2QE9A

Crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
171
structure length
165
Chain Sequence
HHHHHENLYFQGMMKFFEYNWQVRDQWFTWCHQLTTEELLKNRLGGVENILYTLFHIIDVEYSWIRAIQGKEDIAVQFADYQTLNKVKSLSNTFRTEIIDVLQTHELVSVPWETGVLYTRDEILHHIIAHEIHHIGQLSVWARELKLSPVSASFIGRTLKPIHSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein yizA
publication title Crystal structure of uncharacterized protein BSU10800 (YP_054576.1) from Bacillus subtilis at 1.90 A resolution
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 53
structure length 165
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05163 DinB DinB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2qe9A01
5COGA 3GORA 2QE9A 2YQYA 5COMA 3QTHA 5COFA 2OQMA 1RXQA 2F22A 3CEXA 2NSGA 3DI5A 4N6CA 3DKAA 2OU6A 2P1AA 5CIVA 2RD9A 2NSFA 2QNLA 2HKVA
chains in the Genus database with same CATH superfamily
2EILC 4ANJA 3HNIA 1HW1A 5D92A 4DRJB 1TQGA 4JW1A 2EIJC 1UG7A 1JR8A 1T6IA 3QMKA 3S27A 3HNLA 4AE4B 5EGYA 5COFA 3DE8A 1K05A 1RJ9A 4NCQA 1Y4CA 2LP4A 4CS8A 3US6A 2HJMA 5A6BA 2CGEA 2VCCA 2WVQA 4O79A 4QI0A 1E2XA 4QDLA 4CS9C 4CBEA 5FCLA 5TJ5E 1Q0GA 2IXNA 3Q7GA 1KU2A 4OIQF 1NU9C 1WATA 4C3BA 5L0JA 1SF8A 4HE8D 5T1DB 1RCPA 1Q0DA 1WOLA 1QPUA 1XZQA 1G4WR 4LDKA 3OEOA 4N6HA 3C8GD 4U5DE 3GWNA 5A6JA 4YT5A 1D0XA 1FMWA 2EIMC 4IJJA 4YWQA 4Q4ZF 3CQZA 4A4AA 4YL1A 1V54C 4CJOA 4YN0B 4DVZA 2G3KA 2IXMA 1OCCC 1ZU5A 1E84A 4MQ9F 1M2OA 3SYNA 2H7VC 2Q00A 3EQLF 1NU7D 4U5HA 2ICWG 2I15A 2NUPA 4IAOA 4CS9A 1SR2A 1RKEB 4QI2A 2XLOA 3WHNA 4ULVA 1NBBA 1C03A 3DM5A 4LLEA 3EZIA 3EGXA 1YLMA 3AJMA 3JYYA 3TOMA 2KNHA 1V4AA 1YYJA 1O5HA 3QVYA 4NTBA 1YZCA 2AU5A 3E70C 4GEHA 3VYWA 4JTDB 1W2WA 1LS1A 1NFOA 2OG2A 1MMAA 3S9OA 2XXAB 1I5NA 2XM0A 3DXJF 4KNWA 3RKOF 1APCA 1AVOB 2CNWD 4BJ1A 1BR2A 1OW7A 3CAXA 1U0BB 3RH3A 3JRMO 3AOUA 1FMVA 3PMRA 2ZXPA 4YL0A 1BBHA 2GAQA 5K0IA 2HZ8A 3H65A 5EK0A 2Y3GA 3AG3C 4PR9A 3UR3C 5B3IA 2PBEA 3DJUB 5KYWA 1SYQA 4ULWA 3WAQA 1CGNA 2WZFA 3FDQA 3NMJA 2H8AA 1R5ID 3DI5A 5KYYB 3ZWIA 5A6AA 1V55C 4YT4A 5L3VA 4FESA 4H4KC 3JTLO 2YWAA 3V5ZA 2PFDA 2XSEA 2J7PA 1R4TA 2J9WA 3LUTB 4IB4A 4LERA 3U3FA 4WJ0A 2VCAA 4KC9A 5T3WA 1JRAA 2L9JA 2WZLA 4E0HA 3NYJA 2OEXA 4WGZA 2YLIA 4XLPF 1H6GA 2XL8A 4IRUA 3M4CA 2XLVA 2KJGA 3UGPA 1ZYRF 2B0HA 5HSWA 3DM9B 3U8VA 3MX3A 2R7UA 1GS9A 1WGWA 4MVSA 1ST6A 4OINF 3B71A 3S84A 4XEFA 3LEOA 3BEHA 3ASOC 3DJNB 1ZU4A 2WZGA 3DAGA 3W8IA 2OCCC 3IHUA 4IWBA 1EKYA 4MVOA 3V5XA 3K1IC 2ZXOA 3EH1A 1JOGA 2YRFA 1LKXA 3GEHA 4J7YA 3FAPB 1MMGA 3RQFA 1VYIA 2GWWA 3DAFA 5D91A 2A6EF 4CIPA 3ZIBA 3EG9A 3ZQVA 4P9TA 2JPUA 1M57C 2XL6A 1TWHA 1A7VA 2O9XA 3S28A 3GM2A 3K6BA 4PACA 4AE4A 4I3MA 4MW8A 1ZHXA 5L0DA 3S29A 4UDVA 5JSLA 3VRCA 3SXYA 1CGOA 4E7ZA 4O6MA 4AL0A 3DMDA 1D1AA 4MS2A 1LIHA 4HFFB 2XM4A 5DS4A 3X2QC 3GODA 1KTMA 3O55A 2HFIA 3IQTA 4ONSA 1D1BA 3FOPA 1FFHA 4MVRA 2CDQA 1NZEA 3C8GA 2J0XA 3K1IA 4K1OA 5BQIA 3IPMO 4G78A 1V74B 1MMNA 2Y39A 1C02A 4U9DA 3ZTZA 4FWVA 4JC7A 3U8PA 2LCHA 3UMIA 1WN0A 3A11A 4G7ZF 2D5RB 3CZ6A 2TMVP 3M1CB 4LDRA 4FX5A 2YL3A 2WL8A 1VK5A 2BC5A 1D0YA 4EIYA 2H7OA 4C7OB 1Z7Qc 3L8JA 4LDQA 3T6BA 2A0UA 5L3QA 3ZVRA 1I4ZA 3HNKA 5E2QA 4BEMJ 2HKVA 3PCVA 2R03A 4PJJA 1UFBA 3U2MA 2LFDA 5E3CA 3UMHA 5T3TA 2HMZA 1OKKA 2OJED 2Y3HA 1BDJB 5A69A 4I44A 3HNJA 4P6IC 1FTSA 3C63A 3DZAA 4XWJA 1SZIA 2YL1A 4D4XA 2EPNA 2FGYA 3F47A 3SZRA 3C7JA 3IQ6A 4J30B 2CNWA 1Z63A 1Z3IX 2XXAA 1H9GA 2EPKX 3A9CA 5B3SC 1DOWA 1ZZPA 1RMVA 3T4RA 3MFNA 1HE9A 4XQ1A 5CI9A 2VB6A 4JEAA 3ABMC 2OEVA 2ZXWC 4YL3A 3VM6A 1D1CA 2OOCA 4K7BA 3M4BA 4K0DA 1ZHTA 5GPGB 2PX3A 1G8XA 3AQBA 4BG0A 5EHHA 5HV9A 2Q4FA 2YKZA 3KMIA 4E17A 3R2PA 1OXKA 1WWPA 5IY5C 5KYXB 2PX0A 4DVYP 4RD9A 2J46A 2R7QA 4U5GA 5DS6A 4EBKA 1T6UA 2YVKA 2IM8A 3M79A 2LSEA 3NMKA 1MQVA 2IBFA 3L34A 2DB4A 2A68F 5F5FA 4JCHA 3FAJA 3RF3A 2XLMA 4E0IA 5KYUB 5DQZA 3Q6MA 4JURI 3U3BA 3G4ZA 3POVA 2VASA 4MVUA 4BJ6C 1VLSA 4I1OB 2MWQA 3FXHA 5JS5A 3NDBB 5DQTA 1YA7O 5DS5A 1WASA 2WVOA 4ZLCA 1G5ZA 2J9BA 1C17M 3BRJA 2X51A 1PCXA 3LJBA 3N2ZB 1I4YA 3TD7A 1MNDA 2JD3A 4OIRF 2R25A 4XPWA 2NUTA 2L6FA 2GA0A 3KYIA 2YLGA 4A2NB 2J45A 3GEEA 4W8PA 2XL4A 1JAFA 3JT1A 2I8BA 2OJQA 2YLDA 5L0GA 3NG1A 4KI2A 1QVXA 3EZHA 4YJWA 3ABKC 1E86A 2M64A 2R7OA 1J8MF 3MLGA 3AG2C 3ZDLA 3C62A 2Q9BA 2J0WA 4XTKA 1YYXA 2D4UA 3B29A 3KPHA 1A41A 2CCYA 3NMIA 1SMYF 2P1AA 2Z15A 3ECSA 4PJLA 1JPNA 4PK4A 2AWYA 4I1MA 1TFKB 3X1OA 3EGDB 4BJ6A 2L7AA 3LAYA 2YL0A 4DBQA 3FMSA 1NLXA 2CYDA 2Y3DA 1T01A 2XLWA 1AEPA 4BPMA 5B1AC 4DRIB 2UUHA 2QUPA 1LI5A 2EINC 3B0UX 1LS4A 2W4MA 1J8YF 4J32B 4L6RA 4C3EA 5A6KA 2WVNA 3Q6NA 2KSFA 3ATPA 4NTFA 4YT2A 3AG4C 1Q0MA 1YVIA 3NYLA 4JTAB 4U9EA 3WODF 1E85A 3V5YA 2YQYA 2NPUA 3LNMB 4MVMA 3VF0A 3G4XA 2X0CA 4LACB 1A7EA 3W2VA 2HSQA 4PFPA 3LS0A 2ZD9A 5JLIA 1JMWA 1RXQA 3OWTA 1OR2A 3EHMA 1OCOC 1HMOA 3B0PA 3SNHA 1TFOB 4EKWA 1VOMA 1LPEA 4RDAA 4HFKB 4IARA 1Z5ZA 1O3UA 2A1DD 2HS5A 2IXOA 2OU6A 4O6NA 4F4BA 5DLJA 3T9OA 3GM3A 2G62A 5BQGA 3RW0A 3ZC4A 5E3AA 3RIPA 3UGOA 2YHSA 3RVZA 3ITFA 3GM1A 3NYMA 1M6TA 2NG1A 3N24A 4O6YA 1M56C 4X0RA 3EGXB 3WG7C 3K7DA 2XRHA 1U89A 1ZVZA 2QNLA 2UUIA 3JCUQ 4OIPF 3OA1A 2XS8A 1OCZC 2J9UA 3IQCA 2R7TA 4CSAC 4OIOF 3AQCA 1VTMP 1GGQA 2E87A 3SXMA 2IXPA 3EH2A 2W4BA 4CDAA 1ORSC 1ORYA 3W4YA 1TWCA 3JYHA 4EBJA 1EQ1A 1F1MA 2R7SA 3CEXA 1QKRA 2H7BA 2HSBA 3GEIA 4JCZA 1B68A 1CPQA 1L3PA 2PNOA 3UNGC 4EUKB 5KYWB 2R7VA 5DVWA 1K40A 1LM3B 3QW1A 3I5PA 3U9MA 1T5OA 3EFOB 4P9FA 1MNEA 4NTAA 1XWJA 4J7TA 1EA8A 4JTCB 1QQ3A 2BE5F 2GFHA 2JX0A 2KYHA 2QLAA 3EJNA 2R9RB 1JPJA 3LESA 3O39A 4CDVA 1KNYA 2FFHA 3T6JA 5AC4A 5JRAA 4JRZA 4KNVA 2YEVA 1XZPA 2XLEA 2AP3A 1ZW3A 4DOZA 2DGJA 5L0CA 4CSAA 2W45A 1CPRA 4GQHA 5KYUA 4FAPB 1S05A 4CS8C 1RKEA 2J9VA 4MTFA 4XEKA 3PHF2 2P7VA 3FVYA 1QLEC 1U6HA 1IW7F 2NSGA 1TWAA 3TJ6A 1IZMA 1E83A 1OQCA 1HY5A 4MTGA 2HJ3A 3DWWA 1ZHYA 3QVZA 4MNDA 4XPXA 2LK4A 3RQGA 3JSEO 3FOOA 2LFFA 1ZHWA 3W2WA 4EBBA 5CIVA 1FAPB 1MMDA 2WB7A 3K66A 1VMAA 2RD9A 2VCBA 5F28E 1WTYA 4ZLDA 2V26A 3K33A 1HW2A 2ZPAA 4DXWA 5KYNA 3ZSUA 3AGTA 1YZAA 2M4EA 2ZXRA 3RVYA 1HMDA 3QW0A 5AGFA 1ORJA 2HV7A 2EPLX 2Q3TA 3KH2A 3O10A 4GYTA 4LLCA 5COMA 4W8KA 1OW6A 5KYYA 2ETSA 3R7CA 3QTHA 3RYLA 4XEVA 5BUOA 1N1CA 4DRHB 3EGDA 3S0XA 4U5CE 4KBLA 3U5SA 4AX2A 2G3VA 4PJMA 1G4US 1RKCA 2F22A 2Y69C 1DOVA 2KW3C 3DKAA 1T9KA 5JVEA 1QSPA 4AL1A 1VLTA 3CSKA 4BEJA 5B1BC 3F46A 1AUEA 3RFYA 5F5HA 3C8GB 2DYSC 1LE2A 1TWGA 1Q0FA 1VB5A 3GWLA 3ZG1A 2KQ9A 3H2VA 1PD1A 2V3CC 1M2VB 2P6VA 3KL4A 2IOQA 3C8ZA 4CJGA 2R02A 4JZAA 4Z9JA 5JT4A 3SXZA 5L0FA 2L81A 5BQHA 5JP7A 5AC5A 2EPOA 2R7RA 1HE1A 1OXBA 2R7XA 1Y6DA 4MVZA 2OQMA 3Q7LA 4Z9HA 4DBRA 4N06A 1GM5A 1EI7A 4IAQA 4N6CA 3ASNC 1NSGB 3JRTA 4EWCA 1RJ9B 3L1MA 3NRHA 2KK1A 2MYSA 4WGYA 1OKKD 4XLNF 2QY9A 2XLHA 5E33A 4HEAJ 1OW8A 2P0NA 2RSEB 4CX9A 4E7SA 5A6BD 3I4UA 4Q7CA 1YAUO 3KYJA 4M63A 1Z6AA 1GQAA 4D4NA 4G7OF 2A0BA 2PF4E 3UMKA 1OCRC 3O6XA 1LI7A 3JSZA 3QZCA 3AGUA 1NG1A 3GORA 3TQOA 1YA9A 2XLDA 3MYFA 3HJCA 2EPMX 3ABLC 1LE4A 2MHRA 4O7GA 4OD4A 3G50A 3ZQYA 1FNTc 2YL7A 3EFOA 5JUAA 2QTVA 4BJTA 2FAPB 2IYLD 3K1HA 4JVSA 5CI8A 3LLIA 3U2LA 2A6HF 2BL2A 3DD7A 3FHDA 4CS7A 4JE9A 5L0HA 2P61A 2XS1A 4C7OA 1TKNA 2L6GA 1A0BA 2DYRC 2C03A 2R05A 3I5QA 2HV6A 4IGGA 3GANA 4JJGA 4PJNA 2NUPB 1PD0A 3SEOA 3C18A 3IEEA 2HUJA 1O87A 3TULA 4U5EE 4BJ5C 2HMQA 3U9JA 1K04A 2NSFA 3H2UA 1PV3A 2LQGA 2Q9CA 5COGA 3SP1A 4ER9A 1FFTC 3IQ5A 3PDMP 2LD6A 3B0VC 3N0TA 4DJ9A 4WABA 1TR2A 4MW3A 2CW0F 2NUTB 4H54A 2Y3BA 4R32A 4C3DA 2W9YA 2KGOA 3TOLA 3B9QA 1YARO 4NY3A 3V7OA 1H9TA 4OD5A 1BR1A 1D0ZA 4Z9IA 3TK0A 1H7IA 2LIGA 1S7ZA 3MYIA 2VC9A 2DI3A 3VAYA 1YJGA 1Q0KA 256BA 3LEVA 3T6GB 4N4WA 4CIHA 1NFNA 1T6QA 4B6IA 3ZTMA 1YDIA 2AWCA 5KYXA 4E18A 1LVKA 4BJ5A 3KKBA 3NKEA 1L7CA 2J8WA 3S90A 3LNRA 2EIKC 2VH3A 1A7DA 3M15A 2AVKA 4Q5SF 3SXKA 1CGME 1OR3A 4MVQA 2J7PD 4G0HA 4RBNA 2Q7RA 2QE9A 2A69F 4CDYA 3TJ5A 4JEBA 3E9VA 4YK5A 4AK9A 3LS1A 4G7HF 4EHPA 1VYKA 4MTOA 2ASRA 2Q9AA 5FZTA 3W8HA 2C04A 2KC3A 2PP4A 1ZW2A 2YZSA 3HTKC 3LLKA 4JJFA 4PFOA 4U5FE 4YT8A 1BR4A 3EHNA 4NC3A 3U0CA 3HLZA 1FR0A 4JIOA 3AG1C 3NKDA 1M2VA 3HKKA 2R7WA 1ZHZA 3RQEA 3L8IA 4NQFA 5L0IA 3J06A 2B0JA 3EPVA 3MBGA 1QZXA 3JZ0A 2GDCA 3L0IA 2OKUA 1BZ4A 2L6HA 4JKVA 4XPYA 3DE9A 4U5BE 1Z23A 3EG9B
chains in the Genus database with same CATH topology
5COGA 3GORA 2QE9A 2YQYA 5COMA 3QTHA 5COFA 2OQMA 1RXQA 2F22A 3CEXA 2NSGA 3DI5A 4N6CA 3DKAA 2OU6A 2P1AA 5CIVA 2RD9A 2NSFA 2QNLA 2HKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5COG A;  3GOR A;  2QE9 A;  2YQY A;  5COM A;  3QTH A;  5COF A;  2OQM A;  1RXQ A;  2F22 A;  3CEX A;  2NSG A;  3DI5 A;  4N6C A;  3DKA A;  2OU6 A;  2P1A A;  5CIV A;  2RD9 A;  2NSF A;  2QNL A;  2HKV A; 
#chains in the Genus database with same CATH topology
 2EIL C;  4ANJ A;  3HNI A;  1HW1 A;  5D92 A;  4DRJ B;  1TQG A;  4JW1 A;  2EIJ C;  1UG7 A;  1JR8 A;  1T6I A;  3QMK A;  3S27 A;  3HNL A;  4AE4 B;  5EGY A;  5COF A;  3DE8 A;  1K05 A;  1RJ9 A;  4NCQ A;  1Y4C A;  2LP4 A;  4CS8 A;  3US6 A;  2HJM A;  5A6B A;  2CGE A;  2VCC A;  2WVQ A;  4O79 A;  4QI0 A;  1E2X A;  4QDL A;  4CS9 C;  4CBE A;  5FCL A;  5TJ5 E;  1Q0G A;  2IXN A;  3Q7G A;  1KU2 A;  4OIQ F;  1NU9 C;  1WAT A;  4C3B A;  5L0J A;  1SF8 A;  4HE8 D;  5T1D B;  1RCP A;  1Q0D A;  1WOL A;  1QPU A;  1XZQ A;  1G4W R;  4LDK A;  3OEO A;  4N6H A;  3C8G D;  4U5D E;  3GWN A;  5A6J A;  4YT5 A;  1D0X A;  1FMW A;  2EIM C;  4IJJ A;  4YWQ A;  4Q4Z F;  3CQZ A;  4A4A A;  4YL1 A;  1V54 C;  4CJO A;  4YN0 B;  4DVZ A;  2G3K A;  2IXM A;  1OCC C;  1ZU5 A;  1E84 A;  4MQ9 F;  1M2O A;  3SYN A;  2H7V C;  2Q00 A;  3EQL F;  1NU7 D;  4U5H A;  2ICW G;  2I15 A;  2NUP A;  4IAO A;  4CS9 A;  1SR2 A;  1RKE B;  4QI2 A;  2XLO A;  3WHN A;  4ULV A;  1NBB A;  1C03 A;  3DM5 A;  4LLE A;  3EZI A;  3EGX A;  1YLM A;  3AJM A;  3JYY A;  3TOM A;  2KNH A;  1V4A A;  1YYJ A;  1O5H A;  3QVY A;  4NTB A;  1YZC A;  2AU5 A;  3E70 C;  4GEH A;  3VYW A;  4JTD B;  1W2W A;  1LS1 A;  1NFO A;  2OG2 A;  1MMA A;  3S9O A;  2XXA B;  1I5N A;  2XM0 A;  3DXJ F;  4KNW A;  3RKO F;  1APC A;  1AVO B;  2CNW D;  4BJ1 A;  1BR2 A;  1OW7 A;  3CAX A;  1U0B B;  3RH3 A;  3JRM O;  3AOU A;  1FMV A;  3PMR A;  2ZXP A;  4YL0 A;  1BBH A;  2GAQ A;  5K0I A;  2HZ8 A;  3H65 A;  5EK0 A;  2Y3G A;  3AG3 C;  4PR9 A;  3UR3 C;  5B3I A;  2PBE A;  3DJU B;  5KYW A;  1SYQ A;  4ULW A;  3WAQ A;  1CGN A;  2WZF A;  3FDQ A;  3NMJ A;  2H8A A;  1R5I D;  3DI5 A;  5KYY B;  3ZWI A;  5A6A A;  1V55 C;  4YT4 A;  5L3V A;  4FES A;  4H4K C;  3JTL O;  2YWA A;  3V5Z A;  2PFD A;  2XSE A;  2J7P A;  1R4T A;  2J9W A;  3LUT B;  4IB4 A;  4LER A;  3U3F A;  4WJ0 A;  2VCA A;  4KC9 A;  5T3W A;  1JRA A;  2L9J A;  2WZL A;  4E0H A;  3NYJ A;  2OEX A;  4WGZ A;  2YLI A;  4XLP F;  1H6G A;  2XL8 A;  4IRU A;  3M4C A;  2XLV A;  2KJG A;  3UGP A;  1ZYR F;  2B0H A;  5HSW A;  3DM9 B;  3U8V A;  3MX3 A;  2R7U A;  1GS9 A;  1WGW A;  4MVS A;  1ST6 A;  4OIN F;  3B71 A;  3S84 A;  4XEF A;  3LEO A;  3BEH A;  3ASO C;  3DJN B;  1ZU4 A;  2WZG A;  3DAG A;  3W8I A;  2OCC C;  3IHU A;  4IWB A;  1EKY A;  4MVO A;  3V5X A;  3K1I C;  2ZXO A;  3EH1 A;  1JOG A;  2YRF A;  1LKX A;  3GEH A;  4J7Y A;  3FAP B;  1MMG A;  3RQF A;  1VYI A;  2GWW A;  3DAF A;  5D91 A;  2A6E F;  4CIP A;  3ZIB A;  3EG9 A;  3ZQV A;  4P9T A;  2JPU A;  1M57 C;  2XL6 A;  1TWH A;  1A7V A;  2O9X A;  3S28 A;  3GM2 A;  3K6B A;  4PAC A;  4AE4 A;  4I3M A;  4MW8 A;  1ZHX A;  5L0D A;  3S29 A;  4UDV A;  5JSL A;  3VRC A;  3SXY A;  1CGO A;  4E7Z A;  4O6M A;  4AL0 A;  3DMD A;  1D1A A;  4MS2 A;  1LIH A;  4HFF B;  2XM4 A;  5DS4 A;  3X2Q C;  3GOD A;  1KTM A;  3O55 A;  2HFI A;  3IQT A;  4ONS A;  1D1B A;  3FOP A;  1FFH A;  4MVR A;  2CDQ A;  1NZE A;  3C8G A;  2J0X A;  3K1I A;  4K1O A;  5BQI A;  3IPM O;  4G78 A;  1V74 B;  1MMN A;  2Y39 A;  1C02 A;  4U9D A;  3ZTZ A;  4FWV A;  4JC7 A;  3U8P A;  2LCH A;  3UMI A;  1WN0 A;  3A11 A;  4G7Z F;  2D5R B;  3CZ6 A;  2TMV P;  3M1C B;  4LDR A;  4FX5 A;  2YL3 A;  2WL8 A;  1VK5 A;  2BC5 A;  1D0Y A;  4EIY A;  2H7O A;  4C7O B;  1Z7Q c;  3L8J A;  4LDQ A;  3T6B A;  2A0U A;  5L3Q A;  3ZVR A;  1I4Z A;  3HNK A;  5E2Q A;  4BEM J;  2HKV A;  3PCV A;  2R03 A;  4PJJ A;  1UFB A;  3U2M A;  2LFD A;  5E3C A;  3UMH A;  5T3T A;  2HMZ A;  1OKK A;  2OJE D;  2Y3H A;  1BDJ B;  5A69 A;  4I44 A;  3HNJ A;  4P6I C;  1FTS A;  3C63 A;  3DZA A;  4XWJ A;  1SZI A;  2YL1 A;  4D4X A;  2EPN A;  2FGY A;  3F47 A;  3SZR A;  3C7J A;  3IQ6 A;  4J30 B;  2CNW A;  1Z63 A;  1Z3I X;  2XXA A;  1H9G A;  2EPK X;  3A9C A;  5B3S C;  1DOW A;  1ZZP A;  1RMV A;  3T4R A;  3MFN A;  1HE9 A;  4XQ1 A;  5CI9 A;  2VB6 A;  4JEA A;  3ABM C;  2OEV A;  2ZXW C;  4YL3 A;  3VM6 A;  1D1C A;  2OOC A;  4K7B A;  3M4B A;  4K0D A;  1ZHT A;  5GPG B;  2PX3 A;  1G8X A;  3AQB A;  4BG0 A;  5EHH A;  5HV9 A;  2Q4F A;  2YKZ A;  3KMI A;  4E17 A;  3R2P A;  1OXK A;  1WWP A;  5IY5 C;  5KYX B;  2PX0 A;  4DVY P;  4RD9 A;  2J46 A;  2R7Q A;  4U5G A;  5DS6 A;  4EBK A;  1T6U A;  2YVK A;  2IM8 A;  3M79 A;  2LSE A;  3NMK A;  1MQV A;  2IBF A;  3L34 A;  2DB4 A;  2A68 F;  5F5F A;  4JCH A;  3FAJ A;  3RF3 A;  2XLM A;  4E0I A;  5KYU B;  5DQZ A;  3Q6M A;  4JUR I;  3U3B A;  3G4Z A;  3POV A;  2VAS A;  4MVU A;  4BJ6 C;  1VLS A;  4I1O B;  2MWQ A;  3FXH A;  5JS5 A;  3NDB B;  5DQT A;  1YA7 O;  5DS5 A;  1WAS A;  2WVO A;  4ZLC A;  1G5Z A;  2J9B A;  1C17 M;  3BRJ A;  2X51 A;  1PCX A;  3LJB A;  3N2Z B;  1I4Y A;  3TD7 A;  1MND A;  2JD3 A;  4OIR F;  2R25 A;  4XPW A;  2NUT A;  2L6F A;  2GA0 A;  3KYI A;  2YLG A;  4A2N B;  2J45 A;  3GEE A;  4W8P A;  2XL4 A;  1JAF A;  3JT1 A;  2I8B A;  2OJQ A;  2YLD A;  5L0G A;  3NG1 A;  4KI2 A;  1QVX A;  3EZH A;  4YJW A;  3ABK C;  1E86 A;  2M64 A;  2R7O A;  1J8M F;  3MLG A;  3AG2 C;  3ZDL A;  3C62 A;  2Q9B A;  2J0W A;  4XTK A;  1YYX A;  2D4U A;  3B29 A;  3KPH A;  1A41 A;  2CCY A;  3NMI A;  1SMY F;  2P1A A;  2Z15 A;  3ECS A;  4PJL A;  1JPN A;  4PK4 A;  2AWY A;  4I1M A;  1TFK B;  3X1O A;  3EGD B;  4BJ6 A;  2L7A A;  3LAY A;  2YL0 A;  4DBQ A;  3FMS A;  1NLX A;  2CYD A;  2Y3D A;  1T01 A;  2XLW A;  1AEP A;  4BPM A;  5B1A C;  4DRI B;  2UUH A;  2QUP A;  1LI5 A;  2EIN C;  3B0U X;  1LS4 A;  2W4M A;  1J8Y F;  4J32 B;  4L6R A;  4C3E A;  5A6K A;  2WVN A;  3Q6N A;  2KSF A;  3ATP A;  4NTF A;  4YT2 A;  3AG4 C;  1Q0M A;  1YVI A;  3NYL A;  4JTA B;  4U9E A;  3WOD F;  1E85 A;  3V5Y A;  2YQY A;  2NPU A;  3LNM B;  4MVM A;  3VF0 A;  3G4X A;  2X0C A;  4LAC B;  1A7E A;  3W2V A;  2HSQ A;  4PFP A;  3LS0 A;  2ZD9 A;  5JLI A;  1JMW A;  1RXQ A;  3OWT A;  1OR2 A;  3EHM A;  1OCO C;  1HMO A;  3B0P A;  3SNH A;  1TFO B;  4EKW A;  1VOM A;  1LPE A;  4RDA A;  4HFK B;  4IAR A;  1Z5Z A;  1O3U A;  2A1D D;  2HS5 A;  2IXO A;  2OU6 A;  4O6N A;  4F4B A;  5DLJ A;  3T9O A;  3GM3 A;  2G62 A;  5BQG A;  3RW0 A;  3ZC4 A;  5E3A A;  3RIP A;  3UGO A;  2YHS A;  3RVZ A;  3ITF A;  3GM1 A;  3NYM A;  1M6T A;  2NG1 A;  3N24 A;  4O6Y A;  1M56 C;  4X0R A;  3EGX B;  3WG7 C;  3K7D A;  2XRH A;  1U89 A;  1ZVZ A;  2QNL A;  2UUI A;  3JCU Q;  4OIP F;  3OA1 A;  2XS8 A;  1OCZ C;  2J9U A;  3IQC A;  2R7T A;  4CSA C;  4OIO F;  3AQC A;  1VTM P;  1GGQ A;  2E87 A;  3SXM A;  2IXP A;  3EH2 A;  2W4B A;  4CDA A;  1ORS C;  1ORY A;  3W4Y A;  1TWC A;  3JYH A;  4EBJ A;  1EQ1 A;  1F1M A;  2R7S A;  3CEX A;  1QKR A;  2H7B A;  2HSB A;  3GEI A;  4JCZ A;  1B68 A;  1CPQ A;  1L3P A;  2PNO A;  3UNG C;  4EUK B;  5KYW B;  2R7V A;  5DVW A;  1K40 A;  1LM3 B;  3QW1 A;  3I5P A;  3U9M A;  1T5O A;  3EFO B;  4P9F A;  1MNE A;  4NTA A;  1XWJ A;  4J7T A;  1EA8 A;  4JTC B;  1QQ3 A;  2BE5 F;  2GFH A;  2JX0 A;  2KYH A;  2QLA A;  3EJN A;  2R9R B;  1JPJ A;  3LES A;  3O39 A;  4CDV A;  1KNY A;  2FFH A;  3T6J A;  5AC4 A;  5JRA A;  4JRZ A;  4KNV A;  2YEV A;  1XZP A;  2XLE A;  2AP3 A;  1ZW3 A;  4DOZ A;  2DGJ A;  5L0C A;  4CSA A;  2W45 A;  1CPR A;  4GQH A;  5KYU A;  4FAP B;  1S05 A;  4CS8 C;  1RKE A;  2J9V A;  4MTF A;  4XEK A;  3PHF 2;  2P7V A;  3FVY A;  1QLE C;  1U6H A;  1IW7 F;  2NSG A;  1TWA A;  3TJ6 A;  1IZM A;  1E83 A;  1OQC A;  1HY5 A;  4MTG A;  2HJ3 A;  3DWW A;  1ZHY A;  3QVZ A;  4MND A;  4XPX A;  2LK4 A;  3RQG A;  3JSE O;  3FOO A;  2LFF A;  1ZHW A;  3W2W A;  4EBB A;  5CIV A;  1FAP B;  1MMD A;  2WB7 A;  3K66 A;  1VMA A;  2RD9 A;  2VCB A;  5F28 E;  1WTY A;  4ZLD A;  2V26 A;  3K33 A;  1HW2 A;  2ZPA A;  4DXW A;  5KYN A;  3ZSU A;  3AGT A;  1YZA A;  2M4E A;  2ZXR A;  3RVY A;  1HMD A;  3QW0 A;  5AGF A;  1ORJ A;  2HV7 A;  2EPL X;  2Q3T A;  3KH2 A;  3O10 A;  4GYT A;  4LLC A;  5COM A;  4W8K A;  1OW6 A;  5KYY A;  2ETS A;  3R7C A;  3QTH A;  3RYL A;  4XEV A;  5BUO A;  1N1C A;  4DRH B;  3EGD A;  3S0X A;  4U5C E;  4KBL A;  3U5S A;  4AX2 A;  2G3V A;  4PJM A;  1G4U S;  1RKC A;  2F22 A;  2Y69 C;  1DOV A;  2KW3 C;  3DKA A;  1T9K A;  5JVE A;  1QSP A;  4AL1 A;  1VLT A;  3CSK A;  4BEJ A;  5B1B C;  3F46 A;  1AUE A;  3RFY A;  5F5H A;  3C8G B;  2DYS C;  1LE2 A;  1TWG A;  1Q0F A;  1VB5 A;  3GWL A;  3ZG1 A;  2KQ9 A;  3H2V A;  1PD1 A;  2V3C C;  1M2V B;  2P6V A;  3KL4 A;  2IOQ A;  3C8Z A;  4CJG A;  2R02 A;  4JZA A;  4Z9J A;  5JT4 A;  3SXZ A;  5L0F A;  2L81 A;  5BQH A;  5JP7 A;  5AC5 A;  2EPO A;  2R7R A;  1HE1 A;  1OXB A;  2R7X A;  1Y6D A;  4MVZ A;  2OQM A;  3Q7L A;  4Z9H A;  4DBR A;  4N06 A;  1GM5 A;  1EI7 A;  4IAQ A;  4N6C A;  3ASN C;  1NSG B;  3JRT A;  4EWC A;  1RJ9 B;  3L1M A;  3NRH A;  2KK1 A;  2MYS A;  4WGY A;  1OKK D;  4XLN F;  2QY9 A;  2XLH A;  5E33 A;  4HEA J;  1OW8 A;  2P0N A;  2RSE B;  4CX9 A;  4E7S A;  5A6B D;  3I4U A;  4Q7C A;  1YAU O;  3KYJ A;  4M63 A;  1Z6A A;  1GQA A;  4D4N A;  4G7O F;  2A0B A;  2PF4 E;  3UMK A;  1OCR C;  3O6X A;  1LI7 A;  3JSZ A;  3QZC A;  3AGU A;  1NG1 A;  3GOR A;  3TQO A;  1YA9 A;  2XLD A;  3MYF A;  3HJC A;  2EPM X;  3ABL C;  1LE4 A;  2MHR A;  4O7G A;  4OD4 A;  3G50 A;  3ZQY A;  1FNT c;  2YL7 A;  3EFO A;  5JUA A;  2QTV A;  4BJT A;  2FAP B;  2IYL D;  3K1H A;  4JVS A;  5CI8 A;  3LLI A;  3U2L A;  2A6H F;  2BL2 A;  3DD7 A;  3FHD A;  4CS7 A;  4JE9 A;  5L0H A;  2P61 A;  2XS1 A;  4C7O A;  1TKN A;  2L6G A;  1A0B A;  2DYR C;  2C03 A;  2R05 A;  3I5Q A;  2HV6 A;  4IGG A;  3GAN A;  4JJG A;  4PJN A;  2NUP B;  1PD0 A;  3SEO A;  3C18 A;  3IEE A;  2HUJ A;  1O87 A;  3TUL A;  4U5E E;  4BJ5 C;  2HMQ A;  3U9J A;  1K04 A;  2NSF A;  3H2U A;  1PV3 A;  2LQG A;  2Q9C A;  5COG A;  3SP1 A;  4ER9 A;  1FFT C;  3IQ5 A;  3PDM P;  2LD6 A;  3B0V C;  3N0T A;  4DJ9 A;  4WAB A;  1TR2 A;  4MW3 A;  2CW0 F;  2NUT B;  4H54 A;  2Y3B A;  4R32 A;  4C3D A;  2W9Y A;  2KGO A;  3TOL A;  3B9Q A;  1YAR O;  4NY3 A;  3V7O A;  1H9T A;  4OD5 A;  1BR1 A;  1D0Z A;  4Z9I A;  3TK0 A;  1H7I A;  2LIG A;  1S7Z A;  3MYI A;  2VC9 A;  2DI3 A;  3VAY A;  1YJG A;  1Q0K A;  256B A;  3LEV A;  3T6G B;  4N4W A;  4CIH A;  1NFN A;  1T6Q A;  4B6I A;  3ZTM A;  1YDI A;  2AWC A;  5KYX A;  4E18 A;  1LVK A;  4BJ5 A;  3KKB A;  3NKE A;  1L7C A;  2J8W A;  3S90 A;  3LNR A;  2EIK C;  2VH3 A;  1A7D A;  3M15 A;  2AVK A;  4Q5S F;  3SXK A;  1CGM E;  1OR3 A;  4MVQ A;  2J7P D;  4G0H A;  4RBN A;  2Q7R A;  2QE9 A;  2A69 F;  4CDY A;  3TJ5 A;  4JEB A;  3E9V A;  4YK5 A;  4AK9 A;  3LS1 A;  4G7H F;  4EHP A;  1VYK A;  4MTO A;  2ASR A;  2Q9A A;  5FZT A;  3W8H A;  2C04 A;  2KC3 A;  2PP4 A;  1ZW2 A;  2YZS A;  3HTK C;  3LLK A;  4JJF A;  4PFO A;  4U5F E;  4YT8 A;  1BR4 A;  3EHN A;  4NC3 A;  3U0C A;  3HLZ A;  1FR0 A;  4JIO A;  3AG1 C;  3NKD A;  1M2V A;  3HKK A;  2R7W A;  1ZHZ A;  3RQE A;  3L8I A;  4NQF A;  5L0I A;  3J06 A;  2B0J A;  3EPV A;  3MBG A;  1QZX A;  3JZ0 A;  2GDC A;  3L0I A;  2OKU A;  1BZ4 A;  2L6H A;  4JKV A;  4XPY A;  3DE9 A;  4U5B E;  1Z23 A;  3EG9 B; 
#chains in the Genus database with same CATH homology
 5COG A;  3GOR A;  2QE9 A;  2YQY A;  5COM A;  3QTH A;  5COF A;  2OQM A;  1RXQ A;  2F22 A;  3CEX A;  2NSG A;  3DI5 A;  4N6C A;  3DKA A;  2OU6 A;  2P1A A;  5CIV A;  2RD9 A;  2NSF A;  2QNL A;  2HKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...