2QE9A

Crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
171
structure length
165
Chain Sequence
b'HHHHHENLYFQGMMKFFEYNWQVRDQWFTWCHQLTTEELLKNRLGGVENILYTLFHIIDVEYSWIRAIQGKEDIAVQFADYQTLNKVKSLSNTFRTEIIDVLQTHELVSVPWETGVLYTRDEILHHIIAHEIHHIGQLSVWARELKLSPVSASFIGRTLKPIHSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein yizA
publication title Crystal structure of uncharacterized protein BSU10800 (YP_054576.1) from Bacillus subtilis at 1.90 A resolution
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 53
structure length 165
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05163 DinB DinB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2qe9A01
5CIVA 3CEXA 3GORA 5COGA 2F22A 3DKAA 2NSFA 2OQMA 5COMA 2HKVA 3DI5A 2RD9A 2P1AA 2QE9A 2QNLA 5COFA 4N6CA 2YQYA 3QTHA 2NSGA 2OU6A 1RXQA
chains in the Genus database with same CATH superfamily
2ETSA 1Q0MA 2IBFA 3C63A 3IQTA 1HE1A 2P0NA 2YVKA 1SZIA 4QDLA 2HJ3A 3ABMC 1WN0A 2LFDA 1L3PA 2MYSA 2RSEB 3IQ6A 3GWLA 1GQAA 3KMIA 4IARA 3TOMA 2AP3A 1D1AA 3FDQA 4GYTA 2LFFA 3QVZA 1GS9A 4BJ1A 1E86A 3C8GB 2HV6A 3QW0A 4CIHA 4OD4A 2OJED 4CJOA 2R7SA 4E7SA 4WJ0A 1OCCC 2CNWD 1I4ZA 1OQCA 4I1MA 5DS5A 1RKEB 3AJMA 3ASOC 4UDVA 2Y3BA 3NKDA 4J7YA 3V5YA 4C3BA 1EQ1A 1ZHWA 4CS8A 5L3QA 4RBNA 4C3EA 1Z63A 1D0ZA 3CSKA 3PMRA 3ZSUA 2R7UA 4IAQA 1VLTA 2IXNA 3LLIA 4PFPA 1TWAA 4U9DA 3TOLA 3TQOA 4AK9A 4EIYA 2R03A 3UMKA 4MS2A 3GM1A 1LVKA 5BQHA 4XLPF 3L8JA 2B0HA 2A6EF 3A11A 2YL0A 3C62A 3PCVA 3Q6MA 4YWQA 3ABLC 3DM9B 4NY3A 5HSWA 1LIHA 2HUJA 4HE8D 4U5CE 4AE4B 3ASNC 4DRIB 3TD7A 3KL4A 1ZW2A 2J8WA 3EHMA 5L0GA 3JCUQ 3AQCA 3ZIBA 2W4MA 2YLDA 1JPNA 4JCZA 3DMDA 1MMNA 1T6IA 5L0HA 3UMIA 2G3VA 2HJMA 4XLNF 2GFHA 3UNGC 3VM6A 3WG7C 2YL1A 5KYXB 1NG1A 2R25A 5JUAA 3BRJA 1D0YA 3EZHA 4MTFA 1UFBA 2A68F 2J46A 2R7WA 1OW8A 1E2XA 2YLIA 4W8PA 2IXPA 5F5FA 1KTMA 1WATA 4BJTA 1V74B 2Y3HA 3S0XA 1FFHA 1U0BB 5DS6A 2XXAB 4BJ5A 1QKRA 2MWQA 5IY5C 2FAPB 2EINC 1M56C 2KYHA 3ITFA 3T6GB 3F46A 1VYIA 3LEVA 4NQFA 3V5XA 3POVA 1OW6A 1TQGA 3GEHA 4MVMA 2OG2A 4I44A 4JIOA 3T6BA 2XRHA 4IGGA 1HMOA 2EILC 1YARO 3CAXA 4MNDA 4YK5A 4PK4A 1OCOC 1L7CA 4JTAB 5E3CA 3U2MA 4PR9A 4K0DA 2R7TA 2NUTB 3FOPA 3HKKA 4EHPA 3U0CA 4C7OA 2GDCA 2XLOA 4A4AA 5A69A 4MTOA 1M57C 5E3AA 1NFOA 3IPMO 1F1MA 4U5HA 3TULA 3DE8A 1HY5A 3WAQA 1FTSA 2H7BA 3C8ZA 2PNOA 4KNWA 3FMSA 4QI2A 2G62A 3DD7A 3EGDB 2TMVP 5KYWA 3GORA 1YZAA 5L0FA 2ASRA 4CSAC 2B0JA 3DZAA 1JAFA 4MVUA 2UUIA 2V26A 3EQLF 4ONSA 4BEJA 2WVQA 4CS7A 1OXKA 1YA7O 1WWPA 2J7PA 2X51A 4KBLA 5JVEA 1H9GA 2CGEA 2EPKX 4G78A 2OQMA 3O10A 3AGUA 1C02A 1IW7F 2LQGA 4IAOA 3ZWIA 2XL6A 4KNVA 5HV9A 2YEVA 3RQGA 4BJ6C 1CGNA 5B1BC 1RCPA 4P9FA 256BA 3K1HA 5JSLA 1TFOB 3JYYA 3RW0A 3ZVRA 1S05A 2L9JA 3G50A 5KYNA 2HS5A 2HSQA 2XLVA 2XLEA 3GEIA 4U5BE 3RKOF 1J8YF 3IQCA 5L3VA 2OEXA 1V55C 4H54A 5T1DB 5K0IA 1MQVA 2Q9AA 1W2WA 1XZPA 5B3SC 3CEXA 2JD3A 1WOLA 4FAPB 3U9MA 3NRHA 4LLCA 3DKAA 3EFOB 5F5HA 3G4ZA 5CI9A 4EUKB 1OR3A 1YLMA 2L81A 3KKBA 1Q0FA 1SF8A 2WVOA 3U3FA 2EIMC 3QZCA 4DRHB 2ZXOA 2IM8A 5A6JA 2DI3A 1ZHZA 1I4YA 3AG4C 3EH2A 2EPOA 3HLZA 4AL0A 1FR0A 3NKEA 1Z6AA 4MVOA 3TK0A 3UR3C 1Y6DA 3T9OA 1YZCA 2R7OA 2YRFA 3T6JA 4U5EE 4Q5SF 1A7EA 4CX9A 2KW3C 4H4KC 3SXZA 4DXWA 3N0TA 1RKEA 4XPXA 1I5NA 3A9CA 1EI7A 1YJGA 4MQ9F 2OEVA 4MVRA 1B68A 1M2OA 2QLAA 3LJBA 4MTGA 1T5OA 1OKKD 2EPLX 2J0XA 1PV3A 4Z9IA 2LK4A 1MNEA 1H6GA 2KJGA 3AQBA 3L34A 5A6AA 5KYUA 5T3WA 2YZSA 3DI5A 2WZGA 1PCXA 1ZZPA 2VCAA 3TJ5A 1BDJB 2JX0A 2QE9A 3ZQVA 3BEHA 2KSFA 4E7ZA 4PJJA 5L0DA 4ULVA 3EGXA 3ZQYA 1LE4A 3WODF 2D5RB 2R02A 3ZTMA 1M6TA 4IRUA 3H2VA 2ZPAA 3GWNA 3J06A 2XL4A 1Y4CA 2I8BA 3O55A 2NG1A 4YJWA 3W2WA 4MVSA 3GM2A 2H8AA 1GM5A 2VB6A 1AUEA 2V3CC 3M79A 4L6RA 5DQTA 5JRAA 1Z7Qc 2BE5F 1Z3IX 2W45A 4JC7A 1U89A 1A0BA 2A0UA 1HE9A 2KGOA 2L7AA 3PHF2 2Y69C 4PJMA 1AVOB 5COMA 3VRCA 5GPGB 4O6MA 5DS4A 3E70C 1SMYF 1FNTc 3HNKA 2CYDA 4MW3A 3K1IC 5A6KA 4OD5A 1OCRC 1M2VB 2VH3A 3EGXB 1YYXA 3S9OA 1VTMP 1C17M 2VASA 1O5HA 2H7OA 2W4BA 3FXHA 4J30B 4PFOA 2NSGA 1SR2A 2OU6A 1J8MF 1JMWA 2VCCA 1ZVZA 2NUPA 1JRAA 1ZW3A 1AEPA 2CNWA 3K7DA 4JCHA 4RDAA 1IZMA 1N1CA 4P9TA 2OJQA 3W8IA 3MLGA 2DB4A 1BR4A 2AU5A 2HZ8A 1CPRA 2J9BA 3M4BA 4WGZA 4ZLCA 2M64A 3OEOA 1VB5A 2C04A 4NTAA 3LEOA 2ZXRA 3JTLO 2AWYA 1VYKA 2J0WA 1TKNA 1T01A 1RMVA 2A69F 2R7QA 5KYYA 2WZLA 1LS4A 2KNHA 1Z23A 1A41A 4FX5A 4KC9A 2HSBA 5T3TA 4C3DA 3U8PA 4YT4A 5B3IA 4KI2A 2L6FA 4JRZA 2GAQA 4BEMJ 2Q4FA 3LLKA 2Q3TA 3ABKC 5DQZA 1ORYA 2VCBA 1RXQA 2PF4E 4HFFB 3DJNB 2D4UA 4OIPF 5TJ5E 4WABA 2Q9BA 4U9EA 2QUPA 5BUOA 1T9KA 1E85A 2BL2A 2G3KA 3S27A 4IB4A 1TWGA 1HW2A 1FMWA 1A7DA 3S29A 4CS9C 2O9XA 4PACA 1APCA 4XEKA 1CGOA 1G4WR 5E33A 3L1MA 5L0JA 3C18A 1D1BA 1RJ9A 5A6BD 1K04A 1VOMA 4FWVA 1YAUO 4YT5A 3I5QA 5DLJA 1U6HA 3B29A 3F47A 5D91A 4E18A 1OCZC 4EWCA 3R2PA 3HJCA 4CS8C 4O7GA 3QTHA 4YT2A 2E87A 5F28E 2OKUA 1D1CA 2H7VC 2AWCA 4MVQA 2MHRA 2IXOA 4CJGA 3DWWA 4LERA 4CS9A 3S84A 3EPVA 4OIOF 1CPQA 4CDAA 5FZTA 2LCHA 2XSEA 2IYLD 4U5FE 5COGA 3U2LA 4A2NB 5EGYA 1S7ZA 3LS1A 4YN0B 3UMHA 4NTFA 4EKWA 1ZHTA 4CIPA 4JTCB 4C7OB 2HMQA 2M4EA 4G7ZF 4R32A 1MMAA 3VYWA 3U9JA 3UGOA 2HFIA 4DVZA 3SXYA 1KU2A 4N06A 3O6XA 3MFNA 2P7VA 3RH3A 1VMAA 3FOOA 2WZFA 4XWJA 2PBEA 3I4UA 3C8GA 2OCCC 3KH2A 4OINF 4EBKA 3LAYA 3O39A 2LD6A 1JR8A 4PJLA 4I3MA 5KYWB 3JRMO 1TWCA 3HNJA 1A7VA 2VC9A 2XS8A 3RQFA 5FCLA 4BJ5C 4LACB 1R4TA 1T6UA 3OA1A 4JJFA 4OIRF 2W9YA 4N4WA 2FGYA 4E0IA 1K40A 4AL1A 3FAPB 2F22A 1DOVA 1OXBA 4B6IA 1LKXA 2L6HA 1QSPA 3W4YA 1NU9C 2NSFA 4YL0A 4XTKA 3X2QC 2HKVA 3ATPA 1G8XA 1XWJA 2ICWG 2LP4A 2CDQA 2XLWA 3GEEA 2WB7A 5DVWA 5BQGA 3ZG1A 4AE4A 5JT4A 2QNLA 1JPJA 2UUHA 3DE9A 2WVNA 2YLGA 5L0CA 1QVXA 2GA0A 1LPEA 2ZXWC 3RIPA 4GQHA 2Q9CA 3JRTA 1LS1A 2DYSC 4O6YA 4D4XA 2ZXPA 4XEVA 3RYLA 3S28A 5BQIA 2KK1A 4DJ9A 5KYXA 4JEAA 2YWAA 1HW1A 3Q7LA 3KPHA 1E84A 4O79A 1NU7D 1FMVA 4N6HA 3K6BA 3B0PA 3JT1A 4K7BA 5CIVA 1LE2A 4K1OA 4EBBA 1HMDA 5JS5A 4CSAA 2IXMA 2I15A 2GWWA 2NPUA 3RVZA 3U8VA 2XXAA 2Y3DA 3ECSA 4HEAJ 1D0XA 1G4US 1Q0DA 3CQZA 4DRJB 3EG9B 3QW1A 2P61A 4P6IC 4W8KA 4ER9A 3GM3A 3IEEA 4JURI 2L6GA 3RF3A 1LM3B 1OKKA 4BJ6A 3NYJA 2R7VA 3LS0A 2YL3A 1FFTC 4QI0A 1K05A 3NDBB 2KC3A 1NZEA 1NFNA 1SYQA 3DAGA 4J32B 3U3BA 2NUTA 2XM0A 2XLHA 3NYMA 1OR2A 3ZC4A 3N24A 5AGFA 4MVZA 3JSZA 4ZLDA 3WHNA 2XS1A 2XLMA 1H9TA 3V5ZA 2DGJA 4GEHA 5KYUB 4D4NA 1WGWA 1ZHYA 3EGDA 1ZU4A 4DBRA 3W2VA 3PDMP 2HV7A 2Y3GA 4OIQF 2PX3A 5CI8A 3KYIA 3AG3C 2A1DD 4O6NA 4LDKA 5B1AC 5AC4A 3G4XA 3LUTB 3SZRA 1VK5A 3VAYA 3QVYA 4JTDB 4N6CA 1T6QA 2YHSA 1EA8A 4IJJA 1RKCA 2LIGA 4LDQA 4U5GA 3MYIA 4Z9HA 2A0BA 3EHNA 3VF0A 1O87A 1JOGA 4YL1A 4E17A 2OOCA 1TR2A 1V54C 2AVKA 1C03A 1ZU5A 3MBGA 2J7PD 3GODA 3HNLA 1WASA 1ZHXA 4JJGA 4JVSA 2XM4A 1TFKB 1ORSC 1YYJA 3K33A 4NCQA 1FAPB 2EIKC 3I5PA 3RFYA 4BPMA 3V7OA 3H65A 4HFKB 4JEBA 3B71A 3X1OA 1BR1A 4YL3A 3ZDLA 4Q4ZF 1LI5A 3DXJF 3B9QA 3R7CA 1XZQA 2LSEA 4EBJA 2XL8A 3HTKC 3NMKA 5JP7A 1VLSA 3EFOA 1Q0KA 2P1AA 1WTYA 2J9WA 3JYHA 3UGPA 4DBQA 3IHUA 1O3UA 3AOUA 1QLEC 4XQ1A 1G5ZA 2NUPB 4U5DE 3L0IA 3RQEA 3DM5A 4JE9A 2A6HF 5EHHA 2EIJC 3EJNA 1QPUA 1YVIA 1YDIA 2X0CA 3N2ZB 1BBHA 2BC5A 3AGTA 3FHDA 3LESA 1QQ3A 3MYFA 3NYLA 4Z9JA 4G7HF 3LNMB 3B0UX 3SNHA 5JLIA 2PP4A 4G7OF 3C7JA 2JPUA 3M1CB 2DYRC 4NTBA 1LI7A 4CDVA 2QY9A 2CCYA 2YL7A 4M63A 5KYYB 3SYNA 2R05A 4JKVA 4DOZA 4E0HA 4WGYA 3T4RA 5AC5A 3C8GD 3EZIA 1DOWA 3QMKA 3OWTA 2Q00A 1MMDA 4PJNA 4J7TA 4XPWA 1YA9A 2RD9A 1V4AA 1R5ID 1Z5ZA 3M15A 4LLEA 3SP1A 3U5SA 2ZD9A 1BZ4A 2C03A 5D92A 4ANJA 5L0IA 1H7IA 3CZ6A 5COFA 3SEOA 2R7XA 1Q0GA 2YQYA 3DAFA 3K1IA 3FAJA 1NLXA 2QTVA 4FESA 5EK0A 4CBEA 4Q7CA 4YT8A 2EPNA 2HMZA 2Q7RA 5A6BA 3SXKA 2XLDA 2Y39A 3RVYA 1E83A 2J45A 1QZXA 4XEFA 4XPYA 3US6A 3S90A 3B0VC 4F4BA 2IOQA 1NBBA 3K66A 3EH1A 1PD0A 3ZTZA 3W8HA 2KQ9A 2R9RB 4ULWA 3NMIA 4CDYA 3AG2C 4LDRA 3MX3A 4BG0A 1RJ9B 2FFHA 2R7RA 2Z15A 1MNDA 3HNIA 3IQ5A 3NMJA 3GANA 4I1OB 4JZAA 4G0HA 1ST6A 1BR2A 4AX2A 2PX0A 2WL8A 1UG7A 3NG1A 2YKZA 3Q7GA 4NC3A 3Q6NA 4RD9A 1PD1A 3LNRA 2EPMX 5E2QA 1MMGA 4JW1A 1EKYA 1NSGB 1CGME 2J9VA 4IWBA 1OW7A 3EG9A 3DJUB 3H2UA 3AG1C 1ZYRF 1GGQA 2J9UA 3JSEO 2PFDA 3M4CA 3SXMA 3TJ6A 1TWHA 2P6VA 1KNYA 2CW0F 3L8IA 1ORJA 3JZ0A 3FVYA 4X0RA 3KYJA 4DVYP 3E9VA 1M2VA 4MW8A
chains in the Genus database with same CATH topology
5CIVA 3CEXA 3GORA 5COGA 2F22A 3DKAA 2NSFA 2OQMA 5COMA 2HKVA 3DI5A 2RD9A 2P1AA 2QE9A 2QNLA 5COFA 4N6CA 2YQYA 3QTHA 2NSGA 2OU6A 1RXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CIV A;  3CEX A;  3GOR A;  5COG A;  2F22 A;  3DKA A;  2NSF A;  2OQM A;  5COM A;  2HKV A;  3DI5 A;  2RD9 A;  2P1A A;  2QE9 A;  2QNL A;  5COF A;  4N6C A;  2YQY A;  3QTH A;  2NSG A;  2OU6 A;  1RXQ A; 
#chains in the Genus database with same CATH topology
 2ETS A;  1Q0M A;  2IBF A;  3C63 A;  3IQT A;  1HE1 A;  2P0N A;  2YVK A;  1SZI A;  4QDL A;  2HJ3 A;  3ABM C;  1WN0 A;  2LFD A;  1L3P A;  2MYS A;  2RSE B;  3IQ6 A;  3GWL A;  1GQA A;  3KMI A;  4IAR A;  3TOM A;  2AP3 A;  1D1A A;  3FDQ A;  4GYT A;  2LFF A;  3QVZ A;  1GS9 A;  4BJ1 A;  1E86 A;  3C8G B;  2HV6 A;  3QW0 A;  4CIH A;  4OD4 A;  2OJE D;  4CJO A;  2R7S A;  4E7S A;  4WJ0 A;  1OCC C;  2CNW D;  1I4Z A;  1OQC A;  4I1M A;  5DS5 A;  1RKE B;  3AJM A;  3ASO C;  4UDV A;  2Y3B A;  3NKD A;  4J7Y A;  3V5Y A;  4C3B A;  1EQ1 A;  1ZHW A;  4CS8 A;  5L3Q A;  4RBN A;  4C3E A;  1Z63 A;  1D0Z A;  3CSK A;  3PMR A;  3ZSU A;  2R7U A;  4IAQ A;  1VLT A;  2IXN A;  3LLI A;  4PFP A;  1TWA A;  4U9D A;  3TOL A;  3TQO A;  4AK9 A;  4EIY A;  2R03 A;  3UMK A;  4MS2 A;  3GM1 A;  1LVK A;  5BQH A;  4XLP F;  3L8J A;  2B0H A;  2A6E F;  3A11 A;  2YL0 A;  3C62 A;  3PCV A;  3Q6M A;  4YWQ A;  3ABL C;  3DM9 B;  4NY3 A;  5HSW A;  1LIH A;  2HUJ A;  4HE8 D;  4U5C E;  4AE4 B;  3ASN C;  4DRI B;  3TD7 A;  3KL4 A;  1ZW2 A;  2J8W A;  3EHM A;  5L0G A;  3JCU Q;  3AQC A;  3ZIB A;  2W4M A;  2YLD A;  1JPN A;  4JCZ A;  3DMD A;  1MMN A;  1T6I A;  5L0H A;  3UMI A;  2G3V A;  2HJM A;  4XLN F;  2GFH A;  3UNG C;  3VM6 A;  3WG7 C;  2YL1 A;  5KYX B;  1NG1 A;  2R25 A;  5JUA A;  3BRJ A;  1D0Y A;  3EZH A;  4MTF A;  1UFB A;  2A68 F;  2J46 A;  2R7W A;  1OW8 A;  1E2X A;  2YLI A;  4W8P A;  2IXP A;  5F5F A;  1KTM A;  1WAT A;  4BJT A;  1V74 B;  2Y3H A;  3S0X A;  1FFH A;  1U0B B;  5DS6 A;  2XXA B;  4BJ5 A;  1QKR A;  2MWQ A;  5IY5 C;  2FAP B;  2EIN C;  1M56 C;  2KYH A;  3ITF A;  3T6G B;  3F46 A;  1VYI A;  3LEV A;  4NQF A;  3V5X A;  3POV A;  1OW6 A;  1TQG A;  3GEH A;  4MVM A;  2OG2 A;  4I44 A;  4JIO A;  3T6B A;  2XRH A;  4IGG A;  1HMO A;  2EIL C;  1YAR O;  3CAX A;  4MND A;  4YK5 A;  4PK4 A;  1OCO C;  1L7C A;  4JTA B;  5E3C A;  3U2M A;  4PR9 A;  4K0D A;  2R7T A;  2NUT B;  3FOP A;  3HKK A;  4EHP A;  3U0C A;  4C7O A;  2GDC A;  2XLO A;  4A4A A;  5A69 A;  4MTO A;  1M57 C;  5E3A A;  1NFO A;  3IPM O;  1F1M A;  4U5H A;  3TUL A;  3DE8 A;  1HY5 A;  3WAQ A;  1FTS A;  2H7B A;  3C8Z A;  2PNO A;  4KNW A;  3FMS A;  4QI2 A;  2G62 A;  3DD7 A;  3EGD B;  2TMV P;  5KYW A;  3GOR A;  1YZA A;  5L0F A;  2ASR A;  4CSA C;  2B0J A;  3DZA A;  1JAF A;  4MVU A;  2UUI A;  2V26 A;  3EQL F;  4ONS A;  4BEJ A;  2WVQ A;  4CS7 A;  1OXK A;  1YA7 O;  1WWP A;  2J7P A;  2X51 A;  4KBL A;  5JVE A;  1H9G A;  2CGE A;  2EPK X;  4G78 A;  2OQM A;  3O10 A;  3AGU A;  1C02 A;  1IW7 F;  2LQG A;  4IAO A;  3ZWI A;  2XL6 A;  4KNV A;  5HV9 A;  2YEV A;  3RQG A;  4BJ6 C;  1CGN A;  5B1B C;  1RCP A;  4P9F A;  256B A;  3K1H A;  5JSL A;  1TFO B;  3JYY A;  3RW0 A;  3ZVR A;  1S05 A;  2L9J A;  3G50 A;  5KYN A;  2HS5 A;  2HSQ A;  2XLV A;  2XLE A;  3GEI A;  4U5B E;  3RKO F;  1J8Y F;  3IQC A;  5L3V A;  2OEX A;  1V55 C;  4H54 A;  5T1D B;  5K0I A;  1MQV A;  2Q9A A;  1W2W A;  1XZP A;  5B3S C;  3CEX A;  2JD3 A;  1WOL A;  4FAP B;  3U9M A;  3NRH A;  4LLC A;  3DKA A;  3EFO B;  5F5H A;  3G4Z A;  5CI9 A;  4EUK B;  1OR3 A;  1YLM A;  2L81 A;  3KKB A;  1Q0F A;  1SF8 A;  2WVO A;  3U3F A;  2EIM C;  3QZC A;  4DRH B;  2ZXO A;  2IM8 A;  5A6J A;  2DI3 A;  1ZHZ A;  1I4Y A;  3AG4 C;  3EH2 A;  2EPO A;  3HLZ A;  4AL0 A;  1FR0 A;  3NKE A;  1Z6A A;  4MVO A;  3TK0 A;  3UR3 C;  1Y6D A;  3T9O A;  1YZC A;  2R7O A;  2YRF A;  3T6J A;  4U5E E;  4Q5S F;  1A7E A;  4CX9 A;  2KW3 C;  4H4K C;  3SXZ A;  4DXW A;  3N0T A;  1RKE A;  4XPX A;  1I5N A;  3A9C A;  1EI7 A;  1YJG A;  4MQ9 F;  2OEV A;  4MVR A;  1B68 A;  1M2O A;  2QLA A;  3LJB A;  4MTG A;  1T5O A;  1OKK D;  2EPL X;  2J0X A;  1PV3 A;  4Z9I A;  2LK4 A;  1MNE A;  1H6G A;  2KJG A;  3AQB A;  3L34 A;  5A6A A;  5KYU A;  5T3W A;  2YZS A;  3DI5 A;  2WZG A;  1PCX A;  1ZZP A;  2VCA A;  3TJ5 A;  1BDJ B;  2JX0 A;  2QE9 A;  3ZQV A;  3BEH A;  2KSF A;  4E7Z A;  4PJJ A;  5L0D A;  4ULV A;  3EGX A;  3ZQY A;  1LE4 A;  3WOD F;  2D5R B;  2R02 A;  3ZTM A;  1M6T A;  4IRU A;  3H2V A;  2ZPA A;  3GWN A;  3J06 A;  2XL4 A;  1Y4C A;  2I8B A;  3O55 A;  2NG1 A;  4YJW A;  3W2W A;  4MVS A;  3GM2 A;  2H8A A;  1GM5 A;  2VB6 A;  1AUE A;  2V3C C;  3M79 A;  4L6R A;  5DQT A;  5JRA A;  1Z7Q c;  2BE5 F;  1Z3I X;  2W45 A;  4JC7 A;  1U89 A;  1A0B A;  2A0U A;  1HE9 A;  2KGO A;  2L7A A;  3PHF 2;  2Y69 C;  4PJM A;  1AVO B;  5COM A;  3VRC A;  5GPG B;  4O6M A;  5DS4 A;  3E70 C;  1SMY F;  1FNT c;  3HNK A;  2CYD A;  4MW3 A;  3K1I C;  5A6K A;  4OD5 A;  1OCR C;  1M2V B;  2VH3 A;  3EGX B;  1YYX A;  3S9O A;  1VTM P;  1C17 M;  2VAS A;  1O5H A;  2H7O A;  2W4B A;  3FXH A;  4J30 B;  4PFO A;  2NSG A;  1SR2 A;  2OU6 A;  1J8M F;  1JMW A;  2VCC A;  1ZVZ A;  2NUP A;  1JRA A;  1ZW3 A;  1AEP A;  2CNW A;  3K7D A;  4JCH A;  4RDA A;  1IZM A;  1N1C A;  4P9T A;  2OJQ A;  3W8I A;  3MLG A;  2DB4 A;  1BR4 A;  2AU5 A;  2HZ8 A;  1CPR A;  2J9B A;  3M4B A;  4WGZ A;  4ZLC A;  2M64 A;  3OEO A;  1VB5 A;  2C04 A;  4NTA A;  3LEO A;  2ZXR A;  3JTL O;  2AWY A;  1VYK A;  2J0W A;  1TKN A;  1T01 A;  1RMV A;  2A69 F;  2R7Q A;  5KYY A;  2WZL A;  1LS4 A;  2KNH A;  1Z23 A;  1A41 A;  4FX5 A;  4KC9 A;  2HSB A;  5T3T A;  4C3D A;  3U8P A;  4YT4 A;  5B3I A;  4KI2 A;  2L6F A;  4JRZ A;  2GAQ A;  4BEM J;  2Q4F A;  3LLK A;  2Q3T A;  3ABK C;  5DQZ A;  1ORY A;  2VCB A;  1RXQ A;  2PF4 E;  4HFF B;  3DJN B;  2D4U A;  4OIP F;  5TJ5 E;  4WAB A;  2Q9B A;  4U9E A;  2QUP A;  5BUO A;  1T9K A;  1E85 A;  2BL2 A;  2G3K A;  3S27 A;  4IB4 A;  1TWG A;  1HW2 A;  1FMW A;  1A7D A;  3S29 A;  4CS9 C;  2O9X A;  4PAC A;  1APC A;  4XEK A;  1CGO A;  1G4W R;  5E33 A;  3L1M A;  5L0J A;  3C18 A;  1D1B A;  1RJ9 A;  5A6B D;  1K04 A;  1VOM A;  4FWV A;  1YAU O;  4YT5 A;  3I5Q A;  5DLJ A;  1U6H A;  3B29 A;  3F47 A;  5D91 A;  4E18 A;  1OCZ C;  4EWC A;  3R2P A;  3HJC A;  4CS8 C;  4O7G A;  3QTH A;  4YT2 A;  2E87 A;  5F28 E;  2OKU A;  1D1C A;  2H7V C;  2AWC A;  4MVQ A;  2MHR A;  2IXO A;  4CJG A;  3DWW A;  4LER A;  4CS9 A;  3S84 A;  3EPV A;  4OIO F;  1CPQ A;  4CDA A;  5FZT A;  2LCH A;  2XSE A;  2IYL D;  4U5F E;  5COG A;  3U2L A;  4A2N B;  5EGY A;  1S7Z A;  3LS1 A;  4YN0 B;  3UMH A;  4NTF A;  4EKW A;  1ZHT A;  4CIP A;  4JTC B;  4C7O B;  2HMQ A;  2M4E A;  4G7Z F;  4R32 A;  1MMA A;  3VYW A;  3U9J A;  3UGO A;  2HFI A;  4DVZ A;  3SXY A;  1KU2 A;  4N06 A;  3O6X A;  3MFN A;  2P7V A;  3RH3 A;  1VMA A;  3FOO A;  2WZF A;  4XWJ A;  2PBE A;  3I4U A;  3C8G A;  2OCC C;  3KH2 A;  4OIN F;  4EBK A;  3LAY A;  3O39 A;  2LD6 A;  1JR8 A;  4PJL A;  4I3M A;  5KYW B;  3JRM O;  1TWC A;  3HNJ A;  1A7V A;  2VC9 A;  2XS8 A;  3RQF A;  5FCL A;  4BJ5 C;  4LAC B;  1R4T A;  1T6U A;  3OA1 A;  4JJF A;  4OIR F;  2W9Y A;  4N4W A;  2FGY A;  4E0I A;  1K40 A;  4AL1 A;  3FAP B;  2F22 A;  1DOV A;  1OXB A;  4B6I A;  1LKX A;  2L6H A;  1QSP A;  3W4Y A;  1NU9 C;  2NSF A;  4YL0 A;  4XTK A;  3X2Q C;  2HKV A;  3ATP A;  1G8X A;  1XWJ A;  2ICW G;  2LP4 A;  2CDQ A;  2XLW A;  3GEE A;  2WB7 A;  5DVW A;  5BQG A;  3ZG1 A;  4AE4 A;  5JT4 A;  2QNL A;  1JPJ A;  2UUH A;  3DE9 A;  2WVN A;  2YLG A;  5L0C A;  1QVX A;  2GA0 A;  1LPE A;  2ZXW C;  3RIP A;  4GQH A;  2Q9C A;  3JRT A;  1LS1 A;  2DYS C;  4O6Y A;  4D4X A;  2ZXP A;  4XEV A;  3RYL A;  3S28 A;  5BQI A;  2KK1 A;  4DJ9 A;  5KYX A;  4JEA A;  2YWA A;  1HW1 A;  3Q7L A;  3KPH A;  1E84 A;  4O79 A;  1NU7 D;  1FMV A;  4N6H A;  3K6B A;  3B0P A;  3JT1 A;  4K7B A;  5CIV A;  1LE2 A;  4K1O A;  4EBB A;  1HMD A;  5JS5 A;  4CSA A;  2IXM A;  2I15 A;  2GWW A;  2NPU A;  3RVZ A;  3U8V A;  2XXA A;  2Y3D A;  3ECS A;  4HEA J;  1D0X A;  1G4U S;  1Q0D A;  3CQZ A;  4DRJ B;  3EG9 B;  3QW1 A;  2P61 A;  4P6I C;  4W8K A;  4ER9 A;  3GM3 A;  3IEE A;  4JUR I;  2L6G A;  3RF3 A;  1LM3 B;  1OKK A;  4BJ6 A;  3NYJ A;  2R7V A;  3LS0 A;  2YL3 A;  1FFT C;  4QI0 A;  1K05 A;  3NDB B;  2KC3 A;  1NZE A;  1NFN A;  1SYQ A;  3DAG A;  4J32 B;  3U3B A;  2NUT A;  2XM0 A;  2XLH A;  3NYM A;  1OR2 A;  3ZC4 A;  3N24 A;  5AGF A;  4MVZ A;  3JSZ A;  4ZLD A;  3WHN A;  2XS1 A;  2XLM A;  1H9T A;  3V5Z A;  2DGJ A;  4GEH A;  5KYU B;  4D4N A;  1WGW A;  1ZHY A;  3EGD A;  1ZU4 A;  4DBR A;  3W2V A;  3PDM P;  2HV7 A;  2Y3G A;  4OIQ F;  2PX3 A;  5CI8 A;  3KYI A;  3AG3 C;  2A1D D;  4O6N A;  4LDK A;  5B1A C;  5AC4 A;  3G4X A;  3LUT B;  3SZR A;  1VK5 A;  3VAY A;  3QVY A;  4JTD B;  4N6C A;  1T6Q A;  2YHS A;  1EA8 A;  4IJJ A;  1RKC A;  2LIG A;  4LDQ A;  4U5G A;  3MYI A;  4Z9H A;  2A0B A;  3EHN A;  3VF0 A;  1O87 A;  1JOG A;  4YL1 A;  4E17 A;  2OOC A;  1TR2 A;  1V54 C;  2AVK A;  1C03 A;  1ZU5 A;  3MBG A;  2J7P D;  3GOD A;  3HNL A;  1WAS A;  1ZHX A;  4JJG A;  4JVS A;  2XM4 A;  1TFK B;  1ORS C;  1YYJ A;  3K33 A;  4NCQ A;  1FAP B;  2EIK C;  3I5P A;  3RFY A;  4BPM A;  3V7O A;  3H65 A;  4HFK B;  4JEB A;  3B71 A;  3X1O A;  1BR1 A;  4YL3 A;  3ZDL A;  4Q4Z F;  1LI5 A;  3DXJ F;  3B9Q A;  3R7C A;  1XZQ A;  2LSE A;  4EBJ A;  2XL8 A;  3HTK C;  3NMK A;  5JP7 A;  1VLS A;  3EFO A;  1Q0K A;  2P1A A;  1WTY A;  2J9W A;  3JYH A;  3UGP A;  4DBQ A;  3IHU A;  1O3U A;  3AOU A;  1QLE C;  4XQ1 A;  1G5Z A;  2NUP B;  4U5D E;  3L0I A;  3RQE A;  3DM5 A;  4JE9 A;  2A6H F;  5EHH A;  2EIJ C;  3EJN A;  1QPU A;  1YVI A;  1YDI A;  2X0C A;  3N2Z B;  1BBH A;  2BC5 A;  3AGT A;  3FHD A;  3LES A;  1QQ3 A;  3MYF A;  3NYL A;  4Z9J A;  4G7H F;  3LNM B;  3B0U X;  3SNH A;  5JLI A;  2PP4 A;  4G7O F;  3C7J A;  2JPU A;  3M1C B;  2DYR C;  4NTB A;  1LI7 A;  4CDV A;  2QY9 A;  2CCY A;  2YL7 A;  4M63 A;  5KYY B;  3SYN A;  2R05 A;  4JKV A;  4DOZ A;  4E0H A;  4WGY A;  3T4R A;  5AC5 A;  3C8G D;  3EZI A;  1DOW A;  3QMK A;  3OWT A;  2Q00 A;  1MMD A;  4PJN A;  4J7T A;  4XPW A;  1YA9 A;  2RD9 A;  1V4A A;  1R5I D;  1Z5Z A;  3M15 A;  4LLE A;  3SP1 A;  3U5S A;  2ZD9 A;  1BZ4 A;  2C03 A;  5D92 A;  4ANJ A;  5L0I A;  1H7I A;  3CZ6 A;  5COF A;  3SEO A;  2R7X A;  1Q0G A;  2YQY A;  3DAF A;  3K1I A;  3FAJ A;  1NLX A;  2QTV A;  4FES A;  5EK0 A;  4CBE A;  4Q7C A;  4YT8 A;  2EPN A;  2HMZ A;  2Q7R A;  5A6B A;  3SXK A;  2XLD A;  2Y39 A;  3RVY A;  1E83 A;  2J45 A;  1QZX A;  4XEF A;  4XPY A;  3US6 A;  3S90 A;  3B0V C;  4F4B A;  2IOQ A;  1NBB A;  3K66 A;  3EH1 A;  1PD0 A;  3ZTZ A;  3W8H A;  2KQ9 A;  2R9R B;  4ULW A;  3NMI A;  4CDY A;  3AG2 C;  4LDR A;  3MX3 A;  4BG0 A;  1RJ9 B;  2FFH A;  2R7R A;  2Z15 A;  1MND A;  3HNI A;  3IQ5 A;  3NMJ A;  3GAN A;  4I1O B;  4JZA A;  4G0H A;  1ST6 A;  1BR2 A;  4AX2 A;  2PX0 A;  2WL8 A;  1UG7 A;  3NG1 A;  2YKZ A;  3Q7G A;  4NC3 A;  3Q6N A;  4RD9 A;  1PD1 A;  3LNR A;  2EPM X;  5E2Q A;  1MMG A;  4JW1 A;  1EKY A;  1NSG B;  1CGM E;  2J9V A;  4IWB A;  1OW7 A;  3EG9 A;  3DJU B;  3H2U A;  3AG1 C;  1ZYR F;  1GGQ A;  2J9U A;  3JSE O;  2PFD A;  3M4C A;  3SXM A;  3TJ6 A;  1TWH A;  2P6V A;  1KNY A;  2CW0 F;  3L8I A;  1ORJ A;  3JZ0 A;  3FVY A;  4X0R A;  3KYJ A;  4DVY P;  3E9V A;  1M2V A;  4MW8 A; 
#chains in the Genus database with same CATH homology
 5CIV A;  3CEX A;  3GOR A;  5COG A;  2F22 A;  3DKA A;  2NSF A;  2OQM A;  5COM A;  2HKV A;  3DI5 A;  2RD9 A;  2P1A A;  2QE9 A;  2QNL A;  5COF A;  4N6C A;  2YQY A;  3QTH A;  2NSG A;  2OU6 A;  1RXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...