4U5HA

Crystal structure of con-ikot-ikot toxin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
85
structure length
85
Chain Sequence
GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Con-ikot-ikot
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Conus striatus
total genus 29
structure length 85
sequence length 85
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5hA00
4U5EE 4U5GA 4U5HA 4U5BE 4U5CE 4U5DE 4U5FE
chains in the Genus database with same CATH superfamily
1HMOA 2P1AA 4U5GA 3VF0A 4FAPB 1DOWA 4ULVA 1BR1A 1D1AA 2D5RB 2G3VA 3UMHA 4P6IC 4EIYA 2HV7A 3DWWA 4I3MA 3K33A 3S84A 2XXAB 1PD1A 4MQ9F 5JS5A 2EPOA 1ZYRF 3QW1A 2XL4A 5KYYA 2F22A 3TOLA 5JUAA 1G5ZA 5BQIA 1GM5A 2AWYA 3IPMO 5F5HA 3T4RA 2HV6A 4BEMJ 5B1AC 3C7JA 1GQAA 3K66A 1T9KA 4XEKA 2IM8A 1ZU4A 2L6GA 3G4ZA 2NPUA 3JYYA 4OIQF 1O5HA 1CPRA 1OKKA 4PK4A 4BJ5C 2W4MA 4DRHB 2HSQA 1L7CA 3F47A 3ZTZA 3NDBB 2HS5A 3F46A 1XZQA 1D0ZA 3ABMC 3R2PA 2YL0A 2R7TA 3BEHA 3Q7LA 2W9YA 3TJ5A 3V7OA 1XWJA 4DBRA 3B0PA 4LERA 2LQGA 1PD0A 2FGYA 4N6CA 1YA9A 1TWHA 2R7UA 1JMWA 3EH2A 3JSEO 4JVSA 5E33A 4CJGA 3VYWA 3H2VA 1E85A 3ZG1A 2XLWA 1I5NA 5E3CA 1TQGA 2QNLA 1APCA 3HLZA 3I5QA 2YEVA 4O6YA 2KJGA 2Q9BA 3W8HA 5KYUB 4XPXA 4YL1A 1IZMA 1GS9A 4GQHA 2PX0A 3IQCA 2KQ9A 1T6QA 2AVKA 1YLMA 1A0BA 256BA 2VC9A 3KH2A 4HFKB 4KBLA 4MS2A 2EPMX 1H9GA 4P9TA 5JT4A 1BDJB 3HNLA 2RSEB 1M6TA 1L3PA 1Q0DA 4MVZA 4AK9A 1RJ9A 3U8VA 4KNWA 1G8XA 5A6BD 3KYJA 3NYMA 1BZ4A 1OCZC 1D0XA 4JZAA 2PFDA 4CS8A 4QDLA 1RCPA 3ZDLA 2CCYA 1LE2A 5KYWA 4CS9C 2V3CC 2YLIA 1D1BA 1WWPA 3GEIA 3GWNA 3B29A 2LSEA 3C8GB 4RDAA 3W2WA 4CDYA 1OW8A 3GM1A 3AG1C 1LI7A 1IW7F 3WODF 5D91A 4AX2A 3ITFA 3J06A 2ZXWC 3K6BA 3KL4A 2H7BA 5CI9A 2G3KA 2WZFA 1HW1A 4AL0A 3GEHA 2KNHA 1ZW2A 2YWAA 5K0IA 3C8ZA 1PV3A 2CGEA 1J8YF 2I8BA 5F28E 3OA1A 1NFOA 3ABKC 2XS1A 2IYLD 3PDMP 4J30B 3S27A 2J9WA 4MNDA 4PACA 1HW2A 1EQ1A 3LJBA 4N06A 2Y69C 3AG3C 3R7CA 3JYHA 1BR2A 3FAPB 1Q0GA 4YJWA 2LIGA 4LDQA 2P61A 2PX3A 1K05A 2XLEA 4U5FE 4AE4A 2YRFA 1G4US 1RKEA 1T6UA 4DRIB 1EA8A 4NCQA 5D92A 2P0NA 3B0VC 1NLXA 3FAJA 3HTKC 1YZAA 3GWLA 2R7SA 1OCRC 2ZXPA 3ZVRA 4ZLDA 1QVXA 2FFHA 4C7OB 5AC4A 3O55A 3EFOB 1ZHWA 2L7AA 3DE8A 3RFYA 1QLEC 3S9OA 4EBKA 2NUTB 1E83A 1NBBA 3RQEA 1K04A 4WABA 3EG9B 1JPNA 4JKVA 1G4WR 4DBQA 2ETSA 4J32B 3EGXB 3AG2C 2R7WA 4JEBA 3AQCA 5COGA 3IQTA 4NY3A 3SYNA 5JVEA 1RKCA 1FNTc 1NFNA 1Z63A 1C03A 4DRJB 3N0TA 1ZU5A 4O6NA 3RF3A 3ZIBA 2RD9A 3M4BA 4IARA 2OU6A 3LLKA 4IB4A 1Z5ZA 1SMYF 1RMVA 4XTKA 3UNGC 4I44A 2D4UA 1ST6A 5EK0A 3ZWIA 5KYXA 4JTCB 1VYIA 3DAFA 4RD9A 2Q4FA 2KSFA 2NSFA 4CSAA 3EJNA 2EINC 2AU5A 3RIPA 1GGQA 3ECSA 2XLHA 4JC7A 5B1BC 2E87A 2HZ8A 3ABLC 4IRUA 4K7BA 4Q5SF 3I5PA 4Z9HA 1MMNA 3GEEA 4BJ1A 3O39A 1V74B 3IHUA 3OWTA 5L0FA 5E3AA 1VMAA 1OW6A 2IBFA 3T6GB 2VH3A 4J7TA 1A41A 5DVWA 3V5XA 3K7DA 1VK5A 1LPEA 3DM9B 4OD5A 5DS5A 2HJ3A 2OCCC 2HMQA 2CNWD 1NZEA 2XLMA 3U3FA 2WL8A 3CSKA 3DE9A 4G78A 3MYIA 5A6KA 1N1CA 4MVOA 4U5DE 2NUPB 3S0XA 5KYYB 2HSBA 3ATPA 1JOGA 3DI5A 4NC3A 2P6VA 4O79A 3ZQVA 5L0CA 1KU2A 1E2XA 2XXAA 4MTOA 3U3BA 3SXMA 1CPQA 1HE1A 4BG0A 2LFFA 3AOUA 4LDRA 4BJ6C 1JAFA 2PBEA 2MHRA 3EH1A 1E86A 3I4UA 2GDCA 3DJUB 4O6MA 5E2QA 4PFPA 3U2LA 3US6A 2ASRA 4K1OA 1S7ZA 4XQ1A 3TOMA 1Z23A 2P7VA 3FMSA 1ZHYA 1H7IA 2ZD9A 1OXBA 4IWBA 1FMWA 4YT4A 1NU9C 3U2MA 4NTBA 1UG7A 1VTMP 2J0XA 3FOOA 4YT2A 3FOPA 1V4AA 4KNVA 4WGYA 1SR2A 2R25A 2H8AA 1T01A 4XEFA 5B3SC 3SXZA 4NTAA 4CDVA 2HFIA 4OD4A 4P9FA 3X2QC 4EWCA 3E9VA 3WAQA 4BJ5A 1H9TA 2TMVP 3IQ5A 4A4AA 2Q9CA 3ZQYA 1EI7A 2R03A 4CDAA 4CIHA 3POVA 4WJ0A 2BE5F 1TFKB 2L6FA 2IXPA 3N2ZB 4E18A 2R7OA 3QW0A 2EILC 1OW7A 1I4YA 2XM4A 5F5FA 5B3IA 1R4TA 5L0DA 1FR0A 1ZHZA 4MW3A 2J45A 1VLTA 4CX9A 3NG1A 3N24A 1Q0MA 3V5ZA 4JE9A 1RJ9B 4EBJA 4YK5A 1FFHA 4PR9A 1KTMA 1WOLA 3NMJA 1Z6AA 2C03A 3LNMB 3L1MA 4JCHA 1KNYA 2M4EA 2YLDA 4L6RA 2VASA 4U9EA 1TR2A 3DMDA 3T6JA 3PHF2 1ORYA 2XS8A 2X0CA 5KYWB 3DAGA 3GANA 4D4XA 4W8KA 2CNWA 3UMKA 3NMKA 1H6GA 2Y3HA 1VOMA 1QQ3A 2Q9AA 1U0BB 1S05A 2A6EF 4G0HA 2CYDA 2A0BA 1LS4A 4Z9IA 1SZIA 2QY9A 3VAYA 4LACB 2NSGA 4MVQA 1VYKA 4OIOF 2KC3A 1YVIA 1MNDA 4CS9A 4EHPA 3EGDA 3GM3A 3QZCA 5A6JA 3ZC4A 1WGWA 3O6XA 3U5SA 1YDIA 3S28A 2VB6A 1U89A 1OXKA 1HE9A 4XEVA 3JRMO 2H7VC 2L6HA 3UMIA 5JRAA 5IY5C 1W2WA 3DKAA 1J8MF 4XLNF 4D4NA 1MMAA 4Q4ZF 2J9UA 2Q7RA 4CIPA 5JP7A 1I4ZA 3LNRA 2J7PD 2CW0F 1EKYA 2OEXA 1MMGA 1QKRA 2A0UA 2IXMA 1HMDA 2QUPA 4FWVA 4BPMA 3B0UX 2YL1A 2JD3A 3CZ6A 3KYIA 4H54A 4Z9JA 3JT1A 2IXNA 2WVOA 5CI8A 3A9CA 4CBEA 4DOZA 4U5EE 2DYSC 5L0IA 3QVYA 2B0HA 3RYLA 4F4BA 3QVZA 2J9VA 1E84A 4K0DA 5L0HA 4CS7A 1V55C 2J46A 2EPLX 5COFA 2OJED 2AP3A 3SXYA 5EHHA 4C3EA 1M2VA 3KPHA 3MFNA 1OR3A 3DXJF 4U5BE 3RVYA 2R7RA 3U8PA 3W4YA 2J8WA 4I1OB 2IXOA 2QTVA 3L0IA 3MBGA 4E0HA 5JLIA 4KI2A 4C7OA 3EFOA 2CDQA 2KW3C 2H7OA 2W45A 3K1HA 5JSLA 3DZAA 4XLPF 1Q0KA 5BUOA 3C63A 3S90A 4GEHA 3NYLA 3JSZA 2EPKX 2A1DD 2NG1A 3EGXA 3T9OA 3C62A 3ZTMA 3RQGA 2Z15A 4EBBA 1O3UA 2DYRC 4OIPF 4DXWA 3K1IC 3U0CA 1TWGA 4AL1A 3M1CB 2XSEA 3KKBA 3L34A 3UR3C 1XZPA 2OG2A 4J7YA 5KYXB 3AJMA 1B68A 1WATA 1M57C 4IAOA 4JRZA 4BJTA 4QI0A 2GWWA 4YT5A 3RVZA 4X0RA 2YL7A 1VLSA 1UFBA 2XL8A 5DS4A 3EZIA 1O87A 3CQZA 3MX3A 4BEJA 4GYTA 1SYQA 4JJGA 3W8IA 2A6HF 4G7OF 1YARO 3V5YA 3GORA 3GODA 1ZW3A 4JJFA 2ZPAA 5FCLA 3EHMA 2C04A 2KGOA 3S29A 5L3QA 2YKZA 1MMDA 3AG4C 2GA0A 3RKOF 4DVYP 1ZHXA 1PCXA 1BBHA 2J9BA 3EHNA 3EPVA 2B0JA 3C8GD 2R05A 2W4BA 3E70C 4LLCA 2R02A 5AGFA 2J7PA 3UGOA 3AGTA 3TJ6A 1LVKA 1M2OA 3X1OA 5HSWA 2OEVA 4ULWA 1TKNA 3U9MA 2Y3BA 4ER9A 5L0GA 2OQMA 2Y3GA 3IQ6A 4IGGA 4PJNA 2KK1A 5T1DB 3JRTA 4E17A 4MTFA 1JRAA 4DJ9A 1FTSA 4MVMA 4NQFA 3NKDA 3LEOA 3M15A 2NUPA 3M4CA 2IOQA 3RH3A 2R9RB 5HV9A 4JTAB 3FDQA 1A7EA 4YT8A 3QTHA 4M63A 5BQGA 1NG1A 1ZVZA 2PNOA 1Z3IX 1A7VA 3SNHA 2Y39A 4XWJA 5BQHA 5DS6A 3WG7C 1T6IA 1F1MA 2A68F 2MWQA 4G7HF 4G7ZF 2ZXOA 4BJ6A 5DQZA 4JW1A 2HKVA 5COMA 2M64A 3L8IA 3MLGA 3DM5A 3TD7A 2YQYA 3LS1A 2R7XA 1OCCC 1R5ID 1YZCA 5DLJA 2EIKC 5KYUA 4ANJA 4LDKA 2R7QA 1AEPA 5EGYA 1D0YA 1SF8A 2LD6A 3ASOC 2GFHA 2OJQA 3AGUA 2XLVA 4W8PA 3VM6A 2HMZA 5T3TA 1K40A 4HE8D 3B9QA 3FXHA 4MVRA 2YHSA 4CS8C 1A7DA 3HNJA 1LM3B 4PJMA 4RBNA 1ZZPA 2HUJA 1LS1A 3HJCA 3B71A 3LEVA 1MNEA 2V26A 4PJJA 3LS0A 2A69F 4H4KC 2LCHA 1M56C 3LLIA 1YA7O 4HEAJ 1NSGB 1QZXA 3EZHA 4N6HA 2BC5A 2EIMC 2XRHA 3FVYA 4B6IA 1YYXA 3AQBA 3HNKA 2X51A 4E7ZA 1ORJA 1TWAA 3MYFA 3WHNA 1T5OA 1CGOA 3C8GA 3LUTB 2I15A 3HKKA 4FX5A 4IJJA 4U5CE 5AC5A 3CEXA 3NKEA 4XPYA 1YYJA 3OEOA 1QSPA 2XM0A 4ONSA 4ZLCA 1V54C 2OOCA 2ZXRA 5L0JA 3SP1A 1NU7D 5L3VA 2BL2A 4A2NB 3W2VA 3Q6NA 2PF4E 3Q6MA 1Z7Qc 2YVKA 2R7VA 4E7SA 1U6HA 1ORSC 2JPUA 4MW8A 3EGDB 2Q3TA 3IEEA 4HFFB 4OIRF 1YJGA 4MVUA 1LIHA 2GAQA 3JTLO 5A6AA 1WTYA 1DOVA 2XLOA 3RQFA 4YL0A 1AVOB 4YN0B 4JEAA 4E0IA 1VB5A 3ZSUA 1OCOC 3JCUQ 3DD7A 1Q0FA 2Y3DA 3LAYA 3JZ0A 1BR4A 1LKXA 4C3DA 3DJNB 3SXKA 1MQVA 1JPJA 2QE9A 3PMRA 4MVSA 3GM2A 1WN0A 4AE4B 1RKEB 3HNIA 3TQOA 1FFTC 1TFOB 5TJ5E 3H2UA 2L9JA 1TWCA 2JX0A 4JURI 4N4WA 2DI3A 1HY5A 1C02A 2UUIA 2FAPB 1AUEA 2VCCA 2YLGA 3L8JA 4U5HA 5T3WA 2OKUA 4KC9A 2J0WA 3UGPA 1Y4CA 2VCAA 4I1MA 1OKKD 4EKWA 2VCBA 2YL3A 3O10A 1D1CA 2QLAA 1LI5A 1CGNA 2EIJC 4MTGA 4NTFA 4YWQA 2NUTA 4UDVA 1ZHTA 1CGME 1M2VB 3EG9A 3ASNC 2WVQA 4IAQA 2WVNA 2O9XA 3TK0A 2UUHA 2XLDA 2ICWG 3BRJA 5KYNA 3M79A 2DGJA 2LP4A 3FHDA 1Y6DA 3G50A 3QMKA 5GPGB 3U9JA 4EUKB 3VRCA 3A11A 1RXQA 1YAUO 4JCZA 1OR2A 3SZRA 4CSAC 3NRHA 5A6BA 4PJLA 2L81A 4R32A 1LE4A 2DB4A 4XPWA 4LLEA 1QPUA 3SEOA 2WB7A 2G62A 3H65A 3RW0A 2WZLA 4Q7CA 5DQTA 2HJMA 5FZTA 2PP4A 3TULA 4WGZA 2EPNA 2KYHA 2AWCA 4PFOA 1FAPB 3G4XA 1JR8A 3NMIA 1OQCA 4CJOA 4YL3A 2XL6A 2WZGA 2YZSA 5CIVA 2MYSA 4O7GA 1C17M 3NYJA 3K1IA 4DVZA 1FMVA 4FESA 3CAXA 4OINF 4C3BA 1WASA 3C18A 3LESA 4QI2A 4JIOA 4JTDB 3T6BA 3PCVA 2Q00A 3EQLF 3KMIA 2LK4A 5A69A 2LFDA 4U9DA 3Q7GA
chains in the Genus database with same CATH topology
4U5GA 1BR1A 1D1AA 2D5RB 2G3VA 3UMHA 4P6IC 2HV7A 4I3MA 3K33A 2XXAB 1PD1A 4MQ9F 1ZYRF 2XL4A 5KYYA 5F5HA 3T4RA 2HV6A 5B1AC 3K66A 1ZU4A 4OIQF 1O5HA 1OKKA 4PK4A 4BJ5C 2W4MA 3F47A 3NDBB 3F46A 1D0ZA 3ABMC 2R7TA 3Q7LA 2W9YA 3V7OA 4DBRA 3B0PA 4LERA 1PD0A 2FGYA 2R7UA 1TWHA 3EH2A 4JVSA 5E33A 3VYWA 3ZG1A 5E3CA 3HLZA 3I5QA 4O6YA 2YEVA 2KJGA 2Q9BA 3W8HA 5KYUB 1IZMA 2PX0A 2KQ9A 3KH2A 4HFKB 4KBLA 4AK9A 1RJ9A 4KNWA 1G8XA 3NYMA 1OCZC 1D0XA 4JZAA 2PFDA 4CS8A 4QDLA 5KYWA 4CS9C 2V3CC 1D1BA 4RDAA 2LSEA 3W2WA 3AG1C 1IW7F 5D91A 4AX2A 3ITFA 2ZXWC 3K6BA 3KL4A 2H7BA 5CI9A 2G3KA 2WZFA 2KNHA 2CGEA 1J8YF 2I8BA 3OA1A 3ABKC 2IYLD 4J30B 3S27A 2J9WA 4MNDA 3LJBA 4N06A 2Y69C 3AG3C 3JYHA 1BR2A 4YJWA 2PX3A 4U5FE 4AE4A 5D92A 3B0VC 3FAJA 3HTKC 2R7SA 1OCRC 2ZXPA 3ZVRA 4ZLDA 2FFHA 4C7OB 3EFOB 1ZHWA 3RFYA 1QLEC 2NUTB 4DBQA 3EG9B 1JPNA 4J32B 3EGXB 3AG2C 2R7WA 3AQCA 4NY3A 3SYNA 1Z63A 3N0TA 1ZU5A 4O6NA 3ZIBA 3LLKA 1Z5ZA 1SMYF 4XTKA 3UNGC 4I44A 1ST6A 5KYXA 1VYIA 3DAFA 4RD9A 4CSAA 3EJNA 2EINC 3RIPA 3ECSA 5B1BC 2E87A 3ABLC 4IRUA 4K7BA 4Q5SF 3I5PA 1MMNA 4BJ1A 3O39A 3OWTA 5E3AA 1VMAA 2VH3A 5DVWA 3K7DA 1VK5A 3DM9B 4OD5A 5DS5A 2OCCC 2CNWD 1NZEA 2WL8A 3CSKA 1N1CA 3S0XA 4U5DE 2NUPB 5KYYB 2P6VA 4O79A 1KU2A 2XXAA 4BG0A 4BJ6C 3EH1A 3I4UA 3DJUB 4O6MA 5E2QA 4PFPA 1S7ZA 1Z23A 2P7VA 1ZHYA 4IWBA 1FMWA 4YT4A 1NU9C 2J0XA 4YT2A 4KNVA 5B3SC 3X2QC 4OD4A 4EWCA 3E9VA 4BJ5A 2Q9CA 4CIHA 3POVA 4WJ0A 2BE5F 3N2ZB 2IXPA 2R7OA 2EILC 5F5FA 1ZHZA 2J45A 3NG1A 3N24A 1RJ9B 1FFHA 1Z6AA 2C03A 4JCHA 5T1DB 2M4EA 2VASA 3T6JA 1TR2A 3DMDA 3PHF2 5KYWB 3DAGA 3GANA 4W8KA 2CNWA 3UMKA 2Y3HA 1VOMA 2Q9AA 2A6EF 4G0HA 3VAYA 2QY9A 1SZIA 4LACB 1VYKA 4OIOF 4CS9A 1MNDA 3EGDA 3QZCA 3ZC4A 1WGWA 3O6XA 3S28A 2VB6A 2H7VC 3UMIA 5IY5C 1W2WA 1J8MF 4XLNF 1MMAA 4Q4ZF 2J9UA 3LNRA 2J7PD 2CW0F 3B0UX 1MMGA 2IXMA 4FWVA 2JD3A 3CZ6A 3JT1A 2IXNA 2WVOA 5CI8A 4CBEA 4DOZA 4U5EE 2DYSC 3RYLA 4F4BA 2J9VA 4K0DA 4CS7A 1V55C 2J46A 5EHHA 4C3EA 1M2VA 4U5BE 3DXJF 2R7RA 4I1OB 4KI2A 2IXOA 2QTVA 3L0IA 4C7OA 3EFOA 2CDQA 2KW3C 2H7OA 2W45A 3K1HA 3DZAA 4XLPF 5BUOA 4GEHA 3NYLA 3JSZA 2A1DD 2NG1A 3EGXA 4EBBA 2Z15A 2DYRC 4OIPF 3K1IC 1TWGA 3M1CB 2XSEA 3KKBA 3L34A 3UR3C 2OG2A 5KYXB 1M57C 4IAOA 4BJTA 4QI0A 4YT5A 4X0RA 5DS4A 3EZIA 1O87A 3CQZA 3MX3A 4BEJA 4GYTA 4JJGA 3W8IA 2A6HF 4G7OF 3GODA 4JJFA 2ZPAA 5FCLA 3EHMA 2C04A 2KGOA 3S29A 5L3QA 3AG4C 1MMDA 3RKOF 4DVYP 1ZHXA 1PCXA 3EHNA 3EPVA 2B0JA 3E70C 2W4BA 3UGOA 4LLCA 2J7PA 1LVKA 1M2OA 3X1OA 5HSWA 4ULWA 1TKNA 2Y3BA 2Y3GA 4PJNA 3JRTA 1FTSA 3NKDA 2NUPA 2IOQA 3RH3A 3FDQA 4YT8A 4M63A 1NG1A 1Z3IX 3SNHA 2Y39A 4XWJA 5DS6A 3WG7C 2A68F 2MWQA 4G7HF 4G7ZF 2ZXOA 4BJ6A 5DQZA 4JW1A 3MLGA 3DM5A 3TD7A 2R7XA 3LS1A 1OCCC 5DLJA 2EIKC 5KYUA 4ANJA 5EGYA 2R7QA 1D0YA 1SF8A 3ASOC 2GFHA 5T3TA 4HE8D 3B9QA 2YHSA 4CS8C 4PJMA 4RBNA 3HJCA 1LS1A 3LEVA 1MNEA 2V26A 4PJJA 3LS0A 2A69F 4H4KC 1M56C 3LLIA 4HEAJ 1QZXA 3EZHA 2EIMC 4B6IA 2XRHA 3FVYA 3AQBA 2X51A 4E7ZA 1TWAA 4FX5A 4U5CE 4IJJA 3NKEA 4ZLCA 3OEOA 1V54C 2ZXRA 3SP1A 1NU7D 5L3VA 4A2NB 3W2VA 3Q6NA 2PF4E 3Q6MA 2R7VA 4E7SA 3EGDB 3IEEA 2Q3TA 4HFFB 4OIRF 4YN0B 3ZSUA 1OCOC 3JCUQ 3DD7A 2Y3DA 3LAYA 1BR4A 1LKXA 4C3DA 3DJNB 3PMRA 1JPJA 4AE4B 1FFTC 2L9JA 1TWCA 4JURI 3WODF 5T3WA 4U5HA 4KC9A 2J0WA 3UGPA 4I1MA 1OKKD 1D1CA 2EIJC 4YWQA 2NUTA 1ZHTA 1M2VB 3EG9A 3ASNC 2WVQA 2WVNA 2O9XA 5KYNA 2DGJA 3FHDA 3QMKA 3SZRA 4CSAC 3NRHA 4PJLA 2L81A 4LLEA 3SEOA 2WB7A 2G62A 3H65A 2WZLA 4Q7CA 5DQTA 2PP4A 4PFOA 2YZSA 2WZGA 2MYSA 4O7GA 3NYJA 4DVZA 1FMVA 4FESA 4OINF 4C3BA 3LESA 4QI2A 3T6BA 3EQLF 3KMIA 3Q7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5E E;  4U5G A;  4U5H A;  4U5B E;  4U5C E;  4U5D E;  4U5F E; 
#chains in the Genus database with same CATH topology
 1HMO A;  2P1A A;  4U5G A;  3VF0 A;  4FAP B;  1DOW A;  4ULV A;  1BR1 A;  1D1A A;  2D5R B;  2G3V A;  3UMH A;  4P6I C;  4EIY A;  2HV7 A;  3DWW A;  4I3M A;  3K33 A;  3S84 A;  2XXA B;  1PD1 A;  4MQ9 F;  5JS5 A;  2EPO A;  1ZYR F;  3QW1 A;  2XL4 A;  5KYY A;  2F22 A;  3TOL A;  5JUA A;  1G5Z A;  5BQI A;  1GM5 A;  2AWY A;  3IPM O;  5F5H A;  3T4R A;  2HV6 A;  4BEM J;  5B1A C;  3C7J A;  1GQA A;  3K66 A;  1T9K A;  4XEK A;  2IM8 A;  1ZU4 A;  2L6G A;  3G4Z A;  2NPU A;  3JYY A;  4OIQ F;  1O5H A;  1CPR A;  1OKK A;  4PK4 A;  4BJ5 C;  2W4M A;  4DRH B;  2HSQ A;  1L7C A;  3F47 A;  3ZTZ A;  3NDB B;  2HS5 A;  3F46 A;  1XZQ A;  1D0Z A;  3ABM C;  3R2P A;  2YL0 A;  2R7T A;  3BEH A;  3Q7L A;  2W9Y A;  3TJ5 A;  3V7O A;  1XWJ A;  4DBR A;  3B0P A;  4LER A;  2LQG A;  1PD0 A;  2FGY A;  4N6C A;  1YA9 A;  1TWH A;  2R7U A;  1JMW A;  3EH2 A;  3JSE O;  4JVS A;  5E33 A;  4CJG A;  3VYW A;  3H2V A;  1E85 A;  3ZG1 A;  2XLW A;  1I5N A;  5E3C A;  1TQG A;  2QNL A;  1APC A;  3HLZ A;  3I5Q A;  2YEV A;  4O6Y A;  2KJG A;  2Q9B A;  3W8H A;  5KYU B;  4XPX A;  4YL1 A;  1IZM A;  1GS9 A;  4GQH A;  2PX0 A;  3IQC A;  2KQ9 A;  1T6Q A;  2AVK A;  1YLM A;  1A0B A;  256B A;  2VC9 A;  3KH2 A;  4HFK B;  4KBL A;  4MS2 A;  2EPM X;  1H9G A;  4P9T A;  5JT4 A;  1BDJ B;  3HNL A;  2RSE B;  1M6T A;  1L3P A;  1Q0D A;  4MVZ A;  4AK9 A;  1RJ9 A;  3U8V A;  4KNW A;  1G8X A;  5A6B D;  3KYJ A;  3NYM A;  1BZ4 A;  1OCZ C;  1D0X A;  4JZA A;  2PFD A;  4CS8 A;  4QDL A;  1RCP A;  3ZDL A;  2CCY A;  1LE2 A;  5KYW A;  4CS9 C;  2V3C C;  2YLI A;  1D1B A;  1WWP A;  3GEI A;  3GWN A;  3B29 A;  2LSE A;  3C8G B;  4RDA A;  3W2W A;  4CDY A;  1OW8 A;  3GM1 A;  3AG1 C;  1LI7 A;  1IW7 F;  3WOD F;  5D91 A;  4AX2 A;  3ITF A;  3J06 A;  2ZXW C;  3K6B A;  3KL4 A;  2H7B A;  5CI9 A;  2G3K A;  2WZF A;  1HW1 A;  4AL0 A;  3GEH A;  2KNH A;  1ZW2 A;  2YWA A;  5K0I A;  3C8Z A;  1PV3 A;  2CGE A;  1J8Y F;  2I8B A;  5F28 E;  3OA1 A;  1NFO A;  3ABK C;  2XS1 A;  2IYL D;  3PDM P;  4J30 B;  3S27 A;  2J9W A;  4MND A;  4PAC A;  1HW2 A;  1EQ1 A;  3LJB A;  4N06 A;  2Y69 C;  3AG3 C;  3R7C A;  3JYH A;  1BR2 A;  3FAP B;  1Q0G A;  4YJW A;  2LIG A;  4LDQ A;  2P61 A;  2PX3 A;  1K05 A;  2XLE A;  4U5F E;  4AE4 A;  2YRF A;  1G4U S;  1RKE A;  1T6U A;  4DRI B;  1EA8 A;  4NCQ A;  5D92 A;  2P0N A;  3B0V C;  1NLX A;  3FAJ A;  3HTK C;  1YZA A;  3GWL A;  2R7S A;  1OCR C;  2ZXP A;  3ZVR A;  4ZLD A;  1QVX A;  2FFH A;  4C7O B;  5AC4 A;  3O55 A;  3EFO B;  1ZHW A;  2L7A A;  3DE8 A;  3RFY A;  1QLE C;  3S9O A;  4EBK A;  2NUT B;  1E83 A;  1NBB A;  3RQE A;  1K04 A;  4WAB A;  3EG9 B;  1JPN A;  4JKV A;  1G4W R;  4DBQ A;  2ETS A;  4J32 B;  3EGX B;  3AG2 C;  2R7W A;  4JEB A;  3AQC A;  5COG A;  3IQT A;  4NY3 A;  3SYN A;  5JVE A;  1RKC A;  1FNT c;  1NFN A;  1Z63 A;  1C03 A;  4DRJ B;  3N0T A;  1ZU5 A;  4O6N A;  3RF3 A;  3ZIB A;  2RD9 A;  3M4B A;  4IAR A;  2OU6 A;  3LLK A;  4IB4 A;  1Z5Z A;  1SMY F;  1RMV A;  4XTK A;  3UNG C;  4I44 A;  2D4U A;  1ST6 A;  5EK0 A;  3ZWI A;  5KYX A;  4JTC B;  1VYI A;  3DAF A;  4RD9 A;  2Q4F A;  2KSF A;  2NSF A;  4CSA A;  3EJN A;  2EIN C;  2AU5 A;  3RIP A;  1GGQ A;  3ECS A;  2XLH A;  4JC7 A;  5B1B C;  2E87 A;  2HZ8 A;  3ABL C;  4IRU A;  4K7B A;  4Q5S F;  3I5P A;  4Z9H A;  1MMN A;  3GEE A;  4BJ1 A;  3O39 A;  1V74 B;  3IHU A;  3OWT A;  5L0F A;  5E3A A;  1VMA A;  1OW6 A;  2IBF A;  3T6G B;  2VH3 A;  4J7T A;  1A41 A;  5DVW A;  3V5X A;  3K7D A;  1VK5 A;  1LPE A;  3DM9 B;  4OD5 A;  5DS5 A;  2HJ3 A;  2OCC C;  2HMQ A;  2CNW D;  1NZE A;  2XLM A;  3U3F A;  2WL8 A;  3CSK A;  3DE9 A;  4G78 A;  3MYI A;  5A6K A;  1N1C A;  4MVO A;  4U5D E;  2NUP B;  3S0X A;  5KYY B;  2HSB A;  3ATP A;  1JOG A;  3DI5 A;  4NC3 A;  2P6V A;  4O79 A;  3ZQV A;  5L0C A;  1KU2 A;  1E2X A;  2XXA A;  4MTO A;  3U3B A;  3SXM A;  1CPQ A;  1HE1 A;  4BG0 A;  2LFF A;  3AOU A;  4LDR A;  4BJ6 C;  1JAF A;  2PBE A;  2MHR A;  3EH1 A;  1E86 A;  3I4U A;  2GDC A;  3DJU B;  4O6M A;  5E2Q A;  4PFP A;  3U2L A;  3US6 A;  2ASR A;  4K1O A;  1S7Z A;  4XQ1 A;  3TOM A;  1Z23 A;  2P7V A;  3FMS A;  1ZHY A;  1H7I A;  2ZD9 A;  1OXB A;  4IWB A;  1FMW A;  4YT4 A;  1NU9 C;  3U2M A;  4NTB A;  1UG7 A;  1VTM P;  2J0X A;  3FOO A;  4YT2 A;  3FOP A;  1V4A A;  4KNV A;  4WGY A;  1SR2 A;  2R25 A;  2H8A A;  1T01 A;  4XEF A;  5B3S C;  3SXZ A;  4NTA A;  4CDV A;  2HFI A;  4OD4 A;  4P9F A;  3X2Q C;  4EWC A;  3E9V A;  3WAQ A;  4BJ5 A;  1H9T A;  2TMV P;  3IQ5 A;  4A4A A;  2Q9C A;  3ZQY A;  1EI7 A;  2R03 A;  4CDA A;  4CIH A;  3POV A;  4WJ0 A;  2BE5 F;  1TFK B;  2L6F A;  2IXP A;  3N2Z B;  4E18 A;  2R7O A;  3QW0 A;  2EIL C;  1OW7 A;  1I4Y A;  2XM4 A;  5F5F A;  5B3I A;  1R4T A;  5L0D A;  1FR0 A;  1ZHZ A;  4MW3 A;  2J45 A;  1VLT A;  4CX9 A;  3NG1 A;  3N24 A;  1Q0M A;  3V5Z A;  4JE9 A;  1RJ9 B;  4EBJ A;  4YK5 A;  1FFH A;  4PR9 A;  1KTM A;  1WOL A;  3NMJ A;  1Z6A A;  2C03 A;  3LNM B;  3L1M A;  4JCH A;  1KNY A;  2M4E A;  2YLD A;  4L6R A;  2VAS A;  4U9E A;  1TR2 A;  3DMD A;  3T6J A;  3PHF 2;  1ORY A;  2XS8 A;  2X0C A;  5KYW B;  3DAG A;  3GAN A;  4D4X A;  4W8K A;  2CNW A;  3UMK A;  3NMK A;  1H6G A;  2Y3H A;  1VOM A;  1QQ3 A;  2Q9A A;  1U0B B;  1S05 A;  2A6E F;  4G0H A;  2CYD A;  2A0B A;  1LS4 A;  4Z9I A;  1SZI A;  2QY9 A;  3VAY A;  4LAC B;  2NSG A;  4MVQ A;  1VYK A;  4OIO F;  2KC3 A;  1YVI A;  1MND A;  4CS9 A;  4EHP A;  3EGD A;  3GM3 A;  3QZC A;  5A6J A;  3ZC4 A;  1WGW A;  3O6X A;  3U5S A;  1YDI A;  3S28 A;  2VB6 A;  1U89 A;  1OXK A;  1HE9 A;  4XEV A;  3JRM O;  2H7V C;  2L6H A;  3UMI A;  5JRA A;  5IY5 C;  1W2W A;  3DKA A;  1J8M F;  4XLN F;  4D4N A;  1MMA A;  4Q4Z F;  2J9U A;  2Q7R A;  4CIP A;  5JP7 A;  1I4Z A;  3LNR A;  2J7P D;  2CW0 F;  1EKY A;  2OEX A;  1MMG A;  1QKR A;  2A0U A;  2IXM A;  1HMD A;  2QUP A;  4FWV A;  4BPM A;  3B0U X;  2YL1 A;  2JD3 A;  3CZ6 A;  3KYI A;  4H54 A;  4Z9J A;  3JT1 A;  2IXN A;  2WVO A;  5CI8 A;  3A9C A;  4CBE A;  4DOZ A;  4U5E E;  2DYS C;  5L0I A;  3QVY A;  2B0H A;  3RYL A;  4F4B A;  3QVZ A;  2J9V A;  1E84 A;  4K0D A;  5L0H A;  4CS7 A;  1V55 C;  2J46 A;  2EPL X;  5COF A;  2OJE D;  2AP3 A;  3SXY A;  5EHH A;  4C3E A;  1M2V A;  3KPH A;  3MFN A;  1OR3 A;  3DXJ F;  4U5B E;  3RVY A;  2R7R A;  3U8P A;  3W4Y A;  2J8W A;  4I1O B;  2IXO A;  2QTV A;  3L0I A;  3MBG A;  4E0H A;  5JLI A;  4KI2 A;  4C7O A;  3EFO A;  2CDQ A;  2KW3 C;  2H7O A;  2W45 A;  3K1H A;  5JSL A;  3DZA A;  4XLP F;  1Q0K A;  5BUO A;  3C63 A;  3S90 A;  4GEH A;  3NYL A;  3JSZ A;  2EPK X;  2A1D D;  2NG1 A;  3EGX A;  3T9O A;  3C62 A;  3ZTM A;  3RQG A;  2Z15 A;  4EBB A;  1O3U A;  2DYR C;  4OIP F;  4DXW A;  3K1I C;  3U0C A;  1TWG A;  4AL1 A;  3M1C B;  2XSE A;  3KKB A;  3L34 A;  3UR3 C;  1XZP A;  2OG2 A;  4J7Y A;  5KYX B;  3AJM A;  1B68 A;  1WAT A;  1M57 C;  4IAO A;  4JRZ A;  4BJT A;  4QI0 A;  2GWW A;  4YT5 A;  3RVZ A;  4X0R A;  2YL7 A;  1VLS A;  1UFB A;  2XL8 A;  5DS4 A;  3EZI A;  1O87 A;  3CQZ A;  3MX3 A;  4BEJ A;  4GYT A;  1SYQ A;  4JJG A;  3W8I A;  2A6H F;  4G7O F;  1YAR O;  3V5Y A;  3GOR A;  3GOD A;  1ZW3 A;  4JJF A;  2ZPA A;  5FCL A;  3EHM A;  2C04 A;  2KGO A;  3S29 A;  5L3Q A;  2YKZ A;  1MMD A;  3AG4 C;  2GA0 A;  3RKO F;  4DVY P;  1ZHX A;  1PCX A;  1BBH A;  2J9B A;  3EHN A;  3EPV A;  2B0J A;  3C8G D;  2R05 A;  2W4B A;  3E70 C;  4LLC A;  2R02 A;  5AGF A;  2J7P A;  3UGO A;  3AGT A;  3TJ6 A;  1LVK A;  1M2O A;  3X1O A;  5HSW A;  2OEV A;  4ULW A;  1TKN A;  3U9M A;  2Y3B A;  4ER9 A;  5L0G A;  2OQM A;  2Y3G A;  3IQ6 A;  4IGG A;  4PJN A;  2KK1 A;  5T1D B;  3JRT A;  4E17 A;  4MTF A;  1JRA A;  4DJ9 A;  1FTS A;  4MVM A;  4NQF A;  3NKD A;  3LEO A;  3M15 A;  2NUP A;  3M4C A;  2IOQ A;  3RH3 A;  2R9R B;  5HV9 A;  4JTA B;  3FDQ A;  1A7E A;  4YT8 A;  3QTH A;  4M63 A;  5BQG A;  1NG1 A;  1ZVZ A;  2PNO A;  1Z3I X;  1A7V A;  3SNH A;  2Y39 A;  4XWJ A;  5BQH A;  5DS6 A;  3WG7 C;  1T6I A;  1F1M A;  2A68 F;  2MWQ A;  4G7H F;  4G7Z F;  2ZXO A;  4BJ6 A;  5DQZ A;  4JW1 A;  2HKV A;  5COM A;  2M64 A;  3L8I A;  3MLG A;  3DM5 A;  3TD7 A;  2YQY A;  3LS1 A;  2R7X A;  1OCC C;  1R5I D;  1YZC A;  5DLJ A;  2EIK C;  5KYU A;  4ANJ A;  4LDK A;  2R7Q A;  1AEP A;  5EGY A;  1D0Y A;  1SF8 A;  2LD6 A;  3ASO C;  2GFH A;  2OJQ A;  3AGU A;  2XLV A;  4W8P A;  3VM6 A;  2HMZ A;  5T3T A;  1K40 A;  4HE8 D;  3B9Q A;  3FXH A;  4MVR A;  2YHS A;  4CS8 C;  1A7D A;  3HNJ A;  1LM3 B;  4PJM A;  4RBN A;  1ZZP A;  2HUJ A;  1LS1 A;  3HJC A;  3B71 A;  3LEV A;  1MNE A;  2V26 A;  4PJJ A;  3LS0 A;  2A69 F;  4H4K C;  2LCH A;  1M56 C;  3LLI A;  1YA7 O;  4HEA J;  1NSG B;  1QZX A;  3EZH A;  4N6H A;  2BC5 A;  2EIM C;  2XRH A;  3FVY A;  4B6I A;  1YYX A;  3AQB A;  3HNK A;  2X51 A;  4E7Z A;  1ORJ A;  1TWA A;  3MYF A;  3WHN A;  1T5O A;  1CGO A;  3C8G A;  3LUT B;  2I15 A;  3HKK A;  4FX5 A;  4IJJ A;  4U5C E;  5AC5 A;  3CEX A;  3NKE A;  4XPY A;  1YYJ A;  3OEO A;  1QSP A;  2XM0 A;  4ONS A;  4ZLC A;  1V54 C;  2OOC A;  2ZXR A;  5L0J A;  3SP1 A;  1NU7 D;  5L3V A;  2BL2 A;  4A2N B;  3W2V A;  3Q6N A;  2PF4 E;  3Q6M A;  1Z7Q c;  2YVK A;  2R7V A;  4E7S A;  1U6H A;  1ORS C;  2JPU A;  4MW8 A;  3EGD B;  2Q3T A;  3IEE A;  4HFF B;  4OIR F;  1YJG A;  4MVU A;  1LIH A;  2GAQ A;  3JTL O;  5A6A A;  1WTY A;  1DOV A;  2XLO A;  3RQF A;  4YL0 A;  1AVO B;  4YN0 B;  4JEA A;  4E0I A;  1VB5 A;  3ZSU A;  1OCO C;  3JCU Q;  3DD7 A;  1Q0F A;  2Y3D A;  3LAY A;  3JZ0 A;  1BR4 A;  1LKX A;  4C3D A;  3DJN B;  3SXK A;  1MQV A;  1JPJ A;  2QE9 A;  3PMR A;  4MVS A;  3GM2 A;  1WN0 A;  4AE4 B;  1RKE B;  3HNI A;  3TQO A;  1FFT C;  1TFO B;  5TJ5 E;  3H2U A;  2L9J A;  1TWC A;  2JX0 A;  4JUR I;  4N4W A;  2DI3 A;  1HY5 A;  1C02 A;  2UUI A;  2FAP B;  1AUE A;  2VCC A;  2YLG A;  3L8J A;  4U5H A;  5T3W A;  2OKU A;  4KC9 A;  2J0W A;  3UGP A;  1Y4C A;  2VCA A;  4I1M A;  1OKK D;  4EKW A;  2VCB A;  2YL3 A;  3O10 A;  1D1C A;  2QLA A;  1LI5 A;  1CGN A;  2EIJ C;  4MTG A;  4NTF A;  4YWQ A;  2NUT A;  4UDV A;  1ZHT A;  1CGM E;  1M2V B;  3EG9 A;  3ASN C;  2WVQ A;  4IAQ A;  2WVN A;  2O9X A;  3TK0 A;  2UUH A;  2XLD A;  2ICW G;  3BRJ A;  5KYN A;  3M79 A;  2DGJ A;  2LP4 A;  3FHD A;  1Y6D A;  3G50 A;  3QMK A;  5GPG B;  3U9J A;  4EUK B;  3VRC A;  3A11 A;  1RXQ A;  1YAU O;  4JCZ A;  1OR2 A;  3SZR A;  4CSA C;  3NRH A;  5A6B A;  4PJL A;  2L81 A;  4R32 A;  1LE4 A;  2DB4 A;  4XPW A;  4LLE A;  1QPU A;  3SEO A;  2WB7 A;  2G62 A;  3H65 A;  3RW0 A;  2WZL A;  4Q7C A;  5DQT A;  2HJM A;  5FZT A;  2PP4 A;  3TUL A;  4WGZ A;  2EPN A;  2KYH A;  2AWC A;  4PFO A;  1FAP B;  3G4X A;  1JR8 A;  3NMI A;  1OQC A;  4CJO A;  4YL3 A;  2XL6 A;  2WZG A;  2YZS A;  5CIV A;  2MYS A;  4O7G A;  1C17 M;  3NYJ A;  3K1I A;  4DVZ A;  1FMV A;  4FES A;  3CAX A;  4OIN F;  4C3B A;  1WAS A;  3C18 A;  3LES A;  4QI2 A;  4JIO A;  4JTD B;  3T6B A;  3PCV A;  2Q00 A;  3EQL F;  3KMI A;  2LK4 A;  5A69 A;  2LFD A;  4U9D A;  3Q7G A; 
#chains in the Genus database with same CATH homology
 4U5G A;  1BR1 A;  1D1A A;  2D5R B;  2G3V A;  3UMH A;  4P6I C;  2HV7 A;  4I3M A;  3K33 A;  2XXA B;  1PD1 A;  4MQ9 F;  1ZYR F;  2XL4 A;  5KYY A;  5F5H A;  3T4R A;  2HV6 A;  5B1A C;  3K66 A;  1ZU4 A;  4OIQ F;  1O5H A;  1OKK A;  4PK4 A;  4BJ5 C;  2W4M A;  3F47 A;  3NDB B;  3F46 A;  1D0Z A;  3ABM C;  2R7T A;  3Q7L A;  2W9Y A;  3V7O A;  4DBR A;  3B0P A;  4LER A;  1PD0 A;  2FGY A;  2R7U A;  1TWH A;  3EH2 A;  4JVS A;  5E33 A;  3VYW A;  3ZG1 A;  5E3C A;  3HLZ A;  3I5Q A;  4O6Y A;  2YEV A;  2KJG A;  2Q9B A;  3W8H A;  5KYU B;  1IZM A;  2PX0 A;  2KQ9 A;  3KH2 A;  4HFK B;  4KBL A;  4AK9 A;  1RJ9 A;  4KNW A;  1G8X A;  3NYM A;  1OCZ C;  1D0X A;  4JZA A;  2PFD A;  4CS8 A;  4QDL A;  5KYW A;  4CS9 C;  2V3C C;  1D1B A;  4RDA A;  2LSE A;  3W2W A;  3AG1 C;  1IW7 F;  5D91 A;  4AX2 A;  3ITF A;  2ZXW C;  3K6B A;  3KL4 A;  2H7B A;  5CI9 A;  2G3K A;  2WZF A;  2KNH A;  2CGE A;  1J8Y F;  2I8B A;  3OA1 A;  3ABK C;  2IYL D;  4J30 B;  3S27 A;  2J9W A;  4MND A;  3LJB A;  4N06 A;  2Y69 C;  3AG3 C;  3JYH A;  1BR2 A;  4YJW A;  2PX3 A;  4U5F E;  4AE4 A;  5D92 A;  3B0V C;  3FAJ A;  3HTK C;  2R7S A;  1OCR C;  2ZXP A;  3ZVR A;  4ZLD A;  2FFH A;  4C7O B;  3EFO B;  1ZHW A;  3RFY A;  1QLE C;  2NUT B;  4DBQ A;  3EG9 B;  1JPN A;  4J32 B;  3EGX B;  3AG2 C;  2R7W A;  3AQC A;  4NY3 A;  3SYN A;  1Z63 A;  3N0T A;  1ZU5 A;  4O6N A;  3ZIB A;  3LLK A;  1Z5Z A;  1SMY F;  4XTK A;  3UNG C;  4I44 A;  1ST6 A;  5KYX A;  1VYI A;  3DAF A;  4RD9 A;  4CSA A;  3EJN A;  2EIN C;  3RIP A;  3ECS A;  5B1B C;  2E87 A;  3ABL C;  4IRU A;  4K7B A;  4Q5S F;  3I5P A;  1MMN A;  4BJ1 A;  3O39 A;  3OWT A;  5E3A A;  1VMA A;  2VH3 A;  5DVW A;  3K7D A;  1VK5 A;  3DM9 B;  4OD5 A;  5DS5 A;  2OCC C;  2CNW D;  1NZE A;  2WL8 A;  3CSK A;  1N1C A;  3S0X A;  4U5D E;  2NUP B;  5KYY B;  2P6V A;  4O79 A;  1KU2 A;  2XXA A;  4BG0 A;  4BJ6 C;  3EH1 A;  3I4U A;  3DJU B;  4O6M A;  5E2Q A;  4PFP A;  1S7Z A;  1Z23 A;  2P7V A;  1ZHY A;  4IWB A;  1FMW A;  4YT4 A;  1NU9 C;  2J0X A;  4YT2 A;  4KNV A;  5B3S C;  3X2Q C;  4OD4 A;  4EWC A;  3E9V A;  4BJ5 A;  2Q9C A;  4CIH A;  3POV A;  4WJ0 A;  2BE5 F;  3N2Z B;  2IXP A;  2R7O A;  2EIL C;  5F5F A;  1ZHZ A;  2J45 A;  3NG1 A;  3N24 A;  1RJ9 B;  1FFH A;  1Z6A A;  2C03 A;  4JCH A;  5T1D B;  2M4E A;  2VAS A;  3T6J A;  1TR2 A;  3DMD A;  3PHF 2;  5KYW B;  3DAG A;  3GAN A;  4W8K A;  2CNW A;  3UMK A;  2Y3H A;  1VOM A;  2Q9A A;  2A6E F;  4G0H A;  3VAY A;  2QY9 A;  1SZI A;  4LAC B;  1VYK A;  4OIO F;  4CS9 A;  1MND A;  3EGD A;  3QZC A;  3ZC4 A;  1WGW A;  3O6X A;  3S28 A;  2VB6 A;  2H7V C;  3UMI A;  5IY5 C;  1W2W A;  1J8M F;  4XLN F;  1MMA A;  4Q4Z F;  2J9U A;  3LNR A;  2J7P D;  2CW0 F;  3B0U X;  1MMG A;  2IXM A;  4FWV A;  2JD3 A;  3CZ6 A;  3JT1 A;  2IXN A;  2WVO A;  5CI8 A;  4CBE A;  4DOZ A;  4U5E E;  2DYS C;  3RYL A;  4F4B A;  2J9V A;  4K0D A;  4CS7 A;  1V55 C;  2J46 A;  5EHH A;  4C3E A;  1M2V A;  4U5B E;  3DXJ F;  2R7R A;  4I1O B;  4KI2 A;  2IXO A;  2QTV A;  3L0I A;  4C7O A;  3EFO A;  2CDQ A;  2KW3 C;  2H7O A;  2W45 A;  3K1H A;  3DZA A;  4XLP F;  5BUO A;  4GEH A;  3NYL A;  3JSZ A;  2A1D D;  2NG1 A;  3EGX A;  4EBB A;  2Z15 A;  2DYR C;  4OIP F;  3K1I C;  1TWG A;  3M1C B;  2XSE A;  3KKB A;  3L34 A;  3UR3 C;  2OG2 A;  5KYX B;  1M57 C;  4IAO A;  4BJT A;  4QI0 A;  4YT5 A;  4X0R A;  5DS4 A;  3EZI A;  1O87 A;  3CQZ A;  3MX3 A;  4BEJ A;  4GYT A;  4JJG A;  3W8I A;  2A6H F;  4G7O F;  3GOD A;  4JJF A;  2ZPA A;  5FCL A;  3EHM A;  2C04 A;  2KGO A;  3S29 A;  5L3Q A;  3AG4 C;  1MMD A;  3RKO F;  4DVY P;  1ZHX A;  1PCX A;  3EHN A;  3EPV A;  2B0J A;  3E70 C;  2W4B A;  3UGO A;  4LLC A;  2J7P A;  1LVK A;  1M2O A;  3X1O A;  5HSW A;  4ULW A;  1TKN A;  2Y3B A;  2Y3G A;  4PJN A;  3JRT A;  1FTS A;  3NKD A;  2NUP A;  2IOQ A;  3RH3 A;  3FDQ A;  4YT8 A;  4M63 A;  1NG1 A;  1Z3I X;  3SNH A;  2Y39 A;  4XWJ A;  5DS6 A;  3WG7 C;  2A68 F;  2MWQ A;  4G7H F;  4G7Z F;  2ZXO A;  4BJ6 A;  5DQZ A;  4JW1 A;  3MLG A;  3DM5 A;  3TD7 A;  2R7X A;  3LS1 A;  1OCC C;  5DLJ A;  2EIK C;  5KYU A;  4ANJ A;  5EGY A;  2R7Q A;  1D0Y A;  1SF8 A;  3ASO C;  2GFH A;  5T3T A;  4HE8 D;  3B9Q A;  2YHS A;  4CS8 C;  4PJM A;  4RBN A;  3HJC A;  1LS1 A;  3LEV A;  1MNE A;  2V26 A;  4PJJ A;  3LS0 A;  2A69 F;  4H4K C;  1M56 C;  3LLI A;  4HEA J;  1QZX A;  3EZH A;  2EIM C;  4B6I A;  2XRH A;  3FVY A;  3AQB A;  2X51 A;  4E7Z A;  1TWA A;  4FX5 A;  4U5C E;  4IJJ A;  3NKE A;  4ZLC A;  3OEO A;  1V54 C;  2ZXR A;  3SP1 A;  1NU7 D;  5L3V A;  4A2N B;  3W2V A;  3Q6N A;  2PF4 E;  3Q6M A;  2R7V A;  4E7S A;  3EGD B;  3IEE A;  2Q3T A;  4HFF B;  4OIR F;  4YN0 B;  3ZSU A;  1OCO C;  3JCU Q;  3DD7 A;  2Y3D A;  3LAY A;  1BR4 A;  1LKX A;  4C3D A;  3DJN B;  3PMR A;  1JPJ A;  4AE4 B;  1FFT C;  2L9J A;  1TWC A;  4JUR I;  3WOD F;  5T3W A;  4U5H A;  4KC9 A;  2J0W A;  3UGP A;  4I1M A;  1OKK D;  1D1C A;  2EIJ C;  4YWQ A;  2NUT A;  1ZHT A;  1M2V B;  3EG9 A;  3ASN C;  2WVQ A;  2WVN A;  2O9X A;  5KYN A;  2DGJ A;  3FHD A;  3QMK A;  3SZR A;  4CSA C;  3NRH A;  4PJL A;  2L81 A;  4LLE A;  3SEO A;  2WB7 A;  2G62 A;  3H65 A;  2WZL A;  4Q7C A;  5DQT A;  2PP4 A;  4PFO A;  2YZS A;  2WZG A;  2MYS A;  4O7G A;  3NYJ A;  4DVZ A;  1FMV A;  4FES A;  4OIN F;  4C3B A;  3LES A;  4QI2 A;  3T6B A;  3EQL F;  3KMI A;  3Q7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...