4U5HA

Crystal structure of con-ikot-ikot toxin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
85
structure length
85
Chain Sequence
GPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Conus striatus
molecule tags Toxin
molecule keywords Con-ikot-ikot
total genus 29
structure length 85
sequence length 85
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5hA00
4U5DE 4U5EE 4U5GA 4U5HA 4U5FE 4U5CE 4U5BE
chains in the Genus database with same CATH superfamily
3U8PA 3JSEO 1NFNA 2B0HA 1Q0FA 1O3UA 1TKNA 2DYSC 2NSGA 3FOPA 4MVOA 3MYFA 2J8WA 2IBFA 3UGOA 256BA 3US6A 1RKEB 1T9KA 3DZAA 4JTAB 4MVZA 2XM4A 3QMKA 3JCUQ 4OIOF 1A41A 2G3VA 2JPUA 2R7QA 2J7PA 5JUAA 2R7XA 3LEVA 2RD9A 4IAOA 3DJUB 3LS1A 3C7JA 5DS5A 1FFHA 3TJ5A 1U89A 1SZIA 1JRAA 3EGDB 1J8YF 2XM0A 3HLZA 1VB5A 3LESA 3QW0A 4IAQA 3C63A 1OW7A 2Q9CA 4XEVA 5D92A 5KYXA 2A6EF 3GORA 2DI3A 2OKUA 1NFOA 1NLXA 2H7BA 2YLGA 3HNLA 4JVSA 1OQCA 4PK4A 1AUEA 1YVIA 3VAYA 1RXQA 3AGTA 2MYSA 3KKBA 2IXPA 2IXOA 4M63A 1M2VB 3ZIBA 2CGEA 1DOWA 1XWJA 2Y39A 3LNRA 2ZXRA 3U5SA 3V7OA 4LLEA 3VF0A 4AE4B 1LIHA 2IXMA 3OWTA 1FMVA 3NRHA 5E33A 4YT2A 3ASNC 2A69F 1D0XA 4CJGA 4NTFA 2YL3A 4RDAA 1VMAA 2X0CA 2YWAA 3SXMA 3ABMC 5L3QA 1EKYA 4U5HA 1ZHTA 3CQZA 3JYHA 2VH3A 5BQGA 3RQGA 3UNGC 3A11A 3TULA 1CGOA 4KBLA 3FMSA 3PCVA 2GFHA 3W8IA 1PD1A 4YK5A 4BPMA 1Z63A 1HE1A 5AC5A 2MHRA 1OCCC 1XZPA 4JJGA 4MVUA 4YN0B 4JCZA 4BJ6A 1HMDA 1K04A 1ZHYA 2HMZA 3VRCA 2ICWG 2A0UA 1NU9C 1L7CA 3H2VA 1QZXA 5FCLA 5K0IA 4OIQF 2Q3TA 5FZTA 1RMVA 3DE8A 1VYKA 1MMNA 1Z6AA 2PBEA 3U3FA 2EPMX 5HV9A 4U5CE 5F5FA 4XPXA 3EZIA 2DYRC 3LNMB 3JRMO 3L8JA 3JZ0A 4W8PA 3T6JA 2YL0A 5KYWA 4NY3A 4E0HA 2XLMA 3EFOA 3GANA 5D91A 3VM6A 1H9GA 2VCBA 2WB7A 3ZWIA 4EBJA 4MTFA 1CGME 3EJNA 2LK4A 1PCXA 4BJ5C 2EPNA 2AVKA 3ZTZA 5BUOA 2H8AA 3L0IA 1UFBA 4JZAA 3S84A 2XLDA 4OIRF 5A6JA 3DD7A 3EQLF 3TQOA 3B71A 3EGXA 2R9RB 4HE8D 1YZAA 3NDBB 3NYLA 2UUHA 1YLMA 3ZQYA 1NZEA 1AVOB 5GPGB 1E84A 3HJCA 4JEAA 1MQVA 1M2OA 4HFKB 4JRZA 2KJGA 3DI5A 5A6KA 2GDCA 2E87A 2XS8A 3U8VA 1WASA 2NSFA 4OINF 4O79A 1M2VA 3NYJA 2Q9BA 1ZYRF 2I15A 3PDMP 1MNDA 3TOLA 4U9DA 1BZ4A 1LS4A 2W9YA 3RQFA 4DVYP 3WHNA 3WODF 3IEEA 2HV7A 3L34A 1VOMA 3IPMO 3DE9A 4CS8A 3LJBA 3AG2C 3ZDLA 1A7VA 1MMDA 2NUPA 4LDRA 2A0BA 4FAPB 5KYUB 3POVA 1SR2A 3N0TA 3C62A 4Q4ZF 4AX2A 1RKCA 1Z23A 2WZFA 3KH2A 5DQTA 5B3SC 5CIVA 5KYYB 1RKEA 1AEPA 1VLTA 2GWWA 2XSEA 1E83A 2J7PD 1S7ZA 3S90A 1G5ZA 3U9MA 1VK5A 1D1BA 2W4MA 1FNTc 4MW8A 4P9FA 1IZMA 1Z3IX 3AG3C 1ZHZA 3ECSA 1APCA 2XRHA 2ASRA 2KYHA 3TOMA 3O55A 4ER9A 5L0DA 1HY5A 3ASOC 4C3EA 1FTSA 1OCZC 2X51A 3LS0A 4CIPA 3SP1A 5DQZA 3DAGA 1IW7F 3EHNA 1HMOA 4O6YA 2QLAA 4MVRA 4XQ1A 5COMA 4CDYA 1OXKA 1ZU5A 2HJMA 2KSFA 2NUTA 1TWGA 5JVEA 3EH2A 3FXHA 4BG0A 4DRJB 1T6QA 1H7IA 3GODA 4J30B 4U5BE 2A68F 4MVQA 4O6NA 2ZXWC 4LDQA 5JP7A 4CS7A 4A4AA 1PD0A 3FDQA 3KPHA 1BDJB 2H7VC 2FGYA 4E7SA 3B0UX 3HNIA 2OG2A 5EHHA 4NTAA 2J0WA 2J9WA 3K33A 2HS5A 2YEVA 4J32B 3RF3A 3X2QC 1VYIA 1G4US 5DLJA 2HFIA 3DWWA 4BJ1A 4E17A 4XLPF 2AP3A 2VCAA 3RKOF 1LE4A 1WWPA 2JD3A 2XLEA 3B0VC 2VCCA 3EGXB 4P6IC 5COGA 2Y3HA 3QVZA 2M4EA 2HV6A 4C7OA 4J7TA 5EGYA 4CDAA 3ABKC 4ZLDA 1GM5A 4KI2A 3EHMA 4MVMA 2CYDA 4YL1A 5BQIA 3NMIA 5F28E 3GM1A 2L6HA 2WVQA 3MYIA 4K7BA 3IQ5A 4YT8A 4DBRA 4N4WA 1D1CA 5E3CA 2LSEA 4YWQA 3UGPA 4U5FE 4ANJA 1RJ9A 4JC7A 4JIOA 4PJMA 2KC3A 3RVZA 3TD7A 3W2WA 4E0IA 3HNJA 3RH3A 5DS6A 2R7WA 4JCHA 2XLWA 3I4UA 3MLGA 2AWCA 4PJJA 1QLEC 3B9QA 3AGUA 3LUTB 2KK1A 2ZPAA 2R7RA 1V55C 2R7SA 4CX9A 1NSGB 4JTDB 4N6CA 2YHSA 1I5NA 2KQ9A 2VC9A 1CPRA 3NKEA 2I8BA 2D4UA 4G78A 3QW1A 3AOUA 3FAPB 1I4YA 4MVSA 4W8KA 5DVWA 4RD9A 1D1AA 2Y3BA 1C02A 4ULVA 5TJ5E 4KC9A 3K7DA 2OJED 2DGJA 4EWCA 3GM3A 1KTMA 1OXBA 4IB4A 3LLKA 4GYTA 3ITFA 2IYLD 3M15A 4PACA 4EIYA 4AL0A 4UDVA 3EGDA 3L8IA 3T4RA 3T6BA 3BEHA 3T9OA 3C8GB 1R5ID 3ATPA 4P9TA 4I44A 5JS5A 3BRJA 3MFNA 3O39A 5KYXB 1T6IA 4DJ9A 1VTMP 3AG1C 2O9XA 2XLVA 3DXJF 4DRIB 2Q4FA 1M6TA 2GAQA 3EH1A 1U6HA 1A7EA 1MNEA 1ORSC 3LAYA 4BJ5A 2PX0A 3JRTA 2P1AA 3Q6NA 1L3PA 3M4CA 1BR4A 4DRHB 4E18A 3GEIA 2R25A 3KL4A 3U3BA 3Q7LA 4LERA 1QVXA 3O10A 4XEKA 4ONSA 2DB4A 1D0YA 3VYWA 1KU2A 1OW8A 1RCPA 2L6GA 1PV3A 2LIGA 4MTOA 3RW0A 3FHDA 1HE9A 4FESA 3ZG1A 2HJ3A 3Q7GA 3IQCA 3GEHA 2TMVP 1JOGA 1M56C 4NC3A 4LLCA 4DXWA 4G7OF 1K05A 3RIPA 4FWVA 1JAFA 2EINC 4MTGA 3IQTA 1KNYA 2QNLA 1YDIA 1OCRC 1YA7O 2C04A 1N1CA 2OCCC 3FVYA 2H7OA 2CDQA 3DM5A 1OKKD 3R7CA 3K66A 1LKXA 4YT5A 2YVKA 4K1OA 3V5ZA 4ULWA 1J8MF 4D4NA 2OEXA 1G8XA 1ORYA 5B1BC 1WGWA 2Y3DA 4GQHA 4O7GA 2ZXOA 1EI7A 1V54C 1OKKA 3NMKA 2XS1A 4BEJA 4PR9A 3O6XA 3FOOA 4C3BA 2EPLX 1HW1A 2J0XA 2YRFA 2F22A 4U5GA 2IXNA 2EPKX 3U2MA 2A6HF 5A6BD 3ZSUA 1XZQA 3I5QA 5L0CA 4JJFA 2ETSA 1QPUA 1R4TA 2UUIA 4PFOA 2FFHA 3LLIA 3W4YA 1GGQA 4IRUA 3SZRA 5AC4A 2B0JA 2YL7A 1T5OA 3OA1A 3QZCA 4PJLA 2WL8A 1T6UA 1Q0GA 1QKRA 4BEMJ 1LE2A 1LI5A 4LDKA 3RQEA 5A6AA 2GA0A 4CS9A 4Z9HA 3AG4C 4PFPA 5L0IA 2Z15A 2P7VA 2LFFA 3T6GB 2YKZA 3AJMA 3UMIA 2YLIA 4G7HF 1LS1A 1YJGA 3M1CB 4MNDA 4JURI 2PP4A 5B1AC 2Q9AA 3CSKA 4CSAA 1O87A 1JMWA 3NYMA 4XEFA 3UMHA 3W8HA 3TJ6A 3DJNB 2YLDA 3LEOA 3I5PA 1QSPA 4I1MA 3NMJA 1LI7A 2QTVA 2R7TA 1WTYA 1O5HA 4BJTA 1V4AA 3NKDA 5HSWA 3G4XA 1YYJA 2OJQA 3V5YA 1Z5ZA 5JLIA 1E2XA 1ZHWA 4K0DA 5L0GA 1NG1A 1TR2A 3S9OA 4IWBA 1H6GA 4CIHA 2HMQA 3K1IA 5AGFA 3E70C 3DKAA 1TFKB 1E85A 2P0NA 2LCHA 4I1OB 1C17M 4MQ9F 2EPOA 4D4XA 2WZLA 5JRAA 3EG9B 4L6RA 4Q7CA 4CDVA 1A7DA 4JE9A 4IGGA 4CSAC 1FAPB 2OEVA 2CCYA 1OW6A 5KYNA 3M4BA 3SEOA 2HKVA 3R2PA 2R05A 2A1DD 2WVOA 4JW1A 1ORJA 3L1MA 4IJJA 4R32A 1M57C 2IOQA 4XTKA 3ZC4A 1QQ3A 1Q0DA 3N2ZB 4U5EE 3MBGA 1H9TA 3HKKA 3B0PA 1K40A 2V3CC 4Z9JA 1OCOC 1I4ZA 4QI2A 2LP4A 1GQAA 2G3KA 4JEBA 3C8ZA 1A0BA 1G4WR 5L0FA 4PJNA 2CNWD 2YZSA 5E2QA 5E3AA 1JPJA 2YL1A 3X1OA 2OU6A 3FAJA 2Y69C 2G62A 3RYLA 4CS9C 4QDLA 3F47A 3M79A 2ZD9A 5DS4A 4ZLCA 1OR2A 2XXAB 3CAXA 2NUPB 2L7AA 3GM2A 1ST6A 3GWLA 4XPWA 1TWAA 3EFOB 4N6HA 2YQYA 5T1DB 1DOVA 2J9VA 3HNKA 1C03A 2D5RB 2QUPA 2M64A 4X0RA 3JYYA 3UMKA 2XLOA 5B3IA 1OR3A 4HFFB 4BJ6C 1ZHXA 5IY5C 2R7UA 4CBEA 2VB6A 1UG7A 3G4ZA 1ZVZA 3H2UA 3V5XA 2ZXPA 4CJOA 2BE5F 2WVNA 1YAUO 5CI8A 1F1MA 2AU5A 3F46A 5T3TA 3JT1A 3DM9B 4E7ZA 2NG1A 5KYUA 5JT4A 1Y4CA 1VLSA 3ZTMA 4NCQA 3AQCA 2XL8A 1TWHA 2PX3A 2Y3GA 1TQGA 2J45A 1TFOB 1Q0KA 2P61A 3GEEA 3S27A 3N24A 1SYQA 4KNWA 4RBNA 1S05A 3H65A 2XLHA 2W45A 1LM3B 2LQGA 3AQBA 4AE4A 5A69A 3RVYA 5COFA 1BR2A 2LFDA 4MS2A 1FMWA 1SMYF 2J9UA 2QE9A 2R02A 4GEHA 4Q5SF 3G50A 3RFYA 3C8GD 4YL0A 4FX5A 1HW2A 3W2VA 1Q0MA 2EIJC 2L6FA 3WAQA 1SF8A 2CNWA 2OOCA 1D0ZA 4LACB 2R7OA 1JR8A 2C03A 4JTCB 4XWJA 1W2WA 4DVZA 1E86A 2L9JA 4YL3A 2LD6A 3U9JA 3NG1A 2R7VA 2PF4E 3KMIA 2AWYA 1WOLA 1LPEA 2J46A 5T3WA 1T01A 3SNHA 3ZQVA 2HZ8A 3IQ6A 1Y6DA 3SXYA 3IHUA 2HSQA 4KNVA 1GS9A 1NBBA 1V74B 3JSZA 5EK0A 5F5HA 3CEXA 3ABLC 2BL2A 1MMGA 4H54A 3GWNA 1CGNA 3WG7C 1WATA 4OD4A 3JTLO 4EBBA 2BC5A 1YARO 4EHPA 3OEOA 2HSBA 2XL6A 3J06A 2QY9A 1CPQA 3K6BA 2CW0F 2P6VA 3EPVA 4U5DE 3TK0A 4CS8C 5KYYA 4NQFA 2EIMC 3S28A 3UR3C 3C8GA 4QI0A 3PHF2 2R03A 1ZU4A 1EA8A 3KYIA 1YYXA 1FFTC 3C18A 1WN0A 4JKVA 4XPYA 4AL1A 5A6BA 5KYWB 2RSEB 4H4KC 1ZZPA 2NUTB 3K1HA 3PMRA 3KYJA 4Z9IA 1ZW3A 3SXZA 3K1IC 2NPUA 4WGZA 2OQMA 2Q7RA 5L0HA 1TWCA 3U0CA 3QVYA 2XXAA 2J9BA 1B68A 2W4BA 3HTKC 5L0JA 2WZGA 4J7YA 2PNOA 4I3MA 4O6MA 4YJWA 4DBQA 4F4BA 3U2LA 2MWQA 2V26A 3A9CA 5BQHA 3SXKA 1RJ9B 1EQ1A 2KNHA 3EZHA 2XL4A 4WGYA 2EIKC 4XLNF 4EUKB 2JX0A 3MX3A 4IARA 3S0XA 4WABA 1BR1A 5CI9A 2FAPB 1YZCA 2PFDA 4HEAJ 3DMDA 3EG9A 4NTBA 2VASA 3SYNA 2IM8A 1ZW2A 4U9EA 4A2NB 4C3DA 1YA9A 3Q6MA 4N06A 3CZ6A 3S29A 4YT4A 4C7OB 2KW3C 1Z7Qc 1MMAA 4G7ZF 4AK9A 3E9VA 5L3VA 1LVKA 2L81A 4OD5A 2HUJA 1NU7D 4B6IA 1FR0A 3QTHA 1JPNA 2EILC 4EBKA 4WJ0A 4MW3A 4OIPF 2KGOA 3ZVRA 4G0HA 3B29A 5JSLA 4EKWA 1BBHA 4DOZA 3DAFA 1U0BB 2Q00A
chains in the Genus database with same CATH topology
3UGOA 1TKNA 2DYSC 3DZAA 3QMKA 3JCUQ 4OIOF 2R7QA 2G3VA 2J7PA 2R7XA 3LEVA 4IAOA 3DJUB 3LS1A 5DS5A 1FFHA 1SZIA 3EGDB 1J8YF 3HLZA 3LESA 2Q9CA 5D92A 5KYXA 2A6EF 4JVSA 2H7BA 4YT4A 4PK4A 3VAYA 2MYSA 3KKBA 2IXPA 2IXOA 4M63A 1M2VB 3ZIBA 2CGEA 2Y39A 3LNRA 2ZXRA 3V7OA 4LLEA 4AE4B 2IXMA 3OWTA 1FMVA 3NRHA 5E33A 4YT2A 3ASNC 2A69F 1D0XA 4RDAA 1VMAA 3ABMC 5L3QA 4U5HA 1ZHTA 3CQZA 3JYHA 2VH3A 3UNGC 4KBLA 2GFHA 3W8IA 1PD1A 1Z63A 1OCCC 4JJGA 4YN0B 4BJ6A 1ZHYA 1NU9C 1QZXA 5FCLA 4OIQF 2Q3TA 1VYKA 1Z6AA 1MMNA 4U5CE 5F5FA 3EZIA 2DYRC 3T6JA 5KYWA 4NY3A 3EFOA 3GANA 5D91A 2WB7A 3EJNA 1PCXA 4BJ5C 5BUOA 3L0IA 4JZAA 4OIRF 3DD7A 3EQLF 3EGXA 4HE8D 3NDBB 3NYLA 1NZEA 3HJCA 1M2OA 4HFKB 2KJGA 2E87A 4OINF 4O79A 1M2VA 3NYJA 2Q9BA 1ZYRF 1MNDA 2W9YA 4DVYP 3WODF 3IEEA 2HV7A 3L34A 1VOMA 4CS8A 3LJBA 3AG2C 1MMDA 2NUPA 5KYUB 3POVA 3N0TA 4Q4ZF 4AX2A 1Z23A 2WZFA 3KH2A 5DQTA 5B3SC 2XSEA 2J7PD 1S7ZA 1VK5A 1D1BA 2W4MA 1IZMA 1Z3IX 3AG3C 1ZHZA 3ECSA 2XRHA 5KYYB 3ASOC 4C3EA 1FTSA 1OCZC 2X51A 3LS0A 3SP1A 5DQZA 3DAGA 1IW7F 3EHNA 4O6YA 1ZU5A 2NUTA 1TWGA 3EH2A 4BG0A 3GODA 4J30B 4U5BE 2A68F 4O6NA 2ZXWC 4CS7A 1PD0A 3FDQA 2H7VC 2FGYA 4E7SA 3B0UX 2OG2A 5EHHA 2J0WA 2J9WA 3K33A 4J32B 2YEVA 3X2QC 5DLJA 1VYIA 4BJ1A 4XLPF 3RKOF 2JD3A 3B0VC 3EGXB 4P6IC 2Y3HA 2M4EA 2HV6A 4C7OA 5EGYA 3ABKC 4ZLDA 4KI2A 3EHMA 2WVQA 4K7BA 4YT8A 4DBRA 1D1CA 5E3CA 2LSEA 4YWQA 3UGPA 4U5FE 4ANJA 1RJ9A 3TD7A 4PJMA 3W2WA 5DS6A 2R7WA 3RH3A 4JCHA 3I4UA 4PJJA 3MLGA 1QLEC 3B9QA 2R7RA 2ZPAA 2R7SA 1V55C 2YHSA 2KQ9A 3NKEA 2I8BA 5DVWA 4W8KA 4RD9A 1D1AA 2Y3BA 4KC9A 3K7DA 2DGJA 4EWCA 3LLKA 4GYTA 3ITFA 2IYLD 3EGDA 3T4RA 3T6BA 4I44A 3O39A 5KYXB 3AG1C 2O9XA 3DXJF 3EH1A 4BJ5A 1MNEA 3LAYA 2PX0A 3JRTA 3Q6NA 1BR4A 3KL4A 3Q7LA 4LERA 1D0YA 3VYWA 1KU2A 3FHDA 4FESA 3ZG1A 3Q7GA 1M56C 4LLCA 4G7OF 3RIPA 4FWVA 2EINC 1OCRC 2C04A 1N1CA 2OCCC 3FVYA 2H7OA 2CDQA 3DM5A 1OKKD 3K66A 1LKXA 4YT5A 4ULWA 1J8MF 1G8XA 5B1BC 1WGWA 2Y3DA 4O7GA 2ZXOA 1V54C 1OKKA 4BEJA 3O6XA 4C3BA 2J0XA 4U5GA 2IXNA 2A6HF 3ZSUA 3I5QA 4JJFA 4PFOA 2FFHA 3LLIA 4IRUA 3SZRA 2B0JA 4PJLA 3OA1A 3QZCA 2WL8A 4CS9A 3AG4C 4PFPA 2Z15A 2P7VA 4G7HF 3UMIA 1LS1A 3M1CB 4MNDA 4JURI 2PP4A 5B1AC 2Q9AA 3CSKA 4CSAA 1O87A 3NYMA 3UMHA 3W8HA 3DJNB 3I5PA 4I1MA 2QTVA 2R7TA 1O5HA 4BJTA 3NKDA 5HSWA 1Z5ZA 1ZHWA 4K0DA 1NG1A 1TR2A 4IWBA 4CIHA 3E70C 4MQ9F 4I1OB 2WZLA 3EG9B 4Q7CA 4CSAC 5KYNA 3SEOA 2A1DD 2WVOA 4JW1A 4IJJA 4XTKA 3ZC4A 1M57C 2IOQA 3N2ZB 4U5EE 3B0PA 2V3CC 1OCOC 4QI2A 2G3KA 4PJNA 2CNWD 2YZSA 5E2QA 5E3AA 1JPJA 3X1OA 3FAJA 2Y69C 2G62A 3RYLA 4CS9C 4QDLA 3F47A 5DS4A 4ZLCA 2XXAB 2NUPB 1ST6A 1TWAA 3EFOB 5T1DB 2J9VA 2D5RB 4X0RA 3UMKA 5IY5C 4HFFB 4BJ6C 1ZHXA 2R7UA 4CBEA 2VB6A 2ZXPA 2BE5F 2WVNA 5CI8A 3F46A 5T3TA 3JT1A 3DM9B 4E7ZA 2NG1A 5KYUA 3AQCA 1TWHA 2PX3A 2Y3GA 2J45A 3S27A 3N24A 4KNWA 4RBNA 3H65A 2W45A 3AQBA 4AE4A 1BR2A 1FMWA 1SMYF 2J9UA 4GEHA 4Q5SF 3RFYA 4FX5A 3W2VA 2EIJC 1SF8A 2CNWA 4LACB 1D0ZA 2R7OA 2C03A 4XWJA 1W2WA 4DVZA 2L9JA 3NG1A 2R7VA 2PF4E 3KMIA 2J46A 5T3WA 3SNHA 4KNVA 3JSZA 5F5HA 3ABLC 1MMGA 3WG7C 4OD4A 4EBBA 3OEOA 2QY9A 3K6BA 2CW0F 2P6VA 3EPVA 4U5DE 4CS8C 5KYYA 3S28A 2EIMC 3UR3C 4QI0A 3PHF2 1ZU4A 1FFTC 5KYWB 4H4KC 2NUTB 3K1HA 3PMRA 3K1IC 1TWCA 2XXAA 3HTKC 2W4BA 2WZGA 4O6MA 4I3MA 4YJWA 4DBQA 4F4BA 2MWQA 2V26A 1RJ9B 2KNHA 3EZHA 2XL4A 2EIKC 4XLNF 3MX3A 3S0XA 1BR1A 5CI9A 2PFDA 4HEAJ 3DMDA 3EG9A 3SYNA 2VASA 4A2NB 4C3DA 3Q6MA 4N06A 3CZ6A 3S29A 4C7OB 2KW3C 1MMAA 4G7ZF 4AK9A 3E9VA 5L3VA 1LVKA 2L81A 4OD5A 1NU7D 4B6IA 1JPNA 2EILC 4WJ0A 4OIPF 2KGOA 3ZVRA 4G0HA 4DOZA 3DAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5D E;  4U5E E;  4U5G A;  4U5H A;  4U5F E;  4U5C E;  4U5B E; 
#chains in the Genus database with same CATH topology
 3U8P A;  3JSE O;  1NFN A;  2B0H A;  1Q0F A;  1O3U A;  1TKN A;  2DYS C;  2NSG A;  3FOP A;  4MVO A;  3MYF A;  2J8W A;  2IBF A;  3UGO A;  256B A;  3US6 A;  1RKE B;  1T9K A;  3DZA A;  4JTA B;  4MVZ A;  2XM4 A;  3QMK A;  3JCU Q;  4OIO F;  1A41 A;  2G3V A;  2JPU A;  2R7Q A;  2J7P A;  5JUA A;  2R7X A;  3LEV A;  2RD9 A;  4IAO A;  3DJU B;  3LS1 A;  3C7J A;  5DS5 A;  1FFH A;  3TJ5 A;  1U89 A;  1SZI A;  1JRA A;  3EGD B;  1J8Y F;  2XM0 A;  3HLZ A;  1VB5 A;  3LES A;  3QW0 A;  4IAQ A;  3C63 A;  1OW7 A;  2Q9C A;  4XEV A;  5D92 A;  5KYX A;  2A6E F;  3GOR A;  2DI3 A;  2OKU A;  1NFO A;  1NLX A;  2H7B A;  2YLG A;  3HNL A;  4JVS A;  1OQC A;  4PK4 A;  1AUE A;  1YVI A;  3VAY A;  1RXQ A;  3AGT A;  2MYS A;  3KKB A;  2IXP A;  2IXO A;  4M63 A;  1M2V B;  3ZIB A;  2CGE A;  1DOW A;  1XWJ A;  2Y39 A;  3LNR A;  2ZXR A;  3U5S A;  3V7O A;  4LLE A;  3VF0 A;  4AE4 B;  1LIH A;  2IXM A;  3OWT A;  1FMV A;  3NRH A;  5E33 A;  4YT2 A;  3ASN C;  2A69 F;  1D0X A;  4CJG A;  4NTF A;  2YL3 A;  4RDA A;  1VMA A;  2X0C A;  2YWA A;  3SXM A;  3ABM C;  5L3Q A;  1EKY A;  4U5H A;  1ZHT A;  3CQZ A;  3JYH A;  2VH3 A;  5BQG A;  3RQG A;  3UNG C;  3A11 A;  3TUL A;  1CGO A;  4KBL A;  3FMS A;  3PCV A;  2GFH A;  3W8I A;  1PD1 A;  4YK5 A;  4BPM A;  1Z63 A;  1HE1 A;  5AC5 A;  2MHR A;  1OCC C;  1XZP A;  4JJG A;  4MVU A;  4YN0 B;  4JCZ A;  4BJ6 A;  1HMD A;  1K04 A;  1ZHY A;  2HMZ A;  3VRC A;  2ICW G;  2A0U A;  1NU9 C;  1L7C A;  3H2V A;  1QZX A;  5FCL A;  5K0I A;  4OIQ F;  2Q3T A;  5FZT A;  1RMV A;  3DE8 A;  1VYK A;  1MMN A;  1Z6A A;  2PBE A;  3U3F A;  2EPM X;  5HV9 A;  4U5C E;  5F5F A;  4XPX A;  3EZI A;  2DYR C;  3LNM B;  3JRM O;  3L8J A;  3JZ0 A;  4W8P A;  3T6J A;  2YL0 A;  5KYW A;  4NY3 A;  4E0H A;  2XLM A;  3EFO A;  3GAN A;  5D91 A;  3VM6 A;  1H9G A;  2VCB A;  2WB7 A;  3ZWI A;  4EBJ A;  4MTF A;  1CGM E;  3EJN A;  2LK4 A;  1PCX A;  4BJ5 C;  2EPN A;  2AVK A;  3ZTZ A;  5BUO A;  2H8A A;  3L0I A;  1UFB A;  4JZA A;  3S84 A;  2XLD A;  4OIR F;  5A6J A;  3DD7 A;  3EQL F;  3TQO A;  3B71 A;  3EGX A;  2R9R B;  4HE8 D;  1YZA A;  3NDB B;  3NYL A;  2UUH A;  1YLM A;  3ZQY A;  1NZE A;  1AVO B;  5GPG B;  1E84 A;  3HJC A;  4JEA A;  1MQV A;  1M2O A;  4HFK B;  4JRZ A;  2KJG A;  3DI5 A;  5A6K A;  2GDC A;  2E87 A;  2XS8 A;  3U8V A;  1WAS A;  2NSF A;  4OIN F;  4O79 A;  1M2V A;  3NYJ A;  2Q9B A;  1ZYR F;  2I15 A;  3PDM P;  1MND A;  3TOL A;  4U9D A;  1BZ4 A;  1LS4 A;  2W9Y A;  3RQF A;  4DVY P;  3WHN A;  3WOD F;  3IEE A;  2HV7 A;  3L34 A;  1VOM A;  3IPM O;  3DE9 A;  4CS8 A;  3LJB A;  3AG2 C;  3ZDL A;  1A7V A;  1MMD A;  2NUP A;  4LDR A;  2A0B A;  4FAP B;  5KYU B;  3POV A;  1SR2 A;  3N0T A;  3C62 A;  4Q4Z F;  4AX2 A;  1RKC A;  1Z23 A;  2WZF A;  3KH2 A;  5DQT A;  5B3S C;  5CIV A;  5KYY B;  1RKE A;  1AEP A;  1VLT A;  2GWW A;  2XSE A;  1E83 A;  2J7P D;  1S7Z A;  3S90 A;  1G5Z A;  3U9M A;  1VK5 A;  1D1B A;  2W4M A;  1FNT c;  4MW8 A;  4P9F A;  1IZM A;  1Z3I X;  3AG3 C;  1ZHZ A;  3ECS A;  1APC A;  2XRH A;  2ASR A;  2KYH A;  3TOM A;  3O55 A;  4ER9 A;  5L0D A;  1HY5 A;  3ASO C;  4C3E A;  1FTS A;  1OCZ C;  2X51 A;  3LS0 A;  4CIP A;  3SP1 A;  5DQZ A;  3DAG A;  1IW7 F;  3EHN A;  1HMO A;  4O6Y A;  2QLA A;  4MVR A;  4XQ1 A;  5COM A;  4CDY A;  1OXK A;  1ZU5 A;  2HJM A;  2KSF A;  2NUT A;  1TWG A;  5JVE A;  3EH2 A;  3FXH A;  4BG0 A;  4DRJ B;  1T6Q A;  1H7I A;  3GOD A;  4J30 B;  4U5B E;  2A68 F;  4MVQ A;  4O6N A;  2ZXW C;  4LDQ A;  5JP7 A;  4CS7 A;  4A4A A;  1PD0 A;  3FDQ A;  3KPH A;  1BDJ B;  2H7V C;  2FGY A;  4E7S A;  3B0U X;  3HNI A;  2OG2 A;  5EHH A;  4NTA A;  2J0W A;  2J9W A;  3K33 A;  2HS5 A;  2YEV A;  4J32 B;  3RF3 A;  3X2Q C;  1VYI A;  1G4U S;  5DLJ A;  2HFI A;  3DWW A;  4BJ1 A;  4E17 A;  4XLP F;  2AP3 A;  2VCA A;  3RKO F;  1LE4 A;  1WWP A;  2JD3 A;  2XLE A;  3B0V C;  2VCC A;  3EGX B;  4P6I C;  5COG A;  2Y3H A;  3QVZ A;  2M4E A;  2HV6 A;  4C7O A;  4J7T A;  5EGY A;  4CDA A;  3ABK C;  4ZLD A;  1GM5 A;  4KI2 A;  3EHM A;  4MVM A;  2CYD A;  4YL1 A;  5BQI A;  3NMI A;  5F28 E;  3GM1 A;  2L6H A;  2WVQ A;  3MYI A;  4K7B A;  3IQ5 A;  4YT8 A;  4DBR A;  4N4W A;  1D1C A;  5E3C A;  2LSE A;  4YWQ A;  3UGP A;  4U5F E;  4ANJ A;  1RJ9 A;  4JC7 A;  4JIO A;  4PJM A;  2KC3 A;  3RVZ A;  3TD7 A;  3W2W A;  4E0I A;  3HNJ A;  3RH3 A;  5DS6 A;  2R7W A;  4JCH A;  2XLW A;  3I4U A;  3MLG A;  2AWC A;  4PJJ A;  1QLE C;  3B9Q A;  3AGU A;  3LUT B;  2KK1 A;  2ZPA A;  2R7R A;  1V55 C;  2R7S A;  4CX9 A;  1NSG B;  4JTD B;  4N6C A;  2YHS A;  1I5N A;  2KQ9 A;  2VC9 A;  1CPR A;  3NKE A;  2I8B A;  2D4U A;  4G78 A;  3QW1 A;  3AOU A;  3FAP B;  1I4Y A;  4MVS A;  4W8K A;  5DVW A;  4RD9 A;  1D1A A;  2Y3B A;  1C02 A;  4ULV A;  5TJ5 E;  4KC9 A;  3K7D A;  2OJE D;  2DGJ A;  4EWC A;  3GM3 A;  1KTM A;  1OXB A;  4IB4 A;  3LLK A;  4GYT A;  3ITF A;  2IYL D;  3M15 A;  4PAC A;  4EIY A;  4AL0 A;  4UDV A;  3EGD A;  3L8I A;  3T4R A;  3T6B A;  3BEH A;  3T9O A;  3C8G B;  1R5I D;  3ATP A;  4P9T A;  4I44 A;  5JS5 A;  3BRJ A;  3MFN A;  3O39 A;  5KYX B;  1T6I A;  4DJ9 A;  1VTM P;  3AG1 C;  2O9X A;  2XLV A;  3DXJ F;  4DRI B;  2Q4F A;  1M6T A;  2GAQ A;  3EH1 A;  1U6H A;  1A7E A;  1MNE A;  1ORS C;  3LAY A;  4BJ5 A;  2PX0 A;  3JRT A;  2P1A A;  3Q6N A;  1L3P A;  3M4C A;  1BR4 A;  4DRH B;  4E18 A;  3GEI A;  2R25 A;  3KL4 A;  3U3B A;  3Q7L A;  4LER A;  1QVX A;  3O10 A;  4XEK A;  4ONS A;  2DB4 A;  1D0Y A;  3VYW A;  1KU2 A;  1OW8 A;  1RCP A;  2L6G A;  1PV3 A;  2LIG A;  4MTO A;  3RW0 A;  3FHD A;  1HE9 A;  4FES A;  3ZG1 A;  2HJ3 A;  3Q7G A;  3IQC A;  3GEH A;  2TMV P;  1JOG A;  1M56 C;  4NC3 A;  4LLC A;  4DXW A;  4G7O F;  1K05 A;  3RIP A;  4FWV A;  1JAF A;  2EIN C;  4MTG A;  3IQT A;  1KNY A;  2QNL A;  1YDI A;  1OCR C;  1YA7 O;  2C04 A;  1N1C A;  2OCC C;  3FVY A;  2H7O A;  2CDQ A;  3DM5 A;  1OKK D;  3R7C A;  3K66 A;  1LKX A;  4YT5 A;  2YVK A;  4K1O A;  3V5Z A;  4ULW A;  1J8M F;  4D4N A;  2OEX A;  1G8X A;  1ORY A;  5B1B C;  1WGW A;  2Y3D A;  4GQH A;  4O7G A;  2ZXO A;  1EI7 A;  1V54 C;  1OKK A;  3NMK A;  2XS1 A;  4BEJ A;  4PR9 A;  3O6X A;  3FOO A;  4C3B A;  2EPL X;  1HW1 A;  2J0X A;  2YRF A;  2F22 A;  4U5G A;  2IXN A;  2EPK X;  3U2M A;  2A6H F;  5A6B D;  3ZSU A;  1XZQ A;  3I5Q A;  5L0C A;  4JJF A;  2ETS A;  1QPU A;  1R4T A;  2UUI A;  4PFO A;  2FFH A;  3LLI A;  3W4Y A;  1GGQ A;  4IRU A;  3SZR A;  5AC4 A;  2B0J A;  2YL7 A;  1T5O A;  3OA1 A;  3QZC A;  4PJL A;  2WL8 A;  1T6U A;  1Q0G A;  1QKR A;  4BEM J;  1LE2 A;  1LI5 A;  4LDK A;  3RQE A;  5A6A A;  2GA0 A;  4CS9 A;  4Z9H A;  3AG4 C;  4PFP A;  5L0I A;  2Z15 A;  2P7V A;  2LFF A;  3T6G B;  2YKZ A;  3AJM A;  3UMI A;  2YLI A;  4G7H F;  1LS1 A;  1YJG A;  3M1C B;  4MND A;  4JUR I;  2PP4 A;  5B1A C;  2Q9A A;  3CSK A;  4CSA A;  1O87 A;  1JMW A;  3NYM A;  4XEF A;  3UMH A;  3W8H A;  3TJ6 A;  3DJN B;  2YLD A;  3LEO A;  3I5P A;  1QSP A;  4I1M A;  3NMJ A;  1LI7 A;  2QTV A;  2R7T A;  1WTY A;  1O5H A;  4BJT A;  1V4A A;  3NKD A;  5HSW A;  3G4X A;  1YYJ A;  2OJQ A;  3V5Y A;  1Z5Z A;  5JLI A;  1E2X A;  1ZHW A;  4K0D A;  5L0G A;  1NG1 A;  1TR2 A;  3S9O A;  4IWB A;  1H6G A;  4CIH A;  2HMQ A;  3K1I A;  5AGF A;  3E70 C;  3DKA A;  1TFK B;  1E85 A;  2P0N A;  2LCH A;  4I1O B;  1C17 M;  4MQ9 F;  2EPO A;  4D4X A;  2WZL A;  5JRA A;  3EG9 B;  4L6R A;  4Q7C A;  4CDV A;  1A7D A;  4JE9 A;  4IGG A;  4CSA C;  1FAP B;  2OEV A;  2CCY A;  1OW6 A;  5KYN A;  3M4B A;  3SEO A;  2HKV A;  3R2P A;  2R05 A;  2A1D D;  2WVO A;  4JW1 A;  1ORJ A;  3L1M A;  4IJJ A;  4R32 A;  1M57 C;  2IOQ A;  4XTK A;  3ZC4 A;  1QQ3 A;  1Q0D A;  3N2Z B;  4U5E E;  3MBG A;  1H9T A;  3HKK A;  3B0P A;  1K40 A;  2V3C C;  4Z9J A;  1OCO C;  1I4Z A;  4QI2 A;  2LP4 A;  1GQA A;  2G3K A;  4JEB A;  3C8Z A;  1A0B A;  1G4W R;  5L0F A;  4PJN A;  2CNW D;  2YZS A;  5E2Q A;  5E3A A;  1JPJ A;  2YL1 A;  3X1O A;  2OU6 A;  3FAJ A;  2Y69 C;  2G62 A;  3RYL A;  4CS9 C;  4QDL A;  3F47 A;  3M79 A;  2ZD9 A;  5DS4 A;  4ZLC A;  1OR2 A;  2XXA B;  3CAX A;  2NUP B;  2L7A A;  3GM2 A;  1ST6 A;  3GWL A;  4XPW A;  1TWA A;  3EFO B;  4N6H A;  2YQY A;  5T1D B;  1DOV A;  2J9V A;  3HNK A;  1C03 A;  2D5R B;  2QUP A;  2M64 A;  4X0R A;  3JYY A;  3UMK A;  2XLO A;  5B3I A;  1OR3 A;  4HFF B;  4BJ6 C;  1ZHX A;  5IY5 C;  2R7U A;  4CBE A;  2VB6 A;  1UG7 A;  3G4Z A;  1ZVZ A;  3H2U A;  3V5X A;  2ZXP A;  4CJO A;  2BE5 F;  2WVN A;  1YAU O;  5CI8 A;  1F1M A;  2AU5 A;  3F46 A;  5T3T A;  3JT1 A;  3DM9 B;  4E7Z A;  2NG1 A;  5KYU A;  5JT4 A;  1Y4C A;  1VLS A;  3ZTM A;  4NCQ A;  3AQC A;  2XL8 A;  1TWH A;  2PX3 A;  2Y3G A;  1TQG A;  2J45 A;  1TFO B;  1Q0K A;  2P61 A;  3GEE A;  3S27 A;  3N24 A;  1SYQ A;  4KNW A;  4RBN A;  1S05 A;  3H65 A;  2XLH A;  2W45 A;  1LM3 B;  2LQG A;  3AQB A;  4AE4 A;  5A69 A;  3RVY A;  5COF A;  1BR2 A;  2LFD A;  4MS2 A;  1FMW A;  1SMY F;  2J9U A;  2QE9 A;  2R02 A;  4GEH A;  4Q5S F;  3G50 A;  3RFY A;  3C8G D;  4YL0 A;  4FX5 A;  1HW2 A;  3W2V A;  1Q0M A;  2EIJ C;  2L6F A;  3WAQ A;  1SF8 A;  2CNW A;  2OOC A;  1D0Z A;  4LAC B;  2R7O A;  1JR8 A;  2C03 A;  4JTC B;  4XWJ A;  1W2W A;  4DVZ A;  1E86 A;  2L9J A;  4YL3 A;  2LD6 A;  3U9J A;  3NG1 A;  2R7V A;  2PF4 E;  3KMI A;  2AWY A;  1WOL A;  1LPE A;  2J46 A;  5T3W A;  1T01 A;  3SNH A;  3ZQV A;  2HZ8 A;  3IQ6 A;  1Y6D A;  3SXY A;  3IHU A;  2HSQ A;  4KNV A;  1GS9 A;  1NBB A;  1V74 B;  3JSZ A;  5EK0 A;  5F5H A;  3CEX A;  3ABL C;  2BL2 A;  1MMG A;  4H54 A;  3GWN A;  1CGN A;  3WG7 C;  1WAT A;  4OD4 A;  3JTL O;  4EBB A;  2BC5 A;  1YAR O;  4EHP A;  3OEO A;  2HSB A;  2XL6 A;  3J06 A;  2QY9 A;  1CPQ A;  3K6B A;  2CW0 F;  2P6V A;  3EPV A;  4U5D E;  3TK0 A;  4CS8 C;  5KYY A;  4NQF A;  2EIM C;  3S28 A;  3UR3 C;  3C8G A;  4QI0 A;  3PHF 2;  2R03 A;  1ZU4 A;  1EA8 A;  3KYI A;  1YYX A;  1FFT C;  3C18 A;  1WN0 A;  4JKV A;  4XPY A;  4AL1 A;  5A6B A;  5KYW B;  2RSE B;  4H4K C;  1ZZP A;  2NUT B;  3K1H A;  3PMR A;  3KYJ A;  4Z9I A;  1ZW3 A;  3SXZ A;  3K1I C;  2NPU A;  4WGZ A;  2OQM A;  2Q7R A;  5L0H A;  1TWC A;  3U0C A;  3QVY A;  2XXA A;  2J9B A;  1B68 A;  2W4B A;  3HTK C;  5L0J A;  2WZG A;  4J7Y A;  2PNO A;  4I3M A;  4O6M A;  4YJW A;  4DBQ A;  4F4B A;  3U2L A;  2MWQ A;  2V26 A;  3A9C A;  5BQH A;  3SXK A;  1RJ9 B;  1EQ1 A;  2KNH A;  3EZH A;  2XL4 A;  4WGY A;  2EIK C;  4XLN F;  4EUK B;  2JX0 A;  3MX3 A;  4IAR A;  3S0X A;  4WAB A;  1BR1 A;  5CI9 A;  2FAP B;  1YZC A;  2PFD A;  4HEA J;  3DMD A;  3EG9 A;  4NTB A;  2VAS A;  3SYN A;  2IM8 A;  1ZW2 A;  4U9E A;  4A2N B;  4C3D A;  1YA9 A;  3Q6M A;  4N06 A;  3CZ6 A;  3S29 A;  4YT4 A;  4C7O B;  2KW3 C;  1Z7Q c;  1MMA A;  4G7Z F;  4AK9 A;  3E9V A;  5L3V A;  1LVK A;  2L81 A;  4OD5 A;  2HUJ A;  1NU7 D;  4B6I A;  1FR0 A;  3QTH A;  1JPN A;  2EIL C;  4EBK A;  4WJ0 A;  4MW3 A;  4OIP F;  2KGO A;  3ZVR A;  4G0H A;  3B29 A;  5JSL A;  4EKW A;  1BBH A;  4DOZ A;  3DAF A;  1U0B B;  2Q00 A; 
#chains in the Genus database with same CATH homology
 3UGO A;  1TKN A;  2DYS C;  3DZA A;  3QMK A;  3JCU Q;  4OIO F;  2R7Q A;  2G3V A;  2J7P A;  2R7X A;  3LEV A;  4IAO A;  3DJU B;  3LS1 A;  5DS5 A;  1FFH A;  1SZI A;  3EGD B;  1J8Y F;  3HLZ A;  3LES A;  2Q9C A;  5D92 A;  5KYX A;  2A6E F;  4JVS A;  2H7B A;  4YT4 A;  4PK4 A;  3VAY A;  2MYS A;  3KKB A;  2IXP A;  2IXO A;  4M63 A;  1M2V B;  3ZIB A;  2CGE A;  2Y39 A;  3LNR A;  2ZXR A;  3V7O A;  4LLE A;  4AE4 B;  2IXM A;  3OWT A;  1FMV A;  3NRH A;  5E33 A;  4YT2 A;  3ASN C;  2A69 F;  1D0X A;  4RDA A;  1VMA A;  3ABM C;  5L3Q A;  4U5H A;  1ZHT A;  3CQZ A;  3JYH A;  2VH3 A;  3UNG C;  4KBL A;  2GFH A;  3W8I A;  1PD1 A;  1Z63 A;  1OCC C;  4JJG A;  4YN0 B;  4BJ6 A;  1ZHY A;  1NU9 C;  1QZX A;  5FCL A;  4OIQ F;  2Q3T A;  1VYK A;  1Z6A A;  1MMN A;  4U5C E;  5F5F A;  3EZI A;  2DYR C;  3T6J A;  5KYW A;  4NY3 A;  3EFO A;  3GAN A;  5D91 A;  2WB7 A;  3EJN A;  1PCX A;  4BJ5 C;  5BUO A;  3L0I A;  4JZA A;  4OIR F;  3DD7 A;  3EQL F;  3EGX A;  4HE8 D;  3NDB B;  3NYL A;  1NZE A;  3HJC A;  1M2O A;  4HFK B;  2KJG A;  2E87 A;  4OIN F;  4O79 A;  1M2V A;  3NYJ A;  2Q9B A;  1ZYR F;  1MND A;  2W9Y A;  4DVY P;  3WOD F;  3IEE A;  2HV7 A;  3L34 A;  1VOM A;  4CS8 A;  3LJB A;  3AG2 C;  1MMD A;  2NUP A;  5KYU B;  3POV A;  3N0T A;  4Q4Z F;  4AX2 A;  1Z23 A;  2WZF A;  3KH2 A;  5DQT A;  5B3S C;  2XSE A;  2J7P D;  1S7Z A;  1VK5 A;  1D1B A;  2W4M A;  1IZM A;  1Z3I X;  3AG3 C;  1ZHZ A;  3ECS A;  2XRH A;  5KYY B;  3ASO C;  4C3E A;  1FTS A;  1OCZ C;  2X51 A;  3LS0 A;  3SP1 A;  5DQZ A;  3DAG A;  1IW7 F;  3EHN A;  4O6Y A;  1ZU5 A;  2NUT A;  1TWG A;  3EH2 A;  4BG0 A;  3GOD A;  4J30 B;  4U5B E;  2A68 F;  4O6N A;  2ZXW C;  4CS7 A;  1PD0 A;  3FDQ A;  2H7V C;  2FGY A;  4E7S A;  3B0U X;  2OG2 A;  5EHH A;  2J0W A;  2J9W A;  3K33 A;  4J32 B;  2YEV A;  3X2Q C;  5DLJ A;  1VYI A;  4BJ1 A;  4XLP F;  3RKO F;  2JD3 A;  3B0V C;  3EGX B;  4P6I C;  2Y3H A;  2M4E A;  2HV6 A;  4C7O A;  5EGY A;  3ABK C;  4ZLD A;  4KI2 A;  3EHM A;  2WVQ A;  4K7B A;  4YT8 A;  4DBR A;  1D1C A;  5E3C A;  2LSE A;  4YWQ A;  3UGP A;  4U5F E;  4ANJ A;  1RJ9 A;  3TD7 A;  4PJM A;  3W2W A;  5DS6 A;  2R7W A;  3RH3 A;  4JCH A;  3I4U A;  4PJJ A;  3MLG A;  1QLE C;  3B9Q A;  2R7R A;  2ZPA A;  2R7S A;  1V55 C;  2YHS A;  2KQ9 A;  3NKE A;  2I8B A;  5DVW A;  4W8K A;  4RD9 A;  1D1A A;  2Y3B A;  4KC9 A;  3K7D A;  2DGJ A;  4EWC A;  3LLK A;  4GYT A;  3ITF A;  2IYL D;  3EGD A;  3T4R A;  3T6B A;  4I44 A;  3O39 A;  5KYX B;  3AG1 C;  2O9X A;  3DXJ F;  3EH1 A;  4BJ5 A;  1MNE A;  3LAY A;  2PX0 A;  3JRT A;  3Q6N A;  1BR4 A;  3KL4 A;  3Q7L A;  4LER A;  1D0Y A;  3VYW A;  1KU2 A;  3FHD A;  4FES A;  3ZG1 A;  3Q7G A;  1M56 C;  4LLC A;  4G7O F;  3RIP A;  4FWV A;  2EIN C;  1OCR C;  2C04 A;  1N1C A;  2OCC C;  3FVY A;  2H7O A;  2CDQ A;  3DM5 A;  1OKK D;  3K66 A;  1LKX A;  4YT5 A;  4ULW A;  1J8M F;  1G8X A;  5B1B C;  1WGW A;  2Y3D A;  4O7G A;  2ZXO A;  1V54 C;  1OKK A;  4BEJ A;  3O6X A;  4C3B A;  2J0X A;  4U5G A;  2IXN A;  2A6H F;  3ZSU A;  3I5Q A;  4JJF A;  4PFO A;  2FFH A;  3LLI A;  4IRU A;  3SZR A;  2B0J A;  4PJL A;  3OA1 A;  3QZC A;  2WL8 A;  4CS9 A;  3AG4 C;  4PFP A;  2Z15 A;  2P7V A;  4G7H F;  3UMI A;  1LS1 A;  3M1C B;  4MND A;  4JUR I;  2PP4 A;  5B1A C;  2Q9A A;  3CSK A;  4CSA A;  1O87 A;  3NYM A;  3UMH A;  3W8H A;  3DJN B;  3I5P A;  4I1M A;  2QTV A;  2R7T A;  1O5H A;  4BJT A;  3NKD A;  5HSW A;  1Z5Z A;  1ZHW A;  4K0D A;  1NG1 A;  1TR2 A;  4IWB A;  4CIH A;  3E70 C;  4MQ9 F;  4I1O B;  2WZL A;  3EG9 B;  4Q7C A;  4CSA C;  5KYN A;  3SEO A;  2A1D D;  2WVO A;  4JW1 A;  4IJJ A;  4XTK A;  3ZC4 A;  1M57 C;  2IOQ A;  3N2Z B;  4U5E E;  3B0P A;  2V3C C;  1OCO C;  4QI2 A;  2G3K A;  4PJN A;  2CNW D;  2YZS A;  5E2Q A;  5E3A A;  1JPJ A;  3X1O A;  3FAJ A;  2Y69 C;  2G62 A;  3RYL A;  4CS9 C;  4QDL A;  3F47 A;  5DS4 A;  4ZLC A;  2XXA B;  2NUP B;  1ST6 A;  1TWA A;  3EFO B;  5T1D B;  2J9V A;  2D5R B;  4X0R A;  3UMK A;  5IY5 C;  4HFF B;  4BJ6 C;  1ZHX A;  2R7U A;  4CBE A;  2VB6 A;  2ZXP A;  2BE5 F;  2WVN A;  5CI8 A;  3F46 A;  5T3T A;  3JT1 A;  3DM9 B;  4E7Z A;  2NG1 A;  5KYU A;  3AQC A;  1TWH A;  2PX3 A;  2Y3G A;  2J45 A;  3S27 A;  3N24 A;  4KNW A;  4RBN A;  3H65 A;  2W45 A;  3AQB A;  4AE4 A;  1BR2 A;  1FMW A;  1SMY F;  2J9U A;  4GEH A;  4Q5S F;  3RFY A;  4FX5 A;  3W2V A;  2EIJ C;  1SF8 A;  2CNW A;  4LAC B;  1D0Z A;  2R7O A;  2C03 A;  4XWJ A;  1W2W A;  4DVZ A;  2L9J A;  3NG1 A;  2R7V A;  2PF4 E;  3KMI A;  2J46 A;  5T3W A;  3SNH A;  4KNV A;  3JSZ A;  5F5H A;  3ABL C;  1MMG A;  3WG7 C;  4OD4 A;  4EBB A;  3OEO A;  2QY9 A;  3K6B A;  2CW0 F;  2P6V A;  3EPV A;  4U5D E;  4CS8 C;  5KYY A;  3S28 A;  2EIM C;  3UR3 C;  4QI0 A;  3PHF 2;  1ZU4 A;  1FFT C;  5KYW B;  4H4K C;  2NUT B;  3K1H A;  3PMR A;  3K1I C;  1TWC A;  2XXA A;  3HTK C;  2W4B A;  2WZG A;  4O6M A;  4I3M A;  4YJW A;  4DBQ A;  4F4B A;  2MWQ A;  2V26 A;  1RJ9 B;  2KNH A;  3EZH A;  2XL4 A;  2EIK C;  4XLN F;  3MX3 A;  3S0X A;  1BR1 A;  5CI9 A;  2PFD A;  4HEA J;  3DMD A;  3EG9 A;  3SYN A;  2VAS A;  4A2N B;  4C3D A;  3Q6M A;  4N06 A;  3CZ6 A;  3S29 A;  4C7O B;  2KW3 C;  1MMA A;  4G7Z F;  4AK9 A;  3E9V A;  5L3V A;  1LVK A;  2L81 A;  4OD5 A;  1NU7 D;  4B6I A;  1JPN A;  2EIL C;  4WJ0 A;  4OIP F;  2KGO A;  3ZVR A;  4G0H A;  4DOZ A;  3DAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...