2QE9A

Crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
171
structure length
165
Chain Sequence
b'HHHHHENLYFQGMMKFFEYNWQVRDQWFTWCHQLTTEELLKNRLGGVENILYTLFHIIDVEYSWIRAIQGKEDIAVQFADYQTLNKVKSLSNTFRTEIIDVLQTHELVSVPWETGVLYTRDEILHHIIAHEIHHIGQLSVWARELKLSPVSASFIGRTLKPIHSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein BSU10800 (YP_054576.1) from Bacillus subtilis at 1.90 A resolution
rcsb
molecule keywords Uncharacterized protein yizA
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 53
structure length 165
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05163 DinB DinB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2qe9A01
2QE9A 2RD9A 4N6CA 2YQYA 3CEXA 2P1AA 5COMA 3DKAA 2F22A 5COFA 2OQMA 2HKVA 3DI5A 5CIVA 3GORA 2OU6A 3QTHA 2NSGA 1RXQA 2NSFA 2QNLA 5COGA
chains in the Genus database with same CATH superfamily
2HSQA 4JKVA 1YJGA 3WHNA 4IJJA 3JYHA 3ZTMA 3ITFA 4ULWA 3JT1A 1V74B 2PP4A 3RF3A 1HW1A 1NZEA 3C7JA 2FFHA 3IQTA 4R32A 4XEVA 2NUTB 4MW3A 4CJOA 2WZFA 3KH2A 2LP4A 4KBLA 3MLGA 2ASRA 2TMVP 5JP7A 2CNWD 3LNMB 5KYYA 4KI2A 2OCCC 5COFA 2VB6A 2WVOA 3AQCA 1PCXA 3C8GD 3EGDA 4U9DA 1SZIA 4WABA 3Q7LA 3WODF 1K04A 4MS2A 2L6GA 3JTLO 1NFOA 3ABMC 3RFYA 2XLHA 4MTGA 5AC4A 2NG1A 5F28E 4NTFA 4E7ZA 3DAFA 2G3VA 1A41A 4CJGA 4YN0B 4AL1A 1OW6A 1UFBA 1YA9A 2NPUA 2Z15A 4Z9HA 3U8PA 4CIHA 3M4BA 1O5HA 3DE8A 1VK5A 1JOGA 2HMQA 2L7AA 4JCZA 3O55A 5KYWA 3RQFA 2R02A 1ZW2A 4DBQA 4BJ6A 5E3AA 2OJED 3ZWIA 3M79A 1RKEB 2YL7A 4XLNF 3UNGC 3LS0A 3MYIA 4XWJA 1OW7A 3LESA 2Y3HA 5DQTA 1OR2A 3JYYA 2Q4FA 3H2UA 4PACA 3UR3C 3W2VA 3RQGA 4CX9A 3B0PA 1QSPA 3EJNA 5A6KA 4IGGA 5DS4A 1LE2A 2R7VA 3IPMO 1DOWA 1VLSA 4XTKA 2YLDA 2ZXPA 5CI8A 1BR1A 1FNTc 2HMZA 1CGNA 1WN0A 4JTDB 3K1IA 1OCRC 1QQ3A 2QNLA 3AGTA 4K0DA 3L0IA 4XPYA 4G78A 3WAQA 4EBBA 2YL1A 4CDVA 1QVXA 4RD9A 1ZVZA 3VYWA 3AGUA 5EK0A 3WG7C 3T4RA 1T5OA 2M4EA 4U5GA 2XM0A 3ZTZA 1YYJA 2Y3BA 5B3SC 1E85A 1BR4A 3N2ZB 3TD7A 2WVQA 2M64A 3C62A 3GANA 1AUEA 2KSFA 1QLEC 1QZXA 1MMAA 1SR2A 3W2WA 2B0HA 1Q0GA 1ORJA 3U9JA 2QTVA 2Q3TA 3EH2A 5KYYB 3GM1A 3QZCA 1TWCA 4EHPA 2J9WA 2J45A 4U5BE 3EGDB 2HV7A 4EIYA 1ZZPA 1HMDA 3CAXA 3VF0A 3GEEA 4EWCA 1C17M 5L0IA 3B0VC 3T6GB 3LJBA 5EHHA 1BDJB 1B68A 2ZXOA 1U89A 4NTBA 2IXNA 1RXQA 3JZ0A 4PJJA 4WGYA 4BEMJ 3NMKA 1R5ID 2R7TA 1WATA 2J9VA 2XSEA 2AP3A 2RD9A 4HE8D 2GFHA 2XL8A 3KYIA 2LQGA 2Q9BA 1NG1A 5B1BC 1TR2A 2W45A 1WWPA 4A4AA 5BQHA 2R7WA 4IRUA 5BQIA 1AVOB 3QW0A 3ASOC 5IY5C 5KYWB 3EHMA 1O3UA 1ZHTA 3DKAA 3ZDLA 1GM5A 1OKKA 1NSGB 3HJCA 1WGWA 1LI7A 2OG2A 3OEOA 2OQMA 5A6JA 1UG7A 2LK4A 5L0FA 2IXPA 2EPOA 1V54C 3TOLA 3ZG1A 1JRAA 2MHRA 2OKUA 4IAQA 4G0HA 4PFPA 2HUJA 2KQ9A 3US6A 4U9EA 1HMOA 3LNRA 2DYSC 1VYKA 2NSFA 2J0XA 4I3MA 5AC5A 2WZGA 3NYJA 5JUAA 3MBGA 4JC7A 2YL3A 3Q6NA 1C02A 1M2VA 3SNHA 1D1CA 1YA7O 1ZHYA 2CCYA 5JLIA 4IB4A 2X51A 1M57C 4Z9IA 1FTSA 3M4CA 3CQZA 2AU5A 3L34A 2PFDA 5L0CA 3SXZA 1ZU4A 2CDQA 2R03A 4I1MA 3HTKC 2D5RB 1VLTA 4M63A 3NYLA 3SP1A 3CSKA 1OXBA 2VASA 5K0IA 1EQ1A 2DGJA 1BZ4A 4XQ1A 2Q9AA 4NC3A 2XLOA 1SF8A 4YWQA 1EKYA 2IXOA 5FCLA 1ST6A 3OA1A 1J8MF 1VTMP 5COGA 3V5YA 2HZ8A 3UMIA 4DOZA 4DJ9A 2R7OA 4YL0A 5EGYA 2EIMC 4OIOF 3JSEO 3EPVA 4GYTA 1WTYA 1Z3IX 2XLMA 5DVWA 1OQCA 3LLKA 4MNDA 4CBEA 2YRFA 1ZHZA 4N4WA 5FZTA 4CS9A 1S05A 4Q5SF 4WJ0A 3QW1A 2OJQA 4CSAC 1JAFA 1FMVA 3DWWA 3LS1A 4JJGA 3ABLC 2EPMX 4MQ9F 2EPNA 3HNKA 3ZVRA 5JT4A 2J46A 1CPRA 3C63A 1KTMA 3O39A 3JCUQ 5KYUA 4IWBA 3U0CA 2GA0A 4YT8A 2H8AA 1YZCA 1M2OA 5L3QA 2OU6A 2R25A 3RQEA 2XS1A 3QTHA 5JSLA 1W2WA 4EBKA 3PDMP 2XLDA 3UMHA 1YARO 2Y3GA 3RYLA 2EPKX 3DM5A 4JIOA 4X0RA 3B29A 2HJ3A 3AJMA 3ZQVA 3EH1A 3NKEA 4CSAA 1EI7A 2YLGA 1HE9A 3EFOA 4FX5A 4MVZA 2ZPAA 4XLPF 2R7RA 1TKNA 2GWWA 3CEXA 3N24A 3NG1A 1M2VB 2L9JA 3K1IC 3QVYA 1RKCA 4K1OA 3FAJA 4BPMA 5KYNA 3G4ZA 1S7ZA 3HNIA 3DAGA 1XZPA 2V26A 1JPJA 4JEAA 3TJ6A 2UUIA 2UUHA 1H9GA 2VC9A 3TOMA 2I15A 4XEKA 1FMWA 3VAYA 1OW8A 4KNWA 1RMVA 1WASA 4PFOA 3V5ZA 2KNHA 3AOUA 2AWCA 3IHUA 256BA 2HJMA 3EHNA 3K33A 1GS9A 1MNDA 3IQ6A 4CDAA 3KPHA 1VMAA 3G50A 2J7PD 4W8KA 3E9VA 1AEPA 1HE1A 2PF4E 2FGYA 2AVKA 3I5PA 1Z63A 2WB7A 1VOMA 3JSZA 1D1AA 2JX0A 1OKKD 4XEFA 4OIRF 2ZXRA 5D92A 2WL8A 3PMRA 1T6UA 1L7CA 3SEOA 3W8IA 1L3PA 3LLIA 3SXKA 5B3IA 1E86A 2R05A 4MTFA 4QI0A 4DBRA 5BUOA 3DMDA 2P1AA 2IOQA 1ZHWA 2LD6A 5T1DB 3X2QC 1NBBA 3IQCA 3B9QA 4O6YA 2Q7RA 2IBFA 2DI3A 4C3DA 4P9FA 2YLIA 3S84A 4FWVA 3R7CA 2C04A 3HNLA 3U3BA 3U2MA 2J8WA 3W4YA 1J8YF 5JVEA 5KYUB 3EQLF 3E70C 3M15A 1HW2A 1LPEA 2XLWA 2XXAA 4BJ5C 2DB4A 1Z6AA 5DLJA 2FAPB 2O9XA 3C8GA 4C7OA 4ANJA 1Y6DA 2PX0A 2OOCA 1G4WR 1TQGA 1ORSC 1GQAA 2R7XA 1H6GA 2ETSA 1YDIA 1YVIA 3GWNA 3JRTA 1Q0DA 1BR2A 2LFFA 4G7ZF 3EFOB 5HV9A 1ZHXA 2W4BA 4OINF 3NMIA 4O79A 5F5HA 1LVKA 1LKXA 1TFKB 1XZQA 2Q00A 2XLEA 3I4UA 3B71A 3NYMA 2A0UA 4K7BA 4N6HA 2G62A 4LDKA 2CW0F 3ATPA 4MVMA 4O6MA 5TJ5E 3AG3C 4BJ5A 5L0DA 2W9YA 1U0BB 4I44A 4CDYA 4DRHB 3F47A 4J30B 1KNYA 2PNOA 2XRHA 1ZYRF 4Q7CA 3LAYA 5E33A 4BEJA 2J0WA 1TWGA 2BL2A 3K6BA 1JMWA 3G4XA 2LIGA 3S9OA 2LFDA 4UDVA 2PX3A 2YQYA 3EG9A 3J06A 2QE9A 2WVNA 2VCCA 3HNJA 3LEVA 4LDQA 5AGFA 3ASNC 5BQGA 3U2LA 2CYDA 3S0XA 2XS8A 4QDLA 3NDBB 4N6CA 4QI2A 4KC9A 2Y39A 4AK9A 1LM3B 3W8HA 1F1MA 4MVQA 2VH3A 4JE9A 5B1AC 1N1CA 1VB5A 2P0NA 4YL1A 4AL0A 4LDRA 4YT2A 1Z23A 4MVUA 1H9TA 1RJ9A 2A1DD 3U5SA 1Q0FA 1YLMA 2YWAA 2JD3A 4CS8C 4MTOA 2E87A 2JPUA 1H7IA 1NU9C 3FDQA 4JW1A 2QY9A 3S28A 4CS9C 2EIJC 4JTCB 3DE9A 4DXWA 1Z5ZA 3I5QA 4P9TA 5CIVA 3S90A 1MNEA 1TWHA 3SYNA 4CIPA 1K05A 2H7OA 2NUPA 3GM3A 4BJ6C 1A7VA 3PCVA 1APCA 1BBHA 4E0IA 4G7OF 2KYHA 3U8VA 3DI5A 4HFFB 2XXAB 1LS4A 3FXHA 2A69F 4C7OB 5JRAA 2A0BA 4AE4A 2YZSA 4CS8A 1M56C 1OCZC 3AG2C 4U5CE 5KYXA 3IEEA 4JRZA 4PR9A 2KW3C 1E83A 3PHF2 5F5FA 1KU2A 2IM8A 1OCCC 2XL6A 3DZAA 4DVYP 1T9KA 3SXYA 4U5DE 1XWJA 3C18A 2F22A 1M6TA 4YT5A 2GAQA 2HS5A 4E0HA 2V3CC 3S27A 3DXJF 4MVSA 3TK0A 4J32B 2P7VA 1TFOB 4W8PA 3AG1C 3FOPA 5JS5A 2KC3A 4KNVA 3FAPB 3ZQYA 3DJUB 4BJ1A 1Q0KA 1OXKA 2VCAA 3O10A 4JJFA 4EUKB 2NSGA 3T6JA 4ZLCA 1Y4CA 4PJMA 3U9MA 1ZW3A 3C8ZA 3DJNB 4OD5A 4LACB 1FFHA 2IXMA 3MYFA 1V4AA 1SMYF 3GEHA 3RH3A 2OEXA 2Y3DA 2HFIA 2L81A 3EG9B 4PK4A 3Q7GA 2EIKC 3IQ5A 4PJLA 1OR3A 1ORYA 1QPUA 3K1HA 1FR0A 3A11A 3L8IA 4JZAA 3RW0A 3QVZA 3F46A 3LUTB 2CGEA 4MVOA 4RDAA 5CI9A 4YJWA 3VRCA 4E17A 5COMA 5A6BA 4A2NB 2R7SA 4Z9JA 1YZAA 3NRHA 2WZLA 1D1BA 3AQBA 3KKBA 3KYJA 1ZU5A 2GDCA 3MX3A 4H4KC 3DM9B 4YT4A 3KMIA 3ZC4A 1RJ9B 1U6HA 2Y69C 3L1MA 5D91A 3RVYA 1SYQA 4C3BA 2D4UA 3A9CA 5HSWA 2EINC 1CGME 2KGOA 1IW7F 1DOVA 1V55C 3QMKA 2W4MA 4GEHA 4NQFA 4RBNA 2HV6A 1FAPB 3X1OA 1G4US 2ZXWC 1O87A 2NUPB 4J7YA 3RVZA 2PBEA 1E2XA 2BE5F 4ONSA 3O6XA 4AX2A 2VCBA 4G7HF 1C03A 4NY3A 3ABKC 4H54A 4L6RA 4E18A 4HFKB 1T6QA 3N0TA 4AE4B 3VM6A 2B0JA 4LLEA 1I5NA 2RSEB 1IZMA 1NU7D 5KYXB 3R2PA 2A6EF 2Q9CA 1GGQA 3GODA 4I1OB 3JRMO 4FAPB 2HKVA 4FESA 5E2QA 4JEBA 1A7EA 3EZHA 2C03A 2J9BA 1T01A 5GPGB 1PD0A 3V5XA 2R9RB 4E7SA 2HSBA 1QKRA 2CNWA 4OIPF 2J9UA 5E3CA 2I8BA 2R7QA 4JVSA 4OIQF 3FMSA 4F4BA 5A69A 2KK1A 2IYLD 4LLCA 1LE4A 1RCPA 3V7OA 1CGOA 3U3FA 3BEHA 1D0XA 2LCHA 1K40A 1MMNA 1A7DA 3K7DA 1I4YA 2QUPA 2KJGA 2L6FA 4O6NA 4U5EE 2YHSA 4XPWA 3KL4A 1CPQA 3GWLA 4O7GA 3RKOF 3EGXA 4JCHA 2BC5A 5L0JA 1E84A 4DRJB 2DYRC 3FHDA 4DVZA 1A0BA 1VYIA 3H65A 1NFNA 4CS7A 3T9OA 1LIHA 3GORA 3UGPA 1NLXA 2G3KA 2QLAA 3NKDA 1WOLA 3GEIA 3MFNA 4U5HA 4NTAA 1MQVA 2H7VC 2OEVA 4B6IA 2LSEA 3T6BA 2YKZA 3DD7A 4C3EA 4N06A 1Z7Qc 2NUTA 3UGOA 4D4NA 1LI5A 4JTAB 2J7PA 3CZ6A 4BG0A 4IARA 3SZRA 2EPLX 2ZD9A 4NCQA 2L6HA 4P6IC 4U5FE 3ECSA 5T3TA 5A6AA 1G5ZA 4Q4ZF 1TWAA 1MMGA 2A68F 2ICWG 3L8JA 4DRIB 3RIPA 1OCOC 1Q0MA 4LERA 4YL3A 3BRJA 3GM2A 4GQHA 5DQZA 3LEOA 4BJTA 4MW8A 3TQOA 1PD1A 3TJ5A 2R7UA 4XPXA 2AWYA 3OWTA 1JR8A 1D0ZA 2YVKA 1EA8A 3AG4C 3K66A 4ULVA 4YK5A 3ZIBA 5L0HA 2X0CA 2A6HF 2MYSA 2XLVA 1FFTC 5T3WA 3Q6MA 5A6BD 2P6VA 4HEAJ 1G8XA 3H2VA 3NMJA 3FOOA 3C8GB 3S29A 4WGZA 2YL0A 3HKKA 3HLZA 5L3VA 4D4XA 4EBJA 1PV3A 4ZLDA 1MMDA 3M1CB 1RKEA 1YAUO 4EKWA 3UMKA 3ZSUA 3B0UX 3TULA 1HY5A 4IAOA 4OD4A 5L0GA 4JURI 2XM4A 1R4TA 2P61A 3EGXB 1D0YA 1LS1A 4PJNA 2YEVA 2XL4A 4J7TA 5DS5A 1JPNA 1YYXA 5DS6A 2EILC 1I4ZA 3EZIA 3SXMA 1T6IA 4MVRA 4ER9A 2H7BA 3POVA 2MWQA 3FVYA
chains in the Genus database with same CATH topology
2QE9A 2RD9A 4N6CA 2YQYA 3CEXA 2P1AA 5COMA 3DKAA 2F22A 5COFA 2OQMA 2HKVA 3DI5A 5CIVA 3GORA 2OU6A 3QTHA 2NSGA 1RXQA 2NSFA 2QNLA 5COGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QE9 A;  2RD9 A;  4N6C A;  2YQY A;  3CEX A;  2P1A A;  5COM A;  3DKA A;  2F22 A;  5COF A;  2OQM A;  2HKV A;  3DI5 A;  5CIV A;  3GOR A;  2OU6 A;  3QTH A;  2NSG A;  1RXQ A;  2NSF A;  2QNL A;  5COG A; 
#chains in the Genus database with same CATH topology
 2HSQ A;  4JKV A;  1YJG A;  3WHN A;  4IJJ A;  3JYH A;  3ZTM A;  3ITF A;  4ULW A;  3JT1 A;  1V74 B;  2PP4 A;  3RF3 A;  1HW1 A;  1NZE A;  3C7J A;  2FFH A;  3IQT A;  4R32 A;  4XEV A;  2NUT B;  4MW3 A;  4CJO A;  2WZF A;  3KH2 A;  2LP4 A;  4KBL A;  3MLG A;  2ASR A;  2TMV P;  5JP7 A;  2CNW D;  3LNM B;  5KYY A;  4KI2 A;  2OCC C;  5COF A;  2VB6 A;  2WVO A;  3AQC A;  1PCX A;  3C8G D;  3EGD A;  4U9D A;  1SZI A;  4WAB A;  3Q7L A;  3WOD F;  1K04 A;  4MS2 A;  2L6G A;  3JTL O;  1NFO A;  3ABM C;  3RFY A;  2XLH A;  4MTG A;  5AC4 A;  2NG1 A;  5F28 E;  4NTF A;  4E7Z A;  3DAF A;  2G3V A;  1A41 A;  4CJG A;  4YN0 B;  4AL1 A;  1OW6 A;  1UFB A;  1YA9 A;  2NPU A;  2Z15 A;  4Z9H A;  3U8P A;  4CIH A;  3M4B A;  1O5H A;  3DE8 A;  1VK5 A;  1JOG A;  2HMQ A;  2L7A A;  4JCZ A;  3O55 A;  5KYW A;  3RQF A;  2R02 A;  1ZW2 A;  4DBQ A;  4BJ6 A;  5E3A A;  2OJE D;  3ZWI A;  3M79 A;  1RKE B;  2YL7 A;  4XLN F;  3UNG C;  3LS0 A;  3MYI A;  4XWJ A;  1OW7 A;  3LES A;  2Y3H A;  5DQT A;  1OR2 A;  3JYY A;  2Q4F A;  3H2U A;  4PAC A;  3UR3 C;  3W2V A;  3RQG A;  4CX9 A;  3B0P A;  1QSP A;  3EJN A;  5A6K A;  4IGG A;  5DS4 A;  1LE2 A;  2R7V A;  3IPM O;  1DOW A;  1VLS A;  4XTK A;  2YLD A;  2ZXP A;  5CI8 A;  1BR1 A;  1FNT c;  2HMZ A;  1CGN A;  1WN0 A;  4JTD B;  3K1I A;  1OCR C;  1QQ3 A;  2QNL A;  3AGT A;  4K0D A;  3L0I A;  4XPY A;  4G78 A;  3WAQ A;  4EBB A;  2YL1 A;  4CDV A;  1QVX A;  4RD9 A;  1ZVZ A;  3VYW A;  3AGU A;  5EK0 A;  3WG7 C;  3T4R A;  1T5O A;  2M4E A;  4U5G A;  2XM0 A;  3ZTZ A;  1YYJ A;  2Y3B A;  5B3S C;  1E85 A;  1BR4 A;  3N2Z B;  3TD7 A;  2WVQ A;  2M64 A;  3C62 A;  3GAN A;  1AUE A;  2KSF A;  1QLE C;  1QZX A;  1MMA A;  1SR2 A;  3W2W A;  2B0H A;  1Q0G A;  1ORJ A;  3U9J A;  2QTV A;  2Q3T A;  3EH2 A;  5KYY B;  3GM1 A;  3QZC A;  1TWC A;  4EHP A;  2J9W A;  2J45 A;  4U5B E;  3EGD B;  2HV7 A;  4EIY A;  1ZZP A;  1HMD A;  3CAX A;  3VF0 A;  3GEE A;  4EWC A;  1C17 M;  5L0I A;  3B0V C;  3T6G B;  3LJB A;  5EHH A;  1BDJ B;  1B68 A;  2ZXO A;  1U89 A;  4NTB A;  2IXN A;  1RXQ A;  3JZ0 A;  4PJJ A;  4WGY A;  4BEM J;  3NMK A;  1R5I D;  2R7T A;  1WAT A;  2J9V A;  2XSE A;  2AP3 A;  2RD9 A;  4HE8 D;  2GFH A;  2XL8 A;  3KYI A;  2LQG A;  2Q9B A;  1NG1 A;  5B1B C;  1TR2 A;  2W45 A;  1WWP A;  4A4A A;  5BQH A;  2R7W A;  4IRU A;  5BQI A;  1AVO B;  3QW0 A;  3ASO C;  5IY5 C;  5KYW B;  3EHM A;  1O3U A;  1ZHT A;  3DKA A;  3ZDL A;  1GM5 A;  1OKK A;  1NSG B;  3HJC A;  1WGW A;  1LI7 A;  2OG2 A;  3OEO A;  2OQM A;  5A6J A;  1UG7 A;  2LK4 A;  5L0F A;  2IXP A;  2EPO A;  1V54 C;  3TOL A;  3ZG1 A;  1JRA A;  2MHR A;  2OKU A;  4IAQ A;  4G0H A;  4PFP A;  2HUJ A;  2KQ9 A;  3US6 A;  4U9E A;  1HMO A;  3LNR A;  2DYS C;  1VYK A;  2NSF A;  2J0X A;  4I3M A;  5AC5 A;  2WZG A;  3NYJ A;  5JUA A;  3MBG A;  4JC7 A;  2YL3 A;  3Q6N A;  1C02 A;  1M2V A;  3SNH A;  1D1C A;  1YA7 O;  1ZHY A;  2CCY A;  5JLI A;  4IB4 A;  2X51 A;  1M57 C;  4Z9I A;  1FTS A;  3M4C A;  3CQZ A;  2AU5 A;  3L34 A;  2PFD A;  5L0C A;  3SXZ A;  1ZU4 A;  2CDQ A;  2R03 A;  4I1M A;  3HTK C;  2D5R B;  1VLT A;  4M63 A;  3NYL A;  3SP1 A;  3CSK A;  1OXB A;  2VAS A;  5K0I A;  1EQ1 A;  2DGJ A;  1BZ4 A;  4XQ1 A;  2Q9A A;  4NC3 A;  2XLO A;  1SF8 A;  4YWQ A;  1EKY A;  2IXO A;  5FCL A;  1ST6 A;  3OA1 A;  1J8M F;  1VTM P;  5COG A;  3V5Y A;  2HZ8 A;  3UMI A;  4DOZ A;  4DJ9 A;  2R7O A;  4YL0 A;  5EGY A;  2EIM C;  4OIO F;  3JSE O;  3EPV A;  4GYT A;  1WTY A;  1Z3I X;  2XLM A;  5DVW A;  1OQC A;  3LLK A;  4MND A;  4CBE A;  2YRF A;  1ZHZ A;  4N4W A;  5FZT A;  4CS9 A;  1S05 A;  4Q5S F;  4WJ0 A;  3QW1 A;  2OJQ A;  4CSA C;  1JAF A;  1FMV A;  3DWW A;  3LS1 A;  4JJG A;  3ABL C;  2EPM X;  4MQ9 F;  2EPN A;  3HNK A;  3ZVR A;  5JT4 A;  2J46 A;  1CPR A;  3C63 A;  1KTM A;  3O39 A;  3JCU Q;  5KYU A;  4IWB A;  3U0C A;  2GA0 A;  4YT8 A;  2H8A A;  1YZC A;  1M2O A;  5L3Q A;  2OU6 A;  2R25 A;  3RQE A;  2XS1 A;  3QTH A;  5JSL A;  1W2W A;  4EBK A;  3PDM P;  2XLD A;  3UMH A;  1YAR O;  2Y3G A;  3RYL A;  2EPK X;  3DM5 A;  4JIO A;  4X0R A;  3B29 A;  2HJ3 A;  3AJM A;  3ZQV A;  3EH1 A;  3NKE A;  4CSA A;  1EI7 A;  2YLG A;  1HE9 A;  3EFO A;  4FX5 A;  4MVZ A;  2ZPA A;  4XLP F;  2R7R A;  1TKN A;  2GWW A;  3CEX A;  3N24 A;  3NG1 A;  1M2V B;  2L9J A;  3K1I C;  3QVY A;  1RKC A;  4K1O A;  3FAJ A;  4BPM A;  5KYN A;  3G4Z A;  1S7Z A;  3HNI A;  3DAG A;  1XZP A;  2V26 A;  1JPJ A;  4JEA A;  3TJ6 A;  2UUI A;  2UUH A;  1H9G A;  2VC9 A;  3TOM A;  2I15 A;  4XEK A;  1FMW A;  3VAY A;  1OW8 A;  4KNW A;  1RMV A;  1WAS A;  4PFO A;  3V5Z A;  2KNH A;  3AOU A;  2AWC A;  3IHU A;  256B A;  2HJM A;  3EHN A;  3K33 A;  1GS9 A;  1MND A;  3IQ6 A;  4CDA A;  3KPH A;  1VMA A;  3G50 A;  2J7P D;  4W8K A;  3E9V A;  1AEP A;  1HE1 A;  2PF4 E;  2FGY A;  2AVK A;  3I5P A;  1Z63 A;  2WB7 A;  1VOM A;  3JSZ A;  1D1A A;  2JX0 A;  1OKK D;  4XEF A;  4OIR F;  2ZXR A;  5D92 A;  2WL8 A;  3PMR A;  1T6U A;  1L7C A;  3SEO A;  3W8I A;  1L3P A;  3LLI A;  3SXK A;  5B3I A;  1E86 A;  2R05 A;  4MTF A;  4QI0 A;  4DBR A;  5BUO A;  3DMD A;  2P1A A;  2IOQ A;  1ZHW A;  2LD6 A;  5T1D B;  3X2Q C;  1NBB A;  3IQC A;  3B9Q A;  4O6Y A;  2Q7R A;  2IBF A;  2DI3 A;  4C3D A;  4P9F A;  2YLI A;  3S84 A;  4FWV A;  3R7C A;  2C04 A;  3HNL A;  3U3B A;  3U2M A;  2J8W A;  3W4Y A;  1J8Y F;  5JVE A;  5KYU B;  3EQL F;  3E70 C;  3M15 A;  1HW2 A;  1LPE A;  2XLW A;  2XXA A;  4BJ5 C;  2DB4 A;  1Z6A A;  5DLJ A;  2FAP B;  2O9X A;  3C8G A;  4C7O A;  4ANJ A;  1Y6D A;  2PX0 A;  2OOC A;  1G4W R;  1TQG A;  1ORS C;  1GQA A;  2R7X A;  1H6G A;  2ETS A;  1YDI A;  1YVI A;  3GWN A;  3JRT A;  1Q0D A;  1BR2 A;  2LFF A;  4G7Z F;  3EFO B;  5HV9 A;  1ZHX A;  2W4B A;  4OIN F;  3NMI A;  4O79 A;  5F5H A;  1LVK A;  1LKX A;  1TFK B;  1XZQ A;  2Q00 A;  2XLE A;  3I4U A;  3B71 A;  3NYM A;  2A0U A;  4K7B A;  4N6H A;  2G62 A;  4LDK A;  2CW0 F;  3ATP A;  4MVM A;  4O6M A;  5TJ5 E;  3AG3 C;  4BJ5 A;  5L0D A;  2W9Y A;  1U0B B;  4I44 A;  4CDY A;  4DRH B;  3F47 A;  4J30 B;  1KNY A;  2PNO A;  2XRH A;  1ZYR F;  4Q7C A;  3LAY A;  5E33 A;  4BEJ A;  2J0W A;  1TWG A;  2BL2 A;  3K6B A;  1JMW A;  3G4X A;  2LIG A;  3S9O A;  2LFD A;  4UDV A;  2PX3 A;  2YQY A;  3EG9 A;  3J06 A;  2QE9 A;  2WVN A;  2VCC A;  3HNJ A;  3LEV A;  4LDQ A;  5AGF A;  3ASN C;  5BQG A;  3U2L A;  2CYD A;  3S0X A;  2XS8 A;  4QDL A;  3NDB B;  4N6C A;  4QI2 A;  4KC9 A;  2Y39 A;  4AK9 A;  1LM3 B;  3W8H A;  1F1M A;  4MVQ A;  2VH3 A;  4JE9 A;  5B1A C;  1N1C A;  1VB5 A;  2P0N A;  4YL1 A;  4AL0 A;  4LDR A;  4YT2 A;  1Z23 A;  4MVU A;  1H9T A;  1RJ9 A;  2A1D D;  3U5S A;  1Q0F A;  1YLM A;  2YWA A;  2JD3 A;  4CS8 C;  4MTO A;  2E87 A;  2JPU A;  1H7I A;  1NU9 C;  3FDQ A;  4JW1 A;  2QY9 A;  3S28 A;  4CS9 C;  2EIJ C;  4JTC B;  3DE9 A;  4DXW A;  1Z5Z A;  3I5Q A;  4P9T A;  5CIV A;  3S90 A;  1MNE A;  1TWH A;  3SYN A;  4CIP A;  1K05 A;  2H7O A;  2NUP A;  3GM3 A;  4BJ6 C;  1A7V A;  3PCV A;  1APC A;  1BBH A;  4E0I A;  4G7O F;  2KYH A;  3U8V A;  3DI5 A;  4HFF B;  2XXA B;  1LS4 A;  3FXH A;  2A69 F;  4C7O B;  5JRA A;  2A0B A;  4AE4 A;  2YZS A;  4CS8 A;  1M56 C;  1OCZ C;  3AG2 C;  4U5C E;  5KYX A;  3IEE A;  4JRZ A;  4PR9 A;  2KW3 C;  1E83 A;  3PHF 2;  5F5F A;  1KU2 A;  2IM8 A;  1OCC C;  2XL6 A;  3DZA A;  4DVY P;  1T9K A;  3SXY A;  4U5D E;  1XWJ A;  3C18 A;  2F22 A;  1M6T A;  4YT5 A;  2GAQ A;  2HS5 A;  4E0H A;  2V3C C;  3S27 A;  3DXJ F;  4MVS A;  3TK0 A;  4J32 B;  2P7V A;  1TFO B;  4W8P A;  3AG1 C;  3FOP A;  5JS5 A;  2KC3 A;  4KNV A;  3FAP B;  3ZQY A;  3DJU B;  4BJ1 A;  1Q0K A;  1OXK A;  2VCA A;  3O10 A;  4JJF A;  4EUK B;  2NSG A;  3T6J A;  4ZLC A;  1Y4C A;  4PJM A;  3U9M A;  1ZW3 A;  3C8Z A;  3DJN B;  4OD5 A;  4LAC B;  1FFH A;  2IXM A;  3MYF A;  1V4A A;  1SMY F;  3GEH A;  3RH3 A;  2OEX A;  2Y3D A;  2HFI A;  2L81 A;  3EG9 B;  4PK4 A;  3Q7G A;  2EIK C;  3IQ5 A;  4PJL A;  1OR3 A;  1ORY A;  1QPU A;  3K1H A;  1FR0 A;  3A11 A;  3L8I A;  4JZA A;  3RW0 A;  3QVZ A;  3F46 A;  3LUT B;  2CGE A;  4MVO A;  4RDA A;  5CI9 A;  4YJW A;  3VRC A;  4E17 A;  5COM A;  5A6B A;  4A2N B;  2R7S A;  4Z9J A;  1YZA A;  3NRH A;  2WZL A;  1D1B A;  3AQB A;  3KKB A;  3KYJ A;  1ZU5 A;  2GDC A;  3MX3 A;  4H4K C;  3DM9 B;  4YT4 A;  3KMI A;  3ZC4 A;  1RJ9 B;  1U6H A;  2Y69 C;  3L1M A;  5D91 A;  3RVY A;  1SYQ A;  4C3B A;  2D4U A;  3A9C A;  5HSW A;  2EIN C;  1CGM E;  2KGO A;  1IW7 F;  1DOV A;  1V55 C;  3QMK A;  2W4M A;  4GEH A;  4NQF A;  4RBN A;  2HV6 A;  1FAP B;  3X1O A;  1G4U S;  2ZXW C;  1O87 A;  2NUP B;  4J7Y A;  3RVZ A;  2PBE A;  1E2X A;  2BE5 F;  4ONS A;  3O6X A;  4AX2 A;  2VCB A;  4G7H F;  1C03 A;  4NY3 A;  3ABK C;  4H54 A;  4L6R A;  4E18 A;  4HFK B;  1T6Q A;  3N0T A;  4AE4 B;  3VM6 A;  2B0J A;  4LLE A;  1I5N A;  2RSE B;  1IZM A;  1NU7 D;  5KYX B;  3R2P A;  2A6E F;  2Q9C A;  1GGQ A;  3GOD A;  4I1O B;  3JRM O;  4FAP B;  2HKV A;  4FES A;  5E2Q A;  4JEB A;  1A7E A;  3EZH A;  2C03 A;  2J9B A;  1T01 A;  5GPG B;  1PD0 A;  3V5X A;  2R9R B;  4E7S A;  2HSB A;  1QKR A;  2CNW A;  4OIP F;  2J9U A;  5E3C A;  2I8B A;  2R7Q A;  4JVS A;  4OIQ F;  3FMS A;  4F4B A;  5A69 A;  2KK1 A;  2IYL D;  4LLC A;  1LE4 A;  1RCP A;  3V7O A;  1CGO A;  3U3F A;  3BEH A;  1D0X A;  2LCH A;  1K40 A;  1MMN A;  1A7D A;  3K7D A;  1I4Y A;  2QUP A;  2KJG A;  2L6F A;  4O6N A;  4U5E E;  2YHS A;  4XPW A;  3KL4 A;  1CPQ A;  3GWL A;  4O7G A;  3RKO F;  3EGX A;  4JCH A;  2BC5 A;  5L0J A;  1E84 A;  4DRJ B;  2DYR C;  3FHD A;  4DVZ A;  1A0B A;  1VYI A;  3H65 A;  1NFN A;  4CS7 A;  3T9O A;  1LIH A;  3GOR A;  3UGP A;  1NLX A;  2G3K A;  2QLA A;  3NKD A;  1WOL A;  3GEI A;  3MFN A;  4U5H A;  4NTA A;  1MQV A;  2H7V C;  2OEV A;  4B6I A;  2LSE A;  3T6B A;  2YKZ A;  3DD7 A;  4C3E A;  4N06 A;  1Z7Q c;  2NUT A;  3UGO A;  4D4N A;  1LI5 A;  4JTA B;  2J7P A;  3CZ6 A;  4BG0 A;  4IAR A;  3SZR A;  2EPL X;  2ZD9 A;  4NCQ A;  2L6H A;  4P6I C;  4U5F E;  3ECS A;  5T3T A;  5A6A A;  1G5Z A;  4Q4Z F;  1TWA A;  1MMG A;  2A68 F;  2ICW G;  3L8J A;  4DRI B;  3RIP A;  1OCO C;  1Q0M A;  4LER A;  4YL3 A;  3BRJ A;  3GM2 A;  4GQH A;  5DQZ A;  3LEO A;  4BJT A;  4MW8 A;  3TQO A;  1PD1 A;  3TJ5 A;  2R7U A;  4XPX A;  2AWY A;  3OWT A;  1JR8 A;  1D0Z A;  2YVK A;  1EA8 A;  3AG4 C;  3K66 A;  4ULV A;  4YK5 A;  3ZIB A;  5L0H A;  2X0C A;  2A6H F;  2MYS A;  2XLV A;  1FFT C;  5T3W A;  3Q6M A;  5A6B D;  2P6V A;  4HEA J;  1G8X A;  3H2V A;  3NMJ A;  3FOO A;  3C8G B;  3S29 A;  4WGZ A;  2YL0 A;  3HKK A;  3HLZ A;  5L3V A;  4D4X A;  4EBJ A;  1PV3 A;  4ZLD A;  1MMD A;  3M1C B;  1RKE A;  1YAU O;  4EKW A;  3UMK A;  3ZSU A;  3B0U X;  3TUL A;  1HY5 A;  4IAO A;  4OD4 A;  5L0G A;  4JUR I;  2XM4 A;  1R4T A;  2P61 A;  3EGX B;  1D0Y A;  1LS1 A;  4PJN A;  2YEV A;  2XL4 A;  4J7T A;  5DS5 A;  1JPN A;  1YYX A;  5DS6 A;  2EIL C;  1I4Z A;  3EZI A;  3SXM A;  1T6I A;  4MVR A;  4ER9 A;  2H7B A;  3POV A;  2MWQ A;  3FVY A; 
#chains in the Genus database with same CATH homology
 2QE9 A;  2RD9 A;  4N6C A;  2YQY A;  3CEX A;  2P1A A;  5COM A;  3DKA A;  2F22 A;  5COF A;  2OQM A;  2HKV A;  3DI5 A;  5CIV A;  3GOR A;  2OU6 A;  3QTH A;  2NSG A;  1RXQ A;  2NSF A;  2QNL A;  5COG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...