1FFTC

The structure of ubiquinol oxidase from escherichia coli
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
185
structure length
185
Chain Sequence
HDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL OXIDASE
publication title The structure of the ubiquinol oxidase from Escherichia coli and its ubiquinone binding site.
pubmed doi rcsb
source organism Escherichia coli
total genus 46
structure length 185
sequence length 185
chains with identical sequence H
ec nomenclature
pdb deposition date 2000-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.80 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1fftC00
1OCRC 3AG3C 1M57C 5B1AC 1M56C 2EINC 2Y69C 3X2QC 2ZXWC 2EIJC 2YEVA 2EIKC 3AG4C 1FFTC 2DYRC 3ABMC 3AG1C 1OCOC 3AG2C 2EILC 1V55C 5IY5C 2OCCC 3ASOC 1V54C 3ABLC 5B3SC 2DYSC 1OCZC 1OCCC 2EIMC 1QLEC 3ABKC 3WG7C 3ASNC 5B1BC
chains in the Genus database with same CATH superfamily
3N2ZB 5T3WA 3WHNA 3T6GB 2IXOA 4O79A 2A0BA 3I5PA 2Q7RA 1VLSA 1YYXA 3QW0A 4G78A 4WJ0A 4F4BA 1CPRA 4IWBA 3H65A 4NTBA 4MS2A 3TULA 5DS5A 2H7OA 3ZWIA 4OD5A 2HMZA 1V4AA 4OIRF 4KC9A 1A7DA 4PJNA 5T3TA 3B0VC 2KQ9A 1NU7D 1Q0DA 1T6IA 3AG2C 4NQFA 3LLKA 2J46A 1D0XA 4EUKB 3S0XA 3M79A 4FESA 4U5HA 3IPMO 2V26A 2CGEA 3FMSA 3LLIA 3MBGA 4O6NA 4A4AA 5CIVA 3S90A 1MNDA 1U89A 1U6HA 1WGWA 4CDYA 1RJ9B 3CSKA 2Y3GA 4CDAA 4IAQA 3NYMA 1HE1A 4NTFA 3GORA 1LVKA 2EPKX 4ANJA 2H8AA 1OXKA 1V74B 3C8ZA 2CW0F 2R02A 3LEVA 3NMJA 2XS1A 4GYTA 5DLJA 2OU6A 4IB4A 1ORSC 2EINC 2OKUA 2Q4FA 4U5GA 3W2WA 2P1AA 2KNHA 1A41A 3EQLF 2JPUA 3ZVRA 1JPJA 1OKKA 2EIJC 4AL0A 2YEVA 3DJNB 3K1IC 1A0BA 1NG1A 4LDRA 4U5FE 4JTAB 3RF3A 3LNRA 3GEIA 1OXBA 4U5CE 2W45A 4PFOA 3TQOA 1ZHXA 3EHMA 2EPMX 2PX3A 2EILC 1RXQA 2IXPA 2OCCC 2LK4A 2QLAA 4CX9A 4AX2A 2Z15A 1D0ZA 2QY9A 2AWYA 2UUHA 3L1MA 4JE9A 3IQ5A 4JW1A 4LDQA 4P9FA 3TJ6A 2DI3A 2ZXRA 3R7CA 2CYDA 1IZMA 4MTOA 4JKVA 2A6EF 2YL3A 3C62A 3HTKC 3U9MA 3LAYA 2LFDA 1EA8A 3C18A 1EKYA 4CS9C 1HW1A 2G3KA 1TFOB 3LEOA 4U5DE 2NUTB 2VCAA 2L9JA 1VOMA 1OW6A 3VF0A 1MQVA 4XTKA 4OIPF 2KW3C 5L0JA 1NFOA 1LE4A 3GANA 2WZGA 4R32A 4CS7A 3J06A 1WATA 1AVOB 3U3BA 1QSPA 2IYLD 5COFA 1MNEA 3L34A 3FHDA 3RFYA 3W2VA 1OCOC 4ER9A 2HMQA 3UGPA 3Q6NA 2ZXOA 4FWVA 3TD7A 1ORYA 4EKWA 1NLXA 2EPLX 2LQGA 3S9OA 1BR2A 1EI7A 2R03A 5JS5A 1K05A 1UFBA 2ICWG 3G4XA 4IGGA 3UNGC 3JYYA 3X1OA 1E84A 1O87A 5L3QA 2YVKA 1QLEC 1WTYA 3Q6MA 1I4YA 3SEOA 3SNHA 4CDVA 2GWWA 2LFFA 3LUTB 5KYYB 3MYIA 2VCCA 2XLWA 3IQ6A 2LP4A 4QI0A 2R7SA 1WN0A 2FAPB 1OW8A 2KYHA 3JSEO 1KU2A 4LERA 3B9QA 2XL6A 5T1DB 1FR0A 4DOZA 2R25A 5JT4A 5K0IA 4MQ9F 4UDVA 3BEHA 2VCBA 2PNOA 4D4NA 3HKKA 3LJBA 2TMVP 4PK4A 1QZXA 2CDQA 3V7OA 3PHF2 4PJMA 4XWJA 1D1CA 3SXMA 4MW3A 3T9OA 5BQIA 4MVMA 4CSAC 1QKRA 5L0DA 1M6TA 4WABA 1NFNA 1TFKB 3ABKC 1TWGA 3TJ5A 3QW1A 3W8IA 2E87A 3QVYA 1Q0FA 1TWHA 4C3EA 4I1OB 2FFHA 1YZAA 2GFHA 4QDLA 4YT5A 2A0UA 1M2VA 4XEKA 1GQAA 3I5QA 5JSLA 2A1DD 3DI5A 3NKEA 1D0YA 1LPEA 2Y3DA 4EWCA 5A6KA 1VMAA 3U3FA 4Z9IA 3JCUQ 5B3IA 4DVZA 3UMIA 1O5HA 1PCXA 2J8WA 2P0NA 3OWTA 2KGOA 3DWWA 5E33A 4HE8D 2I15A 3VM6A 1RKCA 1JOGA 3DE8A 2HV6A 2WL8A 2J9WA 2XLMA 3QTHA 4EBBA 1JMWA 2ETSA 3IQCA 2PP4A 3HNKA 3C8GD 2D5RB 4YL1A 3CEXA 1Z3IX 4JTDB 4KNVA 4U9DA 3V5YA 2AVKA 1ZVZA 3WG7C 2XLDA 1Q0MA 1QQ3A 5L0GA 4O7GA 4FX5A 3N24A 5DQZA 2OG2A 3CQZA 3HNIA 3JRMO 4CS8A 3NDBB 3M15A 4PR9A 3C8GA 3T4RA 4CJGA 5KYXB 1MMAA 4C7OA 4KNWA 2XL8A 2VB6A 2CCYA 1XZPA 2OEXA 3RYLA 3T6BA 2Q00A 3DMDA 3AGTA 1O3UA 1E83A 1HW2A 4N4WA 4E7ZA 5KYUA 1AUEA 3FXHA 4JTCB 3SXZA 5BQHA 4I44A 1OCZC 2GAQA 4BJTA 4JC7A 3A9CA 3EHNA 3EG9A 1NU9C 3T6JA 1ZW3A 5JP7A 1T01A 1U0BB 1OKKD 1SMYF 5JUAA 3HNLA 2YL0A 1R4TA 2XXAB 2VASA 1J8YF 2XSEA 4XLPF 3POVA 4A2NB 4OIOF 2A69F 4EIYA 1K04A 4BG0A 1QVXA 4WGYA 1FFHA 3Q7GA 2WVNA 2WVOA 4JZAA 3VYWA 4O6MA 1Y6DA 2NUPA 4GEHA 3AQBA 2BC5A 1FNTc 1JAFA 3LNMB 5AGFA 2LD6A 5KYWA 5KYNA 1WOLA 2R7QA 2WVQA 3QZCA 1F1MA 2IXMA 3O6XA 4YK5A 2R7RA 1ZHWA 3ZTZA 1UG7A 4XQ1A 4YL3A 3ZQYA 2A68F 1RCPA 2WZLA 2M64A 2JX0A 1VK5A 2YZSA 1QPUA 2G62A 3LS0A 4JRZA 4MVSA 5DVWA 1C03A 4WGZA 3L8IA 1FAPB 3ASNC 4CIPA 3QMKA 1T6UA 2X0CA 1OCRC 3RQGA 3V5ZA 2MHRA 4BJ6A 4IAOA 5BUOA 3CZ6A 3FVYA 2Y69C 3IHUA 4J7YA 3WAQA 2C03A 2KC3A 2Y3BA 4HFKB 4PACA 4PJLA 1NZEA 4YN0B 4Q5SF 1AEPA 2R7UA 2B0HA 4ZLDA 2EIKC 3EGXA 1YARO 1M2VB 4JCHA 1BR1A 3AG4C 3E70C 5D92A 2XM4A 2RSEB 3KH2A 1CGNA 5DQTA 2XLHA 1OR2A 3F46A 4DVYP 3RIPA 2EPOA 1JR8A 4O6YA 4Z9JA 1I5NA 4G7OF 2Q3TA 1G4US 3ASOC 4U9EA 5KYYA 1HMDA 4RBNA 1VB5A 3AGUA 4XEVA 1JPNA 4G0HA 5KYXA 2VH3A 3IQTA 4JJFA 4JURI 1PD0A 2W4BA 1CPQA 1G8XA 1GM5A 4EBKA 3TOLA 2BE5F 1ST6A 2OJED 2L6HA 3GM3A 3IEEA 1M57C 2LIGA 2Y3HA 4I3MA 4Q7CA 3S28A 3GEEA 3VRCA 1T9KA 1RKEA 4W8KA 1LS4A 1BR4A 1YAUO 1L3PA 2HJ3A 2J9UA 2OJQA 1J8MF 2XLVA 1VYIA 3KYJA 3F47A 3VAYA 3UR3C 2A6HF 2ZXPA 2DYRC 2H7BA 1L7CA 3C8GB 1E85A 1CGOA 5E2QA 3W8HA 3SXYA 2AWCA 3B0UX 4C7OB 1TWCA 4AK9A 4XEFA 3K1HA 2AU5A 2W9YA 3NKDA 1YYJA 4JVSA 5F5HA 1E86A 5KYUB 1DOVA 2JD3A 3L8JA 1LI7A 5L3VA 5F28E 4DBRA 2HZ8A 3JZ0A 2IOQA 4JCZA 3FAJA 2J9BA 1C02A 2Y39A 2ASRA 3MLGA 3GODA 4K7BA 3SZRA 4HFFB 3AJMA 3ZDLA 2XLEA 3A11A 3EG9B 4MTGA 4PFPA 4BEJA 1H9GA 2J45A 4E17A 5COGA 5B1AC 3US6A 4AE4A 2L7AA 4DBQA 3U0CA 3PCVA 4H4KC 1KNYA 1GS9A 4BEMJ 4YWQA 4MNDA 4MVQA 3RQEA 4NC3A 1FFTC 2PFDA 1DOWA 3AG1C 3DKAA 2NUPB 3E9VA 3MYFA 2HKVA 1EQ1A 4N06A 4OINF 4IJJA 5IY5C 1YZCA 2R9RB 4B6IA 2P7VA 5KYWB 4CS8C 3ABLC 2DYSC 1N1CA 3M4BA 4P9TA 4KI2A 1FTSA 2KSFA 2R7OA 4BJ5A 4N6CA 2FGYA 2J0WA 5BQGA 2LSEA 4IRUA 4E0HA 4AL1A 2R7XA 5A6JA 4YJWA 5B1BC 4E0IA 2BL2A 4BPMA 4D4XA 1ZYRF 2QTVA 4Z9HA 2C04A 4XLNF 3PMRA 1SF8A 3HLZA 3M1CB 1G4WR 3U8PA 2XM0A 1MMDA 1S05A 3BRJA 2H7VC 1VYKA 2NG1A 3ECSA 3LESA 4QI2A 4C3BA 4JEBA 4E7SA 1YVIA 2YLGA 1V55C 3EGXB 1W2WA 2Q9BA 1Z63A 2CNWD 5E3CA 3NYLA 4EHPA 4DRIB 1LE2A 2PX0A 2OOCA 1SR2A 1VTMP 5DS6A 5A69A 4LLEA 1M2OA 3ZTMA 3DE9A 3DM9B 2B0JA 2ZD9A 2R05A 4XPWA 1KTMA 5AC5A 1B68A 4ULVA 3MFNA 2HUJA 2CNWA 4IARA 2VC9A 3EFOA 3RW0A 3TK0A 4G7HF 1YA9A 5JVEA 4XPYA 2XRHA 1PV3A 3ZC4A 1BZ4A 2F22A 1WASA 2ZXWC 3DM5A 3QVZA 4DXWA 3MX3A 3NG1A 1ZHZA 1BDJB 2IM8A 1RKEB 4RD9A 3PDMP 3GWLA 3ABMC 4JJGA 1LS1A 5FZTA 1ZW2A 1SZIA 3O39A 4U5BE 3G50A 4MW8A 4BJ6C 2HJMA 3ATPA 4U5EE 2YQYA 5D91A 3EZIA 3U2LA 2HS5A 2KK1A 3H2UA 3SP1A 4DRHB 3ZQVA 3KL4A 3FOPA 3S84A 4MVZA 4XPXA 3DXJF 1HY5A 3NYJA 2AP3A 3GM2A 2R7VA 3AG3C 3FAPB 256BA 4J32B 2LCHA 2HSBA 1M56C 4J30B 2YWAA 5HV9A 3UGOA 2NSFA 3B71A 3AQCA 5COMA 3FOOA 2ZPAA 1HE9A 3EPVA 5AC4A 4CJOA 4MTFA 4AE4B 2IBFA 1YA7O 1APCA 4NTAA 5L0FA 3NRHA 3U8VA 4NCQA 2PF4E 3K66A 4L6RA 4YL0A 1E2XA 1OQCA 2J0XA 3GM1A 4HEAJ 4MVRA 4EBJA 3CAXA 4H54A 1V54C 3K1IA 2WZFA 3KYIA 4N6HA 3W4YA 1Q0KA 3KKBA 3DJUB 1FMWA 4MVUA 1K40A 5CI8A 2XXAA 2G3VA 1MMNA 2MWQA 2J7PD 3HNJA 3M4CA 3FDQA 3U5SA 3N0TA 2I8BA 1R5ID 2J9VA 1TQGA 1WWPA 1XWJA 3GEHA 1D1BA 1ZZPA 5HSWA 5F5FA 3V5XA 1XZQA 2RD9A 5JRAA 3UMKA 2X51A 4K1OA 2GDCA 2HFIA 4ULWA 2J7PA 5L0CA 4ONSA 1CGME 1MMGA 3EGDB 4DJ9A 3LS1A 2L81A 3JYHA 2P61A 3SXKA 3AOUA 1OW7A 3DD7A 3HJCA 2NSGA 3EJNA 4LDKA 1YLMA 4CS9A 1H9TA 2QE9A 3DAGA 2WB7A 2PBEA 1JRAA 4YT8A 1Q0GA 1C17M 1RJ9A 4G7ZF 2W4MA 1IW7F 3RVZA 2Q9CA 2L6GA 1Z23A 4X0RA 1BBHA 2P6VA 1NSGB 2YL1A 3S29A 2XL4A 3C7JA 2HSQA 5EGYA 4NY3A 5L0HA 1SYQA 3K6BA 4GQHA 1TWAA 4KBLA 4MVOA 3C63A 3OEOA 2QUPA 1ZU5A 5CI9A 1RMVA 3H2VA 1PD1A 3SYNA 1G5ZA 1T5OA 3JRTA 3S27A 3ZSUA 5EHHA 1FMVA 1VLTA 1T6QA 1YDIA 3DAFA 3I4UA 4ZLCA 3KPHA 3EFOB 2OEVA 4LACB 1Z6AA 2IXNA 1NBBA 3WODF 2QNLA 3ZG1A 4Q4ZF 1A7VA 3RH3A 4CBEA 3TOMA 3JTLO 5A6AA 4BJ5C 3RQFA 1H6GA 2V3CC 3K33A 4P6IC 4C3DA 1A7EA 4LLCA 3NMIA 5TJ5E 2DGJA 2D4UA 3K7DA 1OR3A 4CIHA 1H7IA 1ZU4A 1LIHA 3O10A 2EPNA 3ITFA 2YL7A 3JT1A 5B3SC 4K0DA 2M4EA 4J7TA 1OCCC 3U2MA 1ZHYA 2YLIA 3EZHA 2EIMC 3U9JA 5DS4A 2NUTA 2NPUA 5EK0A 3Q7LA 2R7TA 4YT4A 4BJ1A 2OQMA 5L0IA 5A6BD 3RKOF 3G4ZA 3EGDA 4YT2A 4CSAA 3X2QC 1LI5A 2GA0A 2KJGA 1Y4CA 4OIQF 3KMIA 3O55A 5FCLA 2XS8A 4PJJA 5GPGB 2Q9AA 3RVYA 3JSZA 3ZIBA 2R7WA 1TKNA 4FAPB 1HMOA 4E18A 3EH2A 4JIOA 1TR2A 1ORJA 2YRFA 4I1MA 4RDAA 2YHSA 5A6BA 2MYSA 4M63A 3UMHA 3R2PA 5JLIA 4JEAA 1LM3B 1LKXA 1S7ZA 1D1AA 2O9XA 2YKZA 5E3AA 1YJGA 2XLOA 2YLDA 3DZAA 3L0IA 1I4ZA 2HV7A 3OA1A 2L6FA 3B29A 3GWNA 1GGQA 4OD4A 4W8PA 3NMKA 1Z5ZA 3EH1A 1Z7Qc 1ZHTA 3B0PA 4DRJB 2DB4A 2UUIA
chains in the Genus database with same CATH topology
3N2ZB 5T3WA 2IXOA 4O79A 3I5PA 4F4BA 4WJ0A 4IWBA 3H65A 5DS5A 2H7OA 4OD5A 4OIRF 4KC9A 4PJNA 5T3TA 3B0VC 2KQ9A 1NU7D 3AG2C 3LLKA 2J46A 1D0XA 3S0XA 4FESA 4U5HA 2V26A 2CGEA 3LLIA 4O6NA 1MNDA 1WGWA 1RJ9B 3CSKA 2Y3GA 3NYMA 1LVKA 4ANJA 2CW0F 3LEVA 4GYTA 5DLJA 2EINC 3ZVRA 4U5GA 3W2WA 3EQLF 2KNHA 1JPJA 1OKKA 2EIJC 2YEVA 3DJNB 3K1IC 1NG1A 4U5FE 3LNRA 4U5CE 2W45A 4PFOA 1ZHXA 3EHMA 2PX3A 2EILC 2IXPA 2OCCC 2V3CC 4AX2A 2Z15A 1D0ZA 2QY9A 4JW1A 2ZXRA 1IZMA 2A6EF 3HTKC 3LAYA 4CS9C 2G3KA 4U5DE 2NUTB 2L9JA 1VOMA 4OIPF 4XTKA 2KW3C 4CS7A 3GANA 2WZGA 2IYLD 1MNEA 3L34A 3FHDA 3RFYA 3W2VA 1OCOC 3UGPA 3Q6NA 2ZXOA 4FWVA 3TD7A 1BR2A 3X1OA 3UNGC 1O87A 5L3QA 1QLEC 3SEOA 3Q6MA 3SNHA 5KYYB 4QI0A 2R7SA 1KU2A 4LERA 3B9QA 5T1DB 4DOZA 4MQ9F 3LJBA 4PK4A 1QZXA 2CDQA 3V7OA 3PHF2 4PJMA 4XWJA 1D1CA 4CSAC 3ABKC 1TWGA 3W8IA 2E87A 1TWHA 4C3EA 4I1OB 2FFHA 2GFHA 4QDLA 4YT5A 1M2VA 3I5QA 2A1DD 3NKEA 1D0YA 2Y3DA 4EWCA 1VMAA 3JCUQ 4DVZA 3UMIA 1O5HA 1PCXA 3OWTA 2KGOA 5E33A 4HE8D 2HV6A 2WL8A 2J9WA 4EBBA 2PP4A 2D5RB 1Z3IX 4KNVA 3WG7C 4O7GA 4FX5A 3N24A 5DQZA 2OG2A 3CQZA 4CS8A 3NDBB 3T4RA 5KYXB 1MMAA 4C7OA 4KNWA 2VB6A 3RYLA 3T6BA 3DMDA 4E7ZA 5KYUA 4I44A 1OCZC 4BJTA 3EHNA 3EG9A 1NU9C 3T6JA 1OKKD 1SMYF 2VASA 1J8YF 2XSEA 4XLPF 3POVA 4A2NB 4OIOF 2A69F 4BG0A 1FFHA 3Q7GA 2WVNA 2WVOA 4JZAA 3VYWA 4O6MA 2NUPA 4GEHA 3AQBA 5KYWA 5KYNA 2R7QA 2WVQA 3QZCA 2IXMA 3O6XA 2R7RA 1ZHWA 2A68F 2WZLA 1VK5A 2YZSA 2G62A 3LS0A 5DVWA 3ASNC 3QMKA 1OCRC 4BJ6A 4IAOA 5BUOA 3CZ6A 3FVYA 2Y69C 5KYXA 2C03A 2Y3BA 4HFKB 4PJLA 4YN0B 1NZEA 4Q5SF 2R7UA 4ZLDA 2EIKC 3EGXA 1M2VB 4JCHA 1BR1A 3AG4C 3E70C 5D92A 3KH2A 5DQTA 3F46A 4DVYP 3RIPA 4O6YA 4G7OF 2Q3TA 3ASOC 4RBNA 1JPNA 4G0HA 2VH3A 4JJFA 4JURI 1PD0A 2W4BA 1G8XA 2BE5F 1ST6A 3IEEA 1M57C 2Y3HA 4I3MA 4Q7CA 3S28A 4W8KA 1BR4A 2J9UA 3VAYA 1J8MF 1VYIA 3F47A 3UR3C 2A6HF 2ZXPA 2DYRC 2H7BA 5E2QA 3W8HA 3B0UX 4C7OB 1TWCA 4AK9A 3K1HA 2W9YA 3NKDA 5F5HA 4JVSA 5KYUB 2JD3A 5L3VA 4DBRA 2IOQA 3FAJA 3MLGA 2Y39A 4K7BA 3GODA 3SZRA 4HFFB 3EG9B 4BEJA 4PFPA 2J45A 5B1AC 4AE4A 4DBQA 4H4KC 4YWQA 4MNDA 1FFTC 2PFDA 3AG1C 2NUPB 3E9VA 4N06A 4OINF 4IJJA 5IY5C 4B6IA 2P7VA 5KYWB 4CS8C 3ABLC 2DYSC 1N1CA 4KI2A 1FTSA 2R7OA 4BJ5A 2FGYA 2J0WA 2R7XA 2LSEA 4IRUA 4YJWA 5B1BC 1ZYRF 2QTVA 2C04A 4XLNF 3PMRA 1SF8A 3HLZA 3M1CB 1MMDA 2H7VC 1VYKA 2NG1A 3ECSA 3LESA 4QI2A 4C3BA 4E7SA 3EGXB 1V55C 1W2WA 2Q9BA 1Z63A 2CNWD 5E3CA 3NYLA 2PX0A 5DS6A 4LLEA 1M2OA 3DM9B 2B0JA 2CNWA 4G7HF 3EFOA 2XRHA 3ZC4A 2ZXWC 3DM5A 3MX3A 3NG1A 1ZHZA 4RD9A 3ABMC 4JJGA 1LS1A 1SZIA 3O39A 4U5BE 4BJ6C 4U5EE 5D91A 3EZIA 3SP1A 3KL4A 3DXJF 3NYJA 2R7VA 3AG3C 4J30B 4J32B 1M56C 3UGOA 3AQCA 2ZPAA 3EPVA 4AE4B 3NRHA 2PF4E 3K66A 2J0XA 4HEAJ 1V54C 2WZFA 3KKBA 3DJUB 1FMWA 5CI8A 2XXAA 2G3VA 1MMNA 2MWQA 2J7PD 3FDQA 3N0TA 2I8BA 2J9VA 1D1BA 5HSWA 5F5FA 3UMKA 2X51A 4ULWA 2J7PA 1MMGA 3EGDB 3LS1A 2L81A 3JYHA 3DD7A 3HJCA 3EJNA 4CS9A 3DAGA 2WB7A 4YT8A 1RJ9A 2W4MA 1IW7F 2Q9CA 1Z23A 4X0RA 2P6VA 3S29A 2XL4A 5EGYA 4NY3A 3K6BA 1TWAA 4KBLA 5CI9A 3OEOA 1ZU5A 1PD1A 3SYNA 3JRTA 3S27A 3ZSUA 5EHHA 1FMVA 4ZLCA 3DAFA 3I4UA 3EFOB 4LACB 1Z6AA 2IXNA 3WODF 3ZG1A 4Q4ZF 3RH3A 4CBEA 4BJ5C 3K33A 4P6IC 4C3DA 4LLCA 2DGJA 3K7DA 4CIHA 1ZU4A 3ITFA 3JT1A 5B3SC 4K0DA 2M4EA 1OCCC 1ZHYA 3EZHA 2EIMC 5DS4A 2NUTA 3Q7LA 2R7TA 4YT4A 4BJ1A 3RKOF 3EGDA 4YT2A 4CSAA 3X2QC 2KJGA 4OIQF 3KMIA 5FCLA 4PJJA 2R7WA 2Q9AA 3ZIBA 3JSZA 1TKNA 3EH2A 4RDAA 1TR2A 4I1MA 2YHSA 2MYSA 4M63A 3UMHA 1LKXA 1S7ZA 1D1AA 2O9XA 5E3AA 3DZAA 3OA1A 3L0IA 5KYYA 4G7ZF 2HV7A 4OD4A 1Z5ZA 3EH1A 1ZHTA 3B0PA 2XXAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCR C;  3AG3 C;  1M57 C;  5B1A C;  1M56 C;  2EIN C;  2Y69 C;  3X2Q C;  2ZXW C;  2EIJ C;  2YEV A;  2EIK C;  3AG4 C;  1FFT C;  2DYR C;  3ABM C;  3AG1 C;  1OCO C;  3AG2 C;  2EIL C;  1V55 C;  5IY5 C;  2OCC C;  3ASO C;  1V54 C;  3ABL C;  5B3S C;  2DYS C;  1OCZ C;  1OCC C;  2EIM C;  1QLE C;  3ABK C;  3WG7 C;  3ASN C;  5B1B C; 
#chains in the Genus database with same CATH topology
 3N2Z B;  5T3W A;  3WHN A;  3T6G B;  2IXO A;  4O79 A;  2A0B A;  3I5P A;  2Q7R A;  1VLS A;  1YYX A;  3QW0 A;  4G78 A;  4WJ0 A;  4F4B A;  1CPR A;  4IWB A;  3H65 A;  4NTB A;  4MS2 A;  3TUL A;  5DS5 A;  2H7O A;  3ZWI A;  4OD5 A;  2HMZ A;  1V4A A;  4OIR F;  4KC9 A;  1A7D A;  4PJN A;  5T3T A;  3B0V C;  2KQ9 A;  1NU7 D;  1Q0D A;  1T6I A;  3AG2 C;  4NQF A;  3LLK A;  2J46 A;  1D0X A;  4EUK B;  3S0X A;  3M79 A;  4FES A;  4U5H A;  3IPM O;  2V26 A;  2CGE A;  3FMS A;  3LLI A;  3MBG A;  4O6N A;  4A4A A;  5CIV A;  3S90 A;  1MND A;  1U89 A;  1U6H A;  1WGW A;  4CDY A;  1RJ9 B;  3CSK A;  2Y3G A;  4CDA A;  4IAQ A;  3NYM A;  1HE1 A;  4NTF A;  3GOR A;  1LVK A;  2EPK X;  4ANJ A;  2H8A A;  1OXK A;  1V74 B;  3C8Z A;  2CW0 F;  2R02 A;  3LEV A;  3NMJ A;  2XS1 A;  4GYT A;  5DLJ A;  2OU6 A;  4IB4 A;  1ORS C;  2EIN C;  2OKU A;  2Q4F A;  4U5G A;  3W2W A;  2P1A A;  2KNH A;  1A41 A;  3EQL F;  2JPU A;  3ZVR A;  1JPJ A;  1OKK A;  2EIJ C;  4AL0 A;  2YEV A;  3DJN B;  3K1I C;  1A0B A;  1NG1 A;  4LDR A;  4U5F E;  4JTA B;  3RF3 A;  3LNR A;  3GEI A;  1OXB A;  4U5C E;  2W45 A;  4PFO A;  3TQO A;  1ZHX A;  3EHM A;  2EPM X;  2PX3 A;  2EIL C;  1RXQ A;  2IXP A;  2OCC C;  2LK4 A;  2QLA A;  4CX9 A;  4AX2 A;  2Z15 A;  1D0Z A;  2QY9 A;  2AWY A;  2UUH A;  3L1M A;  4JE9 A;  3IQ5 A;  4JW1 A;  4LDQ A;  4P9F A;  3TJ6 A;  2DI3 A;  2ZXR A;  3R7C A;  2CYD A;  1IZM A;  4MTO A;  4JKV A;  2A6E F;  2YL3 A;  3C62 A;  3HTK C;  3U9M A;  3LAY A;  2LFD A;  1EA8 A;  3C18 A;  1EKY A;  4CS9 C;  1HW1 A;  2G3K A;  1TFO B;  3LEO A;  4U5D E;  2NUT B;  2VCA A;  2L9J A;  1VOM A;  1OW6 A;  3VF0 A;  1MQV A;  4XTK A;  4OIP F;  2KW3 C;  5L0J A;  1NFO A;  1LE4 A;  3GAN A;  2WZG A;  4R32 A;  4CS7 A;  3J06 A;  1WAT A;  1AVO B;  3U3B A;  1QSP A;  2IYL D;  5COF A;  1MNE A;  3L34 A;  3FHD A;  3RFY A;  3W2V A;  1OCO C;  4ER9 A;  2HMQ A;  3UGP A;  3Q6N A;  2ZXO A;  4FWV A;  3TD7 A;  1ORY A;  4EKW A;  1NLX A;  2EPL X;  2LQG A;  3S9O A;  1BR2 A;  1EI7 A;  2R03 A;  5JS5 A;  1K05 A;  1UFB A;  2ICW G;  3G4X A;  4IGG A;  3UNG C;  3JYY A;  3X1O A;  1E84 A;  1O87 A;  5L3Q A;  2YVK A;  1QLE C;  1WTY A;  3Q6M A;  1I4Y A;  3SEO A;  3SNH A;  4CDV A;  2GWW A;  2LFF A;  3LUT B;  5KYY B;  3MYI A;  2VCC A;  2XLW A;  3IQ6 A;  2LP4 A;  4QI0 A;  2R7S A;  1WN0 A;  2FAP B;  1OW8 A;  2KYH A;  3JSE O;  1KU2 A;  4LER A;  3B9Q A;  2XL6 A;  5T1D B;  1FR0 A;  4DOZ A;  2R25 A;  5JT4 A;  5K0I A;  4MQ9 F;  4UDV A;  3BEH A;  2VCB A;  2PNO A;  4D4N A;  3HKK A;  3LJB A;  2TMV P;  4PK4 A;  1QZX A;  2CDQ A;  3V7O A;  3PHF 2;  4PJM A;  4XWJ A;  1D1C A;  3SXM A;  4MW3 A;  3T9O A;  5BQI A;  4MVM A;  4CSA C;  1QKR A;  5L0D A;  1M6T A;  4WAB A;  1NFN A;  1TFK B;  3ABK C;  1TWG A;  3TJ5 A;  3QW1 A;  3W8I A;  2E87 A;  3QVY A;  1Q0F A;  1TWH A;  4C3E A;  4I1O B;  2FFH A;  1YZA A;  2GFH A;  4QDL A;  4YT5 A;  2A0U A;  1M2V A;  4XEK A;  1GQA A;  3I5Q A;  5JSL A;  2A1D D;  3DI5 A;  3NKE A;  1D0Y A;  1LPE A;  2Y3D A;  4EWC A;  5A6K A;  1VMA A;  3U3F A;  4Z9I A;  3JCU Q;  5B3I A;  4DVZ A;  3UMI A;  1O5H A;  1PCX A;  2J8W A;  2P0N A;  3OWT A;  2KGO A;  3DWW A;  5E33 A;  4HE8 D;  2I15 A;  3VM6 A;  1RKC A;  1JOG A;  3DE8 A;  2HV6 A;  2WL8 A;  2J9W A;  2XLM A;  3QTH A;  4EBB A;  1JMW A;  2ETS A;  3IQC A;  2PP4 A;  3HNK A;  3C8G D;  2D5R B;  4YL1 A;  3CEX A;  1Z3I X;  4JTD B;  4KNV A;  4U9D A;  3V5Y A;  2AVK A;  1ZVZ A;  3WG7 C;  2XLD A;  1Q0M A;  1QQ3 A;  5L0G A;  4O7G A;  4FX5 A;  3N24 A;  5DQZ A;  2OG2 A;  3CQZ A;  3HNI A;  3JRM O;  4CS8 A;  3NDB B;  3M15 A;  4PR9 A;  3C8G A;  3T4R A;  4CJG A;  5KYX B;  1MMA A;  4C7O A;  4KNW A;  2XL8 A;  2VB6 A;  2CCY A;  1XZP A;  2OEX A;  3RYL A;  3T6B A;  2Q00 A;  3DMD A;  3AGT A;  1O3U A;  1E83 A;  1HW2 A;  4N4W A;  4E7Z A;  5KYU A;  1AUE A;  3FXH A;  4JTC B;  3SXZ A;  5BQH A;  4I44 A;  1OCZ C;  2GAQ A;  4BJT A;  4JC7 A;  3A9C A;  3EHN A;  3EG9 A;  1NU9 C;  3T6J A;  1ZW3 A;  5JP7 A;  1T01 A;  1U0B B;  1OKK D;  1SMY F;  5JUA A;  3HNL A;  2YL0 A;  1R4T A;  2XXA B;  2VAS A;  1J8Y F;  2XSE A;  4XLP F;  3POV A;  4A2N B;  4OIO F;  2A69 F;  4EIY A;  1K04 A;  4BG0 A;  1QVX A;  4WGY A;  1FFH A;  3Q7G A;  2WVN A;  2WVO A;  4JZA A;  3VYW A;  4O6M A;  1Y6D A;  2NUP A;  4GEH A;  3AQB A;  2BC5 A;  1FNT c;  1JAF A;  3LNM B;  5AGF A;  2LD6 A;  5KYW A;  5KYN A;  1WOL A;  2R7Q A;  2WVQ A;  3QZC A;  1F1M A;  2IXM A;  3O6X A;  4YK5 A;  2R7R A;  1ZHW A;  3ZTZ A;  1UG7 A;  4XQ1 A;  4YL3 A;  3ZQY A;  2A68 F;  1RCP A;  2WZL A;  2M64 A;  2JX0 A;  1VK5 A;  2YZS A;  1QPU A;  2G62 A;  3LS0 A;  4JRZ A;  4MVS A;  5DVW A;  1C03 A;  4WGZ A;  3L8I A;  1FAP B;  3ASN C;  4CIP A;  3QMK A;  1T6U A;  2X0C A;  1OCR C;  3RQG A;  3V5Z A;  2MHR A;  4BJ6 A;  4IAO A;  5BUO A;  3CZ6 A;  3FVY A;  2Y69 C;  3IHU A;  4J7Y A;  3WAQ A;  2C03 A;  2KC3 A;  2Y3B A;  4HFK B;  4PAC A;  4PJL A;  1NZE A;  4YN0 B;  4Q5S F;  1AEP A;  2R7U A;  2B0H A;  4ZLD A;  2EIK C;  3EGX A;  1YAR O;  1M2V B;  4JCH A;  1BR1 A;  3AG4 C;  3E70 C;  5D92 A;  2XM4 A;  2RSE B;  3KH2 A;  1CGN A;  5DQT A;  2XLH A;  1OR2 A;  3F46 A;  4DVY P;  3RIP A;  2EPO A;  1JR8 A;  4O6Y A;  4Z9J A;  1I5N A;  4G7O F;  2Q3T A;  1G4U S;  3ASO C;  4U9E A;  5KYY A;  1HMD A;  4RBN A;  1VB5 A;  3AGU A;  4XEV A;  1JPN A;  4G0H A;  5KYX A;  2VH3 A;  3IQT A;  4JJF A;  4JUR I;  1PD0 A;  2W4B A;  1CPQ A;  1G8X A;  1GM5 A;  4EBK A;  3TOL A;  2BE5 F;  1ST6 A;  2OJE D;  2L6H A;  3GM3 A;  3IEE A;  1M57 C;  2LIG A;  2Y3H A;  4I3M A;  4Q7C A;  3S28 A;  3GEE A;  3VRC A;  1T9K A;  1RKE A;  4W8K A;  1LS4 A;  1BR4 A;  1YAU O;  1L3P A;  2HJ3 A;  2J9U A;  2OJQ A;  1J8M F;  2XLV A;  1VYI A;  3KYJ A;  3F47 A;  3VAY A;  3UR3 C;  2A6H F;  2ZXP A;  2DYR C;  2H7B A;  1L7C A;  3C8G B;  1E85 A;  1CGO A;  5E2Q A;  3W8H A;  3SXY A;  2AWC A;  3B0U X;  4C7O B;  1TWC A;  4AK9 A;  4XEF A;  3K1H A;  2AU5 A;  2W9Y A;  3NKD A;  1YYJ A;  4JVS A;  5F5H A;  1E86 A;  5KYU B;  1DOV A;  2JD3 A;  3L8J A;  1LI7 A;  5L3V A;  5F28 E;  4DBR A;  2HZ8 A;  3JZ0 A;  2IOQ A;  4JCZ A;  3FAJ A;  2J9B A;  1C02 A;  2Y39 A;  2ASR A;  3MLG A;  3GOD A;  4K7B A;  3SZR A;  4HFF B;  3AJM A;  3ZDL A;  2XLE A;  3A11 A;  3EG9 B;  4MTG A;  4PFP A;  4BEJ A;  1H9G A;  2J45 A;  4E17 A;  5COG A;  5B1A C;  3US6 A;  4AE4 A;  2L7A A;  4DBQ A;  3U0C A;  3PCV A;  4H4K C;  1KNY A;  1GS9 A;  4BEM J;  4YWQ A;  4MND A;  4MVQ A;  3RQE A;  4NC3 A;  1FFT C;  2PFD A;  1DOW A;  3AG1 C;  3DKA A;  2NUP B;  3E9V A;  3MYF A;  2HKV A;  1EQ1 A;  4N06 A;  4OIN F;  4IJJ A;  5IY5 C;  1YZC A;  2R9R B;  4B6I A;  2P7V A;  5KYW B;  4CS8 C;  3ABL C;  2DYS C;  1N1C A;  3M4B A;  4P9T A;  4KI2 A;  1FTS A;  2KSF A;  2R7O A;  4BJ5 A;  4N6C A;  2FGY A;  2J0W A;  5BQG A;  2LSE A;  4IRU A;  4E0H A;  4AL1 A;  2R7X A;  5A6J A;  4YJW A;  5B1B C;  4E0I A;  2BL2 A;  4BPM A;  4D4X A;  1ZYR F;  2QTV A;  4Z9H A;  2C04 A;  4XLN F;  3PMR A;  1SF8 A;  3HLZ A;  3M1C B;  1G4W R;  3U8P A;  2XM0 A;  1MMD A;  1S05 A;  3BRJ A;  2H7V C;  1VYK A;  2NG1 A;  3ECS A;  3LES A;  4QI2 A;  4C3B A;  4JEB A;  4E7S A;  1YVI A;  2YLG A;  1V55 C;  3EGX B;  1W2W A;  2Q9B A;  1Z63 A;  2CNW D;  5E3C A;  3NYL A;  4EHP A;  4DRI B;  1LE2 A;  2PX0 A;  2OOC A;  1SR2 A;  1VTM P;  5DS6 A;  5A69 A;  4LLE A;  1M2O A;  3ZTM A;  3DE9 A;  3DM9 B;  2B0J A;  2ZD9 A;  2R05 A;  4XPW A;  1KTM A;  5AC5 A;  1B68 A;  4ULV A;  3MFN A;  2HUJ A;  2CNW A;  4IAR A;  2VC9 A;  3EFO A;  3RW0 A;  3TK0 A;  4G7H F;  1YA9 A;  5JVE A;  4XPY A;  2XRH A;  1PV3 A;  3ZC4 A;  1BZ4 A;  2F22 A;  1WAS A;  2ZXW C;  3DM5 A;  3QVZ A;  4DXW A;  3MX3 A;  3NG1 A;  1ZHZ A;  1BDJ B;  2IM8 A;  1RKE B;  4RD9 A;  3PDM P;  3GWL A;  3ABM C;  4JJG A;  1LS1 A;  5FZT A;  1ZW2 A;  1SZI A;  3O39 A;  4U5B E;  3G50 A;  4MW8 A;  4BJ6 C;  2HJM A;  3ATP A;  4U5E E;  2YQY A;  5D91 A;  3EZI A;  3U2L A;  2HS5 A;  2KK1 A;  3H2U A;  3SP1 A;  4DRH B;  3ZQV A;  3KL4 A;  3FOP A;  3S84 A;  4MVZ A;  4XPX A;  3DXJ F;  1HY5 A;  3NYJ A;  2AP3 A;  3GM2 A;  2R7V A;  3AG3 C;  3FAP B;  256B A;  4J32 B;  2LCH A;  2HSB A;  1M56 C;  4J30 B;  2YWA A;  5HV9 A;  3UGO A;  2NSF A;  3B71 A;  3AQC A;  5COM A;  3FOO A;  2ZPA A;  1HE9 A;  3EPV A;  5AC4 A;  4CJO A;  4MTF A;  4AE4 B;  2IBF A;  1YA7 O;  1APC A;  4NTA A;  5L0F A;  3NRH A;  3U8V A;  4NCQ A;  2PF4 E;  3K66 A;  4L6R A;  4YL0 A;  1E2X A;  1OQC A;  2J0X A;  3GM1 A;  4HEA J;  4MVR A;  4EBJ A;  3CAX A;  4H54 A;  1V54 C;  3K1I A;  2WZF A;  3KYI A;  4N6H A;  3W4Y A;  1Q0K A;  3KKB A;  3DJU B;  1FMW A;  4MVU A;  1K40 A;  5CI8 A;  2XXA A;  2G3V A;  1MMN A;  2MWQ A;  2J7P D;  3HNJ A;  3M4C A;  3FDQ A;  3U5S A;  3N0T A;  2I8B A;  1R5I D;  2J9V A;  1TQG A;  1WWP A;  1XWJ A;  3GEH A;  1D1B A;  1ZZP A;  5HSW A;  5F5F A;  3V5X A;  1XZQ A;  2RD9 A;  5JRA A;  3UMK A;  2X51 A;  4K1O A;  2GDC A;  2HFI A;  4ULW A;  2J7P A;  5L0C A;  4ONS A;  1CGM E;  1MMG A;  3EGD B;  4DJ9 A;  3LS1 A;  2L81 A;  3JYH A;  2P61 A;  3SXK A;  3AOU A;  1OW7 A;  3DD7 A;  3HJC A;  2NSG A;  3EJN A;  4LDK A;  1YLM A;  4CS9 A;  1H9T A;  2QE9 A;  3DAG A;  2WB7 A;  2PBE A;  1JRA A;  4YT8 A;  1Q0G A;  1C17 M;  1RJ9 A;  4G7Z F;  2W4M A;  1IW7 F;  3RVZ A;  2Q9C A;  2L6G A;  1Z23 A;  4X0R A;  1BBH A;  2P6V A;  1NSG B;  2YL1 A;  3S29 A;  2XL4 A;  3C7J A;  2HSQ A;  5EGY A;  4NY3 A;  5L0H A;  1SYQ A;  3K6B A;  4GQH A;  1TWA A;  4KBL A;  4MVO A;  3C63 A;  3OEO A;  2QUP A;  1ZU5 A;  5CI9 A;  1RMV A;  3H2V A;  1PD1 A;  3SYN A;  1G5Z A;  1T5O A;  3JRT A;  3S27 A;  3ZSU A;  5EHH A;  1FMV A;  1VLT A;  1T6Q A;  1YDI A;  3DAF A;  3I4U A;  4ZLC A;  3KPH A;  3EFO B;  2OEV A;  4LAC B;  1Z6A A;  2IXN A;  1NBB A;  3WOD F;  2QNL A;  3ZG1 A;  4Q4Z F;  1A7V A;  3RH3 A;  4CBE A;  3TOM A;  3JTL O;  5A6A A;  4BJ5 C;  3RQF A;  1H6G A;  2V3C C;  3K33 A;  4P6I C;  4C3D A;  1A7E A;  4LLC A;  3NMI A;  5TJ5 E;  2DGJ A;  2D4U A;  3K7D A;  1OR3 A;  4CIH A;  1H7I A;  1ZU4 A;  1LIH A;  3O10 A;  2EPN A;  3ITF A;  2YL7 A;  3JT1 A;  5B3S C;  4K0D A;  2M4E A;  4J7T A;  1OCC C;  3U2M A;  1ZHY A;  2YLI A;  3EZH A;  2EIM C;  3U9J A;  5DS4 A;  2NUT A;  2NPU A;  5EK0 A;  3Q7L A;  2R7T A;  4YT4 A;  4BJ1 A;  2OQM A;  5L0I A;  5A6B D;  3RKO F;  3G4Z A;  3EGD A;  4YT2 A;  4CSA A;  3X2Q C;  1LI5 A;  2GA0 A;  2KJG A;  1Y4C A;  4OIQ F;  3KMI A;  3O55 A;  5FCL A;  2XS8 A;  4PJJ A;  5GPG B;  2Q9A A;  3RVY A;  3JSZ A;  3ZIB A;  2R7W A;  1TKN A;  4FAP B;  1HMO A;  4E18 A;  3EH2 A;  4JIO A;  1TR2 A;  1ORJ A;  2YRF A;  4I1M A;  4RDA A;  2YHS A;  5A6B A;  2MYS A;  4M63 A;  3UMH A;  3R2P A;  5JLI A;  4JEA A;  1LM3 B;  1LKX A;  1S7Z A;  1D1A A;  2O9X A;  2YKZ A;  5E3A A;  1YJG A;  2XLO A;  2YLD A;  3DZA A;  3L0I A;  1I4Z A;  2HV7 A;  3OA1 A;  2L6F A;  3B29 A;  3GWN A;  1GGQ A;  4OD4 A;  4W8P A;  3NMK A;  1Z5Z A;  3EH1 A;  1Z7Q c;  1ZHT A;  3B0P A;  4DRJ B;  2DB4 A;  2UUI A; 
#chains in the Genus database with same CATH homology
 3N2Z B;  5T3W A;  2IXO A;  4O79 A;  3I5P A;  4F4B A;  4WJ0 A;  4IWB A;  3H65 A;  5DS5 A;  2H7O A;  4OD5 A;  4OIR F;  4KC9 A;  4PJN A;  5T3T A;  3B0V C;  2KQ9 A;  1NU7 D;  3AG2 C;  3LLK A;  2J46 A;  1D0X A;  3S0X A;  4FES A;  4U5H A;  2V26 A;  2CGE A;  3LLI A;  4O6N A;  1MND A;  1WGW A;  1RJ9 B;  3CSK A;  2Y3G A;  3NYM A;  1LVK A;  4ANJ A;  2CW0 F;  3LEV A;  4GYT A;  5DLJ A;  2EIN C;  3ZVR A;  4U5G A;  3W2W A;  3EQL F;  2KNH A;  1JPJ A;  1OKK A;  2EIJ C;  2YEV A;  3DJN B;  3K1I C;  1NG1 A;  4U5F E;  3LNR A;  4U5C E;  2W45 A;  4PFO A;  1ZHX A;  3EHM A;  2PX3 A;  2EIL C;  2IXP A;  2OCC C;  2V3C C;  4AX2 A;  2Z15 A;  1D0Z A;  2QY9 A;  4JW1 A;  2ZXR A;  1IZM A;  2A6E F;  3HTK C;  3LAY A;  4CS9 C;  2G3K A;  4U5D E;  2NUT B;  2L9J A;  1VOM A;  4OIP F;  4XTK A;  2KW3 C;  4CS7 A;  3GAN A;  2WZG A;  2IYL D;  1MNE A;  3L34 A;  3FHD A;  3RFY A;  3W2V A;  1OCO C;  3UGP A;  3Q6N A;  2ZXO A;  4FWV A;  3TD7 A;  1BR2 A;  3X1O A;  3UNG C;  1O87 A;  5L3Q A;  1QLE C;  3SEO A;  3Q6M A;  3SNH A;  5KYY B;  4QI0 A;  2R7S A;  1KU2 A;  4LER A;  3B9Q A;  5T1D B;  4DOZ A;  4MQ9 F;  3LJB A;  4PK4 A;  1QZX A;  2CDQ A;  3V7O A;  3PHF 2;  4PJM A;  4XWJ A;  1D1C A;  4CSA C;  3ABK C;  1TWG A;  3W8I A;  2E87 A;  1TWH A;  4C3E A;  4I1O B;  2FFH A;  2GFH A;  4QDL A;  4YT5 A;  1M2V A;  3I5Q A;  2A1D D;  3NKE A;  1D0Y A;  2Y3D A;  4EWC A;  1VMA A;  3JCU Q;  4DVZ A;  3UMI A;  1O5H A;  1PCX A;  3OWT A;  2KGO A;  5E33 A;  4HE8 D;  2HV6 A;  2WL8 A;  2J9W A;  4EBB A;  2PP4 A;  2D5R B;  1Z3I X;  4KNV A;  3WG7 C;  4O7G A;  4FX5 A;  3N24 A;  5DQZ A;  2OG2 A;  3CQZ A;  4CS8 A;  3NDB B;  3T4R A;  5KYX B;  1MMA A;  4C7O A;  4KNW A;  2VB6 A;  3RYL A;  3T6B A;  3DMD A;  4E7Z A;  5KYU A;  4I44 A;  1OCZ C;  4BJT A;  3EHN A;  3EG9 A;  1NU9 C;  3T6J A;  1OKK D;  1SMY F;  2VAS A;  1J8Y F;  2XSE A;  4XLP F;  3POV A;  4A2N B;  4OIO F;  2A69 F;  4BG0 A;  1FFH A;  3Q7G A;  2WVN A;  2WVO A;  4JZA A;  3VYW A;  4O6M A;  2NUP A;  4GEH A;  3AQB A;  5KYW A;  5KYN A;  2R7Q A;  2WVQ A;  3QZC A;  2IXM A;  3O6X A;  2R7R A;  1ZHW A;  2A68 F;  2WZL A;  1VK5 A;  2YZS A;  2G62 A;  3LS0 A;  5DVW A;  3ASN C;  3QMK A;  1OCR C;  4BJ6 A;  4IAO A;  5BUO A;  3CZ6 A;  3FVY A;  2Y69 C;  5KYX A;  2C03 A;  2Y3B A;  4HFK B;  4PJL A;  4YN0 B;  1NZE A;  4Q5S F;  2R7U A;  4ZLD A;  2EIK C;  3EGX A;  1M2V B;  4JCH A;  1BR1 A;  3AG4 C;  3E70 C;  5D92 A;  3KH2 A;  5DQT A;  3F46 A;  4DVY P;  3RIP A;  4O6Y A;  4G7O F;  2Q3T A;  3ASO C;  4RBN A;  1JPN A;  4G0H A;  2VH3 A;  4JJF A;  4JUR I;  1PD0 A;  2W4B A;  1G8X A;  2BE5 F;  1ST6 A;  3IEE A;  1M57 C;  2Y3H A;  4I3M A;  4Q7C A;  3S28 A;  4W8K A;  1BR4 A;  2J9U A;  3VAY A;  1J8M F;  1VYI A;  3F47 A;  3UR3 C;  2A6H F;  2ZXP A;  2DYR C;  2H7B A;  5E2Q A;  3W8H A;  3B0U X;  4C7O B;  1TWC A;  4AK9 A;  3K1H A;  2W9Y A;  3NKD A;  5F5H A;  4JVS A;  5KYU B;  2JD3 A;  5L3V A;  4DBR A;  2IOQ A;  3FAJ A;  3MLG A;  2Y39 A;  4K7B A;  3GOD A;  3SZR A;  4HFF B;  3EG9 B;  4BEJ A;  4PFP A;  2J45 A;  5B1A C;  4AE4 A;  4DBQ A;  4H4K C;  4YWQ A;  4MND A;  1FFT C;  2PFD A;  3AG1 C;  2NUP B;  3E9V A;  4N06 A;  4OIN F;  4IJJ A;  5IY5 C;  4B6I A;  2P7V A;  5KYW B;  4CS8 C;  3ABL C;  2DYS C;  1N1C A;  4KI2 A;  1FTS A;  2R7O A;  4BJ5 A;  2FGY A;  2J0W A;  2R7X A;  2LSE A;  4IRU A;  4YJW A;  5B1B C;  1ZYR F;  2QTV A;  2C04 A;  4XLN F;  3PMR A;  1SF8 A;  3HLZ A;  3M1C B;  1MMD A;  2H7V C;  1VYK A;  2NG1 A;  3ECS A;  3LES A;  4QI2 A;  4C3B A;  4E7S A;  3EGX B;  1V55 C;  1W2W A;  2Q9B A;  1Z63 A;  2CNW D;  5E3C A;  3NYL A;  2PX0 A;  5DS6 A;  4LLE A;  1M2O A;  3DM9 B;  2B0J A;  2CNW A;  4G7H F;  3EFO A;  2XRH A;  3ZC4 A;  2ZXW C;  3DM5 A;  3MX3 A;  3NG1 A;  1ZHZ A;  4RD9 A;  3ABM C;  4JJG A;  1LS1 A;  1SZI A;  3O39 A;  4U5B E;  4BJ6 C;  4U5E E;  5D91 A;  3EZI A;  3SP1 A;  3KL4 A;  3DXJ F;  3NYJ A;  2R7V A;  3AG3 C;  4J30 B;  4J32 B;  1M56 C;  3UGO A;  3AQC A;  2ZPA A;  3EPV A;  4AE4 B;  3NRH A;  2PF4 E;  3K66 A;  2J0X A;  4HEA J;  1V54 C;  2WZF A;  3KKB A;  3DJU B;  1FMW A;  5CI8 A;  2XXA A;  2G3V A;  1MMN A;  2MWQ A;  2J7P D;  3FDQ A;  3N0T A;  2I8B A;  2J9V A;  1D1B A;  5HSW A;  5F5F A;  3UMK A;  2X51 A;  4ULW A;  2J7P A;  1MMG A;  3EGD B;  3LS1 A;  2L81 A;  3JYH A;  3DD7 A;  3HJC A;  3EJN A;  4CS9 A;  3DAG A;  2WB7 A;  4YT8 A;  1RJ9 A;  2W4M A;  1IW7 F;  2Q9C A;  1Z23 A;  4X0R A;  2P6V A;  3S29 A;  2XL4 A;  5EGY A;  4NY3 A;  3K6B A;  1TWA A;  4KBL A;  5CI9 A;  3OEO A;  1ZU5 A;  1PD1 A;  3SYN A;  3JRT A;  3S27 A;  3ZSU A;  5EHH A;  1FMV A;  4ZLC A;  3DAF A;  3I4U A;  3EFO B;  4LAC B;  1Z6A A;  2IXN A;  3WOD F;  3ZG1 A;  4Q4Z F;  3RH3 A;  4CBE A;  4BJ5 C;  3K33 A;  4P6I C;  4C3D A;  4LLC A;  2DGJ A;  3K7D A;  4CIH A;  1ZU4 A;  3ITF A;  3JT1 A;  5B3S C;  4K0D A;  2M4E A;  1OCC C;  1ZHY A;  3EZH A;  2EIM C;  5DS4 A;  2NUT A;  3Q7L A;  2R7T A;  4YT4 A;  4BJ1 A;  3RKO F;  3EGD A;  4YT2 A;  4CSA A;  3X2Q C;  2KJG A;  4OIQ F;  3KMI A;  5FCL A;  4PJJ A;  2R7W A;  2Q9A A;  3ZIB A;  3JSZ A;  1TKN A;  3EH2 A;  4RDA A;  1TR2 A;  4I1M A;  2YHS A;  2MYS A;  4M63 A;  3UMH A;  1LKX A;  1S7Z A;  1D1A A;  2O9X A;  5E3A A;  3DZA A;  3OA1 A;  3L0I A;  5KYY A;  4G7Z F;  2HV7 A;  4OD4 A;  1Z5Z A;  3EH1 A;  1ZHT A;  3B0P A;  2XXA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...