2QE9A

Crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
171
structure length
165
Chain Sequence
HHHHHENLYFQGMMKFFEYNWQVRDQWFTWCHQLTTEELLKNRLGGVENILYTLFHIIDVEYSWIRAIQGKEDIAVQFADYQTLNKVKSLSNTFRTEIIDVLQTHELVSVPWETGVLYTRDEILHHIIAHEIHHIGQLSVWARELKLSPVSASFIGRTLKPIHSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein BSU10800 (YP_054576.1) from Bacillus subtilis at 1.90 A resolution
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Uncharacterized protein yizA
total genus 53
structure length 165
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05163 DinB DinB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2qe9A01
2YQYA 2OQMA 5CIVA 2RD9A 3DI5A 2NSGA 2QE9A 2F22A 2QNLA 2P1AA 2HKVA 2OU6A 5COFA 3GORA 5COMA 3QTHA 4N6CA 2NSFA 3CEXA 3DKAA 1RXQA 5COGA
chains in the Genus database with same CATH superfamily
5DQTA 3CQZA 4AL0A 3M4BA 3DM9B 4MTOA 5A6BD 4PJJA 4IJJA 1E85A 2BC5A 5KYUA 3RKOF 2R7QA 1O5HA 4NTFA 2LIGA 2PX0A 4XQ1A 1YVIA 5DQZA 4MS2A 1L7CA 5L0DA 1S7ZA 4HFKB 4ULWA 2OCCC 3ASOC 4LLEA 4I1MA 2DYRC 3WG7C 1LS4A 1ZYRF 1OW8A 3M1CB 1SR2A 1HE9A 1GM5A 2YKZA 1CGNA 2CNWA 1VYIA 4FAPB 3VAYA 3K1IA 4K0DA 4Z9JA 4O6YA 5KYWB 3S9OA 4XPXA 2YLIA 4K7BA 4D4NA 3JT1A 1BBHA 3L8IA 1WASA 4U5EE 4WGYA 5D91A 5CIVA 2LP4A 1PV3A 4JJGA 5B1AC 4O7GA 5A6AA 3TD7A 3LEOA 3AG3C 1OW6A 5DS6A 3LNRA 2HZ8A 2KW3C 1DOVA 2XSEA 2YRFA 4LDQA 4YT8A 1D1CA 1Y4CA 3EHMA 3EFOB 5BQGA 3POVA 1C03A 1NSGB 2R03A 4J30B 3RF3A 2KNHA 2Q9CA 1VLTA 2IXOA 3W2VA 1ZHWA 2JX0A 2EPNA 1D1BA 2GA0A 1NZEA 2IBFA 2WZFA 4H4KC 1E84A 2NSFA 3RQGA 2R7VA 3NKEA 3NYMA 5A6JA 1OXBA 3EGDB 3EFOA 3U8VA 2J45A 2OOCA 1BR2A 2ZXOA 1PCXA 2PNOA 2X51A 1G4WR 2J8WA 4MQ9F 3ZTZA 2XL4A 4G78A 4BEJA 1M2VA 1ZW2A 5L0IA 1NBBA 3GODA 4C7OB 3CZ6A 1JR8A 2H7OA 3CSKA 3B0VC 2HSQA 1M2VB 3QZCA 1YYJA 1ZU4A 2NUPA 2GDCA 2W4MA 2GWWA 3FAJA 1VOMA 3E9VA 3C62A 2HFIA 3US6A 2HKVA 3ZSUA 5DS4A 4GYTA 1LI7A 2A1DD 3V5ZA 4MVUA 2VASA 1JRAA 4MVQA 2WVQA 3SZRA 3T6BA 1PD1A 2NG1A 4NY3A 4BEMJ 2HJMA 4C7OA 1VTMP 4IRUA 3EG9B 3NRHA 3IQ6A 1LIHA 1Z23A 2TMVP 2Q9BA 3GANA 3Q7LA 1HMDA 3JTLO 3L34A 2EIJC 3I4UA 3HNKA 5A69A 3TOLA 4PJNA 2V26A 1FAPB 1U0BB 1ST6A 4N6HA 1RKEB 1GQAA 4QI2A 2WVOA 5T1DB 3OEOA 256BA 2OQMA 1MNDA 3ZWIA 1Z3IX 2Y3BA 1M57C 1OCCC 1T6UA 2WVNA 3KYIA 4DRIB 2AU5A 3C8GD 5L0FA 2DB4A 2P1AA 4JURI 2YL1A 3I5PA 1UFBA 5B3SC 3T4RA 2B0HA 1HY5A 3NG1A 4JKVA 2LSEA 2P6VA 1LM3B 1F1MA 3HTKC 4OD5A 2DI3A 1WN0A 3JZ0A 2LK4A 4E17A 2GFHA 1V4AA 1W2WA 1FFHA 4N06A 4O79A 3B0PA 2PP4A 4ULVA 4XPWA 2NUTA 2Y69C 4CS8C 3SYNA 5B3IA 2EILC 4A2NB 5JLIA 1C17M 4J7YA 3NKDA 3RH3A 4NQFA 1RXQA 1YJGA 1Q0MA 1WOLA 2ZXPA 4YWQA 3HJCA 3IQ5A 2YVKA 1BDJB 2RSEB 3CAXA 3QVZA 2ZXRA 4JEBA 4LLCA 1FMWA 4DXWA 3DZAA 4IAQA 3UGPA 3GEEA 2R7OA 2QTVA 4AE4A 2XL8A 4LDKA 3OWTA 4W8PA 2QE9A 2NSGA 2XM4A 1GS9A 3AOUA 3K6BA 4EHPA 3DJNB 1A7EA 3JCUQ 4AE4B 4MTGA 4WABA 2J9BA 2H7BA 4LERA 4ONSA 4BJTA 5EGYA 1R5ID 3DAFA 4L6RA 2XLWA 1H6GA 2AWYA 2PF4E 3K1HA 4N6CA 4DBRA 5F5FA 1PD0A 3GM2A 2Q9AA 3V5YA 1XZPA 3WAQA 3I5QA 3L1MA 4CIHA 5D92A 4EIYA 3UNGC 4OIPF 2R7UA 1WATA 1U89A 1TWCA 3DKAA 1K05A 3LS1A 2XS8A 2PBEA 4Z9IA 3M79A 3T9OA 3H2VA 5F5HA 3JYHA 4EUKB 4E18A 1H9GA 4C3BA 1OR3A 2FFHA 1A41A 4Q5SF 1SYQA 4PJLA 1NU7D 3PMRA 1OKKD 1WGWA 2KGOA 1TWGA 4JTCB 1WTYA 3QW0A 2QNLA 4AL1A 4U5GA 2M64A 1YDIA 3Q7GA 4XLNF 3W8HA 5KYXB 2Z15A 1RJ9B 1YZAA 2EPKX 2XL6A 3MFNA 3O39A 4U5CE 5E2QA 4PACA 2CNWD 2NUPB 3AGUA 4G7ZF 2OJQA 1R4TA 4CS9C 1MMAA 1NU9C 4FWVA 1OQCA 3N0TA 1TQGA 1E2XA 2BL2A 3DMDA 1FR0A 1Z5ZA 1EI7A 2L6FA 2OEVA 2QY9A 4E0IA 2I15A 2QUPA 1B68A 4KNWA 1Y6DA 2Y3GA 4G7OF 1QQ3A 2MYSA 1MNEA 3MYFA 2EIKC 3DD7A 4PFOA 3VF0A 1MQVA 1N1CA 5KYXA 2DYSC 3ZIBA 4YL0A 2P7VA 2D5RB 3ABKC 4JZAA 3UR3C 3ZDLA 3EZIA 2XLOA 3LEVA 1H9TA 5DS5A 4MVZA 5L3VA 3DXJF 2OKUA 5JUAA 5HSWA 3ZQVA 2P0NA 4P9TA 1AUEA 4HEAJ 5BUOA 1H7IA 2ZPAA 2YLGA 3QTHA 3IHUA 4ZLDA 3JRMO 3ABLC 2P61A 3R7CA 2NPUA 2R7XA 4YT5A 4MVSA 4AK9A 1IW7F 1SMYF 4I1OB 4FX5A 2UUIA 2XLEA 3MLGA 1GGQA 1OCOC 3DE8A 2OEXA 4MW3A 4W8KA 2YL7A 5DVWA 5L3QA 1SF8A 3KH2A 1V54C 2CW0F 4YK5A 5L0GA 1TKNA 1V74B 1LS1A 2R7TA 3F46A 1OR2A 2EIMC 2HJ3A 4DVZA 3VRCA 1FFTC 4IAOA 5IY5C 5GPGB 2IXPA 4Q7CA 1YYXA 2KQ9A 2X0CA 2C04A 3AJMA 1D0XA 3C63A 5CI8A 5KYNA 2Q4FA 3AQCA 5E3CA 4BPMA 5JVEA 3SP1A 4CJOA 4E7ZA 3FOOA 4CS7A 3V5XA 3DAGA 3TQOA 2R7RA 2A68F 3EGXB 3LS0A 3U3FA 1CGME 3C8ZA 4KC9A 2L81A 3ZG1A 5JRAA 1T6QA 3MX3A 4OIQF 2H7VC 1OXKA 2XLMA 3C8GA 4G0HA 3W8IA 4WGZA 4U5DE 2IOQA 1A7DA 3N24A 4Z9HA 3ZTMA 2CCYA 2OG2A 3V7OA 3S90A 4LACB 4UDVA 3B9QA 2VCCA 3K66A 5A6KA 2WZGA 3DI5A 4U5FE 1O3UA 2KK1A 2KYHA 1MMNA 4WJ0A 2HS5A 4CBEA 3B0UX 3RVYA 1VYKA 2YLDA 1LE4A 3MYIA 4JCZA 3U8PA 2J46A 1JOGA 4U5BE 3F47A 2EPLX 2H8AA 2Q00A 5T3WA 3T6GB 5KYYB 2W9YA 4M63A 2ZD9A 2R9RB 3U0CA 2J0XA 4MVOA 4E0HA 3JSZA 2HV6A 1YAUO 2R05A 4BJ1A 4CSAC 5KYYA 1TWAA 1BR4A 3R2PA 3RFYA 1KNYA 3RIPA 3SEOA 1LKXA 1QSPA 2WZLA 3X2QC 1MMDA 1OCZC 5FZTA 4NTAA 1RJ9A 3H2UA 4U9EA 1XZQA 2E87A 4YJWA 1O87A 3EGDA 4KBLA 4U9DA 1YARO 4C3DA 1VK5A 2J9UA 5AC4A 3EZHA 3NMIA 5AGFA 1HE1A 4P6IC 1Z7Qc 1ZHTA 2Y3DA 4E7SA 3EH2A 4HFFB 3OA1A 1T9KA 3PHF2 2G3KA 3IQCA 4CSAA 2A0UA 4BJ5A 3AGTA 3ATPA 4XPYA 3ABMC 3SXKA 3SNHA 4JJFA 2JPUA 2VH3A 4U5HA 5B1BC 3EQLF 3X1OA 5TJ5E 3M15A 3FXHA 3C18A 1AEPA 4IB4A 4JTDB 3HKKA 3IEEA 4K1OA 3U2MA 3VYWA 3GM3A 3EHNA 4JC7A 2R02A 4P9FA 3VM6A 3K1IC 3SXYA 4DVYP 3WHNA 1Z63A 1D0ZA 1J8YF 2Y3HA 3K7DA 1FMVA 1D1AA 3EJNA 1MMGA 2YQYA 3EH1A 4OIOF 4QDLA 3FDQA 5A6BA 3W4YA 3AG2C 2ICWG 4GQHA 4KNVA 3UMKA 3ZC4A 2LCHA 2PX3A 1AVOB 2W4BA 3E70C 3GEIA 2MHRA 3S28A 1E83A 3NMJA 4OIRF 2F22A 2V3CC 3NYLA 1T01A 3IPMO 4LDRA 3S27A 3U3BA 1ZHXA 3DM5A 2ETSA 1RKCA 3LNMB 4RDAA 5COMA 1M6TA 4R32A 2XLVA 1CPRA 3HNIA 3BEHA 2Q3TA 3DJUB 2XS1A 2QLAA 1V55C 3SXZA 4JTAB 2HMQA 1QZXA 3U5SA 2Y39A 3L8JA 1UG7A 3IQTA 4DRHB 4EWCA 1DOWA 1ZHZA 2XRHA 4MNDA 1YA9A 1NG1A 3TJ5A 2KJGA 4DJ9A 2YZSA 3KL4A 5K0IA 3TULA 1ZHYA 4IARA 1LPEA 1YZCA 3B71A 3LJBA 5E3AA 4KI2A 4NTBA 1IZMA 1LVKA 2YHSA 2YL3A 4Q4ZF 1APCA 2XXAB 2A6EF 4PK4A 3S29A 2W45A 3O10A 4YT4A 3J06A 2KSFA 2G62A 3U9MA 3FVYA 2FAPB 2YWAA 2M4EA 3GEHA 3O55A 4XEFA 3L0IA 5JSLA 4MVRA 1S05A 1VLSA 5BQIA 3U2LA 1I4YA 3RQEA 3C7JA 3B29A 4I3MA 3FMSA 4JEAA 1FNTc 3RVZA 1RCPA 3A11A 1ZZPA 3KPHA 3NYJA 5DLJA 4CDYA 2HUJA 2IM8A 3TOMA 1RMVA 1EA8A 2G3VA 2PFDA 3DWWA 1JMWA 4XTKA 5EK0A 1LE2A 3AQBA 3MBGA 2YL0A 1A7VA 2WL8A 3ZVRA 4EBBA 1HMOA 2L7AA 3BRJA 3FOPA 1QLEC 1TFKB 2UUHA 4AX2A 1J8MF 4JCHA 2J9WA 4N4WA 3GM1A 3H65A 1SZIA 1CGOA 5KYUB 3S84A 1Q0DA 4I44A 4B6IA 2J7PA 3JRTA 3Q6NA 5E33A 4CX9A 3T6JA 5HV9A 2EINC 4HE8D 3UMIA 2YEVA 1QKRA 4CS9A 3KYJA 5COFA 4XEKA 4O6MA 3JYYA 2OJED 4ZLCA 4YT2A 2WB7A 1T6IA 2JD3A 1OW7A 2DGJA 4NCQA 5AC5A 1VMAA 2A0BA 5CI9A 2HSBA 4CDVA 4YL1A 2A6HF 5JP7A 2L6HA 5FCLA 3LAYA 3HNJA 4A4AA 1G5ZA 2VCBA 2R25A 3M4CA 4QI0A 4YL3A 2A69F 3GWNA 1WWPA 2L6GA 4CS8A 3ASNC 2CGEA 1OCRC 3PCVA 4C3EA 1Q0GA 3EG9A 2VC9A 3SXMA 5L0JA 3UMHA 3PDMP 1JPNA 2O9XA 2RD9A 3RYLA 2IXNA 4MW8A 4YN0B 2NUTB 5BQHA 2LFFA 3WODF 1BR1A 2OU6A 1M2OA 3JSEO 4EBJA 2Q7RA 3NMKA 1ORYA 1ZU5A 2XLDA 4IGGA 4CJGA 1EQ1A 1FTSA 1LI5A 2XLHA 2LD6A 3ITFA 1D0YA 4H54A 4OINF 2ZXWC 3RQFA 4JVSA 3ZQYA 2ASRA 1L3PA 4JE9A 2XXAA 4F4BA 2AP3A 4O6NA 1HW1A 3FHDA 1NFNA 1T5OA 3AG1C 4G7HF 5F28E 5COGA 3EGXA 4BG0A 2HV7A 2J7PD 1JAFA 4BJ6C 1XWJA 4IWBA 1KU2A 1TFOB 4J7TA 4PJMA 1HW2A 3FAPB 4NC3A 4RD9A 1I5NA 3LUTB 5T3TA 4EKWA 4DOZA 1QVXA 2AVKA 3GWLA 2I8BA 2GAQA 4RBNA 3LLIA 1Q0FA 1TR2A 4XWJA 2R7WA 3G50A 1KTMA 3QMKA 1QPUA 4EBKA 3GORA 4JRZA 4D4XA 1E86A 4CIPA 4OD4A 1JPJA 4MVMA 3C8GB 4BJ5C 2CDQA 2EPOA 2BE5F 4J32B 4ANJA 5JS5A 3HLZA 1G8XA 1NLXA 3TJ6A 2EPMX 3LESA 3U9JA 1YA7O 1I4ZA 3UGOA 1YLMA 5L0CA 1K40A 2CYDA 3RW0A 1CPQA 3KKBA 1NFOA 3DE9A 4MTFA 1OKKA 1TWHA 2LFDA 4PR9A 4PFPA 5KYWA 4XEVA 1BZ4A 2J9VA 1Z6AA 2L9JA 3K33A 2VCAA 1K04A 2IYLD 4GEHA 2VB6A 2KC3A 5EHHA 3O6XA 3G4XA 4JW1A 4JIOA 3G4ZA 3AG4C 3TK0A 2IXMA 2AWCA 3QW1A 1VB5A 1ORJA 3QVYA 3A9CA 2XM0A 1G4US 3HNLA 4X0RA 1EKYA 1Q0KA 1ZW3A 3N2ZB 3W2WA 1C02A 4DBQA 1RKEA 4FESA 3NDBB 4BJ6A 2HMZA 4ER9A 3ECSA 2B0JA 5JT4A 3KMIA 1A0BA 3LLKA 2R7SA 1M56C 5L0HA 4XLPF 4CDAA 3CEXA 2J0WA 2MWQA 2FGYA 1U6HA 2D4UA 2C03A 4DRJB 3S0XA 2LQGA 1ORSC 3EPVA 3Q6MA 1ZVZA
chains in the Genus database with same CATH topology
2YQYA 2OQMA 5CIVA 2RD9A 3DI5A 2NSGA 2QE9A 2F22A 2QNLA 2P1AA 2HKVA 2OU6A 5COFA 3GORA 5COMA 3QTHA 4N6CA 2NSFA 3CEXA 3DKAA 1RXQA 5COGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQY A;  2OQM A;  5CIV A;  2RD9 A;  3DI5 A;  2NSG A;  2QE9 A;  2F22 A;  2QNL A;  2P1A A;  2HKV A;  2OU6 A;  5COF A;  3GOR A;  5COM A;  3QTH A;  4N6C A;  2NSF A;  3CEX A;  3DKA A;  1RXQ A;  5COG A; 
#chains in the Genus database with same CATH topology
 5DQT A;  3CQZ A;  4AL0 A;  3M4B A;  3DM9 B;  4MTO A;  5A6B D;  4PJJ A;  4IJJ A;  1E85 A;  2BC5 A;  5KYU A;  3RKO F;  2R7Q A;  1O5H A;  4NTF A;  2LIG A;  2PX0 A;  4XQ1 A;  1YVI A;  5DQZ A;  4MS2 A;  1L7C A;  5L0D A;  1S7Z A;  4HFK B;  4ULW A;  2OCC C;  3ASO C;  4LLE A;  4I1M A;  2DYR C;  3WG7 C;  1LS4 A;  1ZYR F;  1OW8 A;  3M1C B;  1SR2 A;  1HE9 A;  1GM5 A;  2YKZ A;  1CGN A;  2CNW A;  1VYI A;  4FAP B;  3VAY A;  3K1I A;  4K0D A;  4Z9J A;  4O6Y A;  5KYW B;  3S9O A;  4XPX A;  2YLI A;  4K7B A;  4D4N A;  3JT1 A;  1BBH A;  3L8I A;  1WAS A;  4U5E E;  4WGY A;  5D91 A;  5CIV A;  2LP4 A;  1PV3 A;  4JJG A;  5B1A C;  4O7G A;  5A6A A;  3TD7 A;  3LEO A;  3AG3 C;  1OW6 A;  5DS6 A;  3LNR A;  2HZ8 A;  2KW3 C;  1DOV A;  2XSE A;  2YRF A;  4LDQ A;  4YT8 A;  1D1C A;  1Y4C A;  3EHM A;  3EFO B;  5BQG A;  3POV A;  1C03 A;  1NSG B;  2R03 A;  4J30 B;  3RF3 A;  2KNH A;  2Q9C A;  1VLT A;  2IXO A;  3W2V A;  1ZHW A;  2JX0 A;  2EPN A;  1D1B A;  2GA0 A;  1NZE A;  2IBF A;  2WZF A;  4H4K C;  1E84 A;  2NSF A;  3RQG A;  2R7V A;  3NKE A;  3NYM A;  5A6J A;  1OXB A;  3EGD B;  3EFO A;  3U8V A;  2J45 A;  2OOC A;  1BR2 A;  2ZXO A;  1PCX A;  2PNO A;  2X51 A;  1G4W R;  2J8W A;  4MQ9 F;  3ZTZ A;  2XL4 A;  4G78 A;  4BEJ A;  1M2V A;  1ZW2 A;  5L0I A;  1NBB A;  3GOD A;  4C7O B;  3CZ6 A;  1JR8 A;  2H7O A;  3CSK A;  3B0V C;  2HSQ A;  1M2V B;  3QZC A;  1YYJ A;  1ZU4 A;  2NUP A;  2GDC A;  2W4M A;  2GWW A;  3FAJ A;  1VOM A;  3E9V A;  3C62 A;  2HFI A;  3US6 A;  2HKV A;  3ZSU A;  5DS4 A;  4GYT A;  1LI7 A;  2A1D D;  3V5Z A;  4MVU A;  2VAS A;  1JRA A;  4MVQ A;  2WVQ A;  3SZR A;  3T6B A;  1PD1 A;  2NG1 A;  4NY3 A;  4BEM J;  2HJM A;  4C7O A;  1VTM P;  4IRU A;  3EG9 B;  3NRH A;  3IQ6 A;  1LIH A;  1Z23 A;  2TMV P;  2Q9B A;  3GAN A;  3Q7L A;  1HMD A;  3JTL O;  3L34 A;  2EIJ C;  3I4U A;  3HNK A;  5A69 A;  3TOL A;  4PJN A;  2V26 A;  1FAP B;  1U0B B;  1ST6 A;  4N6H A;  1RKE B;  1GQA A;  4QI2 A;  2WVO A;  5T1D B;  3OEO A;  256B A;  2OQM A;  1MND A;  3ZWI A;  1Z3I X;  2Y3B A;  1M57 C;  1OCC C;  1T6U A;  2WVN A;  3KYI A;  4DRI B;  2AU5 A;  3C8G D;  5L0F A;  2DB4 A;  2P1A A;  4JUR I;  2YL1 A;  3I5P A;  1UFB A;  5B3S C;  3T4R A;  2B0H A;  1HY5 A;  3NG1 A;  4JKV A;  2LSE A;  2P6V A;  1LM3 B;  1F1M A;  3HTK C;  4OD5 A;  2DI3 A;  1WN0 A;  3JZ0 A;  2LK4 A;  4E17 A;  2GFH A;  1V4A A;  1W2W A;  1FFH A;  4N06 A;  4O79 A;  3B0P A;  2PP4 A;  4ULV A;  4XPW A;  2NUT A;  2Y69 C;  4CS8 C;  3SYN A;  5B3I A;  2EIL C;  4A2N B;  5JLI A;  1C17 M;  4J7Y A;  3NKD A;  3RH3 A;  4NQF A;  1RXQ A;  1YJG A;  1Q0M A;  1WOL A;  2ZXP A;  4YWQ A;  3HJC A;  3IQ5 A;  2YVK A;  1BDJ B;  2RSE B;  3CAX A;  3QVZ A;  2ZXR A;  4JEB A;  4LLC A;  1FMW A;  4DXW A;  3DZA A;  4IAQ A;  3UGP A;  3GEE A;  2R7O A;  2QTV A;  4AE4 A;  2XL8 A;  4LDK A;  3OWT A;  4W8P A;  2QE9 A;  2NSG A;  2XM4 A;  1GS9 A;  3AOU A;  3K6B A;  4EHP A;  3DJN B;  1A7E A;  3JCU Q;  4AE4 B;  4MTG A;  4WAB A;  2J9B A;  2H7B A;  4LER A;  4ONS A;  4BJT A;  5EGY A;  1R5I D;  3DAF A;  4L6R A;  2XLW A;  1H6G A;  2AWY A;  2PF4 E;  3K1H A;  4N6C A;  4DBR A;  5F5F A;  1PD0 A;  3GM2 A;  2Q9A A;  3V5Y A;  1XZP A;  3WAQ A;  3I5Q A;  3L1M A;  4CIH A;  5D92 A;  4EIY A;  3UNG C;  4OIP F;  2R7U A;  1WAT A;  1U89 A;  1TWC A;  3DKA A;  1K05 A;  3LS1 A;  2XS8 A;  2PBE A;  4Z9I A;  3M79 A;  3T9O A;  3H2V A;  5F5H A;  3JYH A;  4EUK B;  4E18 A;  1H9G A;  4C3B A;  1OR3 A;  2FFH A;  1A41 A;  4Q5S F;  1SYQ A;  4PJL A;  1NU7 D;  3PMR A;  1OKK D;  1WGW A;  2KGO A;  1TWG A;  4JTC B;  1WTY A;  3QW0 A;  2QNL A;  4AL1 A;  4U5G A;  2M64 A;  1YDI A;  3Q7G A;  4XLN F;  3W8H A;  5KYX B;  2Z15 A;  1RJ9 B;  1YZA A;  2EPK X;  2XL6 A;  3MFN A;  3O39 A;  4U5C E;  5E2Q A;  4PAC A;  2CNW D;  2NUP B;  3AGU A;  4G7Z F;  2OJQ A;  1R4T A;  4CS9 C;  1MMA A;  1NU9 C;  4FWV A;  1OQC A;  3N0T A;  1TQG A;  1E2X A;  2BL2 A;  3DMD A;  1FR0 A;  1Z5Z A;  1EI7 A;  2L6F A;  2OEV A;  2QY9 A;  4E0I A;  2I15 A;  2QUP A;  1B68 A;  4KNW A;  1Y6D A;  2Y3G A;  4G7O F;  1QQ3 A;  2MYS A;  1MNE A;  3MYF A;  2EIK C;  3DD7 A;  4PFO A;  3VF0 A;  1MQV A;  1N1C A;  5KYX A;  2DYS C;  3ZIB A;  4YL0 A;  2P7V A;  2D5R B;  3ABK C;  4JZA A;  3UR3 C;  3ZDL A;  3EZI A;  2XLO A;  3LEV A;  1H9T A;  5DS5 A;  4MVZ A;  5L3V A;  3DXJ F;  2OKU A;  5JUA A;  5HSW A;  3ZQV A;  2P0N A;  4P9T A;  1AUE A;  4HEA J;  5BUO A;  1H7I A;  2ZPA A;  2YLG A;  3QTH A;  3IHU A;  4ZLD A;  3JRM O;  3ABL C;  2P61 A;  3R7C A;  2NPU A;  2R7X A;  4YT5 A;  4MVS A;  4AK9 A;  1IW7 F;  1SMY F;  4I1O B;  4FX5 A;  2UUI A;  2XLE A;  3MLG A;  1GGQ A;  1OCO C;  3DE8 A;  2OEX A;  4MW3 A;  4W8K A;  2YL7 A;  5DVW A;  5L3Q A;  1SF8 A;  3KH2 A;  1V54 C;  2CW0 F;  4YK5 A;  5L0G A;  1TKN A;  1V74 B;  1LS1 A;  2R7T A;  3F46 A;  1OR2 A;  2EIM C;  2HJ3 A;  4DVZ A;  3VRC A;  1FFT C;  4IAO A;  5IY5 C;  5GPG B;  2IXP A;  4Q7C A;  1YYX A;  2KQ9 A;  2X0C A;  2C04 A;  3AJM A;  1D0X A;  3C63 A;  5CI8 A;  5KYN A;  2Q4F A;  3AQC A;  5E3C A;  4BPM A;  5JVE A;  3SP1 A;  4CJO A;  4E7Z A;  3FOO A;  4CS7 A;  3V5X A;  3DAG A;  3TQO A;  2R7R A;  2A68 F;  3EGX B;  3LS0 A;  3U3F A;  1CGM E;  3C8Z A;  4KC9 A;  2L81 A;  3ZG1 A;  5JRA A;  1T6Q A;  3MX3 A;  4OIQ F;  2H7V C;  1OXK A;  2XLM A;  3C8G A;  4G0H A;  3W8I A;  4WGZ A;  4U5D E;  2IOQ A;  1A7D A;  3N24 A;  4Z9H A;  3ZTM A;  2CCY A;  2OG2 A;  3V7O A;  3S90 A;  4LAC B;  4UDV A;  3B9Q A;  2VCC A;  3K66 A;  5A6K A;  2WZG A;  3DI5 A;  4U5F E;  1O3U A;  2KK1 A;  2KYH A;  1MMN A;  4WJ0 A;  2HS5 A;  4CBE A;  3B0U X;  3RVY A;  1VYK A;  2YLD A;  1LE4 A;  3MYI A;  4JCZ A;  3U8P A;  2J46 A;  1JOG A;  4U5B E;  3F47 A;  2EPL X;  2H8A A;  2Q00 A;  5T3W A;  3T6G B;  5KYY B;  2W9Y A;  4M63 A;  2ZD9 A;  2R9R B;  3U0C A;  2J0X A;  4MVO A;  4E0H A;  3JSZ A;  2HV6 A;  1YAU O;  2R05 A;  4BJ1 A;  4CSA C;  5KYY A;  1TWA A;  1BR4 A;  3R2P A;  3RFY A;  1KNY A;  3RIP A;  3SEO A;  1LKX A;  1QSP A;  2WZL A;  3X2Q C;  1MMD A;  1OCZ C;  5FZT A;  4NTA A;  1RJ9 A;  3H2U A;  4U9E A;  1XZQ A;  2E87 A;  4YJW A;  1O87 A;  3EGD A;  4KBL A;  4U9D A;  1YAR O;  4C3D A;  1VK5 A;  2J9U A;  5AC4 A;  3EZH A;  3NMI A;  5AGF A;  1HE1 A;  4P6I C;  1Z7Q c;  1ZHT A;  2Y3D A;  4E7S A;  3EH2 A;  4HFF B;  3OA1 A;  1T9K A;  3PHF 2;  2G3K A;  3IQC A;  4CSA A;  2A0U A;  4BJ5 A;  3AGT A;  3ATP A;  4XPY A;  3ABM C;  3SXK A;  3SNH A;  4JJF A;  2JPU A;  2VH3 A;  4U5H A;  5B1B C;  3EQL F;  3X1O A;  5TJ5 E;  3M15 A;  3FXH A;  3C18 A;  1AEP A;  4IB4 A;  4JTD B;  3HKK A;  3IEE A;  4K1O A;  3U2M A;  3VYW A;  3GM3 A;  3EHN A;  4JC7 A;  2R02 A;  4P9F A;  3VM6 A;  3K1I C;  3SXY A;  4DVY P;  3WHN A;  1Z63 A;  1D0Z A;  1J8Y F;  2Y3H A;  3K7D A;  1FMV A;  1D1A A;  3EJN A;  1MMG A;  2YQY A;  3EH1 A;  4OIO F;  4QDL A;  3FDQ A;  5A6B A;  3W4Y A;  3AG2 C;  2ICW G;  4GQH A;  4KNV A;  3UMK A;  3ZC4 A;  2LCH A;  2PX3 A;  1AVO B;  2W4B A;  3E70 C;  3GEI A;  2MHR A;  3S28 A;  1E83 A;  3NMJ A;  4OIR F;  2F22 A;  2V3C C;  3NYL A;  1T01 A;  3IPM O;  4LDR A;  3S27 A;  3U3B A;  1ZHX A;  3DM5 A;  2ETS A;  1RKC A;  3LNM B;  4RDA A;  5COM A;  1M6T A;  4R32 A;  2XLV A;  1CPR A;  3HNI A;  3BEH A;  2Q3T A;  3DJU B;  2XS1 A;  2QLA A;  1V55 C;  3SXZ A;  4JTA B;  2HMQ A;  1QZX A;  3U5S A;  2Y39 A;  3L8J A;  1UG7 A;  3IQT A;  4DRH B;  4EWC A;  1DOW A;  1ZHZ A;  2XRH A;  4MND A;  1YA9 A;  1NG1 A;  3TJ5 A;  2KJG A;  4DJ9 A;  2YZS A;  3KL4 A;  5K0I A;  3TUL A;  1ZHY A;  4IAR A;  1LPE A;  1YZC A;  3B71 A;  3LJB A;  5E3A A;  4KI2 A;  4NTB A;  1IZM A;  1LVK A;  2YHS A;  2YL3 A;  4Q4Z F;  1APC A;  2XXA B;  2A6E F;  4PK4 A;  3S29 A;  2W45 A;  3O10 A;  4YT4 A;  3J06 A;  2KSF A;  2G62 A;  3U9M A;  3FVY A;  2FAP B;  2YWA A;  2M4E A;  3GEH A;  3O55 A;  4XEF A;  3L0I A;  5JSL A;  4MVR A;  1S05 A;  1VLS A;  5BQI A;  3U2L A;  1I4Y A;  3RQE A;  3C7J A;  3B29 A;  4I3M A;  3FMS A;  4JEA A;  1FNT c;  3RVZ A;  1RCP A;  3A11 A;  1ZZP A;  3KPH A;  3NYJ A;  5DLJ A;  4CDY A;  2HUJ A;  2IM8 A;  3TOM A;  1RMV A;  1EA8 A;  2G3V A;  2PFD A;  3DWW A;  1JMW A;  4XTK A;  5EK0 A;  1LE2 A;  3AQB A;  3MBG A;  2YL0 A;  1A7V A;  2WL8 A;  3ZVR A;  4EBB A;  1HMO A;  2L7A A;  3BRJ A;  3FOP A;  1QLE C;  1TFK B;  2UUH A;  4AX2 A;  1J8M F;  4JCH A;  2J9W A;  4N4W A;  3GM1 A;  3H65 A;  1SZI A;  1CGO A;  5KYU B;  3S84 A;  1Q0D A;  4I44 A;  4B6I A;  2J7P A;  3JRT A;  3Q6N A;  5E33 A;  4CX9 A;  3T6J A;  5HV9 A;  2EIN C;  4HE8 D;  3UMI A;  2YEV A;  1QKR A;  4CS9 A;  3KYJ A;  5COF A;  4XEK A;  4O6M A;  3JYY A;  2OJE D;  4ZLC A;  4YT2 A;  2WB7 A;  1T6I A;  2JD3 A;  1OW7 A;  2DGJ A;  4NCQ A;  5AC5 A;  1VMA A;  2A0B A;  5CI9 A;  2HSB A;  4CDV A;  4YL1 A;  2A6H F;  5JP7 A;  2L6H A;  5FCL A;  3LAY A;  3HNJ A;  4A4A A;  1G5Z A;  2VCB A;  2R25 A;  3M4C A;  4QI0 A;  4YL3 A;  2A69 F;  3GWN A;  1WWP A;  2L6G A;  4CS8 A;  3ASN C;  2CGE A;  1OCR C;  3PCV A;  4C3E A;  1Q0G A;  3EG9 A;  2VC9 A;  3SXM A;  5L0J A;  3UMH A;  3PDM P;  1JPN A;  2O9X A;  2RD9 A;  3RYL A;  2IXN A;  4MW8 A;  4YN0 B;  2NUT B;  5BQH A;  2LFF A;  3WOD F;  1BR1 A;  2OU6 A;  1M2O A;  3JSE O;  4EBJ A;  2Q7R A;  3NMK A;  1ORY A;  1ZU5 A;  2XLD A;  4IGG A;  4CJG A;  1EQ1 A;  1FTS A;  1LI5 A;  2XLH A;  2LD6 A;  3ITF A;  1D0Y A;  4H54 A;  4OIN F;  2ZXW C;  3RQF A;  4JVS A;  3ZQY A;  2ASR A;  1L3P A;  4JE9 A;  2XXA A;  4F4B A;  2AP3 A;  4O6N A;  1HW1 A;  3FHD A;  1NFN A;  1T5O A;  3AG1 C;  4G7H F;  5F28 E;  5COG A;  3EGX A;  4BG0 A;  2HV7 A;  2J7P D;  1JAF A;  4BJ6 C;  1XWJ A;  4IWB A;  1KU2 A;  1TFO B;  4J7T A;  4PJM A;  1HW2 A;  3FAP B;  4NC3 A;  4RD9 A;  1I5N A;  3LUT B;  5T3T A;  4EKW A;  4DOZ A;  1QVX A;  2AVK A;  3GWL A;  2I8B A;  2GAQ A;  4RBN A;  3LLI A;  1Q0F A;  1TR2 A;  4XWJ A;  2R7W A;  3G50 A;  1KTM A;  3QMK A;  1QPU A;  4EBK A;  3GOR A;  4JRZ A;  4D4X A;  1E86 A;  4CIP A;  4OD4 A;  1JPJ A;  4MVM A;  3C8G B;  4BJ5 C;  2CDQ A;  2EPO A;  2BE5 F;  4J32 B;  4ANJ A;  5JS5 A;  3HLZ A;  1G8X A;  1NLX A;  3TJ6 A;  2EPM X;  3LES A;  3U9J A;  1YA7 O;  1I4Z A;  3UGO A;  1YLM A;  5L0C A;  1K40 A;  2CYD A;  3RW0 A;  1CPQ A;  3KKB A;  1NFO A;  3DE9 A;  4MTF A;  1OKK A;  1TWH A;  2LFD A;  4PR9 A;  4PFP A;  5KYW A;  4XEV A;  1BZ4 A;  2J9V A;  1Z6A A;  2L9J A;  3K33 A;  2VCA A;  1K04 A;  2IYL D;  4GEH A;  2VB6 A;  2KC3 A;  5EHH A;  3O6X A;  3G4X A;  4JW1 A;  4JIO A;  3G4Z A;  3AG4 C;  3TK0 A;  2IXM A;  2AWC A;  3QW1 A;  1VB5 A;  1ORJ A;  3QVY A;  3A9C A;  2XM0 A;  1G4U S;  3HNL A;  4X0R A;  1EKY A;  1Q0K A;  1ZW3 A;  3N2Z B;  3W2W A;  1C02 A;  4DBQ A;  1RKE A;  4FES A;  3NDB B;  4BJ6 A;  2HMZ A;  4ER9 A;  3ECS A;  2B0J A;  5JT4 A;  3KMI A;  1A0B A;  3LLK A;  2R7S A;  1M56 C;  5L0H A;  4XLP F;  4CDA A;  3CEX A;  2J0W A;  2MWQ A;  2FGY A;  1U6H A;  2D4U A;  2C03 A;  4DRJ B;  3S0X A;  2LQG A;  1ORS C;  3EPV A;  3Q6M A;  1ZVZ A; 
#chains in the Genus database with same CATH homology
 2YQY A;  2OQM A;  5CIV A;  2RD9 A;  3DI5 A;  2NSG A;  2QE9 A;  2F22 A;  2QNL A;  2P1A A;  2HKV A;  2OU6 A;  5COF A;  3GOR A;  5COM A;  3QTH A;  4N6C A;  2NSF A;  3CEX A;  3DKA A;  1RXQ A;  5COG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...