4U5HA

Crystal structure of con-ikot-ikot toxin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
85
structure length
85
Chain Sequence
b'GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Con-ikot-ikot
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Conus striatus
molecule tags Toxin
total genus 29
structure length 85
sequence length 85
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5hA00
4U5GA 4U5HA 4U5EE 4U5FE 4U5DE 4U5BE 4U5CE
chains in the Genus database with same CATH superfamily
4OD5A 1TFOB 2RD9A 3ECSA 1NFNA 4RBNA 4DRHB 3LUTB 5A6JA 1OXBA 3NKDA 1YARO 2D4UA 2HFIA 5E3CA 4G7OF 4XEFA 4G7HF 5KYXB 4C7OA 4EWCA 1RMVA 2ZXPA 4MS2A 4U5GA 4UDVA 3ZQYA 5FCLA 2Y69C 4P6IC 4U5FE 4W8PA 3HNLA 3FMSA 3JSEO 1BR4A 1JPNA 2EIJC 1Z5ZA 2R7OA 3DXJF 1K04A 1GS9A 2HJ3A 2ICWG 3EHMA 1TWAA 4JZAA 1T6QA 1ZW2A 3S0XA 1LS4A 4A4AA 3UGOA 3LNRA 1YLMA 3TQOA 1OW6A 3HTKC 4QI0A 1ZHYA 1N1CA 4FX5A 4BJTA 2EIKC 3IPMO 3JT1A 2A0BA 3JTLO 4BJ6C 4ANJA 1HE9A 2XLWA 3EFOB 2P7VA 4EUKB 1SYQA 5TJ5E 3L8JA 5D91A 2CGEA 3ITFA 3O6XA 3IQCA 4FAPB 1YVIA 2CYDA 3AG4C 2IYLD 2G3VA 2YHSA 4MW8A 2LQGA 2MYSA 1NU7D 2YL0A 2XXAA 2R7WA 2PP4A 4LLEA 3U3BA 4YL1A 2D5RB 4MVSA 1YAUO 4FWVA 4R32A 1R4TA 4FESA 5E33A 1YZCA 4AE4A 2IXMA 4JURI 1KU2A 1E83A 3EG9B 3I5QA 2IOQA 2EPKX 3MYFA 3AGTA 5L3QA 2W4MA 2WL8A 4DRJB 4YL0A 4OIRF 2QLAA 5JUAA 5E3AA 1M2VA 2IBFA 4MVUA 2YL7A 2R7SA 3NYJA 4Z9HA 2HS5A 4Q4ZF 1RJ9A 2VCAA 3Q6NA 4K1OA 4QDLA 3SP1A 1U6HA 2VC9A 1D1AA 3FVYA 1OCOC 3JCUQ 4ULWA 1ZHXA 1OCZC 1CGOA 1S05A 3BRJA 1OKKD 3PMRA 4DRIB 4YT4A 1LS1A 2V3CC 4IWBA 5L0DA 1A7VA 3K1IA 3HNIA 1VOMA 3B0PA 2G3KA 3C7JA 5BQIA 4J7YA 3VYWA 5JT4A 4XLPF 2XL8A 3LLIA 2Q9BA 1LPEA 1MMAA 3V5YA 2YL3A 3K7DA 2YLIA 4JTCB 1OR3A 3DJUB 4IB4A 2KYHA 2YVKA 2XLMA 3RF3A 2P1AA 3ZIBA 1NZEA 3EQLF 2PX0A 1HW1A 4L6RA 1KTMA 4JKVA 4B6IA 5CI8A 3FDQA 1A7DA 2AWYA 1YYXA 2XLHA 2A6HF 3B9QA 3Q7LA 4O6MA 2Q9AA 4E17A 2HUJA 4AX2A 5T3TA 1YA9A 3EH1A 3DMDA 1K40A 3GEEA 5F5HA 1C03A 3AG3C 5JLIA 1GM5A 3HNJA 1LIHA 1M56C 2TMVP 2GA0A 4IRUA 2KJGA 2P0NA 2Q00A 2OQMA 3TK0A 2J9VA 3N0TA 1J8MF 1OW8A 3I5PA 3POVA 1Y6DA 3DD7A 3ZG1A 4C3EA 1I5NA 1D0XA 4NY3A 4N6HA 1QLEC 1ZYRF 2CW0F 2Y3DA 3C63A 3I4UA 2J9BA 4XEKA 1HMDA 3WG7C 2W4BA 1NU9C 2P61A 3MX3A 4WABA 1OKKA 3CSKA 4K0DA 2NUTA 3ZSUA 1VB5A 2J45A 5JVEA 2NUPA 1QSPA 1WATA 5DQTA 3Q7GA 1QZXA 1KNYA 5JSLA 4KBLA 3UMIA 1C02A 4CDAA 1Z63A 2HZ8A 3O39A 3TD7A 5K0IA 2DB4A 2LK4A 1ORSC 2WVNA 3MFNA 4I44A 5DS5A 1NSGB 4BPMA 3IQ6A 1CGNA 4H54A 4MW3A 1F1MA 2MWQA 3LESA 2PBEA 3AOUA 4JJFA 2OEVA 4XLNF 3HLZA 2M4EA 3C8GB 3V5XA 4XTKA 4CIHA 1I4YA 4NCQA 2YKZA 3SXMA 2GDCA 1DOVA 3AJMA 3VAYA 5A6AA 3SXZA 1SZIA 1Q0MA 1ST6A 5B3SC 1E2XA 3E9VA 2H7BA 2V26A 5GPGB 4CBEA 4NTFA 2LFFA 1OR2A 3NYMA 2ZPAA 3TJ5A 3ZTZA 2DYRC 3V7OA 4YN0B 4M63A 1FMWA 3ZC4A 3QTHA 3ASOC 4DOZA 1L3PA 4IJJA 3UR3C 4C7OB 3GODA 3T6GB 4QI2A 2R7VA 4CJGA 4P9FA 2XS1A 4MVZA 4OIQF 4IARA 4LDRA 1PD1A 1YZAA 4WJ0A 1D0ZA 1K05A 2CDQA 5BQGA 1HE1A 2L9JA 1S7ZA 3DM5A 4HFKB 3JRMO 2L6FA 2WVOA 1RXQA 3NRHA 4MTFA 4ULVA 2QY9A 5CIVA 4GEHA 4DXWA 2AWCA 3AQBA 4XPXA 4IAQA 3RQEA 3US6A 1RKEA 4AL1A 1UG7A 2EPNA 1XWJA 3KMIA 1YYJA 3IQ5A 1OCRC 2OJED 4JEAA 4YJWA 4YT8A 1MMNA 2ETSA 2IXNA 1RCPA 4U5EE 1MQVA 5KYYB 1TQGA 2DGJA 2QNLA 2HSBA 1NBBA 3AGUA 2C03A 1A0BA 3ZTMA 1TFKB 3CEXA 3K6BA 2NG1A 2M64A 1GQAA 2KC3A 4CDVA 2PX3A 3FOPA 4D4NA 2J7PD 2Y3BA 3SYNA 1V55C 2CNWD 3JYYA 1WN0A 2P6VA 3GM3A 3L34A 4MTOA 3T6BA 3UMHA 3EHNA 3KKBA 4NC3A 3VF0A 5KYXA 4HE8D 4EIYA 4HFFB 1TR2A 3QZCA 1G5ZA 3UNGC 2WZFA 4AE4B 5L0JA 5T1DB 2R05A 1JR8A 5B1AC 3WHNA 5COFA 4E18A 5KYUB 3TOMA 4JJGA 1HY5A 1M2VB 2L81A 3EJNA 4J7TA 5BQHA 3B71A 4DBQA 3WODF 3G4XA 2R03A 1PD0A 4JCZA 3FHDA 1A41A 1VLTA 2LFDA 3U2MA 3KYJA 4CS8A 3B0VC 3PCVA 1M2OA 4G7ZF 2Q4FA 3S27A 3RVZA 1FFTC 4DVZA 3EFOA 4MQ9F 1DOWA 3JYHA 3NMKA 1H9GA 3EGXA 3V5ZA 4ZLDA 1FTSA 3N2ZB 2HKVA 2YQYA 4Z9JA 3KH2A 4PK4A 4BJ1A 3GM1A 2J7PA 4XQ1A 5JRAA 4RD9A 4EBBA 2VB6A 3DE9A 4KI2A 1JRAA 2CNWA 2LP4A 4Q7CA 4RDAA 2AU5A 2A68F 4PJJA 4C3DA 3S9OA 1L7CA 3SNHA 3UMKA 3LJBA 1M57C 2OG2A 3M4BA 2XS8A 4AK9A 5KYWB 2YZSA 5L0FA 3NG1A 5COGA 5B3IA 4LDKA 2KW3C 3GWLA 2X51A 2FAPB 2BE5F 2O9XA 3EG9A 1Z3IX 2B0JA 3GORA 3TOLA 3FOOA 5DQZA 3GANA 2YEVA 2YRFA 4N06A 1SMYF 2XXAB 3ZQVA 2A6EF 4JW1A 3M15A 3NMJA 3A11A 1XZPA 2QTVA 4O7GA 3R7CA 5AGFA 2KNHA 2VCCA 4N4WA 3J06A 4YT5A 2PF4E 2PFDA 4KC9A 4KNVA 3IHUA 2NUTB 3EGDA 3G50A 1T6IA 3DKAA 1M6TA 2LCHA 1IZMA 2NUPB 2H7VC 2MHRA 1B68A 1OXKA 2L6GA 2YWAA 5EK0A 2R02A 4K7BA 3A9CA 4E0IA 4U5HA 5L0GA 1R5ID 3H65A 3O55A 3W4YA 1QVXA 2KK1A 3TULA 3RW0A 1D1BA 2H7OA 2J9UA 2XM4A 1FR0A 4DVYP 4PJMA 4DBRA 1FMVA 2IM8A 1Z6AA 3GM2A 3PDMP 1Z23A 1EA8A 4PR9A 1T01A 3DWWA 1BR1A 3B29A 1BR2A 1CPQA 2ZXWC 2NPUA 3W8IA 1TWCA 2HV7A 3LAYA 4G0HA 4WGYA 4PFPA 4BJ6A 3S90A 1OW7A 4I1OB 4CSAA 1V4AA 1QQ3A 3LLKA 5EGYA 2CCYA 3K66A 2XLEA 4WGZA 3SXYA 1T5OA 3U0CA 2VH3A 1TWHA 4OIOF 4MVMA 1EQ1A 1SF8A 5A69A 2I15A 3LEVA 3QVYA 4PJNA 1NLXA 1FAPB 2I8BA 1T6UA 2HJMA 5DS4A 4JCHA 5HV9A 4CS8C 1ZU5A 2XRHA 5L3VA 3VRCA 2BL2A 1YJGA 3M1CB 1JMWA 2A0UA 2ZD9A 2GFHA 3C18A 3OEOA 3ZVRA 1XZQA 4I3MA 2A69F 3LNMB 1ORYA 2R25A 3DZAA 3GWNA 4XEVA 5DS6A 1Q0DA 1IW7F 2YLDA 2R7RA 3M4CA 4ZLCA 1TWGA 2OKUA 5DLJA 4U5CE 2H8AA 3T4RA 1E84A 2Z15A 3ASNC 1HW2A 3K1IC 1Q0FA 5JP7A 2R7UA 2AVKA 4X0RA 3AQCA 4IGGA 1H6GA 4O6YA 1LI7A 2L7AA 3L0IA 3OA1A 2GAQA 4U5BE 5CI9A 3LS1A 1ZHTA 3NYLA 3GEHA 1WASA 2IXPA 4CS9A 4O79A 3HJCA 1RKCA 1WTYA 1OQCA 1ZW3A 4HEAJ 1HMOA 4JE9A 2EPMX 1VYIA 4PFOA 1BDJB 1H9TA 1EI7A 1YDIA 1LE4A 2F22A 2KSFA 1WOLA 3F47A 1D0YA 2HMZA 1LE2A 5AC5A 3S84A 1A7EA 3X2QC 2HSQA 1ZHZA 2KQ9A 3W2WA 4MTGA 3RFYA 3UGPA 4NTBA 3EZIA 4NQFA 5E2QA 1I4ZA 3B0UX 2EILC 2OOCA 3Q6MA 4MNDA 1CGME 3HNKA 4N6CA 4KNWA 4YT2A 1LKXA 4G78A 5L0CA 1SR2A 3AG2C 2X0CA 3W2VA 3WAQA 5JS5A 1AEPA 1ZU4A 3W8HA 4ER9A 4CJOA 4EKWA 2JX0A 2LIGA 1ZZPA 3DE8A 3RQFA 2QUPA 2G62A 1G4WR 4E0HA 2XL4A 2XLOA 2C04A 1YA7O 1CPRA 2XL6A 3N24A 2ZXOA 4NTAA 4XWJA 1GGQA 3DI5A 2EINC 4A2NB 2EPLX 3LEOA 2Q3TA 2YL1A 1E85A 3H2UA 3IQTA 1Q0KA 1WGWA 1WWPA 4CX9A 4CSAC 1RJ9B 3C8ZA 3MYIA 4E7SA 2OEXA 4JEBA 4JRZA 3RIPA 3TJ6A 3EGXB 1AVOB 1JPJA 1NFOA 2JPUA 4D4XA 5KYYA 1G4US 2A1DD 3L1MA 3ZWIA 4EHPA 2E87A 2DI3A 2IXOA 5A6BD 5HSWA 1FFHA 1NG1A 1D1CA 4YWQA 3NKEA 2R9RB 3H2VA 3X1OA 4LACB 3BEHA 3JRTA 1AUEA 4MVQA 3ABKC 4BJ5A 3EH2A 1TKNA 4ONSA 4PJLA 2OJQA 4AL0A 4J30B 2ZXRA 1VLSA 3GEIA 3F46A 2R7XA 3U5SA 3JZ0A 1O3UA 3C62A 2XLVA 4P9TA 4F4BA 4J32B 3QMKA 4GYTA 3U8PA 3ATPA 2J8WA 3E70C 1BZ4A 5KYUA 2J0WA 2Q9CA 2R7TA 1VMAA 4LDQA 2Y39A 1J8YF 1Y4CA 2BC5A 4CS9C 4OD4A 2OCCC 3G4ZA 5IY5C 1T9KA 1E86A 1QKRA 3T9OA 2PNOA 2L6HA 2XM0A 3FAPB 3EGDB 1MNDA 2UUIA 2R7QA 2JD3A 1V74B 3ABMC 1OCCC 2W45A 4OINF 1VYKA 3DJNB 4YL3A 2XLDA 3K33A 3SXKA 5EHHA 2KGOA 3T6JA 2QE9A 1U0BB 3U9MA 1APCA 5A6BA 4DJ9A 4PACA 3FXHA 3VM6A 4JIOA 3RQGA 1UFBA 5FZTA 2FGYA 3SEOA 1PV3A 4U9DA 3S29A 2YLGA 3MBGA 4CDYA 3U9JA 3RYLA 4BEJA 2HMQA 3L8IA 5KYWA 1ZVZA 3CZ6A 3NMIA 3AG1C 4U5DE 2ASRA 3DAGA 4H4KC 3QVZA 4JTDB 5B1BC 3U2LA 2DYSC 3HKKA 2NSFA 3C8GD 1QPUA 3LS0A 2EIMC 4MVRA 4JTAB 3U3FA 4EBKA 1H7IA 3CAXA 4CIPA 1U89A 1VTMP 2GWWA 3OWTA 3R2PA 3CQZA 4CS7A 2XSEA 5DVWA 4Q5SF 4I1MA 1ZHWA 1JAFA 2Y3GA 5D92A 1VK5A 1FNTc 5A6KA 4U9EA 2J9WA 2RSEB 4XPWA 3RVYA 4MVOA 2J46A 2WZLA 4BEMJ 2HV6A 1Q0GA 1V54C 3PHF2 5L0IA 5T3WA 1O5HA 3KYIA 3O10A 2NSGA 3QW1A 4GQHA 5F28E 1O87A 4YK5A 4O6NA 4JC7A 2VCBA 3DAFA 2LD6A 4BJ5C 3KPHA 4IAOA 4EBJA 256BA 1BBHA 3FAJA 3NDBB 3M79A 1G8XA 1LVKA 3DM9B 4C3BA 2WZGA 1EKYA 2OU6A 2UUHA 3MLGA 1LI5A 4W8KA 1LM3B 1W2WA 2LSEA 2WVQA 2Q7RA 3QW0A 3K1HA 1C17M 1ORJA 3C8GA 4XPYA 5AC4A 4LERA 1MMDA 1RKEB 3EZHA 5KYNA 2VASA 3KL4A 2FFHA 2Y3HA 3JSZA 4LLCA 5COMA 1JOGA 4JVSA 3ABLC 3EPVA 2WB7A 3IEEA 3U8VA 5F5FA 4OIPF 1MNEA 3ZDLA 4BG0A 2AP3A 3SZRA 3RH3A 2EPOA 4Z9IA 2J0XA 1Z7Qc 2B0HA 4E7ZA 5BUOA 3RKOF 1PCXA 5L0HA 2W9YA 3S28A 1MMGA
chains in the Genus database with same CATH topology
4OD5A 3ECSA 4RBNA 3NKDA 5E3CA 4G7OF 4G7HF 5KYXB 4C7OA 4EWCA 2ZXPA 4U5GA 5FCLA 2Y69C 4P6IC 4U5FE 1BR4A 1JPNA 2EIJC 1Z5ZA 2R7OA 3DXJF 3EHMA 1TWAA 4JZAA 3S0XA 3UGOA 3LNRA 3HTKC 4QI0A 1ZHYA 1N1CA 4FX5A 4BJTA 2EIKC 3JT1A 4BJ6C 4ANJA 3EFOB 2P7VA 5D91A 2CGEA 3ITFA 3O6XA 3AG4C 2IYLD 2G3VA 2YHSA 2XXAA 2MYSA 1NU7D 2R7WA 2PP4A 4LLEA 2D5RB 4FWVA 4FESA 5E33A 4AE4A 2IXMA 4JURI 1KU2A 3EG9B 3I5QA 2IOQA 5L3QA 2W4MA 2WL8A 4OIRF 5E3AA 1M2VA 2R7SA 3NYJA 1RJ9A 3Q6NA 3SP1A 4QDLA 3FVYA 1D1AA 1OCOC 3JCUQ 4ULWA 1ZHXA 1OCZC 3PMRA 1OKKD 4YT4A 1LS1A 2V3CC 4IWBA 1VOMA 3B0PA 2G3KA 4XLPF 3VYWA 3LLIA 2Q9BA 1MMAA 3K7DA 3DJUB 3ZIBA 1NZEA 3EQLF 2PX0A 4B6IA 5CI8A 3FDQA 2A6HF 3B9QA 3Q7LA 4O6MA 2Q9AA 4AX2A 5T3TA 3EH1A 3DMDA 5F5HA 3AG3C 1M56C 4IRUA 2KJGA 2J9VA 3N0TA 1J8MF 3POVA 3I5PA 3DD7A 3ZG1A 4C3EA 1D0XA 4NY3A 1QLEC 1ZYRF 2CW0F 2Y3DA 3I4UA 3WG7C 2W4BA 1NU9C 2NUTA 3MX3A 1OKKA 3CSKA 4K0DA 3ZSUA 2J45A 2NUPA 5DQTA 3Q7GA 1QZXA 1Z63A 4KBLA 3UMIA 3O39A 3TD7A 2WVNA 4I44A 2MWQA 3LESA 4JJFA 4XLNF 3HLZA 2M4EA 4XTKA 4CIHA 3VAYA 1SZIA 1ST6A 5B3SC 3E9VA 2H7BA 2V26A 4CBEA 3NYMA 2ZPAA 2DYRC 3V7OA 4YN0B 4M63A 1FMWA 3ZC4A 3ASOC 4DOZA 4QI2A 4IJJA 3UR3C 4C7OB 3GODA 2R7VA 4OIQF 1PD1A 4WJ0A 1D0ZA 2CDQA 2L9JA 3DM5A 1S7ZA 4HFKB 2WVOA 3NRHA 2QY9A 4GEHA 3AQBA 3KMIA 1OCRC 4YJWA 4YT8A 1MMNA 2IXNA 4U5EE 5KYYB 2DGJA 2C03A 3K6BA 2NG1A 2XXAB 2PX3A 2J7PD 2Y3BA 3SYNA 1V55C 2CNWD 2P6VA 3T6BA 3L34A 4Q4ZF 3UMHA 5DS5A 3EHNA 3KKBA 5KYXA 4HE8D 4HFFB 1TR2A 3QZCA 3UNGC 4AE4B 2WZFA 5T1DB 5B1AC 5KYUB 4JJGA 1M2VB 2L81A 3EJNA 4DBQA 3WODF 1PD0A 3FHDA 4CS8A 3B0VC 1M2OA 4G7ZF 3S27A 1FFTC 4DVZA 3EFOA 4MQ9F 3JYHA 4ZLDA 3EGXA 1FTSA 3N2ZB 3KH2A 4PK4A 4BJ1A 2J7PA 4RD9A 4EBBA 2VB6A 4KI2A 2CNWA 4Q7CA 4RDAA 2A68F 4PJJA 4C3DA 3SNHA 3UMKA 3LJBA 1M57C 2OG2A 4AK9A 5KYWB 2YZSA 3NG1A 2KW3C 2X51A 2BE5F 2O9XA 3EG9A 1Z3IX 2B0JA 5DQZA 3GANA 2YEVA 4N06A 1SMYF 2A6EF 4JW1A 2QTVA 4O7GA 2KNHA 4YT5A 2PF4E 2PFDA 4KC9A 4KNVA 2NUTB 3EGDA 1IZMA 2NUPB 2H7VC 4K7BA 4U5HA 3H65A 1D1BA 2H7OA 2J9UA 4DVYP 4PJMA 4DBRA 1FMVA 1Z6AA 1Z23A 1BR1A 1BR2A 2ZXWC 3W8IA 1TWCA 2HV7A 3LAYA 4G0HA 4BJ6A 4PFPA 4I1OB 4CSAA 3LLKA 5EGYA 3K66A 2VH3A 1TWHA 4OIOF 1SF8A 3LEVA 4PJNA 5DS4A 2I8BA 4JCHA 4CS8C 1ZU5A 2XRHA 5L3VA 3M1CB 3OEOA 2GFHA 3ZVRA 4I3MA 2A69F 5DS6A 3DZAA 1IW7F 2R7RA 4ZLCA 1TWGA 5DLJA 4U5CE 3T4RA 2Z15A 3ASNC 3K1IC 2R7UA 4X0RA 3AQCA 4U5BE 5CI9A 4O6YA 3OA1A 3L0IA 3S29A 3LS1A 1ZHTA 3NYLA 2IXPA 4CS9A 4O79A 3HJCA 4HEAJ 4PFOA 1VYIA 3F47A 1D0YA 3X2QC 1ZHZA 2KQ9A 3W2WA 3UGPA 3RFYA 3EZIA 5E2QA 3B0UX 2EILC 4MNDA 3Q6MA 4KNWA 4YT2A 1LKXA 3AG2C 3W2VA 1ZU4A 3W8HA 2G62A 2XL4A 2C04A 3N24A 2ZXOA 4XWJA 2EINC 4A2NB 2Q3TA 1WGWA 4CSAC 1RJ9B 4E7SA 3RIPA 3EGXB 5KYYA 1JPJA 2A1DD 2E87A 5HSWA 2IXOA 1FFHA 1NG1A 1D1CA 4YWQA 3NKEA 3X1OA 4LACB 3JRTA 3ABKC 4BJ5A 3EH2A 1TKNA 4PJLA 4J30B 2ZXRA 3F46A 2R7XA 4F4BA 4J32B 3QMKA 4GYTA 3E70C 5KYUA 2R7TA 2J0WA 2Q9CA 1VMAA 2Y39A 1J8YF 4CS9C 4OD4A 2OCCC 5IY5C 3EGDB 1MNDA 2R7QA 2JD3A 3ABMC 1OCCC 2W45A 4OINF 1VYKA 3DJNB 5EHHA 3K33A 2KGOA 3T6JA 3SEOA 2FGYA 3RYLA 4BEJA 5KYWA 3CZ6A 3AG1C 4U5DE 3DAGA 4H4KC 5B1BC 2DYSC 3LS0A 2EIMC 3OWTA 3CQZA 4CS7A 2XSEA 5DVWA 4Q5SF 4I1MA 1ZHWA 5D92A 2Y3GA 1VK5A 2J9WA 2J46A 2WZLA 2HV6A 1V54C 3PHF2 5T3WA 1O5HA 1O87A 4O6NA 3DAFA 4BJ5C 4IAOA 3FAJA 3NDBB 1G8XA 1LVKA 3DM9B 4C3BA 2WZGA 3MLGA 4W8KA 1W2WA 2LSEA 2WVQA 3K1HA 4LERA 1MMDA 5KYNA 3EZHA 2VASA 3KL4A 2FFHA 2Y3HA 3JSZA 4LLCA 4JVSA 3ABLC 3EPVA 2WB7A 3IEEA 5F5FA 4OIPF 1MNEA 4BG0A 3SZRA 3RH3A 4E7ZA 2J0XA 5BUOA 3RKOF 1PCXA 2W9YA 3S28A 1MMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5G A;  4U5H A;  4U5E E;  4U5F E;  4U5D E;  4U5B E;  4U5C E; 
#chains in the Genus database with same CATH topology
 4OD5 A;  1TFO B;  2RD9 A;  3ECS A;  1NFN A;  4RBN A;  4DRH B;  3LUT B;  5A6J A;  1OXB A;  3NKD A;  1YAR O;  2D4U A;  2HFI A;  5E3C A;  4G7O F;  4XEF A;  4G7H F;  5KYX B;  4C7O A;  4EWC A;  1RMV A;  2ZXP A;  4MS2 A;  4U5G A;  4UDV A;  3ZQY A;  5FCL A;  2Y69 C;  4P6I C;  4U5F E;  4W8P A;  3HNL A;  3FMS A;  3JSE O;  1BR4 A;  1JPN A;  2EIJ C;  1Z5Z A;  2R7O A;  3DXJ F;  1K04 A;  1GS9 A;  2HJ3 A;  2ICW G;  3EHM A;  1TWA A;  4JZA A;  1T6Q A;  1ZW2 A;  3S0X A;  1LS4 A;  4A4A A;  3UGO A;  3LNR A;  1YLM A;  3TQO A;  1OW6 A;  3HTK C;  4QI0 A;  1ZHY A;  1N1C A;  4FX5 A;  4BJT A;  2EIK C;  3IPM O;  3JT1 A;  2A0B A;  3JTL O;  4BJ6 C;  4ANJ A;  1HE9 A;  2XLW A;  3EFO B;  2P7V A;  4EUK B;  1SYQ A;  5TJ5 E;  3L8J A;  5D91 A;  2CGE A;  3ITF A;  3O6X A;  3IQC A;  4FAP B;  1YVI A;  2CYD A;  3AG4 C;  2IYL D;  2G3V A;  2YHS A;  4MW8 A;  2LQG A;  2MYS A;  1NU7 D;  2YL0 A;  2XXA A;  2R7W A;  2PP4 A;  4LLE A;  3U3B A;  4YL1 A;  2D5R B;  4MVS A;  1YAU O;  4FWV A;  4R32 A;  1R4T A;  4FES A;  5E33 A;  1YZC A;  4AE4 A;  2IXM A;  4JUR I;  1KU2 A;  1E83 A;  3EG9 B;  3I5Q A;  2IOQ A;  2EPK X;  3MYF A;  3AGT A;  5L3Q A;  2W4M A;  2WL8 A;  4DRJ B;  4YL0 A;  4OIR F;  2QLA A;  5JUA A;  5E3A A;  1M2V A;  2IBF A;  4MVU A;  2YL7 A;  2R7S A;  3NYJ A;  4Z9H A;  2HS5 A;  4Q4Z F;  1RJ9 A;  2VCA A;  3Q6N A;  4K1O A;  4QDL A;  3SP1 A;  1U6H A;  2VC9 A;  1D1A A;  3FVY A;  1OCO C;  3JCU Q;  4ULW A;  1ZHX A;  1OCZ C;  1CGO A;  1S05 A;  3BRJ A;  1OKK D;  3PMR A;  4DRI B;  4YT4 A;  1LS1 A;  2V3C C;  4IWB A;  5L0D A;  1A7V A;  3K1I A;  3HNI A;  1VOM A;  3B0P A;  2G3K A;  3C7J A;  5BQI A;  4J7Y A;  3VYW A;  5JT4 A;  4XLP F;  2XL8 A;  3LLI A;  2Q9B A;  1LPE A;  1MMA A;  3V5Y A;  2YL3 A;  3K7D A;  2YLI A;  4JTC B;  1OR3 A;  3DJU B;  4IB4 A;  2KYH A;  2YVK A;  2XLM A;  3RF3 A;  2P1A A;  3ZIB A;  1NZE A;  3EQL F;  2PX0 A;  1HW1 A;  4L6R A;  1KTM A;  4JKV A;  4B6I A;  5CI8 A;  3FDQ A;  1A7D A;  2AWY A;  1YYX A;  2XLH A;  2A6H F;  3B9Q A;  3Q7L A;  4O6M A;  2Q9A A;  4E17 A;  2HUJ A;  4AX2 A;  5T3T A;  1YA9 A;  3EH1 A;  3DMD A;  1K40 A;  3GEE A;  5F5H A;  1C03 A;  3AG3 C;  5JLI A;  1GM5 A;  3HNJ A;  1LIH A;  1M56 C;  2TMV P;  2GA0 A;  4IRU A;  2KJG A;  2P0N A;  2Q00 A;  2OQM A;  3TK0 A;  2J9V A;  3N0T A;  1J8M F;  1OW8 A;  3I5P A;  3POV A;  1Y6D A;  3DD7 A;  3ZG1 A;  4C3E A;  1I5N A;  1D0X A;  4NY3 A;  4N6H A;  1QLE C;  1ZYR F;  2CW0 F;  2Y3D A;  3C63 A;  3I4U A;  2J9B A;  4XEK A;  1HMD A;  3WG7 C;  2W4B A;  1NU9 C;  2P61 A;  3MX3 A;  4WAB A;  1OKK A;  3CSK A;  4K0D A;  2NUT A;  3ZSU A;  1VB5 A;  2J45 A;  5JVE A;  2NUP A;  1QSP A;  1WAT A;  5DQT A;  3Q7G A;  1QZX A;  1KNY A;  5JSL A;  4KBL A;  3UMI A;  1C02 A;  4CDA A;  1Z63 A;  2HZ8 A;  3O39 A;  3TD7 A;  5K0I A;  2DB4 A;  2LK4 A;  1ORS C;  2WVN A;  3MFN A;  4I44 A;  5DS5 A;  1NSG B;  4BPM A;  3IQ6 A;  1CGN A;  4H54 A;  4MW3 A;  1F1M A;  2MWQ A;  3LES A;  2PBE A;  3AOU A;  4JJF A;  2OEV A;  4XLN F;  3HLZ A;  2M4E A;  3C8G B;  3V5X A;  4XTK A;  4CIH A;  1I4Y A;  4NCQ A;  2YKZ A;  3SXM A;  2GDC A;  1DOV A;  3AJM A;  3VAY A;  5A6A A;  3SXZ A;  1SZI A;  1Q0M A;  1ST6 A;  5B3S C;  1E2X A;  3E9V A;  2H7B A;  2V26 A;  5GPG B;  4CBE A;  4NTF A;  2LFF A;  1OR2 A;  3NYM A;  2ZPA A;  3TJ5 A;  3ZTZ A;  2DYR C;  3V7O A;  4YN0 B;  4M63 A;  1FMW A;  3ZC4 A;  3QTH A;  3ASO C;  4DOZ A;  1L3P A;  4IJJ A;  3UR3 C;  4C7O B;  3GOD A;  3T6G B;  4QI2 A;  2R7V A;  4CJG A;  4P9F A;  2XS1 A;  4MVZ A;  4OIQ F;  4IAR A;  4LDR A;  1PD1 A;  1YZA A;  4WJ0 A;  1D0Z A;  1K05 A;  2CDQ A;  5BQG A;  1HE1 A;  2L9J A;  1S7Z A;  3DM5 A;  4HFK B;  3JRM O;  2L6F A;  2WVO A;  1RXQ A;  3NRH A;  4MTF A;  4ULV A;  2QY9 A;  5CIV A;  4GEH A;  4DXW A;  2AWC A;  3AQB A;  4XPX A;  4IAQ A;  3RQE A;  3US6 A;  1RKE A;  4AL1 A;  1UG7 A;  2EPN A;  1XWJ A;  3KMI A;  1YYJ A;  3IQ5 A;  1OCR C;  2OJE D;  4JEA A;  4YJW A;  4YT8 A;  1MMN A;  2ETS A;  2IXN A;  1RCP A;  4U5E E;  1MQV A;  5KYY B;  1TQG A;  2DGJ A;  2QNL A;  2HSB A;  1NBB A;  3AGU A;  2C03 A;  1A0B A;  3ZTM A;  1TFK B;  3CEX A;  3K6B A;  2NG1 A;  2M64 A;  1GQA A;  2KC3 A;  4CDV A;  2PX3 A;  3FOP A;  4D4N A;  2J7P D;  2Y3B A;  3SYN A;  1V55 C;  2CNW D;  3JYY A;  1WN0 A;  2P6V A;  3GM3 A;  3L34 A;  4MTO A;  3T6B A;  3UMH A;  3EHN A;  3KKB A;  4NC3 A;  3VF0 A;  5KYX A;  4HE8 D;  4EIY A;  4HFF B;  1TR2 A;  3QZC A;  1G5Z A;  3UNG C;  2WZF A;  4AE4 B;  5L0J A;  5T1D B;  2R05 A;  1JR8 A;  5B1A C;  3WHN A;  5COF A;  4E18 A;  5KYU B;  3TOM A;  4JJG A;  1HY5 A;  1M2V B;  2L81 A;  3EJN A;  4J7T A;  5BQH A;  3B71 A;  4DBQ A;  3WOD F;  3G4X A;  2R03 A;  1PD0 A;  4JCZ A;  3FHD A;  1A41 A;  1VLT A;  2LFD A;  3U2M A;  3KYJ A;  4CS8 A;  3B0V C;  3PCV A;  1M2O A;  4G7Z F;  2Q4F A;  3S27 A;  3RVZ A;  1FFT C;  4DVZ A;  3EFO A;  4MQ9 F;  1DOW A;  3JYH A;  3NMK A;  1H9G A;  3EGX A;  3V5Z A;  4ZLD A;  1FTS A;  3N2Z B;  2HKV A;  2YQY A;  4Z9J A;  3KH2 A;  4PK4 A;  4BJ1 A;  3GM1 A;  2J7P A;  4XQ1 A;  5JRA A;  4RD9 A;  4EBB A;  2VB6 A;  3DE9 A;  4KI2 A;  1JRA A;  2CNW A;  2LP4 A;  4Q7C A;  4RDA A;  2AU5 A;  2A68 F;  4PJJ A;  4C3D A;  3S9O A;  1L7C A;  3SNH A;  3UMK A;  3LJB A;  1M57 C;  2OG2 A;  3M4B A;  2XS8 A;  4AK9 A;  5KYW B;  2YZS A;  5L0F A;  3NG1 A;  5COG A;  5B3I A;  4LDK A;  2KW3 C;  3GWL A;  2X51 A;  2FAP B;  2BE5 F;  2O9X A;  3EG9 A;  1Z3I X;  2B0J A;  3GOR A;  3TOL A;  3FOO A;  5DQZ A;  3GAN A;  2YEV A;  2YRF A;  4N06 A;  1SMY F;  2XXA B;  3ZQV A;  2A6E F;  4JW1 A;  3M15 A;  3NMJ A;  3A11 A;  1XZP A;  2QTV A;  4O7G A;  3R7C A;  5AGF A;  2KNH A;  2VCC A;  4N4W A;  3J06 A;  4YT5 A;  2PF4 E;  2PFD A;  4KC9 A;  4KNV A;  3IHU A;  2NUT B;  3EGD A;  3G50 A;  1T6I A;  3DKA A;  1M6T A;  2LCH A;  1IZM A;  2NUP B;  2H7V C;  2MHR A;  1B68 A;  1OXK A;  2L6G A;  2YWA A;  5EK0 A;  2R02 A;  4K7B A;  3A9C A;  4E0I A;  4U5H A;  5L0G A;  1R5I D;  3H65 A;  3O55 A;  3W4Y A;  1QVX A;  2KK1 A;  3TUL A;  3RW0 A;  1D1B A;  2H7O A;  2J9U A;  2XM4 A;  1FR0 A;  4DVY P;  4PJM A;  4DBR A;  1FMV A;  2IM8 A;  1Z6A A;  3GM2 A;  3PDM P;  1Z23 A;  1EA8 A;  4PR9 A;  1T01 A;  3DWW A;  1BR1 A;  3B29 A;  1BR2 A;  1CPQ A;  2ZXW C;  2NPU A;  3W8I A;  1TWC A;  2HV7 A;  3LAY A;  4G0H A;  4WGY A;  4PFP A;  4BJ6 A;  3S90 A;  1OW7 A;  4I1O B;  4CSA A;  1V4A A;  1QQ3 A;  3LLK A;  5EGY A;  2CCY A;  3K66 A;  2XLE A;  4WGZ A;  3SXY A;  1T5O A;  3U0C A;  2VH3 A;  1TWH A;  4OIO F;  4MVM A;  1EQ1 A;  1SF8 A;  5A69 A;  2I15 A;  3LEV A;  3QVY A;  4PJN A;  1NLX A;  1FAP B;  2I8B A;  1T6U A;  2HJM A;  5DS4 A;  4JCH A;  5HV9 A;  4CS8 C;  1ZU5 A;  2XRH A;  5L3V A;  3VRC A;  2BL2 A;  1YJG A;  3M1C B;  1JMW A;  2A0U A;  2ZD9 A;  2GFH A;  3C18 A;  3OEO A;  3ZVR A;  1XZQ A;  4I3M A;  2A69 F;  3LNM B;  1ORY A;  2R25 A;  3DZA A;  3GWN A;  4XEV A;  5DS6 A;  1Q0D A;  1IW7 F;  2YLD A;  2R7R A;  3M4C A;  4ZLC A;  1TWG A;  2OKU A;  5DLJ A;  4U5C E;  2H8A A;  3T4R A;  1E84 A;  2Z15 A;  3ASN C;  1HW2 A;  3K1I C;  1Q0F A;  5JP7 A;  2R7U A;  2AVK A;  4X0R A;  3AQC A;  4IGG A;  1H6G A;  4O6Y A;  1LI7 A;  2L7A A;  3L0I A;  3OA1 A;  2GAQ A;  4U5B E;  5CI9 A;  3LS1 A;  1ZHT A;  3NYL A;  3GEH A;  1WAS A;  2IXP A;  4CS9 A;  4O79 A;  3HJC A;  1RKC A;  1WTY A;  1OQC A;  1ZW3 A;  4HEA J;  1HMO A;  4JE9 A;  2EPM X;  1VYI A;  4PFO A;  1BDJ B;  1H9T A;  1EI7 A;  1YDI A;  1LE4 A;  2F22 A;  2KSF A;  1WOL A;  3F47 A;  1D0Y A;  2HMZ A;  1LE2 A;  5AC5 A;  3S84 A;  1A7E A;  3X2Q C;  2HSQ A;  1ZHZ A;  2KQ9 A;  3W2W A;  4MTG A;  3RFY A;  3UGP A;  4NTB A;  3EZI A;  4NQF A;  5E2Q A;  1I4Z A;  3B0U X;  2EIL C;  2OOC A;  3Q6M A;  4MND A;  1CGM E;  3HNK A;  4N6C A;  4KNW A;  4YT2 A;  1LKX A;  4G78 A;  5L0C A;  1SR2 A;  3AG2 C;  2X0C A;  3W2V A;  3WAQ A;  5JS5 A;  1AEP A;  1ZU4 A;  3W8H A;  4ER9 A;  4CJO A;  4EKW A;  2JX0 A;  2LIG A;  1ZZP A;  3DE8 A;  3RQF A;  2QUP A;  2G62 A;  1G4W R;  4E0H A;  2XL4 A;  2XLO A;  2C04 A;  1YA7 O;  1CPR A;  2XL6 A;  3N24 A;  2ZXO A;  4NTA A;  4XWJ A;  1GGQ A;  3DI5 A;  2EIN C;  4A2N B;  2EPL X;  3LEO A;  2Q3T A;  2YL1 A;  1E85 A;  3H2U A;  3IQT A;  1Q0K A;  1WGW A;  1WWP A;  4CX9 A;  4CSA C;  1RJ9 B;  3C8Z A;  3MYI A;  4E7S A;  2OEX A;  4JEB A;  4JRZ A;  3RIP A;  3TJ6 A;  3EGX B;  1AVO B;  1JPJ A;  1NFO A;  2JPU A;  4D4X A;  5KYY A;  1G4U S;  2A1D D;  3L1M A;  3ZWI A;  4EHP A;  2E87 A;  2DI3 A;  2IXO A;  5A6B D;  5HSW A;  1FFH A;  1NG1 A;  1D1C A;  4YWQ A;  3NKE A;  2R9R B;  3H2V A;  3X1O A;  4LAC B;  3BEH A;  3JRT A;  1AUE A;  4MVQ A;  3ABK C;  4BJ5 A;  3EH2 A;  1TKN A;  4ONS A;  4PJL A;  2OJQ A;  4AL0 A;  4J30 B;  2ZXR A;  1VLS A;  3GEI A;  3F46 A;  2R7X A;  3U5S A;  3JZ0 A;  1O3U A;  3C62 A;  2XLV A;  4P9T A;  4F4B A;  4J32 B;  3QMK A;  4GYT A;  3U8P A;  3ATP A;  2J8W A;  3E70 C;  1BZ4 A;  5KYU A;  2J0W A;  2Q9C A;  2R7T A;  1VMA A;  4LDQ A;  2Y39 A;  1J8Y F;  1Y4C A;  2BC5 A;  4CS9 C;  4OD4 A;  2OCC C;  3G4Z A;  5IY5 C;  1T9K A;  1E86 A;  1QKR A;  3T9O A;  2PNO A;  2L6H A;  2XM0 A;  3FAP B;  3EGD B;  1MND A;  2UUI A;  2R7Q A;  2JD3 A;  1V74 B;  3ABM C;  1OCC C;  2W45 A;  4OIN F;  1VYK A;  3DJN B;  4YL3 A;  2XLD A;  3K33 A;  3SXK A;  5EHH A;  2KGO A;  3T6J A;  2QE9 A;  1U0B B;  3U9M A;  1APC A;  5A6B A;  4DJ9 A;  4PAC A;  3FXH A;  3VM6 A;  4JIO A;  3RQG A;  1UFB A;  5FZT A;  2FGY A;  3SEO A;  1PV3 A;  4U9D A;  3S29 A;  2YLG A;  3MBG A;  4CDY A;  3U9J A;  3RYL A;  4BEJ A;  2HMQ A;  3L8I A;  5KYW A;  1ZVZ A;  3CZ6 A;  3NMI A;  3AG1 C;  4U5D E;  2ASR A;  3DAG A;  4H4K C;  3QVZ A;  4JTD B;  5B1B C;  3U2L A;  2DYS C;  3HKK A;  2NSF A;  3C8G D;  1QPU A;  3LS0 A;  2EIM C;  4MVR A;  4JTA B;  3U3F A;  4EBK A;  1H7I A;  3CAX A;  4CIP A;  1U89 A;  1VTM P;  2GWW A;  3OWT A;  3R2P A;  3CQZ A;  4CS7 A;  2XSE A;  5DVW A;  4Q5S F;  4I1M A;  1ZHW A;  1JAF A;  2Y3G A;  5D92 A;  1VK5 A;  1FNT c;  5A6K A;  4U9E A;  2J9W A;  2RSE B;  4XPW A;  3RVY A;  4MVO A;  2J46 A;  2WZL A;  4BEM J;  2HV6 A;  1Q0G A;  1V54 C;  3PHF 2;  5L0I A;  5T3W A;  1O5H A;  3KYI A;  3O10 A;  2NSG A;  3QW1 A;  4GQH A;  5F28 E;  1O87 A;  4YK5 A;  4O6N A;  4JC7 A;  2VCB A;  3DAF A;  2LD6 A;  4BJ5 C;  3KPH A;  4IAO A;  4EBJ A;  256B A;  1BBH A;  3FAJ A;  3NDB B;  3M79 A;  1G8X A;  1LVK A;  3DM9 B;  4C3B A;  2WZG A;  1EKY A;  2OU6 A;  2UUH A;  3MLG A;  1LI5 A;  4W8K A;  1LM3 B;  1W2W A;  2LSE A;  2WVQ A;  2Q7R A;  3QW0 A;  3K1H A;  1C17 M;  1ORJ A;  3C8G A;  4XPY A;  5AC4 A;  4LER A;  1MMD A;  1RKE B;  3EZH A;  5KYN A;  2VAS A;  3KL4 A;  2FFH A;  2Y3H A;  3JSZ A;  4LLC A;  5COM A;  1JOG A;  4JVS A;  3ABL C;  3EPV A;  2WB7 A;  3IEE A;  3U8V A;  5F5F A;  4OIP F;  1MNE A;  3ZDL A;  4BG0 A;  2AP3 A;  3SZR A;  3RH3 A;  2EPO A;  4Z9I A;  2J0X A;  1Z7Q c;  2B0H A;  4E7Z A;  5BUO A;  3RKO F;  1PCX A;  5L0H A;  2W9Y A;  3S28 A;  1MMG A; 
#chains in the Genus database with same CATH homology
 4OD5 A;  3ECS A;  4RBN A;  3NKD A;  5E3C A;  4G7O F;  4G7H F;  5KYX B;  4C7O A;  4EWC A;  2ZXP A;  4U5G A;  5FCL A;  2Y69 C;  4P6I C;  4U5F E;  1BR4 A;  1JPN A;  2EIJ C;  1Z5Z A;  2R7O A;  3DXJ F;  3EHM A;  1TWA A;  4JZA A;  3S0X A;  3UGO A;  3LNR A;  3HTK C;  4QI0 A;  1ZHY A;  1N1C A;  4FX5 A;  4BJT A;  2EIK C;  3JT1 A;  4BJ6 C;  4ANJ A;  3EFO B;  2P7V A;  5D91 A;  2CGE A;  3ITF A;  3O6X A;  3AG4 C;  2IYL D;  2G3V A;  2YHS A;  2XXA A;  2MYS A;  1NU7 D;  2R7W A;  2PP4 A;  4LLE A;  2D5R B;  4FWV A;  4FES A;  5E33 A;  4AE4 A;  2IXM A;  4JUR I;  1KU2 A;  3EG9 B;  3I5Q A;  2IOQ A;  5L3Q A;  2W4M A;  2WL8 A;  4OIR F;  5E3A A;  1M2V A;  2R7S A;  3NYJ A;  1RJ9 A;  3Q6N A;  3SP1 A;  4QDL A;  3FVY A;  1D1A A;  1OCO C;  3JCU Q;  4ULW A;  1ZHX A;  1OCZ C;  3PMR A;  1OKK D;  4YT4 A;  1LS1 A;  2V3C C;  4IWB A;  1VOM A;  3B0P A;  2G3K A;  4XLP F;  3VYW A;  3LLI A;  2Q9B A;  1MMA A;  3K7D A;  3DJU B;  3ZIB A;  1NZE A;  3EQL F;  2PX0 A;  4B6I A;  5CI8 A;  3FDQ A;  2A6H F;  3B9Q A;  3Q7L A;  4O6M A;  2Q9A A;  4AX2 A;  5T3T A;  3EH1 A;  3DMD A;  5F5H A;  3AG3 C;  1M56 C;  4IRU A;  2KJG A;  2J9V A;  3N0T A;  1J8M F;  3POV A;  3I5P A;  3DD7 A;  3ZG1 A;  4C3E A;  1D0X A;  4NY3 A;  1QLE C;  1ZYR F;  2CW0 F;  2Y3D A;  3I4U A;  3WG7 C;  2W4B A;  1NU9 C;  2NUT A;  3MX3 A;  1OKK A;  3CSK A;  4K0D A;  3ZSU A;  2J45 A;  2NUP A;  5DQT A;  3Q7G A;  1QZX A;  1Z63 A;  4KBL A;  3UMI A;  3O39 A;  3TD7 A;  2WVN A;  4I44 A;  2MWQ A;  3LES A;  4JJF A;  4XLN F;  3HLZ A;  2M4E A;  4XTK A;  4CIH A;  3VAY A;  1SZI A;  1ST6 A;  5B3S C;  3E9V A;  2H7B A;  2V26 A;  4CBE A;  3NYM A;  2ZPA A;  2DYR C;  3V7O A;  4YN0 B;  4M63 A;  1FMW A;  3ZC4 A;  3ASO C;  4DOZ A;  4QI2 A;  4IJJ A;  3UR3 C;  4C7O B;  3GOD A;  2R7V A;  4OIQ F;  1PD1 A;  4WJ0 A;  1D0Z A;  2CDQ A;  2L9J A;  3DM5 A;  1S7Z A;  4HFK B;  2WVO A;  3NRH A;  2QY9 A;  4GEH A;  3AQB A;  3KMI A;  1OCR C;  4YJW A;  4YT8 A;  1MMN A;  2IXN A;  4U5E E;  5KYY B;  2DGJ A;  2C03 A;  3K6B A;  2NG1 A;  2XXA B;  2PX3 A;  2J7P D;  2Y3B A;  3SYN A;  1V55 C;  2CNW D;  2P6V A;  3T6B A;  3L34 A;  4Q4Z F;  3UMH A;  5DS5 A;  3EHN A;  3KKB A;  5KYX A;  4HE8 D;  4HFF B;  1TR2 A;  3QZC A;  3UNG C;  4AE4 B;  2WZF A;  5T1D B;  5B1A C;  5KYU B;  4JJG A;  1M2V B;  2L81 A;  3EJN A;  4DBQ A;  3WOD F;  1PD0 A;  3FHD A;  4CS8 A;  3B0V C;  1M2O A;  4G7Z F;  3S27 A;  1FFT C;  4DVZ A;  3EFO A;  4MQ9 F;  3JYH A;  4ZLD A;  3EGX A;  1FTS A;  3N2Z B;  3KH2 A;  4PK4 A;  4BJ1 A;  2J7P A;  4RD9 A;  4EBB A;  2VB6 A;  4KI2 A;  2CNW A;  4Q7C A;  4RDA A;  2A68 F;  4PJJ A;  4C3D A;  3SNH A;  3UMK A;  3LJB A;  1M57 C;  2OG2 A;  4AK9 A;  5KYW B;  2YZS A;  3NG1 A;  2KW3 C;  2X51 A;  2BE5 F;  2O9X A;  3EG9 A;  1Z3I X;  2B0J A;  5DQZ A;  3GAN A;  2YEV A;  4N06 A;  1SMY F;  2A6E F;  4JW1 A;  2QTV A;  4O7G A;  2KNH A;  4YT5 A;  2PF4 E;  2PFD A;  4KC9 A;  4KNV A;  2NUT B;  3EGD A;  1IZM A;  2NUP B;  2H7V C;  4K7B A;  4U5H A;  3H65 A;  1D1B A;  2H7O A;  2J9U A;  4DVY P;  4PJM A;  4DBR A;  1FMV A;  1Z6A A;  1Z23 A;  1BR1 A;  1BR2 A;  2ZXW C;  3W8I A;  1TWC A;  2HV7 A;  3LAY A;  4G0H A;  4BJ6 A;  4PFP A;  4I1O B;  4CSA A;  3LLK A;  5EGY A;  3K66 A;  2VH3 A;  1TWH A;  4OIO F;  1SF8 A;  3LEV A;  4PJN A;  5DS4 A;  2I8B A;  4JCH A;  4CS8 C;  1ZU5 A;  2XRH A;  5L3V A;  3M1C B;  3OEO A;  2GFH A;  3ZVR A;  4I3M A;  2A69 F;  5DS6 A;  3DZA A;  1IW7 F;  2R7R A;  4ZLC A;  1TWG A;  5DLJ A;  4U5C E;  3T4R A;  2Z15 A;  3ASN C;  3K1I C;  2R7U A;  4X0R A;  3AQC A;  4U5B E;  5CI9 A;  4O6Y A;  3OA1 A;  3L0I A;  3S29 A;  3LS1 A;  1ZHT A;  3NYL A;  2IXP A;  4CS9 A;  4O79 A;  3HJC A;  4HEA J;  4PFO A;  1VYI A;  3F47 A;  1D0Y A;  3X2Q C;  1ZHZ A;  2KQ9 A;  3W2W A;  3UGP A;  3RFY A;  3EZI A;  5E2Q A;  3B0U X;  2EIL C;  4MND A;  3Q6M A;  4KNW A;  4YT2 A;  1LKX A;  3AG2 C;  3W2V A;  1ZU4 A;  3W8H A;  2G62 A;  2XL4 A;  2C04 A;  3N24 A;  2ZXO A;  4XWJ A;  2EIN C;  4A2N B;  2Q3T A;  1WGW A;  4CSA C;  1RJ9 B;  4E7S A;  3RIP A;  3EGX B;  5KYY A;  1JPJ A;  2A1D D;  2E87 A;  5HSW A;  2IXO A;  1FFH A;  1NG1 A;  1D1C A;  4YWQ A;  3NKE A;  3X1O A;  4LAC B;  3JRT A;  3ABK C;  4BJ5 A;  3EH2 A;  1TKN A;  4PJL A;  4J30 B;  2ZXR A;  3F46 A;  2R7X A;  4F4B A;  4J32 B;  3QMK A;  4GYT A;  3E70 C;  5KYU A;  2R7T A;  2J0W A;  2Q9C A;  1VMA A;  2Y39 A;  1J8Y F;  4CS9 C;  4OD4 A;  2OCC C;  5IY5 C;  3EGD B;  1MND A;  2R7Q A;  2JD3 A;  3ABM C;  1OCC C;  2W45 A;  4OIN F;  1VYK A;  3DJN B;  5EHH A;  3K33 A;  2KGO A;  3T6J A;  3SEO A;  2FGY A;  3RYL A;  4BEJ A;  5KYW A;  3CZ6 A;  3AG1 C;  4U5D E;  3DAG A;  4H4K C;  5B1B C;  2DYS C;  3LS0 A;  2EIM C;  3OWT A;  3CQZ A;  4CS7 A;  2XSE A;  5DVW A;  4Q5S F;  4I1M A;  1ZHW A;  5D92 A;  2Y3G A;  1VK5 A;  2J9W A;  2J46 A;  2WZL A;  2HV6 A;  1V54 C;  3PHF 2;  5T3W A;  1O5H A;  1O87 A;  4O6N A;  3DAF A;  4BJ5 C;  4IAO A;  3FAJ A;  3NDB B;  1G8X A;  1LVK A;  3DM9 B;  4C3B A;  2WZG A;  3MLG A;  4W8K A;  1W2W A;  2LSE A;  2WVQ A;  3K1H A;  4LER A;  1MMD A;  5KYN A;  3EZH A;  2VAS A;  3KL4 A;  2FFH A;  2Y3H A;  3JSZ A;  4LLC A;  4JVS A;  3ABL C;  3EPV A;  2WB7 A;  3IEE A;  5F5F A;  4OIP F;  1MNE A;  4BG0 A;  3SZR A;  3RH3 A;  4E7Z A;  2J0X A;  5BUO A;  3RKO F;  1PCX A;  2W9Y A;  3S28 A;  1MMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...