4U5HA

Crystal structure of con-ikot-ikot toxin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
85
structure length
85
Chain Sequence
GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Con-ikot-ikot
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Conus striatus
molecule tags Toxin
total genus 29
structure length 85
sequence length 85
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5hA00
4U5DE 4U5HA 4U5FE 4U5BE 4U5EE 4U5GA 4U5CE
chains in the Genus database with same CATH superfamily
1KU2A 2YLDA 3TULA 1FMVA 1T6UA 1BDJB 1MMAA 3ECSA 3EFOB 2YL1A 1RKCA 3IQ6A 2YQYA 3K33A 1Q0DA 5IY5C 3EHMA 2WZFA 4H54A 2JD3A 2FAPB 2R05A 1FTSA 2R9RB 3GM3A 4O7GA 4BJ6A 4OIOF 3DXJF 3HKKA 4J32B 3ZTZA 3EJNA 1YARO 4JCHA 3MLGA 4MVQA 3EGXB 5L0CA 1TKNA 3QW1A 4JJGA 2MWQA 2ZXRA 4DRHB 3Q6MA 4R32A 3F46A 4IGGA 4A4AA 2XS1A 3C62A 4XPYA 2I8BA 1C17M 3EH2A 4HFFB 2D5RB 4PACA 3K1HA 1PV3A 1OCCC 1TWAA 4PJLA 4C7OA 2QTVA 2EIJC 5E3AA 2I15A 4MVUA 2LFFA 3M1CB 1Q0MA 3JCUQ 1LM3B 4CJGA 4E17A 4JVSA 4EBJA 5KYYA 2YWAA 4JW1A 1TFKB 3NMKA 5AGFA 1RJ9A 1UG7A 4C3EA 4MS2A 3EG9A 2CDQA 5EGYA 4KBLA 3ZTMA 3SXKA 3ABMC 3WG7C 1T6QA 1EI7A 3T6GB 1TWHA 3Q7LA 1OKKA 1YA7O 3LAYA 4QI0A 2J7PD 4LLEA 3RKOF 4FWVA 2X51A 5A6JA 5KYUA 3DE8A 3K6BA 2Q3TA 1ORYA 2KGOA 4E0IA 1R4TA 4P9TA 5HV9A 1ST6A 2XL8A 4LDKA 3QTHA 1R5ID 2C03A 4KNWA 3NG1A 3SP1A 4E7ZA 2CNWD 4CSAC 1YDIA 1BBHA 2NUPA 3VM6A 2XXAA 3DM9B 4CIPA 2WZGA 1Z63A 2A68F 1K05A 4JIOA 3PMRA 3IQCA 1A0BA 1PCXA 2YLIA 2EPNA 4QDLA 3U2MA 2VASA 3L8IA 1FR0A 3JSZA 2XRHA 4IARA 2P1AA 2TMVP 3L34A 4MVOA 2DYRC 2H7VC 4LACB 2PNOA 4BJ5A 1I5NA 1B68A 3G50A 3HTKC 1H9TA 5L0HA 4Q5SF 5F5FA 3N24A 4YT8A 2W45A 1A7DA 4IAQA 2XLWA 3O10A 2YL0A 4P6IC 3K1IC 3TOMA 2OU6A 2OEVA 4HEAJ 3DWWA 3Q7GA 2JPUA 4NC3A 1J8YF 5AC4A 2L6GA 1VB5A 4ER9A 2A0UA 4U5FE 1LE4A 1OXBA 2EIKC 2EPKX 1NZEA 3ASOC 3B9QA 3C8GB 4U5GA 5E33A 3ZDLA 2V3CC 2R7SA 3LJBA 4QI2A 1DOVA 1L3PA 5CIVA 4CBEA 1CGME 1MMDA 4PJMA 3DKAA 1BZ4A 1RMVA 3M4BA 3DAGA 4CS8A 3UGOA 5EK0A 1M2VA 3B0VC 2KSFA 4Z9IA 2ZXOA 4P9FA 4EIYA 4DJ9A 5B3SC 4KC9A 4YT4A 2EPMX 3BEHA 5A69A 4E18A 2DB4A 1E86A 2WB7A 1LI5A 4XQ1A 3Q6NA 1FFHA 1ZHTA 2IXNA 3GM2A 4NTAA 1C02A 2J7PA 2M64A 5D91A 2PP4A 3ABKC 3AQBA 3ZG1A 1WN0A 2G3VA 2Q4FA 1ZW3A 4AE4B 1S05A 2A69F 3B29A 5L0DA 3RQFA 3IQ5A 3RVYA 2IM8A 4EWCA 3FOPA 3HNKA 1WASA 1TWGA 2CNWA 4Z9HA 2RD9A 3GEHA 3AOUA 2LIGA 4PFOA 3G4ZA 4O79A 1LI7A 1FAPB 4RBNA 3ZQVA 2HMQA 3NDBB 3A9CA 1FFTC 1ZHWA 1OCOC 2KC3A 3JRTA 1SR2A 2R7QA 1Y4CA 2VH3A 2RSEB 1LPEA 1ZZPA 3DAFA 5L0JA 3CAXA 3HNJA 3UR3C 2IOQA 1BR4A 3ZC4A 4BPMA 2BE5F 4W8PA 4XLNF 1V4AA 3KYIA 1L7CA 3DMDA 1LS4A 3IPMO 3JZ0A 4U5CE 5KYWA 5A6BD 1WOLA 4CDYA 4BEMJ 3PDMP 5DS4A 3US6A 1U0BB 1Q0FA 1JOGA 3V5YA 5T1DB 1LS1A 4NY3A 2PFDA 3I5PA 3EGDB 3JYYA 1HW2A 1VYKA 3ASNC 1QVXA 2OKUA 1RCPA 1VMAA 2XM0A 1NSGB 2ZXWC 2LQGA 2ZD9A 4IJJA 4MW3A 3VYWA 3M15A 1YZCA 4K0DA 5HSWA 3MBGA 4Q4ZF 1PD1A 1GQAA 2GA0A 3NRHA 5FZTA 1M57C 2HZ8A 4C3BA 1RXQA 4U5HA 1QPUA 2HSBA 1TFOB 4N6HA 4ZLDA 4N06A 4O6MA 3SXYA 3QMKA 4YN0B 2KYHA 2P7VA 3AG3C 3GEIA 2AWYA 2Y39A 3B0PA 3U3BA 4JTCB 3W4YA 4WABA 4ULVA 4E7SA 5JS5A 4CDVA 2YEVA 1JPJA 2GAQA 2F22A 3ZWIA 4N4WA 3WAQA 4YL1A 1U89A 4G7ZF 3NYLA 2WVOA 1ZYRF 3HNLA 2Y3BA 4W8KA 3X1OA 3GWNA 3F47A 4LDQA 3S9OA 3EZHA 2OQMA 3U8PA 3RIPA 3OA1A 4ONSA 3U9JA 2Q9AA 1Z23A 2YZSA 1O87A 1F1MA 1T9KA 3AG1C 2QE9A 1ORJA 1YVIA 1H7IA 1H9GA 5COGA 2ETSA 3O39A 4JKVA 4NQFA 3RFYA 1C03A 5BQIA 1XZPA 1H6GA 4G7HF 5BQHA 1Y6DA 1G8XA 4MVZA 4E0HA 2W4MA 4G78A 1Z5ZA 4MTFA 4DXWA 3U0CA 2NSFA 4U5DE 4LLCA 4MNDA 4YL0A 3RW0A 2YKZA 2WVNA 1VOMA 3QW0A 1MMNA 5DQZA 1QKRA 2DI3A 5DLJA 2J45A 2NUTB 1GGQA 1O3UA 1ORSC 5A6BA 4XLPF 3JYHA 3VRCA 3EQLF 3E70C 3I4UA 4CS7A 1E83A 2GFHA 2W4BA 3LNRA 1G4US 3LS1A 4L6RA 5D92A 5JP7A 1A7EA 4JTAB 5JSLA 3G4XA 3NMIA 2J0WA 3TD7A 4OIPF 2LFDA 4BJTA 2OG2A 4MW8A 5CI9A 2G3KA 4IWBA 5DVWA 3HJCA 4AX2A 4DBRA 4U5EE 5JLIA 1NBBA 3ATPA 4NTBA 4XEFA 1HW1A 2O9XA 3H2UA 1T5OA 3JRMO 2NG1A 1LVKA 2ICWG 3C63A 4ULWA 3AGUA 4K7BA 4O6NA 5A6KA 1K40A 3T9OA 2R02A 5KYXA 2VC9A 4IRUA 1E84A 3E9VA 1WWPA 1A41A 4DVZA 2WZLA 5TJ5E 4DVYP 2HV7A 2L6HA 1MMGA 5E2QA 4BEJA 4DRIB 2YL3A 2A6EF 4NTFA 1NU7D 3NKEA 4EBKA 1CGOA 1D0ZA 1NU9C 2Y3DA 3EGDA 2ASRA 4PJNA 4CS8C 2Q9CA 5K0IA 5B1BC 3N0TA 1JAFA 3EFOA 4MVRA 3S27A 1IW7F 4AL1A 4YT2A 3B71A 2HS5A 3BRJA 3DJUB 4EHPA 5DS5A 3T6JA 2HJMA 1OR2A 1HE9A 1ZU5A 3GANA 2H7OA 2VCAA 2V26A 4A2NB 4G7OF 4XEVA 3POVA 1UFBA 2L9JA 2CCYA 4ZLCA 2HFIA 2LP4A 4DBQA 2PX0A 3EGXA 3KMIA 3SNHA 1QLEC 1VYIA 2Q00A 4GYTA 2HV6A 3U9MA 2HJ3A 1I4ZA 1JMWA 4KI2A 2XL4A 3SYNA 2WL8A 1V55C 1HE1A 3C8GD 2XLDA 2ZXPA 3CQZA 5KYNA 2R7OA 2YLGA 3K1IA 2R7VA 1Q0KA 2QLAA 5CI8A 4YWQA 4WJ0A 3KYJA 2EPLX 3NKDA 5GPGB 4UDVA 2FFHA 3GWLA 4C7OB 1SYQA 2EPOA 2L6FA 2IXPA 1A7VA 5F28E 5KYYB 1MQVA 1ZU4A 1FMWA 1RJ9B 3QZCA 2XLOA 4J30B 2XS8A 4EUKB 1JPNA 5FCLA 2QUPA 3EG9B 4JURI 2P6VA 4N6CA 4PR9A 4MTGA 2IYLD 2VCBA 4PJJA 3RYLA 1XWJA 2UUHA 4IB4A 1T01A 3ZIBA 5BUOA 4PK4A 1NFOA 2CYDA 4J7TA 5JVEA 3W2VA 1HMOA 2YHSA 4CX9A 4ANJA 3H2VA 4C3DA 256BA 1D0YA 3HLZA 5JUAA 3M4CA 3ABLC 1MNDA 2LK4A 4JRZA 3S28A 1LKXA 3AJMA 4D4NA 1KTMA 2WVQA 4AK9A 1KNYA 2YVKA 4OIRF 3PCVA 2XXAB 2NUPB 4CDAA 4JTDB 1OR3A 1GM5A 3L8JA 2D4UA 1Z7Qc 4AL0A 5EHHA 4XWJA 1CPQA 1LIHA 2EILC 2XLHA 3EPVA 1Z3IX 4BJ6C 1D1BA 1AVOB 3VAYA 2Y3HA 3M79A 2AVKA 3OWTA 5L0GA 3S0XA 1WTYA 1TQGA 3W8HA 3A11A 4WGZA 2A0BA 4CS9A 1NLXA 3IEEA 2X0CA 2AWCA 2L7AA 3J06A 1ZHZA 5F5HA 3MX3A 2AP3A 4CJOA 2BC5A 2EINC 2G62A 2QY9A 3O55A 3KL4A 4KNVA 3C7JA 2R7TA 1T6IA 3VF0A 4Q7CA 4XTKA 1D1CA 3C8ZA 2QNLA 4HE8D 4OD4A 3KKBA 2ZPAA 3OEOA 3C8GA 3UMHA 1PD0A 2H8AA 4U9DA 3HNIA 3MFNA 3V7OA 4I3MA 3FXHA 1TR2A 3TK0A 4CIHA 1SZIA 5A6AA 4PFPA 4I44A 3RQGA 3T6BA 1M2VB 4OINF 2R7UA 5JT4A 3UGPA 1VK5A 2GDCA 2J9UA 4OD5A 2PBEA 3DI5A 3IQTA 2PX3A 2J8WA 2OEXA 1IZMA 3RH3A 3T4RA 3EH1A 4MVMA 4JEAA 3S90A 4NCQA 2CGEA 2LSEA 1J8MF 1SMYF 2HUJA 2KW3C 3LEVA 3LLIA 1W2WA 4JEBA 4JC7A 3TJ5A 1U6HA 3UMKA 2HMZA 3K66A 1D0XA 2AU5A 4AE4A 4OIQF 3TQOA 5COMA 1MNEA 3JTLO 3SXZA 4O6YA 3V5ZA 1FNTc 2YL7A 1RKEB 1CPRA 4XPXA 4BJ5C 3K7DA 1NG1A 3DJNB 2Q9BA 3NYJA 3R2PA 3LUTB 2HKVA 1BR1A 2J9BA 1DOWA 3C18A 1ZVZA 2BL2A 2IXMA 1HMDA 2GWWA 2OCCC 4YL3A 2XLMA 3SXMA 3LNMB 2Y69C 4GEHA 3X2QC 3ZQYA 2P61A 1YLMA 1BR2A 2A6HF 3MYIA 2UUIA 3UNGC 3QVYA 3RVZA 1EKYA 3GORA 4RD9A 3WHNA 3IHUA 2EIMC 5KYWB 3QVZA 4I1MA 4MQ9F 3ITFA 1M56C 3LLKA 4M63A 1NFNA 1V54C 4YK5A 3EZIA 5AC5A 4YJWA 3PHF2 3TJ6A 5L0IA 1K04A 2KNHA 1YYJA 3AG2C 1GS9A 1OW7A 2XM4A 2LCHA 1VTMP 2VCCA 3R7CA 1WGWA 1YJGA 1APCA 4CSAA 1OCRC 2NSGA 3FAJA 1O5HA 4XPWA 5E3CA 1QZXA 5T3WA 2J9WA 3AQCA 4IAOA 2JX0A 3S84A 3U2LA 5L3QA 2YRFA 2CW0F 4B6IA 2R7XA 4G0HA 3O6XA 2R7RA 3L0IA 3FOOA 2R7WA 2J0XA 1HY5A 2R25A 4JZAA 4D4XA 3L1MA 2OJED 4JJFA 4X0RA 2J46A 3DZAA 2H7BA 1I4YA 3KH2A 1LE2A 5L3VA 1M6TA 3B0UX 2MHRA 2VB6A 1YZAA 3EHNA 3GM1A 4HFKB 3RQEA 1G4WR 3U5SA 3ZVRA 3LS0A 3AG4C 1E85A 3N2ZB 4GQHA 2J9VA 1V74B 1WATA 3CZ6A 4MVSA 3H65A 2DYSC 3TOLA 1JRAA 1CGNA 4MTOA 4XEKA 4LDRA 1EQ1A 3FVYA 1E2XA 1TWCA 4U9EA 1JR8A 3DM5A 1OXKA 2Z15A 2DGJA 1QSPA 2Y3GA 3FDQA 3DD7A 2LD6A 2XLEA 3GEEA 2IBFA 4EKWA 2KQ9A 3S29A 5B3IA 1M2OA 3CSKA 1Z6AA 1D1AA 4K1OA 1YA9A 1N1CA 5KYUB 2P0NA 2Q7RA 3FMSA 3I5QA 2KK1A 4F4BA 2XSEA 3W2WA 3FAPB 3W8IA 5COFA 2M4EA 2XL6A 4J7YA 4EBBA 3FHDA 1OQCA 4WGYA 2FGYA 2W9YA 2C04A 3LEOA 3NYMA 4RDAA 2OJQA 1VLTA 2NUTA 4DRJB 1OW8A 2OOCA 5DS6A 1OCZC 2PF4E 2R03A 3DE9A 1ZW2A 4I1OB 3SEOA 1S7ZA 3V5XA 1RKEA 3U3FA 3MYFA 4FESA 3ZSUA 4FAPB 1YYXA 1ZHXA 3CEXA 1QQ3A 1OW6A 4CS9C 4BG0A 1OKKD 3JSEO 4FX5A 5DQTA 2A1DD 2B0JA 5L0FA 1AUEA 4BJ1A 3AGTA 2B0HA 4LERA 5T3TA 4DOZA 2NPUA 1VLSA 1ZHYA 5B1AC 1XZQA 5JRAA 2KJGA 3NMJA 2L81A 1SF8A 4Z9JA 3U8VA 3UMIA 5KYXB 4U5BE 4JCZA 3WODF 2E87A 5BQGA 1AEPA 2IXOA 2HSQA 3JT1A 2MYSA 3KPHA 4H4KC 1G5ZA 1YAUO 3GODA 4YT5A 3LESA 3RF3A 3SZRA 1EA8A 1Q0GA 4JE9A 2XLVA
chains in the Genus database with same CATH topology
1KU2A 1FMVA 1MMAA 3ECSA 3EFOB 3K33A 5IY5C 3EHMA 2WZFA 2JD3A 4O7GA 1FTSA 4BJ6A 4OIOF 3DXJF 4J32B 3EJNA 4JCHA 3MLGA 3EGXB 1TKNA 4JJGA 2MWQA 2ZXRA 3Q6MA 3F46A 2I8BA 3EH2A 4HFFB 2D5RB 3K1HA 1OCCC 1TWAA 4PJLA 4C7OA 2QTVA 2EIJC 5E3AA 3M1CB 3JCUQ 4JVSA 5KYYA 4JW1A 1RJ9A 4C3EA 5EGYA 3EG9A 2CDQA 4KBLA 3ABMC 3WG7C 1TWHA 3Q7LA 1OKKA 3LAYA 4QI0A 2J7PD 4LLEA 3RKOF 4FWVA 2X51A 5KYUA 3K6BA 2Q3TA 2KGOA 1ST6A 2C03A 4KNWA 3NG1A 3SP1A 4E7ZA 2CNWD 4CSAC 2XXAA 2NUPA 3DM9B 2WZGA 1Z63A 2A68F 3PMRA 1PCXA 4QDLA 2VASA 3JSZA 2XRHA 3L34A 2DYRC 2H7VC 4LACB 4BJ5A 3HTKC 5F5FA 3N24A 4YT8A 2W45A 4P6IC 3K1IC 4HEAJ 3Q7GA 1J8YF 4U5FE 2EIKC 3ASOC 3B9QA 1NZEA 4U5GA 5E33A 2V3CC 2R7SA 4QI2A 3LJBA 4CBEA 1MMDA 4PJMA 3DAGA 4CS8A 3UGOA 1M2VA 3B0VC 2ZXOA 5B3SC 4KC9A 4YT4A 2WB7A 3Q6NA 1FFHA 1ZHTA 2IXNA 5D91A 2J7PA 2PP4A 3ABKC 3AQBA 3ZG1A 2G3VA 4AE4B 2A69F 4EWCA 1TWGA 2CNWA 4PFOA 4O79A 4RBNA 3NDBB 1FFTC 1ZHWA 1OCOC 3JRTA 2R7QA 2VH3A 3DAFA 3UR3C 2IOQA 1BR4A 3ZC4A 2BE5F 4XLNF 3DMDA 4U5CE 5KYWA 5DS4A 5T1DB 1LS1A 4NY3A 2PFDA 3I5PA 3EGDB 1VYKA 3ASNC 1VMAA 2ZXWC 4IJJA 3VYWA 4K0DA 5HSWA 4Q4ZF 1PD1A 3NRHA 1M57C 4C3BA 4U5HA 4ZLDA 4N06A 4O6MA 3QMKA 4YN0B 2P7VA 3AG3C 2Y39A 3B0PA 2YEVA 1JPJA 4G7ZF 3NYLA 2WVOA 1ZYRF 2Y3BA 4W8KA 3X1OA 3F47A 3EZHA 3RIPA 3OA1A 2Q9AA 1Z23A 2YZSA 1O87A 3AG1C 3O39A 3RFYA 4G7HF 1G8XA 2W4MA 1Z5ZA 4U5DE 4LLCA 4MNDA 2WVNA 1VOMA 1MMNA 5DQZA 5DLJA 2J45A 2NUTB 4XLPF 3JYHA 3EQLF 3E70C 3I4UA 4CS7A 2GFHA 2W4BA 3LNRA 5D92A 3LS1A 2J0WA 3TD7A 4OIPF 4BJTA 2OG2A 5CI9A 2G3KA 4IWBA 5DVWA 3HJCA 4AX2A 4DBRA 4U5EE 2O9XA 2NG1A 1LVKA 4ULWA 4K7BA 4O6NA 5KYXA 4IRUA 3E9VA 4DVZA 2WZLA 4DVYP 2HV7A 1MMGA 5E2QA 4BEJA 2A6EF 1NU7D 3NKEA 1D0ZA 1NU9C 2Y3DA 3EGDA 4PJNA 4CS8C 2Q9CA 5B1BC 3N0TA 3EFOA 3S27A 4YT2A 1IW7F 3DJUB 5DS5A 3T6JA 3GANA 1ZU5A 4A2NB 4G7OF 2H7OA 2V26A 3POVA 2L9JA 4ZLCA 4DBQA 2PX0A 3EGXA 3KMIA 3SNHA 1QLEC 1VYIA 4GYTA 2HV6A 4KI2A 2XL4A 3SYNA 2WL8A 1V55C 2ZXPA 3CQZA 5KYNA 2R7OA 2R7VA 5CI8A 4YWQA 4WJ0A 3NKDA 2FFHA 4C7OB 2IXPA 5KYYB 1ZU4A 1FMWA 1RJ9B 3QZCA 4J30B 5FCLA 1JPNA 3EG9B 4JURI 4Q5SF 2P6VA 2IYLD 4PJJA 3RYLA 3ZIBA 5BUOA 4PK4A 3W2VA 2YHSA 4ANJA 4C3DA 1D0YA 3HLZA 3S28A 3ABLC 1MNDA 1LKXA 2WVQA 4AK9A 4OIRF 2XXAB 2NUPB 5EHHA 4XWJA 2EILC 3EPVA 4BJ6C 1Z3IX 1D1BA 3VAYA 2Y3HA 3OWTA 3S0XA 3W8HA 4CS9A 3IEEA 1ZHZA 5F5HA 3MX3A 2EINC 2G62A 2QY9A 3KL4A 4KNVA 2R7TA 4Q7CA 4XTKA 1D1CA 4HE8D 4OD4A 3KKBA 2ZPAA 3OEOA 3UMHA 1PD0A 3V7OA 4I3MA 1TR2A 4CIHA 1SZIA 4PFPA 4I44A 3T6BA 1M2VB 4OINF 2R7UA 3UGPA 1VK5A 2J9UA 4OD5A 2PX3A 1IZMA 3RH3A 3T4RA 3EH1A 2CGEA 2LSEA 1J8MF 1SMYF 2KW3C 3LEVA 3LLIA 1W2WA 3UMKA 3K66A 1D0XA 4AE4A 4OIQF 1MNEA 4O6YA 4BJ5C 3K7DA 1NG1A 3DJNB 2Q9BA 3NYJA 4E7SA 1BR1A 2OCCC 2IXMA 2Y69C 4GEHA 3X2QC 3UNGC 1BR2A 2A6HF 4RD9A 2EIMC 5KYWB 4I1MA 4MQ9F 3ITFA 1M56C 3LLKA 4M63A 1V54C 3EZIA 4YJWA 3PHF2 3AG2C 2KNHA 1WGWA 4CSAA 1OCRC 3FAJA 1O5HA 5E3CA 1QZXA 5T3WA 2J9WA 3AQCA 4IAOA 5L3QA 2CW0F 4B6IA 2R7XA 4G0HA 3O6XA 2R7RA 3L0IA 2R7WA 2J0XA 4JZAA 4JJFA 4X0RA 2J46A 3DZAA 2H7BA 3KH2A 5L3VA 3B0UX 2VB6A 3ZVRA 4HFKB 3EHNA 3LS0A 3AG4C 3N2ZB 2J9VA 3CZ6A 3H65A 2DYSC 3FVYA 1TWCA 3DM5A 2Z15A 2DGJA 2Y3GA 3FDQA 3DD7A 2KQ9A 3S29A 1M2OA 3CSKA 1Z6AA 1D1AA 1N1CA 5KYUB 3I5QA 4F4BA 2XSEA 3W2WA 3W8IA 2M4EA 4EBBA 3FHDA 2FGYA 2W9YA 2C04A 3NYMA 4RDAA 2NUTA 5DS6A 1OCZC 2PF4E 4I1OB 3SEOA 1S7ZA 3ZSUA 4FESA 1ZHXA 4CS9C 4BG0A 1OKKD 4FX5A 5DQTA 2A1DD 2B0JA 4BJ1A 4LERA 5T3TA 4DOZA 1ZHYA 5B1AC 2KJGA 3UMIA 2L81A 1SF8A 5KYXB 4U5BE 3WODF 2E87A 2IXOA 4H4KC 3JT1A 2MYSA 4YT5A 3GODA 3LESA 3SZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5D E;  4U5H A;  4U5F E;  4U5B E;  4U5E E;  4U5G A;  4U5C E; 
#chains in the Genus database with same CATH topology
 1KU2 A;  2YLD A;  3TUL A;  1FMV A;  1T6U A;  1BDJ B;  1MMA A;  3ECS A;  3EFO B;  2YL1 A;  1RKC A;  3IQ6 A;  2YQY A;  3K33 A;  1Q0D A;  5IY5 C;  3EHM A;  2WZF A;  4H54 A;  2JD3 A;  2FAP B;  2R05 A;  1FTS A;  2R9R B;  3GM3 A;  4O7G A;  4BJ6 A;  4OIO F;  3DXJ F;  3HKK A;  4J32 B;  3ZTZ A;  3EJN A;  1YAR O;  4JCH A;  3MLG A;  4MVQ A;  3EGX B;  5L0C A;  1TKN A;  3QW1 A;  4JJG A;  2MWQ A;  2ZXR A;  4DRH B;  3Q6M A;  4R32 A;  3F46 A;  4IGG A;  4A4A A;  2XS1 A;  3C62 A;  4XPY A;  2I8B A;  1C17 M;  3EH2 A;  4HFF B;  2D5R B;  4PAC A;  3K1H A;  1PV3 A;  1OCC C;  1TWA A;  4PJL A;  4C7O A;  2QTV A;  2EIJ C;  5E3A A;  2I15 A;  4MVU A;  2LFF A;  3M1C B;  1Q0M A;  3JCU Q;  1LM3 B;  4CJG A;  4E17 A;  4JVS A;  4EBJ A;  5KYY A;  2YWA A;  4JW1 A;  1TFK B;  3NMK A;  5AGF A;  1RJ9 A;  1UG7 A;  4C3E A;  4MS2 A;  3EG9 A;  2CDQ A;  5EGY A;  4KBL A;  3ZTM A;  3SXK A;  3ABM C;  3WG7 C;  1T6Q A;  1EI7 A;  3T6G B;  1TWH A;  3Q7L A;  1OKK A;  1YA7 O;  3LAY A;  4QI0 A;  2J7P D;  4LLE A;  3RKO F;  4FWV A;  2X51 A;  5A6J A;  5KYU A;  3DE8 A;  3K6B A;  2Q3T A;  1ORY A;  2KGO A;  4E0I A;  1R4T A;  4P9T A;  5HV9 A;  1ST6 A;  2XL8 A;  4LDK A;  3QTH A;  1R5I D;  2C03 A;  4KNW A;  3NG1 A;  3SP1 A;  4E7Z A;  2CNW D;  4CSA C;  1YDI A;  1BBH A;  2NUP A;  3VM6 A;  2XXA A;  3DM9 B;  4CIP A;  2WZG A;  1Z63 A;  2A68 F;  1K05 A;  4JIO A;  3PMR A;  3IQC A;  1A0B A;  1PCX A;  2YLI A;  2EPN A;  4QDL A;  3U2M A;  2VAS A;  3L8I A;  1FR0 A;  3JSZ A;  2XRH A;  4IAR A;  2P1A A;  2TMV P;  3L34 A;  4MVO A;  2DYR C;  2H7V C;  4LAC B;  2PNO A;  4BJ5 A;  1I5N A;  1B68 A;  3G50 A;  3HTK C;  1H9T A;  5L0H A;  4Q5S F;  5F5F A;  3N24 A;  4YT8 A;  2W45 A;  1A7D A;  4IAQ A;  2XLW A;  3O10 A;  2YL0 A;  4P6I C;  3K1I C;  3TOM A;  2OU6 A;  2OEV A;  4HEA J;  3DWW A;  3Q7G A;  2JPU A;  4NC3 A;  1J8Y F;  5AC4 A;  2L6G A;  1VB5 A;  4ER9 A;  2A0U A;  4U5F E;  1LE4 A;  1OXB A;  2EIK C;  2EPK X;  1NZE A;  3ASO C;  3B9Q A;  3C8G B;  4U5G A;  5E33 A;  3ZDL A;  2V3C C;  2R7S A;  3LJB A;  4QI2 A;  1DOV A;  1L3P A;  5CIV A;  4CBE A;  1CGM E;  1MMD A;  4PJM A;  3DKA A;  1BZ4 A;  1RMV A;  3M4B A;  3DAG A;  4CS8 A;  3UGO A;  5EK0 A;  1M2V A;  3B0V C;  2KSF A;  4Z9I A;  2ZXO A;  4P9F A;  4EIY A;  4DJ9 A;  5B3S C;  4KC9 A;  4YT4 A;  2EPM X;  3BEH A;  5A69 A;  4E18 A;  2DB4 A;  1E86 A;  2WB7 A;  1LI5 A;  4XQ1 A;  3Q6N A;  1FFH A;  1ZHT A;  2IXN A;  3GM2 A;  4NTA A;  1C02 A;  2J7P A;  2M64 A;  5D91 A;  2PP4 A;  3ABK C;  3AQB A;  3ZG1 A;  1WN0 A;  2G3V A;  2Q4F A;  1ZW3 A;  4AE4 B;  1S05 A;  2A69 F;  3B29 A;  5L0D A;  3RQF A;  3IQ5 A;  3RVY A;  2IM8 A;  4EWC A;  3FOP A;  3HNK A;  1WAS A;  1TWG A;  2CNW A;  4Z9H A;  2RD9 A;  3GEH A;  3AOU A;  2LIG A;  4PFO A;  3G4Z A;  4O79 A;  1LI7 A;  1FAP B;  4RBN A;  3ZQV A;  2HMQ A;  3NDB B;  3A9C A;  1FFT C;  1ZHW A;  1OCO C;  2KC3 A;  3JRT A;  1SR2 A;  2R7Q A;  1Y4C A;  2VH3 A;  2RSE B;  1LPE A;  1ZZP A;  3DAF A;  5L0J A;  3CAX A;  3HNJ A;  3UR3 C;  2IOQ A;  1BR4 A;  3ZC4 A;  4BPM A;  2BE5 F;  4W8P A;  4XLN F;  1V4A A;  3KYI A;  1L7C A;  3DMD A;  1LS4 A;  3IPM O;  3JZ0 A;  4U5C E;  5KYW A;  5A6B D;  1WOL A;  4CDY A;  4BEM J;  3PDM P;  5DS4 A;  3US6 A;  1U0B B;  1Q0F A;  1JOG A;  3V5Y A;  5T1D B;  1LS1 A;  4NY3 A;  2PFD A;  3I5P A;  3EGD B;  3JYY A;  1HW2 A;  1VYK A;  3ASN C;  1QVX A;  2OKU A;  1RCP A;  1VMA A;  2XM0 A;  1NSG B;  2ZXW C;  2LQG A;  2ZD9 A;  4IJJ A;  4MW3 A;  3VYW A;  3M15 A;  1YZC A;  4K0D A;  5HSW A;  3MBG A;  4Q4Z F;  1PD1 A;  1GQA A;  2GA0 A;  3NRH A;  5FZT A;  1M57 C;  2HZ8 A;  4C3B A;  1RXQ A;  4U5H A;  1QPU A;  2HSB A;  1TFO B;  4N6H A;  4ZLD A;  4N06 A;  4O6M A;  3SXY A;  3QMK A;  4YN0 B;  2KYH A;  2P7V A;  3AG3 C;  3GEI A;  2AWY A;  2Y39 A;  3B0P A;  3U3B A;  4JTC B;  3W4Y A;  4WAB A;  4ULV A;  4E7S A;  5JS5 A;  4CDV A;  2YEV A;  1JPJ A;  2GAQ A;  2F22 A;  3ZWI A;  4N4W A;  3WAQ A;  4YL1 A;  1U89 A;  4G7Z F;  3NYL A;  2WVO A;  1ZYR F;  3HNL A;  2Y3B A;  4W8K A;  3X1O A;  3GWN A;  3F47 A;  4LDQ A;  3S9O A;  3EZH A;  2OQM A;  3U8P A;  3RIP A;  3OA1 A;  4ONS A;  3U9J A;  2Q9A A;  1Z23 A;  2YZS A;  1O87 A;  1F1M A;  1T9K A;  3AG1 C;  2QE9 A;  1ORJ A;  1YVI A;  1H7I A;  1H9G A;  5COG A;  2ETS A;  3O39 A;  4JKV A;  4NQF A;  3RFY A;  1C03 A;  5BQI A;  1XZP A;  1H6G A;  4G7H F;  5BQH A;  1Y6D A;  1G8X A;  4MVZ A;  4E0H A;  2W4M A;  4G78 A;  1Z5Z A;  4MTF A;  4DXW A;  3U0C A;  2NSF A;  4U5D E;  4LLC A;  4MND A;  4YL0 A;  3RW0 A;  2YKZ A;  2WVN A;  1VOM A;  3QW0 A;  1MMN A;  5DQZ A;  1QKR A;  2DI3 A;  5DLJ A;  2J45 A;  2NUT B;  1GGQ A;  1O3U A;  1ORS C;  5A6B A;  4XLP F;  3JYH A;  3VRC A;  3EQL F;  3E70 C;  3I4U A;  4CS7 A;  1E83 A;  2GFH A;  2W4B A;  3LNR A;  1G4U S;  3LS1 A;  4L6R A;  5D92 A;  5JP7 A;  1A7E A;  4JTA B;  5JSL A;  3G4X A;  3NMI A;  2J0W A;  3TD7 A;  4OIP F;  2LFD A;  4BJT A;  2OG2 A;  4MW8 A;  5CI9 A;  2G3K A;  4IWB A;  5DVW A;  3HJC A;  4AX2 A;  4DBR A;  4U5E E;  5JLI A;  1NBB A;  3ATP A;  4NTB A;  4XEF A;  1HW1 A;  2O9X A;  3H2U A;  1T5O A;  3JRM O;  2NG1 A;  1LVK A;  2ICW G;  3C63 A;  4ULW A;  3AGU A;  4K7B A;  4O6N A;  5A6K A;  1K40 A;  3T9O A;  2R02 A;  5KYX A;  2VC9 A;  4IRU A;  1E84 A;  3E9V A;  1WWP A;  1A41 A;  4DVZ A;  2WZL A;  5TJ5 E;  4DVY P;  2HV7 A;  2L6H A;  1MMG A;  5E2Q A;  4BEJ A;  4DRI B;  2YL3 A;  2A6E F;  4NTF A;  1NU7 D;  3NKE A;  4EBK A;  1CGO A;  1D0Z A;  1NU9 C;  2Y3D A;  3EGD A;  2ASR A;  4PJN A;  4CS8 C;  2Q9C A;  5K0I A;  5B1B C;  3N0T A;  1JAF A;  3EFO A;  4MVR A;  3S27 A;  1IW7 F;  4AL1 A;  4YT2 A;  3B71 A;  2HS5 A;  3BRJ A;  3DJU B;  4EHP A;  5DS5 A;  3T6J A;  2HJM A;  1OR2 A;  1HE9 A;  1ZU5 A;  3GAN A;  2H7O A;  2VCA A;  2V26 A;  4A2N B;  4G7O F;  4XEV A;  3POV A;  1UFB A;  2L9J A;  2CCY A;  4ZLC A;  2HFI A;  2LP4 A;  4DBQ A;  2PX0 A;  3EGX A;  3KMI A;  3SNH A;  1QLE C;  1VYI A;  2Q00 A;  4GYT A;  2HV6 A;  3U9M A;  2HJ3 A;  1I4Z A;  1JMW A;  4KI2 A;  2XL4 A;  3SYN A;  2WL8 A;  1V55 C;  1HE1 A;  3C8G D;  2XLD A;  2ZXP A;  3CQZ A;  5KYN A;  2R7O A;  2YLG A;  3K1I A;  2R7V A;  1Q0K A;  2QLA A;  5CI8 A;  4YWQ A;  4WJ0 A;  3KYJ A;  2EPL X;  3NKD A;  5GPG B;  4UDV A;  2FFH A;  3GWL A;  4C7O B;  1SYQ A;  2EPO A;  2L6F A;  2IXP A;  1A7V A;  5F28 E;  5KYY B;  1MQV A;  1ZU4 A;  1FMW A;  1RJ9 B;  3QZC A;  2XLO A;  4J30 B;  2XS8 A;  4EUK B;  1JPN A;  5FCL A;  2QUP A;  3EG9 B;  4JUR I;  2P6V A;  4N6C A;  4PR9 A;  4MTG A;  2IYL D;  2VCB A;  4PJJ A;  3RYL A;  1XWJ A;  2UUH A;  4IB4 A;  1T01 A;  3ZIB A;  5BUO A;  4PK4 A;  1NFO A;  2CYD A;  4J7T A;  5JVE A;  3W2V A;  1HMO A;  2YHS A;  4CX9 A;  4ANJ A;  3H2V A;  4C3D A;  256B A;  1D0Y A;  3HLZ A;  5JUA A;  3M4C A;  3ABL C;  1MND A;  2LK4 A;  4JRZ A;  3S28 A;  1LKX A;  3AJM A;  4D4N A;  1KTM A;  2WVQ A;  4AK9 A;  1KNY A;  2YVK A;  4OIR F;  3PCV A;  2XXA B;  2NUP B;  4CDA A;  4JTD B;  1OR3 A;  1GM5 A;  3L8J A;  2D4U A;  1Z7Q c;  4AL0 A;  5EHH A;  4XWJ A;  1CPQ A;  1LIH A;  2EIL C;  2XLH A;  3EPV A;  1Z3I X;  4BJ6 C;  1D1B A;  1AVO B;  3VAY A;  2Y3H A;  3M79 A;  2AVK A;  3OWT A;  5L0G A;  3S0X A;  1WTY A;  1TQG A;  3W8H A;  3A11 A;  4WGZ A;  2A0B A;  4CS9 A;  1NLX A;  3IEE A;  2X0C A;  2AWC A;  2L7A A;  3J06 A;  1ZHZ A;  5F5H A;  3MX3 A;  2AP3 A;  4CJO A;  2BC5 A;  2EIN C;  2G62 A;  2QY9 A;  3O55 A;  3KL4 A;  4KNV A;  3C7J A;  2R7T A;  1T6I A;  3VF0 A;  4Q7C A;  4XTK A;  1D1C A;  3C8Z A;  2QNL A;  4HE8 D;  4OD4 A;  3KKB A;  2ZPA A;  3OEO A;  3C8G A;  3UMH A;  1PD0 A;  2H8A A;  4U9D A;  3HNI A;  3MFN A;  3V7O A;  4I3M A;  3FXH A;  1TR2 A;  3TK0 A;  4CIH A;  1SZI A;  5A6A A;  4PFP A;  4I44 A;  3RQG A;  3T6B A;  1M2V B;  4OIN F;  2R7U A;  5JT4 A;  3UGP A;  1VK5 A;  2GDC A;  2J9U A;  4OD5 A;  2PBE A;  3DI5 A;  3IQT A;  2PX3 A;  2J8W A;  2OEX A;  1IZM A;  3RH3 A;  3T4R A;  3EH1 A;  4MVM A;  4JEA A;  3S90 A;  4NCQ A;  2CGE A;  2LSE A;  1J8M F;  1SMY F;  2HUJ A;  2KW3 C;  3LEV A;  3LLI A;  1W2W A;  4JEB A;  4JC7 A;  3TJ5 A;  1U6H A;  3UMK A;  2HMZ A;  3K66 A;  1D0X A;  2AU5 A;  4AE4 A;  4OIQ F;  3TQO A;  5COM A;  1MNE A;  3JTL O;  3SXZ A;  4O6Y A;  3V5Z A;  1FNT c;  2YL7 A;  1RKE B;  1CPR A;  4XPX A;  4BJ5 C;  3K7D A;  1NG1 A;  3DJN B;  2Q9B A;  3NYJ A;  3R2P A;  3LUT B;  2HKV A;  1BR1 A;  2J9B A;  1DOW A;  3C18 A;  1ZVZ A;  2BL2 A;  2IXM A;  1HMD A;  2GWW A;  2OCC C;  4YL3 A;  2XLM A;  3SXM A;  3LNM B;  2Y69 C;  4GEH A;  3X2Q C;  3ZQY A;  2P61 A;  1YLM A;  1BR2 A;  2A6H F;  3MYI A;  2UUI A;  3UNG C;  3QVY A;  3RVZ A;  1EKY A;  3GOR A;  4RD9 A;  3WHN A;  3IHU A;  2EIM C;  5KYW B;  3QVZ A;  4I1M A;  4MQ9 F;  3ITF A;  1M56 C;  3LLK A;  4M63 A;  1NFN A;  1V54 C;  4YK5 A;  3EZI A;  5AC5 A;  4YJW A;  3PHF 2;  3TJ6 A;  5L0I A;  1K04 A;  2KNH A;  1YYJ A;  3AG2 C;  1GS9 A;  1OW7 A;  2XM4 A;  2LCH A;  1VTM P;  2VCC A;  3R7C A;  1WGW A;  1YJG A;  1APC A;  4CSA A;  1OCR C;  2NSG A;  3FAJ A;  1O5H A;  4XPW A;  5E3C A;  1QZX A;  5T3W A;  2J9W A;  3AQC A;  4IAO A;  2JX0 A;  3S84 A;  3U2L A;  5L3Q A;  2YRF A;  2CW0 F;  4B6I A;  2R7X A;  4G0H A;  3O6X A;  2R7R A;  3L0I A;  3FOO A;  2R7W A;  2J0X A;  1HY5 A;  2R25 A;  4JZA A;  4D4X A;  3L1M A;  2OJE D;  4JJF A;  4X0R A;  2J46 A;  3DZA A;  2H7B A;  1I4Y A;  3KH2 A;  1LE2 A;  5L3V A;  1M6T A;  3B0U X;  2MHR A;  2VB6 A;  1YZA A;  3EHN A;  3GM1 A;  4HFK B;  3RQE A;  1G4W R;  3U5S A;  3ZVR A;  3LS0 A;  3AG4 C;  1E85 A;  3N2Z B;  4GQH A;  2J9V A;  1V74 B;  1WAT A;  3CZ6 A;  4MVS A;  3H65 A;  2DYS C;  3TOL A;  1JRA A;  1CGN A;  4MTO A;  4XEK A;  4LDR A;  1EQ1 A;  3FVY A;  1E2X A;  1TWC A;  4U9E A;  1JR8 A;  3DM5 A;  1OXK A;  2Z15 A;  2DGJ A;  1QSP A;  2Y3G A;  3FDQ A;  3DD7 A;  2LD6 A;  2XLE A;  3GEE A;  2IBF A;  4EKW A;  2KQ9 A;  3S29 A;  5B3I A;  1M2O A;  3CSK A;  1Z6A A;  1D1A A;  4K1O A;  1YA9 A;  1N1C A;  5KYU B;  2P0N A;  2Q7R A;  3FMS A;  3I5Q A;  2KK1 A;  4F4B A;  2XSE A;  3W2W A;  3FAP B;  3W8I A;  5COF A;  2M4E A;  2XL6 A;  4J7Y A;  4EBB A;  3FHD A;  1OQC A;  4WGY A;  2FGY A;  2W9Y A;  2C04 A;  3LEO A;  3NYM A;  4RDA A;  2OJQ A;  1VLT A;  2NUT A;  4DRJ B;  1OW8 A;  2OOC A;  5DS6 A;  1OCZ C;  2PF4 E;  2R03 A;  3DE9 A;  1ZW2 A;  4I1O B;  3SEO A;  1S7Z A;  3V5X A;  1RKE A;  3U3F A;  3MYF A;  4FES A;  3ZSU A;  4FAP B;  1YYX A;  1ZHX A;  3CEX A;  1QQ3 A;  1OW6 A;  4CS9 C;  4BG0 A;  1OKK D;  3JSE O;  4FX5 A;  5DQT A;  2A1D D;  2B0J A;  5L0F A;  1AUE A;  4BJ1 A;  3AGT A;  2B0H A;  4LER A;  5T3T A;  4DOZ A;  2NPU A;  1VLS A;  1ZHY A;  5B1A C;  1XZQ A;  5JRA A;  2KJG A;  3NMJ A;  2L81 A;  1SF8 A;  4Z9J A;  3U8V A;  3UMI A;  5KYX B;  4U5B E;  4JCZ A;  3WOD F;  2E87 A;  5BQG A;  1AEP A;  2IXO A;  2HSQ A;  3JT1 A;  2MYS A;  3KPH A;  4H4K C;  1G5Z A;  1YAU O;  3GOD A;  4YT5 A;  3LES A;  3RF3 A;  3SZR A;  1EA8 A;  1Q0G A;  4JE9 A;  2XLV A; 
#chains in the Genus database with same CATH homology
 1KU2 A;  1FMV A;  1MMA A;  3ECS A;  3EFO B;  3K33 A;  5IY5 C;  3EHM A;  2WZF A;  2JD3 A;  4O7G A;  1FTS A;  4BJ6 A;  4OIO F;  3DXJ F;  4J32 B;  3EJN A;  4JCH A;  3MLG A;  3EGX B;  1TKN A;  4JJG A;  2MWQ A;  2ZXR A;  3Q6M A;  3F46 A;  2I8B A;  3EH2 A;  4HFF B;  2D5R B;  3K1H A;  1OCC C;  1TWA A;  4PJL A;  4C7O A;  2QTV A;  2EIJ C;  5E3A A;  3M1C B;  3JCU Q;  4JVS A;  5KYY A;  4JW1 A;  1RJ9 A;  4C3E A;  5EGY A;  3EG9 A;  2CDQ A;  4KBL A;  3ABM C;  3WG7 C;  1TWH A;  3Q7L A;  1OKK A;  3LAY A;  4QI0 A;  2J7P D;  4LLE A;  3RKO F;  4FWV A;  2X51 A;  5KYU A;  3K6B A;  2Q3T A;  2KGO A;  1ST6 A;  2C03 A;  4KNW A;  3NG1 A;  3SP1 A;  4E7Z A;  2CNW D;  4CSA C;  2XXA A;  2NUP A;  3DM9 B;  2WZG A;  1Z63 A;  2A68 F;  3PMR A;  1PCX A;  4QDL A;  2VAS A;  3JSZ A;  2XRH A;  3L34 A;  2DYR C;  2H7V C;  4LAC B;  4BJ5 A;  3HTK C;  5F5F A;  3N24 A;  4YT8 A;  2W45 A;  4P6I C;  3K1I C;  4HEA J;  3Q7G A;  1J8Y F;  4U5F E;  2EIK C;  3ASO C;  3B9Q A;  1NZE A;  4U5G A;  5E33 A;  2V3C C;  2R7S A;  4QI2 A;  3LJB A;  4CBE A;  1MMD A;  4PJM A;  3DAG A;  4CS8 A;  3UGO A;  1M2V A;  3B0V C;  2ZXO A;  5B3S C;  4KC9 A;  4YT4 A;  2WB7 A;  3Q6N A;  1FFH A;  1ZHT A;  2IXN A;  5D91 A;  2J7P A;  2PP4 A;  3ABK C;  3AQB A;  3ZG1 A;  2G3V A;  4AE4 B;  2A69 F;  4EWC A;  1TWG A;  2CNW A;  4PFO A;  4O79 A;  4RBN A;  3NDB B;  1FFT C;  1ZHW A;  1OCO C;  3JRT A;  2R7Q A;  2VH3 A;  3DAF A;  3UR3 C;  2IOQ A;  1BR4 A;  3ZC4 A;  2BE5 F;  4XLN F;  3DMD A;  4U5C E;  5KYW A;  5DS4 A;  5T1D B;  1LS1 A;  4NY3 A;  2PFD A;  3I5P A;  3EGD B;  1VYK A;  3ASN C;  1VMA A;  2ZXW C;  4IJJ A;  3VYW A;  4K0D A;  5HSW A;  4Q4Z F;  1PD1 A;  3NRH A;  1M57 C;  4C3B A;  4U5H A;  4ZLD A;  4N06 A;  4O6M A;  3QMK A;  4YN0 B;  2P7V A;  3AG3 C;  2Y39 A;  3B0P A;  2YEV A;  1JPJ A;  4G7Z F;  3NYL A;  2WVO A;  1ZYR F;  2Y3B A;  4W8K A;  3X1O A;  3F47 A;  3EZH A;  3RIP A;  3OA1 A;  2Q9A A;  1Z23 A;  2YZS A;  1O87 A;  3AG1 C;  3O39 A;  3RFY A;  4G7H F;  1G8X A;  2W4M A;  1Z5Z A;  4U5D E;  4LLC A;  4MND A;  2WVN A;  1VOM A;  1MMN A;  5DQZ A;  5DLJ A;  2J45 A;  2NUT B;  4XLP F;  3JYH A;  3EQL F;  3E70 C;  3I4U A;  4CS7 A;  2GFH A;  2W4B A;  3LNR A;  5D92 A;  3LS1 A;  2J0W A;  3TD7 A;  4OIP F;  4BJT A;  2OG2 A;  5CI9 A;  2G3K A;  4IWB A;  5DVW A;  3HJC A;  4AX2 A;  4DBR A;  4U5E E;  2O9X A;  2NG1 A;  1LVK A;  4ULW A;  4K7B A;  4O6N A;  5KYX A;  4IRU A;  3E9V A;  4DVZ A;  2WZL A;  4DVY P;  2HV7 A;  1MMG A;  5E2Q A;  4BEJ A;  2A6E F;  1NU7 D;  3NKE A;  1D0Z A;  1NU9 C;  2Y3D A;  3EGD A;  4PJN A;  4CS8 C;  2Q9C A;  5B1B C;  3N0T A;  3EFO A;  3S27 A;  4YT2 A;  1IW7 F;  3DJU B;  5DS5 A;  3T6J A;  3GAN A;  1ZU5 A;  4A2N B;  4G7O F;  2H7O A;  2V26 A;  3POV A;  2L9J A;  4ZLC A;  4DBQ A;  2PX0 A;  3EGX A;  3KMI A;  3SNH A;  1QLE C;  1VYI A;  4GYT A;  2HV6 A;  4KI2 A;  2XL4 A;  3SYN A;  2WL8 A;  1V55 C;  2ZXP A;  3CQZ A;  5KYN A;  2R7O A;  2R7V A;  5CI8 A;  4YWQ A;  4WJ0 A;  3NKD A;  2FFH A;  4C7O B;  2IXP A;  5KYY B;  1ZU4 A;  1FMW A;  1RJ9 B;  3QZC A;  4J30 B;  5FCL A;  1JPN A;  3EG9 B;  4JUR I;  4Q5S F;  2P6V A;  2IYL D;  4PJJ A;  3RYL A;  3ZIB A;  5BUO A;  4PK4 A;  3W2V A;  2YHS A;  4ANJ A;  4C3D A;  1D0Y A;  3HLZ A;  3S28 A;  3ABL C;  1MND A;  1LKX A;  2WVQ A;  4AK9 A;  4OIR F;  2XXA B;  2NUP B;  5EHH A;  4XWJ A;  2EIL C;  3EPV A;  4BJ6 C;  1Z3I X;  1D1B A;  3VAY A;  2Y3H A;  3OWT A;  3S0X A;  3W8H A;  4CS9 A;  3IEE A;  1ZHZ A;  5F5H A;  3MX3 A;  2EIN C;  2G62 A;  2QY9 A;  3KL4 A;  4KNV A;  2R7T A;  4Q7C A;  4XTK A;  1D1C A;  4HE8 D;  4OD4 A;  3KKB A;  2ZPA A;  3OEO A;  3UMH A;  1PD0 A;  3V7O A;  4I3M A;  1TR2 A;  4CIH A;  1SZI A;  4PFP A;  4I44 A;  3T6B A;  1M2V B;  4OIN F;  2R7U A;  3UGP A;  1VK5 A;  2J9U A;  4OD5 A;  2PX3 A;  1IZM A;  3RH3 A;  3T4R A;  3EH1 A;  2CGE A;  2LSE A;  1J8M F;  1SMY F;  2KW3 C;  3LEV A;  3LLI A;  1W2W A;  3UMK A;  3K66 A;  1D0X A;  4AE4 A;  4OIQ F;  1MNE A;  4O6Y A;  4BJ5 C;  3K7D A;  1NG1 A;  3DJN B;  2Q9B A;  3NYJ A;  4E7S A;  1BR1 A;  2OCC C;  2IXM A;  2Y69 C;  4GEH A;  3X2Q C;  3UNG C;  1BR2 A;  2A6H F;  4RD9 A;  2EIM C;  5KYW B;  4I1M A;  4MQ9 F;  3ITF A;  1M56 C;  3LLK A;  4M63 A;  1V54 C;  3EZI A;  4YJW A;  3PHF 2;  3AG2 C;  2KNH A;  1WGW A;  4CSA A;  1OCR C;  3FAJ A;  1O5H A;  5E3C A;  1QZX A;  5T3W A;  2J9W A;  3AQC A;  4IAO A;  5L3Q A;  2CW0 F;  4B6I A;  2R7X A;  4G0H A;  3O6X A;  2R7R A;  3L0I A;  2R7W A;  2J0X A;  4JZA A;  4JJF A;  4X0R A;  2J46 A;  3DZA A;  2H7B A;  3KH2 A;  5L3V A;  3B0U X;  2VB6 A;  3ZVR A;  4HFK B;  3EHN A;  3LS0 A;  3AG4 C;  3N2Z B;  2J9V A;  3CZ6 A;  3H65 A;  2DYS C;  3FVY A;  1TWC A;  3DM5 A;  2Z15 A;  2DGJ A;  2Y3G A;  3FDQ A;  3DD7 A;  2KQ9 A;  3S29 A;  1M2O A;  3CSK A;  1Z6A A;  1D1A A;  1N1C A;  5KYU B;  3I5Q A;  4F4B A;  2XSE A;  3W2W A;  3W8I A;  2M4E A;  4EBB A;  3FHD A;  2FGY A;  2W9Y A;  2C04 A;  3NYM A;  4RDA A;  2NUT A;  5DS6 A;  1OCZ C;  2PF4 E;  4I1O B;  3SEO A;  1S7Z A;  3ZSU A;  4FES A;  1ZHX A;  4CS9 C;  4BG0 A;  1OKK D;  4FX5 A;  5DQT A;  2A1D D;  2B0J A;  4BJ1 A;  4LER A;  5T3T A;  4DOZ A;  1ZHY A;  5B1A C;  2KJG A;  3UMI A;  2L81 A;  1SF8 A;  5KYX B;  4U5B E;  3WOD F;  2E87 A;  2IXO A;  4H4K C;  3JT1 A;  2MYS A;  4YT5 A;  3GOD A;  3LES A;  3SZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...