genus database with same CATH homology
 4WGY A;  3M4C A;  5JLI A;  2XLE A;  4CDA A;  4ULV A;  4JEB A;  3M79 A;  2XL8 A;  2XLH A;  3HNK A;  4IAQ A;  3VRC A;  4JKV A;  3QVY A;  2J9B A;  2YLG A;  1E83 A;  1E86 A;  2XLV A;  5B3I A;  2XM4 A;  2XLD A;  4CIP A;  1YYX A;  3DE8 A;  4JEA A;  1RCP A;  4D4X A;  4CJG A;  4JE9 A;  1A7V A;  1CGO A;  1YYJ A;  3HNI A;  4D4N A;  3C62 A;  1CPQ A;  5AGF A;  5JS5 A;  2YL1 A;  2XLO A;  4U9E A;  5JP7 A;  3HNJ A;  2XLW A;  4IAR A;  1EKY A;  3IQ5 A;  1BBH A;  1E84 A;  5JSL A;  1MQV A;  4U9D A;  3ZQY A;  4CDV A;  5JRA A;  1GQA A;  4CX9 A;  1LM3 B;  3TOM A;  3DE9 A;  3HNL A;  1NBB A;  3FOO A;  2CCY A;  5JVE A;  4CDY A;  2YLI A;  2XM0 A;  4L6R A;  4N4W A;  1JAF A;  2XL6 A;  1APC A;  1YZC A;  2J8W A;  2YLD A;  1QQ3 A;  3FOP A;  3L1M A;  3QW0 A;  3QVZ A;  1M6T A;  2BC5 A;  2QLA A;  2YKZ A;  1S05 A;  1CPR A;  4EIY A;  3ZTM A;  3M15 A;  3ZWI A;  3ZTZ A;  2YL0 A;  3M4B A;  3TOL A;  1CGN A;  1QPU A;  5JT4 A;  3NMI A;  4WGZ A;  1E85 A;  2YL7 A;  256B A;  4IB4 A;  3U8P A;  5JUA A;  3NMK A;  3C63 A;  3QW1 A;  3IQ6 A;  3NMJ A;  4N6H A;  4ER9 A;  4NC3 A;  1YZA A;  2YL3 A;  2XLM A;  4CJO A;  3ZQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...