1FFTC

The structure of ubiquinol oxidase from escherichia coli
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
185
structure length
185
Chain Sequence
b'HDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL OXIDASE
publication title The structure of the ubiquinol oxidase from Escherichia coli and its ubiquinone binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 46
structure length 185
sequence length 185
chains with identical sequence H
ec nomenclature
pdb deposition date 2000-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.80 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1fftC00
1OCOC 1V54C 3ABLC 2DYRC 2OCCC 3AG4C 3AG1C 1QLEC 3ABKC 3ASNC 3AG3C 5B3SC 1OCZC 1FFTC 2EILC 3ABMC 3X2QC 2ZXWC 5IY5C 1V55C 2EIJC 1M56C 3WG7C 5B1BC 1OCRC 5B1AC 2DYSC 1OCCC 2EINC 3AG2C 2EIKC 3ASOC 2YEVA 1M57C 2EIMC 2Y69C
chains in the Genus database with same CATH superfamily
1UFBA 5A6BD 3CEXA 4U5BE 4CS8A 3J06A 2WZLA 2OCCC 3ZC4A 4JIOA 2L81A 4E17A 4P9TA 4N4WA 5F5FA 1OR2A 2KK1A 3AQBA 3ECSA 3ASNC 4IAQA 4MVSA 4U5HA 4LDQA 3QVYA 5GPGB 3RF3A 2YLIA 2Q00A 2WZFA 3UMHA 2HUJA 2QE9A 3GM1A 5EK0A 3DJUB 3HNKA 4PJJA 4BJ1A 1V4AA 2IXOA 2NUPB 5FZTA 3DE9A 2R7RA 1YAUO 2GFHA 4JTDB 1ORJA 3F46A 1O3UA 3SXKA 3FXHA 2IXNA 1LI5A 4Q7CA 2W9YA 5DS4A 4NTAA 2HFIA 2XL6A 3U2LA 3A9CA 4LDKA 1CGNA 1AVOB 2M64A 3T6BA 1ZYRF 5E2QA 2EIMC 5BQIA 1VLTA 1RKEA 1HW2A 4J30B 2EPMX 4XTKA 1YVIA 3AG1C 3BEHA 1L3PA 5JP7A 2PP4A 4GQHA 5L0JA 4JEAA 4HFFB 3LAYA 2J9VA 1NG1A 2NG1A 2Y3HA 4AK9A 4NCQA 1E83A 4AE4A 4PFPA 3JRTA 2KC3A 4ULVA 3U3BA 2R7WA 3RW0A 1CPRA 2P1AA 4YJWA 5COMA 1TWGA 2AWCA 2PX0A 2R02A 2WL8A 4IWBA 4J7TA 5KYWA 1TWAA 3Q6NA 3F47A 2WVQA 4GYTA 4C7OA 4NTBA 5L0CA 4JE9A 3T6GB 3LNRA 5DQTA 1RKCA 2VCBA 1NU9C 3N0TA 1NFNA 2HV6A 3U8PA 2YL7A 3KKBA 3RQEA 4AX2A 3SXYA 1WN0A 1CGOA 4N6HA 2Y3GA 3X1OA 2IBFA 4JEBA 3GANA 1A41A 1BR2A 4KNWA 2XSEA 1KU2A 4J7YA 3CSKA 4W8PA 3EGXA 3DKAA 3T4RA 1HY5A 1RJ9A 1T01A 3UMIA 1HW1A 1LE4A 2A1DD 2XM4A 2X0CA 3KPHA 4YL0A 2L6GA 2R7VA 2QUPA 2ASRA 4A4AA 4JTCB 1JRAA 5JUAA 2YZSA 3DAFA 4FX5A 2LFFA 3ZSUA 4YT2A 5HV9A 2R7UA 2MHRA 1JPJA 5KYXB 5JRAA 4LACB 4EKWA 2YL0A 2EIKC 2L9JA 4XLPF 4LLCA 4JTAB 1B68A 3S84A 1G4WR 3ZG1A 1YARO 4JZAA 3RKOF 1K05A 2J7PD 1TWCA 3SP1A 1MMDA 1QSPA 1LS4A 5T3TA 2R7QA 1A7DA 2VCAA 4K7BA 4H54A 5BUOA 4I1MA 3US6A 5L3VA 3B9QA 3AG3C 2WVOA 3C7JA 3T6JA 2XXAA 1J8MF 2OU6A 1DOVA 3ZWIA 4XLNF 1E84A 2OQMA 1KTMA 2CYDA 4CS9C 4BJ6C 2EPOA 2AU5A 2DB4A 5B1BC 3ZQVA 1NU7D 2NSGA 1R5ID 3AOUA 3DZAA 4YN0B 5JVEA 1M2VB 3GEIA 4D4XA 1TR2A 4PK4A 5A6BA 4MVUA 2YHSA 2IM8A 2AWYA 2KYHA 1Q0FA 5T1DB 4Z9IA 3V7OA 4DVYP 2Q9BA 2GA0A 3G4ZA 4NY3A 3O6XA 3EGDB 3JSZA 3VRCA 2DGJA 2ZXPA 5A6KA 3ATPA 1VMAA 3NKDA 4WGZA 4UDVA 1EA8A 2A6HF 3CAXA 1Z7Qc 1VTMP 1BDJB 4YL1A 4YL3A 3FDQA 1Q0MA 1C03A 1SF8A 2UUHA 3TQOA 2VCCA 2HJMA 4U5EE 3H2VA 4O7GA 3IEEA 5DLJA 3SYNA 4CBEA 3TJ5A 1Z6AA 3KYJA 5TJ5E 2Q7RA 3WG7C 2XL8A 1OCRC 3AGTA 4R32A 4ZLCA 1E85A 4ZLDA 1F1MA 1T5OA 3O39A 3Q6MA 3BRJA 4JVSA 4IAOA 1Z63A 5L0DA 3ZTMA 2CDQA 1LM3B 3I5QA 3KMIA 2Q9CA 3JT1A 3SXZA 3O55A 5AGFA 4CS9A 4DXWA 2H7OA 4BJ6A 2HS5A 3M4CA 1H9GA 2YKZA 5E3CA 4FESA 1HMOA 3QZCA 1GM5A 2G3VA 5KYYA 2QNLA 1ZVZA 4AE4B 3FAJA 4CDVA 3ZTZA 5B3SC 2HMQA 3ZIBA 2A0UA 1AUEA 1OR3A 1ZU4A 4XEVA 3MFNA 4RBNA 3U0CA 5CI8A 3W4YA 2HV7A 5KYWB 3DWWA 1GQAA 2C03A 4A2NB 3H2UA 1VLSA 3LNMB 1PD1A 1V55C 3C18A 2LSEA 3GEHA 1JMWA 4IB4A 5E3AA 4B6IA 2UUIA 5KYUA 5D92A 3S0XA 4O6YA 3B71A 2R25A 2FAPB 2YRFA 1FTSA 2A68F 1LKXA 2H7BA 3N2ZB 4IARA 2AVKA 5F28E 4W8KA 4E18A 2YQYA 4YT8A 5K0IA 4H4KC 4XEKA 3SXMA 1M6TA 3LS1A 1A7EA 1D0YA 1WOLA 1RJ9B 2LFDA 2LK4A 3JSEO 4G0HA 2GWWA 4CDAA 2LQGA 3RIPA 1JOGA 4JKVA 4BG0A 2V3CC 1V74B 3DXJF 2JX0A 3L0IA 1MMNA 4CJOA 1RCPA 1ZHXA 2KNHA 2Q9AA 4EHPA 1LVKA 2ZPAA 3H65A 1NBBA 3POVA 2XLOA 4IGGA 2R7XA 1IZMA 3CQZA 3KYIA 2I15A 3C8GB 4MTGA 2GDCA 2XLHA 3NYLA 3L8JA 3NMKA 3U9JA 4E7SA 2J0WA 3IQCA 2MYSA 3O10A 5JSLA 4WJ0A 4XWJA 3M15A 2D4UA 1QQ3A 1Y4CA 2NSFA 2XS1A 1QZXA 1LPEA 3FHDA 3HJCA 3Q7GA 3U9MA 1H9TA 3PMRA 1CGME 1T6QA 1ZW3A 2HKVA 3HNIA 3NMJA 4G78A 1H7IA 2XS8A 3HLZA 2RD9A 4EUKB 2DYRC 4HE8D 3JZ0A 2CNWA 3U8VA 2M4EA 3DM5A 3JTLO 2XXAB 4K1OA 2VB6A 5COGA 4MVMA 3LEVA 2NUTA 1BBHA 3C63A 5JLIA 5L0IA 1AEPA 1U6HA 4E7ZA 3S9OA 3EJNA 2R7TA 1JPNA 1U89A 2R03A 2EPNA 2P7VA 4DBRA 2NUPA 1MQVA 3HKKA 2X51A 1QKRA 2ZXOA 2OOCA 2YL3A 1YLMA 1ZHZA 4CIPA 1Q0DA 1J8YF 1SZIA 3C8ZA 3FOPA 2JPUA 4PJNA 2J9UA 1OCOC 3G4XA 3ABLC 1PCXA 3WHNA 3S27A 4NC3A 5JT4A 2B0HA 2OEVA 1VYIA 4X0RA 4BJ5C 1YYXA 3GODA 4OD5A 5DQZA 1EKYA 1WWPA 2P61A 3LLIA 2ICWG 1VYKA 3NG1A 1YDIA 4JW1A 2J45A 1FMVA 4PFOA 3V5YA 3W8IA 4M63A 5BQHA 3DMDA 4G7OF 1GGQA 1FFHA 1YZCA 2XLVA 4D4NA 1VOMA 2XLDA 5JS5A 5CIVA 3S90A 3B0PA 2NPUA 4O6NA 1FNTc 2KSFA 2R7OA 2EIJC 3LEOA 1M56C 2IYLD 3B29A 4U5GA 4MQ9F 4MVQA 1OKKD 3EG9B 3W8HA 1ZHYA 3L34A 3KH2A 4WGYA 3JYYA 4ANJA 1YZAA 2EINC 4WABA 1M2OA 3OWTA 3M1CB 1FR0A 3T9OA 3AJMA 2LD6A 4G7ZF 4IRUA 4ULWA 3B0UX 4NTFA 4XPYA 2OKUA 3DM9B 2J9WA 3VM6A 3W2WA 1V54C 2LIGA 4CIHA 4Q4ZF 1WASA 4KC9A 3K66A 2JD3A 2PFDA 1TKNA 3EHNA 1RMVA 3QW0A 3TK0A 3IHUA 4XPXA 4YT4A 1TFKB 3IQTA 4P9FA 4EBJA 1E2XA 2VASA 2PNOA 3GWNA 1HE1A 2GAQA 4I44A 2PF4E 4C3EA 2A69F 2L6FA 3N24A 3B0VC 2OJQA 4JCZA 4P6IC 1D0ZA 2EPLX 1O5HA 1TQGA 2R9RB 4BJ5A 4YWQA 2J0XA 2Q4FA 1NSGB 1OCCC 3QW1A 3W2VA 4DBQA 2YL1A 3C8GD 4KBLA 3NRHA 1RKEB 5A6AA 3ASOC 2R05A 2EPKX 1Z5ZA 3K7DA 2BC5A 3EHMA 2LCHA 2J9BA 1G5ZA 1Q0GA 2Y3BA 1D1CA 4RDAA 3RYLA 4PR9A 3A11A 3KL4A 4MVOA 4DJ9A 3I5PA 5AC5A 2TMVP 3ABKC 3K33A 4CX9A 2G3KA 3MLGA 5KYNA 2PBEA 3EFOA 2I8BA 1ZU5A 3GEEA 2W4BA 1LS1A 3U3FA 1MNEA 1R4TA 1TWHA 2R7SA 1N1CA 4CJGA 1L7CA 3JCUQ 5T3WA 3LUTB 3V5XA 2ZXWC 1ORYA 3DD7A 4CDYA 5L0HA 1HE9A 4NQFA 2QLAA 5L0GA 4C7OB 1C02A 4Z9JA 1SR2A 3L8IA 3OA1A 4CS7A 3MYFA 1NFOA 2OJED 4U9EA 3K1HA 4FWVA 4EBBA 1I4YA 4OIRF 5EHHA 3PDMP 4AL0A 4MTFA 2YVKA 4KNVA 4XEFA 3V5ZA 4XQ1A 5L3QA 1VK5A 1FMWA 4OINF 1HMDA 1Q0KA 1T9KA 4MW3A 1CPQA 1KNYA 3JYHA 2NUTB 1YA9A 3EGDA 3EGXB 2VC9A 1C17M 1QPUA 3UGPA 1XWJA 3IPMO 3RH3A 2QTVA 3HNJA 3DJNB 2A6EF 4ONSA 3ZQYA 2HSQA 2EILC 3EH1A 4DRJB 5D91A 3ABMC 1PD0A 2FGYA 2Q3TA 4G7HF 4PJLA 4BJTA 1K04A 4Z9HA 4LDRA 4IJJA 4OD4A 3VAYA 1GS9A 2D5RB 5A69A 2WZGA 4ER9A 2MWQA 2FFHA 2Z15A 2RSEB 3I4UA 3RVZA 4N6CA 1SMYF 4PJMA 3CZ6A 5FCLA 1M57C 3R7CA 5HSWA 1ZZPA 2J7PA 2LP4A 1EI7A 2WVNA 3TULA 1OW7A 3GM2A 2F22A 2IXPA 1T6UA 3K6BA 2H8AA 2ZD9A 4MNDA 4Q5SF 4I3MA 1ST6A 1ZHTA 1Z3IX 4JJFA 2XLMA 2KGOA 1YYJA 2YLGA 2HSBA 1WGWA 2AP3A 4BEJA 2DI3A 4OIQF 4JCHA 3LS0A 1ZHWA 3VYWA 1WATA 2BE5F 2VH3A 3QMKA 5A6JA 5IY5C 1K40A 5DS5A 1OKKA 4N06A 2BL2A 1Z23A 4YK5A 1VB5A 2Y39A 2YWAA 3RVYA 5BQGA 3LESA 3TOMA 1S05A 1OW8A 2IXMA 3GWLA 1NLXA 4BEMJ 1LE2A 2W45A 3L1MA 4I1OB 4E0IA 3EQLF 3S28A 4JC7A 4MTOA 1TFOB 2Y69C 3LJBA 3ZVRA 5B3IA 4CSAC 2HMZA 2E87A 4O79A 1O87A 3FVYA 2HZ8A 4EBKA 2OEXA 1W2WA 1QLEC 2J8WA 1OQCA 4QI0A 1A7VA 2CCYA 2IOQA 4RD9A 3RFYA 2XL4A 3RQGA 3QVZA 4JURI 3K1IC 1QVXA 2H7VC 4U5CE 3AGUA 4BPMA 4F4BA 1G4US 1D0XA 1YJGA 1FFTC 2L7AA 2L6HA 1U0BB 1Y6DA 4J32B 3UGOA 4JRZA 2KQ9A 1PV3A 2CW0F 2XLEA 1OXKA 3RQFA 3EPVA 1APCA 4E0HA 2KJGA 3EH2A 2XLWA 3FMSA 4L6RA 4O6MA 3TJ6A 2P6VA 5DS6A 1FAPB 1RXQA 1XZQA 2QY9A 3C8GA 3QTHA 4HEAJ 1BR1A 4U5DE 3AG2C 3Q7LA 3NYJA 3NYMA 4LERA 5DVWA 3IQ5A 3NMIA 2C04A 2J46A 3TOLA 3JRMO 3OEOA 3UMKA 2XRHA 3DI5A 5L0FA 5KYYB 3EFOB 3AG4C 4AL1A 2CNWD 3FAPB 1BR4A 2KW3C 3EZHA 5CI9A 1MMGA 1MMAA 2WB7A 2A0BA 1OXBA 4DRHB 3PCVA 1MNDA 4OIPF 3DAGA 3ZDLA 4C3BA 4JJGA 3MX3A 4EIYA 4CSAA 4QDLA 4K0DA 3X2QC 1JAFA 4GEHA 4MW8A 3AQCA 3VF0A 5COFA 4CS8C 5KYUB 1OW6A 2V26A 1D1AA 2W4MA 4HFKB 2DYSC 2ETSA 4YT5A 3K1IA 5B1AC 3SEOA 1XZPA 4DOZA 1IW7F 3G50A 3R2PA 4PACA 1DOWA 3S29A 4FAPB 3HNLA 5KYXA 1G8XA 2YEVA 3C62A 3GORA 4MS2A 4U9DA 3TD7A 4C3DA 3LLKA 4EWCA 3PHF2 1EQ1A 1D1BA 3HTKC 3FOOA 4XPWA 4KI2A 1UG7A 3U5SA 3M4BA 3E70C 1I4ZA 2XM0A 1NZEA 4U5FE 3SNHA 1E86A 3NDBB 5E33A 2OG2A 1YA7O 1LI7A 1ORSC 3MYIA 1LIHA 1H6GA 1OCZC 3DE8A 3IQ6A 1I5NA 4MVRA 3GM3A 2G62A 2O9XA 5EGYA 2HJ3A 3WAQA 1S7ZA 3UR3C 2B0JA 4LLEA 3UNGC 1T6IA 2P0NA 3U2MA 1BZ4A 1JR8A 256BA 2PX3A 2YLDA 3E9VA 3EG9A 3M79A 3MBGA 1A0BA 1ZW2A 2CGEA 3NKEA 3SZRA 5F5HA 3WODF 4QI2A 2Y3DA 4OIOF 1SYQA 3EZIA 5AC4A 1WTYA 4MVZA 2ZXRA 4DRIB 4DVZA 1M2VA 3ITFA
chains in the Genus database with same CATH topology
4U5BE 4CS8A 2WZLA 2OCCC 3ZC4A 2L81A 5F5FA 3AQBA 3ECSA 3ASNC 4U5HA 3UMHA 2WZFA 3DJUB 4PJJA 4BJ1A 2R7RA 2IXOA 2NUPB 2GFHA 3F46A 2IXNA 4Q7CA 2W9YA 5DS4A 3T6BA 1ZYRF 5E2QA 2EIMC 4J30B 4XTKA 3AG1C 2PP4A 4HFFB 3LAYA 2J9VA 1NG1A 2NG1A 2Y3HA 4AK9A 4AE4A 4PFPA 3JRTA 2R7WA 4YJWA 1TWGA 2PX0A 2WL8A 4IWBA 5KYWA 1TWAA 3Q6NA 3F47A 2WVQA 4GYTA 4C7OA 3LNRA 5DQTA 1NU9C 3N0TA 2HV6A 3KKBA 4AX2A 2Y3GA 3X1OA 3GANA 1BR2A 4KNWA 2XSEA 1KU2A 3CSKA 3T4RA 3EGXA 1RJ9A 3UMIA 2A1DD 2R7VA 2YZSA 3DAFA 4FX5A 3ZSUA 4YT2A 2R7UA 1JPJA 5KYXB 4LACB 2EIKC 2L9JA 4XLPF 4LLCA 3ZG1A 4JZAA 3RKOF 2J7PD 3SP1A 1TWCA 1MMDA 5T3TA 2R7QA 4K7BA 5BUOA 4I1MA 5L3VA 3B9QA 3AG3C 2WVOA 3T6JA 2XXAA 1J8MF 4XLNF 4CS9C 4BJ6C 5B1BC 1NU7D 3DZAA 4YN0B 1M2VB 1TR2A 4PK4A 2YHSA 5T1DB 3V7OA 4DVYP 2Q9BA 4NY3A 3O6XA 3EGDB 3JSZA 2DGJA 2ZXPA 1VMAA 3NKDA 2A6HF 3FDQA 1SF8A 4U5EE 4O7GA 3IEEA 5DLJA 3SYNA 4CBEA 1Z6AA 3WG7C 4ZLCA 4ZLDA 1OCRC 3O39A 3Q6MA 4JVSA 4IAOA 1Z63A 2CDQA 3I5QA 3KMIA 2Q9CA 3JT1A 4CS9A 2H7OA 4BJ6A 5E3CA 4FESA 3QZCA 2G3VA 5KYYA 4AE4B 3FAJA 5B3SC 3ZIBA 1ZU4A 4RBNA 5CI8A 2HV7A 5KYWB 2C03A 4A2NB 1PD1A 1V55C 4B6IA 2LSEA 5E3AA 3S0XA 5KYUA 5D92A 4O6YA 1FTSA 2A68F 1LKXA 2H7BA 3N2ZB 4YT8A 4W8KA 4H4KC 3LS1A 1D0YA 1RJ9B 4G0HA 3RIPA 4BG0A 2V3CC 3DXJF 3L0IA 1MMNA 1ZHXA 2KNHA 2Q9AA 1LVKA 2ZPAA 3H65A 3POVA 2R7XA 1IZMA 3CQZA 4E7SA 3NYLA 2J0WA 2MYSA 4WJ0A 4XWJA 4ANJA 3Q7GA 3HJCA 1QZXA 3B0UX 3FHDA 3PMRA 3HLZA 2DYRC 4HE8D 2CNWA 2M4EA 3DM5A 2XXAB 2VB6A 2NUTA 3LEVA 4E7ZA 3EJNA 2R7TA 1JPNA 2P7VA 4DBRA 2NUPA 2X51A 2ZXOA 1ZHZA 1SZIA 1J8YF 4PJNA 2J9UA 1OCOC 3ABLC 1PCXA 3S27A 1VYIA 4X0RA 4BJ5C 4OD5A 3GODA 5DQZA 3LLIA 4JW1A 1VYKA 3NG1A 4PFOA 2J45A 1FMVA 3W8IA 4G7OF 4M63A 3DMDA 1FFHA 1VOMA 3B0PA 4O6NA 2R7OA 2EIJC 1M56C 2IYLD 4U5GA 4MQ9F 1OKKD 3EG9B 3W8HA 1ZHYA 3L34A 3KH2A 2EINC 1M2OA 3OWTA 3M1CB 4G7ZF 4IRUA 4ULWA 3DM9B 2J9WA 3W2WA 1V54C 4CIHA 4Q4ZF 4KC9A 3K66A 2JD3A 2PFDA 1TKNA 3EHNA 4YT4A 2VASA 4I44A 2PF4E 4C3EA 2A69F 3N24A 3B0VC 4P6IC 1D0ZA 1O5HA 4BJ5A 4YWQA 2J0XA 1OCCC 3W2VA 4DBQA 4KBLA 3NRHA 3ASOC 1Z5ZA 3K7DA 3EHMA 2Y3BA 1D1CA 4RDAA 3RYLA 3KL4A 3I5PA 3ABKC 3K33A 2G3KA 3MLGA 5KYNA 3EFOA 2I8BA 1ZU5A 2W4BA 1LS1A 1TWHA 1MNEA 2R7SA 1N1CA 5T3WA 3JCUQ 2ZXWC 3DD7A 4C7OB 3OA1A 4CS7A 3K1HA 4FWVA 4EBBA 5EHHA 4OIRF 4KNVA 5L3QA 1VK5A 1FMWA 4OINF 3JYHA 2NUTB 3EGDA 3EGXB 3UGPA 3RH3A 2QTVA 3DJNB 2A6EF 3EH1A 2EILC 5D91A 3ABMC 1PD0A 2FGYA 2Q3TA 4G7HF 4PJLA 4BJTA 4IJJA 4OD4A 3VAYA 2D5RB 2WZGA 2MWQA 2FFHA 2Z15A 3I4UA 4PJMA 1SMYF 3CZ6A 5FCLA 1M57C 5HSWA 2J7PA 2WVNA 2IXPA 3K6BA 4MNDA 4Q5SF 4I3MA 1ST6A 1ZHTA 1Z3IX 4JJFA 2KGOA 1WGWA 4BEJA 4OIQF 4JCHA 3LS0A 1ZHWA 3VYWA 2BE5F 3QMKA 2VH3A 5IY5C 5DS5A 1OKKA 4N06A 1Z23A 2Y39A 3LESA 2IXMA 2W45A 4I1OB 3EQLF 3S28A 2Y69C 3LJBA 3ZVRA 4CSAC 2E87A 4O79A 1O87A 3FVYA 1W2WA 1QLEC 4QI0A 4RD9A 2IOQA 3RFYA 2XL4A 4JURI 4U5CE 3K1IC 2H7VC 4F4BA 1D0XA 1FFTC 4J32B 3UGOA 2KQ9A 2CW0F 3EPVA 2KJGA 3EH2A 4O6MA 2P6VA 5DS6A 2QY9A 4HEAJ 4U5DE 1BR1A 3AG2C 3Q7LA 3NYJA 3NYMA 4LERA 5DVWA 2C04A 2J46A 3OEOA 3UMKA 2XRHA 5KYYB 3EFOB 3AG4C 2CNWD 1BR4A 2KW3C 3EZHA 5CI9A 1MMGA 1MMAA 2WB7A 1MNDA 4OIPF 3DAGA 4C3BA 4JJGA 3MX3A 4CSAA 4QDLA 4K0DA 3X2QC 4GEHA 3AQCA 5KYUB 4CS8C 2V26A 2W4MA 1D1AA 4HFKB 4YT5A 2DYSC 5B1AC 3SEOA 4DOZA 1IW7F 3S29A 5KYXA 1G8XA 2YEVA 3PHF2 3TD7A 4C3DA 3LLKA 4EWCA 1D1BA 3HTKC 4KI2A 3E70C 4U5FE 1NZEA 3SNHA 3NDBB 5E33A 2OG2A 1OCZC 2G62A 2O9XA 5EGYA 1S7ZA 3UR3C 2B0JA 4LLEA 3UNGC 2PX3A 3SZRA 3E9VA 3EG9A 3NKEA 5F5HA 3WODF 2CGEA 4QI2A 2Y3DA 4OIOF 3EZIA 2ZXRA 4DVZA 1M2VA 3ITFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCO C;  1V54 C;  3ABL C;  2DYR C;  2OCC C;  3AG4 C;  3AG1 C;  1QLE C;  3ABK C;  3ASN C;  3AG3 C;  5B3S C;  1OCZ C;  1FFT C;  2EIL C;  3ABM C;  3X2Q C;  2ZXW C;  5IY5 C;  1V55 C;  2EIJ C;  1M56 C;  3WG7 C;  5B1B C;  1OCR C;  5B1A C;  2DYS C;  1OCC C;  2EIN C;  3AG2 C;  2EIK C;  3ASO C;  2YEV A;  1M57 C;  2EIM C;  2Y69 C; 
#chains in the Genus database with same CATH topology
 1UFB A;  5A6B D;  3CEX A;  4U5B E;  4CS8 A;  3J06 A;  2WZL A;  2OCC C;  3ZC4 A;  4JIO A;  2L81 A;  4E17 A;  4P9T A;  4N4W A;  5F5F A;  1OR2 A;  2KK1 A;  3AQB A;  3ECS A;  3ASN C;  4IAQ A;  4MVS A;  4U5H A;  4LDQ A;  3QVY A;  5GPG B;  3RF3 A;  2YLI A;  2Q00 A;  2WZF A;  3UMH A;  2HUJ A;  2QE9 A;  3GM1 A;  5EK0 A;  3DJU B;  3HNK A;  4PJJ A;  4BJ1 A;  1V4A A;  2IXO A;  2NUP B;  5FZT A;  3DE9 A;  2R7R A;  1YAU O;  2GFH A;  4JTD B;  1ORJ A;  3F46 A;  1O3U A;  3SXK A;  3FXH A;  2IXN A;  1LI5 A;  4Q7C A;  2W9Y A;  5DS4 A;  4NTA A;  2HFI A;  2XL6 A;  3U2L A;  3A9C A;  4LDK A;  1CGN A;  1AVO B;  2M64 A;  3T6B A;  1ZYR F;  5E2Q A;  2EIM C;  5BQI A;  1VLT A;  1RKE A;  1HW2 A;  4J30 B;  2EPM X;  4XTK A;  1YVI A;  3AG1 C;  3BEH A;  1L3P A;  5JP7 A;  2PP4 A;  4GQH A;  5L0J A;  4JEA A;  4HFF B;  3LAY A;  2J9V A;  1NG1 A;  2NG1 A;  2Y3H A;  4AK9 A;  4NCQ A;  1E83 A;  4AE4 A;  4PFP A;  3JRT A;  2KC3 A;  4ULV A;  3U3B A;  2R7W A;  3RW0 A;  1CPR A;  2P1A A;  4YJW A;  5COM A;  1TWG A;  2AWC A;  2PX0 A;  2R02 A;  2WL8 A;  4IWB A;  4J7T A;  5KYW A;  1TWA A;  3Q6N A;  3F47 A;  2WVQ A;  4GYT A;  4C7O A;  4NTB A;  5L0C A;  4JE9 A;  3T6G B;  3LNR A;  5DQT A;  1RKC A;  2VCB A;  1NU9 C;  3N0T A;  1NFN A;  2HV6 A;  3U8P A;  2YL7 A;  3KKB A;  3RQE A;  4AX2 A;  3SXY A;  1WN0 A;  1CGO A;  4N6H A;  2Y3G A;  3X1O A;  2IBF A;  4JEB A;  3GAN A;  1A41 A;  1BR2 A;  4KNW A;  2XSE A;  1KU2 A;  4J7Y A;  3CSK A;  4W8P A;  3EGX A;  3DKA A;  3T4R A;  1HY5 A;  1RJ9 A;  1T01 A;  3UMI A;  1HW1 A;  1LE4 A;  2A1D D;  2XM4 A;  2X0C A;  3KPH A;  4YL0 A;  2L6G A;  2R7V A;  2QUP A;  2ASR A;  4A4A A;  4JTC B;  1JRA A;  5JUA A;  2YZS A;  3DAF A;  4FX5 A;  2LFF A;  3ZSU A;  4YT2 A;  5HV9 A;  2R7U A;  2MHR A;  1JPJ A;  5KYX B;  5JRA A;  4LAC B;  4EKW A;  2YL0 A;  2EIK C;  2L9J A;  4XLP F;  4LLC A;  4JTA B;  1B68 A;  3S84 A;  1G4W R;  3ZG1 A;  1YAR O;  4JZA A;  3RKO F;  1K05 A;  2J7P D;  1TWC A;  3SP1 A;  1MMD A;  1QSP A;  1LS4 A;  5T3T A;  2R7Q A;  1A7D A;  2VCA A;  4K7B A;  4H54 A;  5BUO A;  4I1M A;  3US6 A;  5L3V A;  3B9Q A;  3AG3 C;  2WVO A;  3C7J A;  3T6J A;  2XXA A;  1J8M F;  2OU6 A;  1DOV A;  3ZWI A;  4XLN F;  1E84 A;  2OQM A;  1KTM A;  2CYD A;  4CS9 C;  4BJ6 C;  2EPO A;  2AU5 A;  2DB4 A;  5B1B C;  3ZQV A;  1NU7 D;  2NSG A;  1R5I D;  3AOU A;  3DZA A;  4YN0 B;  5JVE A;  1M2V B;  3GEI A;  4D4X A;  1TR2 A;  4PK4 A;  5A6B A;  4MVU A;  2YHS A;  2IM8 A;  2AWY A;  2KYH A;  1Q0F A;  5T1D B;  4Z9I A;  3V7O A;  4DVY P;  2Q9B A;  2GA0 A;  3G4Z A;  4NY3 A;  3O6X A;  3EGD B;  3JSZ A;  3VRC A;  2DGJ A;  2ZXP A;  5A6K A;  3ATP A;  1VMA A;  3NKD A;  4WGZ A;  4UDV A;  1EA8 A;  2A6H F;  3CAX A;  1Z7Q c;  1VTM P;  1BDJ B;  4YL1 A;  4YL3 A;  3FDQ A;  1Q0M A;  1C03 A;  1SF8 A;  2UUH A;  3TQO A;  2VCC A;  2HJM A;  4U5E E;  3H2V A;  4O7G A;  3IEE A;  5DLJ A;  3SYN A;  4CBE A;  3TJ5 A;  1Z6A A;  3KYJ A;  5TJ5 E;  2Q7R A;  3WG7 C;  2XL8 A;  1OCR C;  3AGT A;  4R32 A;  4ZLC A;  1E85 A;  4ZLD A;  1F1M A;  1T5O A;  3O39 A;  3Q6M A;  3BRJ A;  4JVS A;  4IAO A;  1Z63 A;  5L0D A;  3ZTM A;  2CDQ A;  1LM3 B;  3I5Q A;  3KMI A;  2Q9C A;  3JT1 A;  3SXZ A;  3O55 A;  5AGF A;  4CS9 A;  4DXW A;  2H7O A;  4BJ6 A;  2HS5 A;  3M4C A;  1H9G A;  2YKZ A;  5E3C A;  4FES A;  1HMO A;  3QZC A;  1GM5 A;  2G3V A;  5KYY A;  2QNL A;  1ZVZ A;  4AE4 B;  3FAJ A;  4CDV A;  3ZTZ A;  5B3S C;  2HMQ A;  3ZIB A;  2A0U A;  1AUE A;  1OR3 A;  1ZU4 A;  4XEV A;  3MFN A;  4RBN A;  3U0C A;  5CI8 A;  3W4Y A;  2HV7 A;  5KYW B;  3DWW A;  1GQA A;  2C03 A;  4A2N B;  3H2U A;  1VLS A;  3LNM B;  1PD1 A;  1V55 C;  3C18 A;  2LSE A;  3GEH A;  1JMW A;  4IB4 A;  5E3A A;  4B6I A;  2UUI A;  5KYU A;  5D92 A;  3S0X A;  4O6Y A;  3B71 A;  2R25 A;  2FAP B;  2YRF A;  1FTS A;  2A68 F;  1LKX A;  2H7B A;  3N2Z B;  4IAR A;  2AVK A;  5F28 E;  4W8K A;  4E18 A;  2YQY A;  4YT8 A;  5K0I A;  4H4K C;  4XEK A;  3SXM A;  1M6T A;  3LS1 A;  1A7E A;  1D0Y A;  1WOL A;  1RJ9 B;  2LFD A;  2LK4 A;  3JSE O;  4G0H A;  2GWW A;  4CDA A;  2LQG A;  3RIP A;  1JOG A;  4JKV A;  4BG0 A;  2V3C C;  1V74 B;  3DXJ F;  2JX0 A;  3L0I A;  1MMN A;  4CJO A;  1RCP A;  1ZHX A;  2KNH A;  2Q9A A;  4EHP A;  1LVK A;  2ZPA A;  3H65 A;  1NBB A;  3POV A;  2XLO A;  4IGG A;  2R7X A;  1IZM A;  3CQZ A;  3KYI A;  2I15 A;  3C8G B;  4MTG A;  2GDC A;  2XLH A;  3NYL A;  3L8J A;  3NMK A;  3U9J A;  4E7S A;  2J0W A;  3IQC A;  2MYS A;  3O10 A;  5JSL A;  4WJ0 A;  4XWJ A;  3M15 A;  2D4U A;  1QQ3 A;  1Y4C A;  2NSF A;  2XS1 A;  1QZX A;  1LPE A;  3FHD A;  3HJC A;  3Q7G A;  3U9M A;  1H9T A;  3PMR A;  1CGM E;  1T6Q A;  1ZW3 A;  2HKV A;  3HNI A;  3NMJ A;  4G78 A;  1H7I A;  2XS8 A;  3HLZ A;  2RD9 A;  4EUK B;  2DYR C;  4HE8 D;  3JZ0 A;  2CNW A;  3U8V A;  2M4E A;  3DM5 A;  3JTL O;  2XXA B;  4K1O A;  2VB6 A;  5COG A;  4MVM A;  3LEV A;  2NUT A;  1BBH A;  3C63 A;  5JLI A;  5L0I A;  1AEP A;  1U6H A;  4E7Z A;  3S9O A;  3EJN A;  2R7T A;  1JPN A;  1U89 A;  2R03 A;  2EPN A;  2P7V A;  4DBR A;  2NUP A;  1MQV A;  3HKK A;  2X51 A;  1QKR A;  2ZXO A;  2OOC A;  2YL3 A;  1YLM A;  1ZHZ A;  4CIP A;  1Q0D A;  1J8Y F;  1SZI A;  3C8Z A;  3FOP A;  2JPU A;  4PJN A;  2J9U A;  1OCO C;  3G4X A;  3ABL C;  1PCX A;  3WHN A;  3S27 A;  4NC3 A;  5JT4 A;  2B0H A;  2OEV A;  1VYI A;  4X0R A;  4BJ5 C;  1YYX A;  3GOD A;  4OD5 A;  5DQZ A;  1EKY A;  1WWP A;  2P61 A;  3LLI A;  2ICW G;  1VYK A;  3NG1 A;  1YDI A;  4JW1 A;  2J45 A;  1FMV A;  4PFO A;  3V5Y A;  3W8I A;  4M63 A;  5BQH A;  3DMD A;  4G7O F;  1GGQ A;  1FFH A;  1YZC A;  2XLV A;  4D4N A;  1VOM A;  2XLD A;  5JS5 A;  5CIV A;  3S90 A;  3B0P A;  2NPU A;  4O6N A;  1FNT c;  2KSF A;  2R7O A;  2EIJ C;  3LEO A;  1M56 C;  2IYL D;  3B29 A;  4U5G A;  4MQ9 F;  4MVQ A;  1OKK D;  3EG9 B;  3W8H A;  1ZHY A;  3L34 A;  3KH2 A;  4WGY A;  3JYY A;  4ANJ A;  1YZA A;  2EIN C;  4WAB A;  1M2O A;  3OWT A;  3M1C B;  1FR0 A;  3T9O A;  3AJM A;  2LD6 A;  4G7Z F;  4IRU A;  4ULW A;  3B0U X;  4NTF A;  4XPY A;  2OKU A;  3DM9 B;  2J9W A;  3VM6 A;  3W2W A;  1V54 C;  2LIG A;  4CIH A;  4Q4Z F;  1WAS A;  4KC9 A;  3K66 A;  2JD3 A;  2PFD A;  1TKN A;  3EHN A;  1RMV A;  3QW0 A;  3TK0 A;  3IHU A;  4XPX A;  4YT4 A;  1TFK B;  3IQT A;  4P9F A;  4EBJ A;  1E2X A;  2VAS A;  2PNO A;  3GWN A;  1HE1 A;  2GAQ A;  4I44 A;  2PF4 E;  4C3E A;  2A69 F;  2L6F A;  3N24 A;  3B0V C;  2OJQ A;  4JCZ A;  4P6I C;  1D0Z A;  2EPL X;  1O5H A;  1TQG A;  2R9R B;  4BJ5 A;  4YWQ A;  2J0X A;  2Q4F A;  1NSG B;  1OCC C;  3QW1 A;  3W2V A;  4DBQ A;  2YL1 A;  3C8G D;  4KBL A;  3NRH A;  1RKE B;  5A6A A;  3ASO C;  2R05 A;  2EPK X;  1Z5Z A;  3K7D A;  2BC5 A;  3EHM A;  2LCH A;  2J9B A;  1G5Z A;  1Q0G A;  2Y3B A;  1D1C A;  4RDA A;  3RYL A;  4PR9 A;  3A11 A;  3KL4 A;  4MVO A;  4DJ9 A;  3I5P A;  5AC5 A;  2TMV P;  3ABK C;  3K33 A;  4CX9 A;  2G3K A;  3MLG A;  5KYN A;  2PBE A;  3EFO A;  2I8B A;  1ZU5 A;  3GEE A;  2W4B A;  1LS1 A;  3U3F A;  1MNE A;  1R4T A;  1TWH A;  2R7S A;  1N1C A;  4CJG A;  1L7C A;  3JCU Q;  5T3W A;  3LUT B;  3V5X A;  2ZXW C;  1ORY A;  3DD7 A;  4CDY A;  5L0H A;  1HE9 A;  4NQF A;  2QLA A;  5L0G A;  4C7O B;  1C02 A;  4Z9J A;  1SR2 A;  3L8I A;  3OA1 A;  4CS7 A;  3MYF A;  1NFO A;  2OJE D;  4U9E A;  3K1H A;  4FWV A;  4EBB A;  1I4Y A;  4OIR F;  5EHH A;  3PDM P;  4AL0 A;  4MTF A;  2YVK A;  4KNV A;  4XEF A;  3V5Z A;  4XQ1 A;  5L3Q A;  1VK5 A;  1FMW A;  4OIN F;  1HMD A;  1Q0K A;  1T9K A;  4MW3 A;  1CPQ A;  1KNY A;  3JYH A;  2NUT B;  1YA9 A;  3EGD A;  3EGX B;  2VC9 A;  1C17 M;  1QPU A;  3UGP A;  1XWJ A;  3IPM O;  3RH3 A;  2QTV A;  3HNJ A;  3DJN B;  2A6E F;  4ONS A;  3ZQY A;  2HSQ A;  2EIL C;  3EH1 A;  4DRJ B;  5D91 A;  3ABM C;  1PD0 A;  2FGY A;  2Q3T A;  4G7H F;  4PJL A;  4BJT A;  1K04 A;  4Z9H A;  4LDR A;  4IJJ A;  4OD4 A;  3VAY A;  1GS9 A;  2D5R B;  5A69 A;  2WZG A;  4ER9 A;  2MWQ A;  2FFH A;  2Z15 A;  2RSE B;  3I4U A;  3RVZ A;  4N6C A;  1SMY F;  4PJM A;  3CZ6 A;  5FCL A;  1M57 C;  3R7C A;  5HSW A;  1ZZP A;  2J7P A;  2LP4 A;  1EI7 A;  2WVN A;  3TUL A;  1OW7 A;  3GM2 A;  2F22 A;  2IXP A;  1T6U A;  3K6B A;  2H8A A;  2ZD9 A;  4MND A;  4Q5S F;  4I3M A;  1ST6 A;  1ZHT A;  1Z3I X;  4JJF A;  2XLM A;  2KGO A;  1YYJ A;  2YLG A;  2HSB A;  1WGW A;  2AP3 A;  4BEJ A;  2DI3 A;  4OIQ F;  4JCH A;  3LS0 A;  1ZHW A;  3VYW A;  1WAT A;  2BE5 F;  2VH3 A;  3QMK A;  5A6J A;  5IY5 C;  1K40 A;  5DS5 A;  1OKK A;  4N06 A;  2BL2 A;  1Z23 A;  4YK5 A;  1VB5 A;  2Y39 A;  2YWA A;  3RVY A;  5BQG A;  3LES A;  3TOM A;  1S05 A;  1OW8 A;  2IXM A;  3GWL A;  1NLX A;  4BEM J;  1LE2 A;  2W45 A;  3L1M A;  4I1O B;  4E0I A;  3EQL F;  3S28 A;  4JC7 A;  4MTO A;  1TFO B;  2Y69 C;  3LJB A;  3ZVR A;  5B3I A;  4CSA C;  2HMZ A;  2E87 A;  4O79 A;  1O87 A;  3FVY A;  2HZ8 A;  4EBK A;  2OEX A;  1W2W A;  1QLE C;  2J8W A;  1OQC A;  4QI0 A;  1A7V A;  2CCY A;  2IOQ A;  4RD9 A;  3RFY A;  2XL4 A;  3RQG A;  3QVZ A;  4JUR I;  3K1I C;  1QVX A;  2H7V C;  4U5C E;  3AGU A;  4BPM A;  4F4B A;  1G4U S;  1D0X A;  1YJG A;  1FFT C;  2L7A A;  2L6H A;  1U0B B;  1Y6D A;  4J32 B;  3UGO A;  4JRZ A;  2KQ9 A;  1PV3 A;  2CW0 F;  2XLE A;  1OXK A;  3RQF A;  3EPV A;  1APC A;  4E0H A;  2KJG A;  3EH2 A;  2XLW A;  3FMS A;  4L6R A;  4O6M A;  3TJ6 A;  2P6V A;  5DS6 A;  1FAP B;  1RXQ A;  1XZQ A;  2QY9 A;  3C8G A;  3QTH A;  4HEA J;  1BR1 A;  4U5D E;  3AG2 C;  3Q7L A;  3NYJ A;  3NYM A;  4LER A;  5DVW A;  3IQ5 A;  3NMI A;  2C04 A;  2J46 A;  3TOL A;  3JRM O;  3OEO A;  3UMK A;  2XRH A;  3DI5 A;  5L0F A;  5KYY B;  3EFO B;  3AG4 C;  4AL1 A;  2CNW D;  3FAP B;  1BR4 A;  2KW3 C;  3EZH A;  5CI9 A;  1MMG A;  1MMA A;  2WB7 A;  2A0B A;  1OXB A;  4DRH B;  3PCV A;  1MND A;  4OIP F;  3DAG A;  3ZDL A;  4C3B A;  4JJG A;  3MX3 A;  4EIY A;  4CSA A;  4QDL A;  4K0D A;  3X2Q C;  1JAF A;  4GEH A;  4MW8 A;  3AQC A;  3VF0 A;  5COF A;  4CS8 C;  5KYU B;  1OW6 A;  2V26 A;  1D1A A;  2W4M A;  4HFK B;  2DYS C;  2ETS A;  4YT5 A;  3K1I A;  5B1A C;  3SEO A;  1XZP A;  4DOZ A;  1IW7 F;  3G50 A;  3R2P A;  4PAC A;  1DOW A;  3S29 A;  4FAP B;  3HNL A;  5KYX A;  1G8X A;  2YEV A;  3C62 A;  3GOR A;  4MS2 A;  4U9D A;  3TD7 A;  4C3D A;  3LLK A;  4EWC A;  3PHF 2;  1EQ1 A;  1D1B A;  3HTK C;  3FOO A;  4XPW A;  4KI2 A;  1UG7 A;  3U5S A;  3M4B A;  3E70 C;  1I4Z A;  2XM0 A;  1NZE A;  4U5F E;  3SNH A;  1E86 A;  3NDB B;  5E33 A;  2OG2 A;  1YA7 O;  1LI7 A;  1ORS C;  3MYI A;  1LIH A;  1H6G A;  1OCZ C;  3DE8 A;  3IQ6 A;  1I5N A;  4MVR A;  3GM3 A;  2G62 A;  2O9X A;  5EGY A;  2HJ3 A;  3WAQ A;  1S7Z A;  3UR3 C;  2B0J A;  4LLE A;  3UNG C;  1T6I A;  2P0N A;  3U2M A;  1BZ4 A;  1JR8 A;  256B A;  2PX3 A;  2YLD A;  3E9V A;  3EG9 A;  3M79 A;  3MBG A;  1A0B A;  1ZW2 A;  2CGE A;  3NKE A;  3SZR A;  5F5H A;  3WOD F;  4QI2 A;  2Y3D A;  4OIO F;  1SYQ A;  3EZI A;  5AC4 A;  1WTY A;  4MVZ A;  2ZXR A;  4DRI B;  4DVZ A;  1M2V A;  3ITF A; 
#chains in the Genus database with same CATH homology
 4U5B E;  4CS8 A;  2WZL A;  2OCC C;  3ZC4 A;  2L81 A;  5F5F A;  3AQB A;  3ECS A;  3ASN C;  4U5H A;  3UMH A;  2WZF A;  3DJU B;  4PJJ A;  4BJ1 A;  2R7R A;  2IXO A;  2NUP B;  2GFH A;  3F46 A;  2IXN A;  4Q7C A;  2W9Y A;  5DS4 A;  3T6B A;  1ZYR F;  5E2Q A;  2EIM C;  4J30 B;  4XTK A;  3AG1 C;  2PP4 A;  4HFF B;  3LAY A;  2J9V A;  1NG1 A;  2NG1 A;  2Y3H A;  4AK9 A;  4AE4 A;  4PFP A;  3JRT A;  2R7W A;  4YJW A;  1TWG A;  2PX0 A;  2WL8 A;  4IWB A;  5KYW A;  1TWA A;  3Q6N A;  3F47 A;  2WVQ A;  4GYT A;  4C7O A;  3LNR A;  5DQT A;  1NU9 C;  3N0T A;  2HV6 A;  3KKB A;  4AX2 A;  2Y3G A;  3X1O A;  3GAN A;  1BR2 A;  4KNW A;  2XSE A;  1KU2 A;  3CSK A;  3T4R A;  3EGX A;  1RJ9 A;  3UMI A;  2A1D D;  2R7V A;  2YZS A;  3DAF A;  4FX5 A;  3ZSU A;  4YT2 A;  2R7U A;  1JPJ A;  5KYX B;  4LAC B;  2EIK C;  2L9J A;  4XLP F;  4LLC A;  3ZG1 A;  4JZA A;  3RKO F;  2J7P D;  3SP1 A;  1TWC A;  1MMD A;  5T3T A;  2R7Q A;  4K7B A;  5BUO A;  4I1M A;  5L3V A;  3B9Q A;  3AG3 C;  2WVO A;  3T6J A;  2XXA A;  1J8M F;  4XLN F;  4CS9 C;  4BJ6 C;  5B1B C;  1NU7 D;  3DZA A;  4YN0 B;  1M2V B;  1TR2 A;  4PK4 A;  2YHS A;  5T1D B;  3V7O A;  4DVY P;  2Q9B A;  4NY3 A;  3O6X A;  3EGD B;  3JSZ A;  2DGJ A;  2ZXP A;  1VMA A;  3NKD A;  2A6H F;  3FDQ A;  1SF8 A;  4U5E E;  4O7G A;  3IEE A;  5DLJ A;  3SYN A;  4CBE A;  1Z6A A;  3WG7 C;  4ZLC A;  4ZLD A;  1OCR C;  3O39 A;  3Q6M A;  4JVS A;  4IAO A;  1Z63 A;  2CDQ A;  3I5Q A;  3KMI A;  2Q9C A;  3JT1 A;  4CS9 A;  2H7O A;  4BJ6 A;  5E3C A;  4FES A;  3QZC A;  2G3V A;  5KYY A;  4AE4 B;  3FAJ A;  5B3S C;  3ZIB A;  1ZU4 A;  4RBN A;  5CI8 A;  2HV7 A;  5KYW B;  2C03 A;  4A2N B;  1PD1 A;  1V55 C;  4B6I A;  2LSE A;  5E3A A;  3S0X A;  5KYU A;  5D92 A;  4O6Y A;  1FTS A;  2A68 F;  1LKX A;  2H7B A;  3N2Z B;  4YT8 A;  4W8K A;  4H4K C;  3LS1 A;  1D0Y A;  1RJ9 B;  4G0H A;  3RIP A;  4BG0 A;  2V3C C;  3DXJ F;  3L0I A;  1MMN A;  1ZHX A;  2KNH A;  2Q9A A;  1LVK A;  2ZPA A;  3H65 A;  3POV A;  2R7X A;  1IZM A;  3CQZ A;  4E7S A;  3NYL A;  2J0W A;  2MYS A;  4WJ0 A;  4XWJ A;  4ANJ A;  3Q7G A;  3HJC A;  1QZX A;  3B0U X;  3FHD A;  3PMR A;  3HLZ A;  2DYR C;  4HE8 D;  2CNW A;  2M4E A;  3DM5 A;  2XXA B;  2VB6 A;  2NUT A;  3LEV A;  4E7Z A;  3EJN A;  2R7T A;  1JPN A;  2P7V A;  4DBR A;  2NUP A;  2X51 A;  2ZXO A;  1ZHZ A;  1SZI A;  1J8Y F;  4PJN A;  2J9U A;  1OCO C;  3ABL C;  1PCX A;  3S27 A;  1VYI A;  4X0R A;  4BJ5 C;  4OD5 A;  3GOD A;  5DQZ A;  3LLI A;  4JW1 A;  1VYK A;  3NG1 A;  4PFO A;  2J45 A;  1FMV A;  3W8I A;  4G7O F;  4M63 A;  3DMD A;  1FFH A;  1VOM A;  3B0P A;  4O6N A;  2R7O A;  2EIJ C;  1M56 C;  2IYL D;  4U5G A;  4MQ9 F;  1OKK D;  3EG9 B;  3W8H A;  1ZHY A;  3L34 A;  3KH2 A;  2EIN C;  1M2O A;  3OWT A;  3M1C B;  4G7Z F;  4IRU A;  4ULW A;  3DM9 B;  2J9W A;  3W2W A;  1V54 C;  4CIH A;  4Q4Z F;  4KC9 A;  3K66 A;  2JD3 A;  2PFD A;  1TKN A;  3EHN A;  4YT4 A;  2VAS A;  4I44 A;  2PF4 E;  4C3E A;  2A69 F;  3N24 A;  3B0V C;  4P6I C;  1D0Z A;  1O5H A;  4BJ5 A;  4YWQ A;  2J0X A;  1OCC C;  3W2V A;  4DBQ A;  4KBL A;  3NRH A;  3ASO C;  1Z5Z A;  3K7D A;  3EHM A;  2Y3B A;  1D1C A;  4RDA A;  3RYL A;  3KL4 A;  3I5P A;  3ABK C;  3K33 A;  2G3K A;  3MLG A;  5KYN A;  3EFO A;  2I8B A;  1ZU5 A;  2W4B A;  1LS1 A;  1TWH A;  1MNE A;  2R7S A;  1N1C A;  5T3W A;  3JCU Q;  2ZXW C;  3DD7 A;  4C7O B;  3OA1 A;  4CS7 A;  3K1H A;  4FWV A;  4EBB A;  5EHH A;  4OIR F;  4KNV A;  5L3Q A;  1VK5 A;  1FMW A;  4OIN F;  3JYH A;  2NUT B;  3EGD A;  3EGX B;  3UGP A;  3RH3 A;  2QTV A;  3DJN B;  2A6E F;  3EH1 A;  2EIL C;  5D91 A;  3ABM C;  1PD0 A;  2FGY A;  2Q3T A;  4G7H F;  4PJL A;  4BJT A;  4IJJ A;  4OD4 A;  3VAY A;  2D5R B;  2WZG A;  2MWQ A;  2FFH A;  2Z15 A;  3I4U A;  4PJM A;  1SMY F;  3CZ6 A;  5FCL A;  1M57 C;  5HSW A;  2J7P A;  2WVN A;  2IXP A;  3K6B A;  4MND A;  4Q5S F;  4I3M A;  1ST6 A;  1ZHT A;  1Z3I X;  4JJF A;  2KGO A;  1WGW A;  4BEJ A;  4OIQ F;  4JCH A;  3LS0 A;  1ZHW A;  3VYW A;  2BE5 F;  3QMK A;  2VH3 A;  5IY5 C;  5DS5 A;  1OKK A;  4N06 A;  1Z23 A;  2Y39 A;  3LES A;  2IXM A;  2W45 A;  4I1O B;  3EQL F;  3S28 A;  2Y69 C;  3LJB A;  3ZVR A;  4CSA C;  2E87 A;  4O79 A;  1O87 A;  3FVY A;  1W2W A;  1QLE C;  4QI0 A;  4RD9 A;  2IOQ A;  3RFY A;  2XL4 A;  4JUR I;  4U5C E;  3K1I C;  2H7V C;  4F4B A;  1D0X A;  1FFT C;  4J32 B;  3UGO A;  2KQ9 A;  2CW0 F;  3EPV A;  2KJG A;  3EH2 A;  4O6M A;  2P6V A;  5DS6 A;  2QY9 A;  4HEA J;  4U5D E;  1BR1 A;  3AG2 C;  3Q7L A;  3NYJ A;  3NYM A;  4LER A;  5DVW A;  2C04 A;  2J46 A;  3OEO A;  3UMK A;  2XRH A;  5KYY B;  3EFO B;  3AG4 C;  2CNW D;  1BR4 A;  2KW3 C;  3EZH A;  5CI9 A;  1MMG A;  1MMA A;  2WB7 A;  1MND A;  4OIP F;  3DAG A;  4C3B A;  4JJG A;  3MX3 A;  4CSA A;  4QDL A;  4K0D A;  3X2Q C;  4GEH A;  3AQC A;  5KYU B;  4CS8 C;  2V26 A;  2W4M A;  1D1A A;  4HFK B;  4YT5 A;  2DYS C;  5B1A C;  3SEO A;  4DOZ A;  1IW7 F;  3S29 A;  5KYX A;  1G8X A;  2YEV A;  3PHF 2;  3TD7 A;  4C3D A;  3LLK A;  4EWC A;  1D1B A;  3HTK C;  4KI2 A;  3E70 C;  4U5F E;  1NZE A;  3SNH A;  3NDB B;  5E33 A;  2OG2 A;  1OCZ C;  2G62 A;  2O9X A;  5EGY A;  1S7Z A;  3UR3 C;  2B0J A;  4LLE A;  3UNG C;  2PX3 A;  3SZR A;  3E9V A;  3EG9 A;  3NKE A;  5F5H A;  3WOD F;  2CGE A;  4QI2 A;  2Y3D A;  4OIO F;  3EZI A;  2ZXR A;  4DVZ A;  1M2V A;  3ITF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...