2QE9A

Crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
171
structure length
165
Chain Sequence
HHHHHENLYFQGMMKFFEYNWQVRDQWFTWCHQLTTEELLKNRLGGVENILYTLFHIIDVEYSWIRAIQGKEDIAVQFADYQTLNKVKSLSNTFRTEIIDVLQTHELVSVPWETGVLYTRDEILHHIIAHEIHHIGQLSVWARELKLSPVSASFIGRTLKPIHSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Uncharacterized protein yizA
publication title Crystal structure of uncharacterized protein BSU10800 (YP_054576.1) from Bacillus subtilis at 1.90 A resolution
rcsb
source organism Bacillus subtilis
total genus 53
structure length 165
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05163 DinB DinB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2qe9A01
2P1AA 2NSGA 2HKVA 2RD9A 3DI5A 3DKAA 2QE9A 3QTHA 2F22A 5COMA 5CIVA 2OU6A 2NSFA 3GORA 4N6CA 5COGA 2QNLA 1RXQA 5COFA 2YQYA 2OQMA 3CEXA
chains in the Genus database with same CATH superfamily
4CDAA 2BC5A 4XWJA 5BUOA 3KKBA 4KNVA 1FFTC 2JX0A 2NSGA 2Q9AA 4JKVA 1V54C 3W8HA 4Z9IA 1Q0FA 2E87A 4JVSA 1T01A 3N2ZB 1EKYA 2WZLA 2IXNA 2YLDA 3QTHA 3U3BA 1U6HA 3IQTA 4JCHA 3DAGA 3VYWA 3HLZA 1SMYF 2J9UA 5JUAA 4BJ5C 3V5XA 4LDKA 2DI3A 4DVYP 1QSPA 4XLNF 4EIYA 3EFOA 2P7VA 5COGA 1PD0A 5D91A 3RIPA 1S05A 3GWLA 5CI9A 4OINF 1DOWA 1RXQA 4PFOA 1IZMA 4H54A 2L6FA 4XEVA 2Q7RA 1WN0A 3TULA 4KC9A 3RQGA 3FOOA 1LVKA 3UNGC 5D92A 2OCCC 2VB6A 3Q7LA 4U9EA 1KU2A 5T1DB 2QUPA 2XLDA 1QKRA 3QMKA 4JC7A 5JSLA 1A7VA 2LQGA 1VB5A 3EG9A 1VTMP 2XLVA 3C8GA 3ZC4A 4MVMA 3GODA 2H8AA 2M4EA 4M63A 1PV3A 2H7BA 2R25A 3H2UA 4OD5A 3K6BA 4N06A 4JTDB 2DYSC 2MYSA 2XXAA 5CIVA 1XZQA 5IY5C 5E3CA 3Q7GA 1I4YA 3MFNA 2YZSA 3GORA 2X0CA 3C18A 4BEJA 1SYQA 2EIKC 2DYRC 3ABKC 3N0TA 4FAPB 2NUPB 2WL8A 3MLGA 1MMGA 3RF3A 4CJOA 1WASA 4EHPA 5FZTA 5DS4A 1UG7A 2YRFA 1M6TA 1ZHXA 2KQ9A 3EGXB 3RKOF 5B3SC 1EQ1A 1ZU4A 2J0XA 2LSEA 3VF0A 4R32A 2R7TA 3EZIA 3U2LA 1YAUO 2HS5A 1JRAA 1VYKA 3W4YA 1E84A 4RBNA 1ORJA 4JJFA 1M2OA 3FVYA 3UR3C 4EUKB 3M4BA 2L7AA 2YL3A 3K7DA 1GQAA 256BA 4BJTA 4OIPF 2ZXWC 2EIMC 2VASA 1FTSA 2F22A 3O6XA 4HE8D 4W8KA 2H7VC 2HMQA 2TMVP 1EA8A 3HNKA 1MMAA 1OW6A 1OR3A 4U5DE 1HY5A 4EBJA 2YEVA 4U5FE 3W2VA 2YLIA 1RJ9B 1LPEA 4K7BA 3S27A 3JTLO 2AWYA 1VOMA 2AVKA 2ZXOA 3ZSUA 4C3DA 4RD9A 1FR0A 1D0ZA 1U89A 1AVOB 5T3TA 2Y3GA 2Q00A 5F5FA 1MMNA 1LM3B 2XXAB 3AOUA 1T6IA 2OQMA 4NTFA 2XL4A 5KYXB 2R7VA 5KYWA 1TWGA 1TWCA 3AG1C 3WHNA 1LIHA 1C02A 2L6GA 3NMKA 5TJ5E 1K40A 2KC3A 2OG2A 4ULVA 1OQCA 1R4TA 2PNOA 4DRIB 3ABLC 2CDQA 4WJ0A 3CSKA 3RVYA 3UGPA 1VYIA 4AE4B 4XPXA 1BR1A 2L6HA 5E33A 5L3QA 4IAQA 2WVOA 4EKWA 2YL1A 4C7OA 2IXPA 2W4MA 5B3IA 4JEAA 4O7GA 3TD7A 4L6RA 1W2WA 2J9BA 3AJMA 1BR2A 2CCYA 4YN0B 1LS1A 3GM2A 2XL8A 1A41A 1LI5A 4GQHA 5A6AA 1TFOB 3IPMO 2V26A 5JVEA 3DM9B 1KTMA 2JD3A 4LERA 3TQOA 3A11A 4JTAB 2YL0A 1WTYA 2C04A 3JSEO 2VCBA 4U5EE 3VM6A 2VCAA 4C3EA 2XM0A 3U9MA 1D1CA 2OJQA 4ER9A 4G7HF 3KPHA 4IJJA 3ITFA 1QPUA 4CDVA 1A7DA 2MWQA 4JEBA 5DQZA 2VCCA 1OW7A 4DRHB 2YVKA 3AGUA 3QW0A 2I8BA 2XLMA 3HNIA 4DOZA 3U8VA 4YT4A 2KW3C 3I4UA 1HW2A 2R7SA 1RKEB 5DQTA 1H9TA 1LE2A 3C63A 4CIPA 1YA7O 2LFFA 2IBFA 2XSEA 3RQFA 2JPUA 1WGWA 4IRUA 1BBHA 1LE4A 3CEXA 4HEAJ 1CPRA 1D0YA 3W8IA 3QVZA 4MTFA 3RYLA 4ANJA 1BDJB 4G78A 4O79A 2IYLD 4YT8A 1V55C 1Z5ZA 2D5RB 2HKVA 3CZ6A 3JSZA 2Q9BA 2RD9A 3HKKA 2X51A 3LLIA 4LLEA 1RCPA 2PFDA 3B71A 3M1CB 4XPYA 4YJWA 4CS9A 2XLHA 3KMIA 3J06A 4PJNA 3MYIA 1TWHA 4U5BE 2PP4A 3B9QA 4JIOA 5L0JA 4DVZA 3GEHA 4JJGA 1M57C 3AG2C 3LUTB 1OW8A 2FFHA 1S7ZA 3SYNA 3EPVA 3GEIA 3TJ6A 3VAYA 4I1OB 5A6KA 3S0XA 3RQEA 1M56C 1O5HA 2HFIA 3FOPA 2R7WA 2J9VA 3M4CA 2B0JA 4MW8A 5JRAA 1F1MA 4IARA 3U2MA 1ORSC 4DRJB 2J7PA 2D4UA 3Q6MA 3LS1A 2P1AA 2GAQA 2XLOA 1YZCA 5AC4A 5EGYA 3B29A 2Y39A 2XS1A 1OKKA 1KNYA 1YLMA 1LI7A 4P9FA 3ZQVA 2HJMA 4GEHA 4BG0A 4E7ZA 4E0HA 4A4AA 4HFKB 3OEOA 2IM8A 2A0UA 2LIGA 2VC9A 4CS8A 2KK1A 4JE9A 2J45A 3X1OA 3WAQA 4MNDA 4ZLDA 2DB4A 3UMHA 3DJNB 1NFNA 2Q3TA 1YDIA 3UMKA 3ZIBA 2KSFA 2AP3A 2QNLA 5BQHA 5AGFA 2ZXRA 1YA9A 4LLCA 4P6IC 3RH3A 3U3FA 2Q9CA 4W8PA 3T6JA 5L0IA 3S90A 4Q5SF 1OCCC 3NDBB 5COFA 4PFPA 1T6UA 4MVQA 1FMVA 1J8MF 2Y3HA 4NTAA 5T3WA 1IW7F 1LKXA 2LCHA 3C62A 3IQ5A 2DGJA 4NCQA 3N24A 2A69F 1Z23A 3CAXA 3DI5A 3DKAA 3GANA 4O6MA 5KYNA 1Z63A 3PCVA 3NYJA 1ZVZA 3UGOA 2O9XA 3R2PA 4B6IA 5A6JA 3AQCA 1OCRC 3V5YA 4IAOA 2UUHA 1VMAA 4CDYA 1Y4CA 3JZ0A 2YHSA 4FWVA 3SXYA 1M2VB 2HJ3A 2LFDA 1PCXA 2J8WA 2OEVA 3WG7C 5JS5A 2NSFA 3EGDB 3H65A 1OCZC 3NMIA 4PJJA 4BPMA 4LACB 1CPQA 1V74B 3QW1A 1YZAA 2UUIA 3LS0A 2Y69C 4EBKA 3G4ZA 4JRZA 3JYYA 1FAPB 3DXJF 3OA1A 4MVRA 4O6NA 1E83A 4MVZA 4MVOA 3ZVRA 3JRTA 2EINC 1BZ4A 2WVNA 4CS9C 3GM3A 1ZHZA 3B0PA 2AWCA 3PDMP 2GA0A 2CGEA 1ZW3A 4XLPF 1K05A 2LK4A 3RW0A 3W2WA 1ST6A 2G62A 3KYIA 3RFYA 5A6BD 4QI0A 3MYFA 3L34A 4MTGA 4HFFB 2NUPA 2QY9A 2WB7A 3V5ZA 2HV7A 3KH2A 2R9RB 3DE8A 2XS8A 3UMIA 1O3UA 1MMDA 5E2QA 3MBGA 3IEEA 5FCLA 3EGXA 1N1CA 3L8JA 5B1BC 4ZLCA 4RDAA 4WGYA 2EILC 3LLKA 1JR8A 5KYUB 2LP4A 3AG3C 1HE9A 4PACA 2RSEB 3SEOA 4CIHA 2R03A 5HSWA 1SR2A 3K1IA 2EPKX 2YQYA 2W45A 3LEOA 3T4RA 1ZHWA 3MX3A 2CNWD 2NUTB 4J7YA 3SNHA 4CS8C 2ZD9A 3ZTZA 4YWQA 2L81A 4XTKA 1WATA 3L1MA 2XRHA 4AL1A 2BL2A 3K66A 4YL0A 3NKDA 4PR9A 3SXZA 1RJ9A 4E17A 1E85A 2FGYA 3ZQYA 2R7UA 3PMRA 3JRMO 1I4ZA 2XM4A 3ATPA 3DMDA 3HNLA 3IHUA 3POVA 1ZHYA 4NY3A 4E7SA 5KYYB 5L0GA 5BQIA 1OXBA 4XEKA 2PX0A 1Z7Qc 2QLAA 4YT5A 2WZFA 5KYXA 4CSAA 4N6CA 5F5HA 3ABMC 3IQ6A 4WGZA 1OXKA 1T9KA 3EHMA 3JYHA 4PJMA 4AK9A 4FESA 2Z15A 5F28E 2KYHA 3HJCA 3F47A 1RMVA 4MTOA 4YL3A 2XL6A 3DJUB 2HUJA 3HTKC 3L8IA 1C03A 2ASRA 2MHRA 4OD4A 2R7XA 4CS7A 2ZXPA 4MVUA 4AE4A 2C03A 3K33A 2A6EF 5DLJA 2R05A 5EHHA 3C8GD 4XPWA 3TK0A 3ASNC 2FAPB 3ZTMA 2YWAA 4WABA 3FDQA 1FMWA 1H7IA 3KL4A 3AQBA 4G7ZF 3G50A 1ZU5A 5B1AC 3DWWA 4IB4A 2G3KA 1FNTc 4AL0A 1YYXA 4OIRF 3FMSA 4IWBA 3OWTA 4G7OF 3I5QA 1JPNA 2R7QA 3EZHA 3LESA 2OU6A 3BEHA 3ASOC 1TQGA 3AG4C 2G3VA 3NMJA 5GPGB 1J8YF 3EG9B 3S9OA 3V7OA 4YK5A 1VLSA 3C8GB 3EH1A 3IQCA 3S29A 3T6GB 1C17M 1TFKB 3FXHA 4JZAA 4D4XA 3EHNA 1G4US 1QLEC 3EJNA 1YARO 2HSBA 2L9JA 3KYJA 1TKNA 4JW1A 2YLGA 2IXMA 3SP1A 2A1DD 4OIQF 1U0BB 3DM5A 1JMWA 1TWAA 4BEMJ 2AU5A 5DS5A 3B0UX 1E2XA 2HSQA 4J7TA 1SF8A 1A0BA 5A6BA 4CBEA 3NG1A 1I5NA 1XWJA 2Q4FA 3M79A 3O55A 1MNEA 1H6GA 2HZ8A 1RKEA 3PHF2 4K0DA 2WZGA 4Z9JA 3K1IC 4AX2A 3S84A 3NKEA 1HMDA 3BRJA 2OEXA 3A9CA 3R7CA 2I15A 1HMOA 1T6QA 3E70C 3HNJA 3QZCA 4LDRA 3SXKA 4DXWA 1BR4A 5L0CA 2ETSA 4U5GA 1Z3IX 1D0XA 3JCUQ 4CX9A 3GEEA 2YL7A 1OCOC 1GS9A 1XZPA 2P6VA 1ZW2A 1ZZPA 2BE5F 1JOGA 1NSGB 2ICWG 2P61A 5HV9A 4N6HA 4KI2A 3U9JA 4Q7CA 4DBQA 4CSAC 4Q4ZF 3US6A 4I44A 1QZXA 2R7RA 1H9GA 4NC3A 4N4WA 5EK0A 5L3VA 4DJ9A 1HW1A 3GM1A 1GM5A 4OIOF 1ZHTA 3C7JA 3DAFA 3ZDLA 4J32B 1L3PA 3H2VA 1CGME 4A2NB 3EQLF 2VH3A 4BJ6A 5KYWB 1CGOA 2R02A 1UFBA 3O10A 4Z9HA 4H4KC 3DZAA 3FAJA 2XLWA 2HMZA 2J0WA 1AUEA 2M64A 3NYMA 3TJ5A 4KBLA 2CW0F 3LNRA 2PBEA 1OR2A 3S28A 1Q0GA 3FHDA 2P0NA 4EBBA 1CGNA 3SZRA 1K04A 3DE9A 4QDLA 1MQVA 1D1BA 2WVQA 4C7OB 1EI7A 2QTVA 3LAYA 4CJGA 1JAFA 1R5ID 4P9TA 3LEVA 3M15A 2QE9A 2Y3DA 3L0IA 4PK4A 5L0HA 2IXOA 1G8XA 2J46A 4DBRA 1GGQA 2J9WA 1NZEA 3CQZA 1VK5A 3NYLA 4J30B 3DD7A 5JLIA 3E9VA 3U0CA 5DS6A 1DOVA 4QI2A 2OJED 4PJLA 1HE1A 2EPOA 2IOQA 3TOMA 4JCZA 4U5CE 2A68F 3Q6NA 3I5PA 1NLXA 2EIJC 4I3MA 2R7OA 4IGGA 3SXMA 3U8PA 4E0IA 5L0FA 1VLTA 1A7EA 1FFHA 2EPLX 3LJBA 4GYTA 2NG1A 3T9OA 1ZYRF 5CI8A 5E3AA 3NRHA 1M2VA 3VRCA 4BJ5A 2ZPAA 5K0IA 4EWCA 4X0RA 3EGDA 1YJGA 4NTBA 1TR2A 3G4XA 1MNDA 1QQ3A 4G0HA 5A69A 3K1HA 2GDCA 3TOLA 4U9DA 2YKZA 4U5HA 4FX5A 5DVWA 4JTCB 4I1MA 2Y3BA 2CYDA 3LNMB 3U5SA 1O87A 4D4NA 1LS4A 2H7OA 1YVIA 2KNHA 1V4AA 4F4BA 4YL1A 1PD1A 1Q0MA 1Q0KA 3X2QC 4XQ1A 2KJGA 4XEFA 2W9YA 1NG1A 1QVXA 2J7PD 4KNWA 1JPJA 4ONSA 1NU7D 1NBBA 4BJ6C 1AEPA 4BJ1A 4K1OA 1YYJA 2A0BA 2EPNA 1OKKD 3EFOB 5AC5A 1D1AA 1T5OA 5BQGA 1WOLA 2B0HA 3FAPB 1SZIA 3WODF 5JT4A 2KGOA 2XLEA 1NU9C 2OKUA 1G5ZA 4NQFA 2W4BA 4JURI 5KYUA 1G4WR 5COMA 2NPUA 4O6YA 2PX3A 3ECSA 2NUTA 2EPMX 2PF4E 2LD6A 1APCA 2HV6A 1B68A 1Q0DA 1WWPA 1Z6AA 2GFHA 2OOCA 3C8ZA 2A6HF 4MS2A 1ORYA 4MW3A 3ZG1A 3ZWIA 4E18A 1RKCA 3JT1A 4LDQA 3AGTA 3QVYA 4YT2A 4MQ9F 4MVSA 3EH2A 3T6BA 5L0DA 3O39A 4UDVA 2GWWA 3F46A 3RVZA 1NFOA 5JP7A 1Y6DA 4C3BA 3B0VC 5KYYA 1E86A 3GWNA 4ULWA 1L7CA 2V3CC 2CNWA
chains in the Genus database with same CATH topology
2P1AA 2NSGA 2HKVA 2RD9A 3DI5A 3DKAA 2QE9A 3QTHA 2F22A 5COMA 5CIVA 2OU6A 2NSFA 3GORA 4N6CA 5COGA 2QNLA 1RXQA 5COFA 2YQYA 2OQMA 3CEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P1A A;  2NSG A;  2HKV A;  2RD9 A;  3DI5 A;  3DKA A;  2QE9 A;  3QTH A;  2F22 A;  5COM A;  5CIV A;  2OU6 A;  2NSF A;  3GOR A;  4N6C A;  5COG A;  2QNL A;  1RXQ A;  5COF A;  2YQY A;  2OQM A;  3CEX A; 
#chains in the Genus database with same CATH topology
 4CDA A;  2BC5 A;  4XWJ A;  5BUO A;  3KKB A;  4KNV A;  1FFT C;  2JX0 A;  2NSG A;  2Q9A A;  4JKV A;  1V54 C;  3W8H A;  4Z9I A;  1Q0F A;  2E87 A;  4JVS A;  1T01 A;  3N2Z B;  1EKY A;  2WZL A;  2IXN A;  2YLD A;  3QTH A;  3U3B A;  1U6H A;  3IQT A;  4JCH A;  3DAG A;  3VYW A;  3HLZ A;  1SMY F;  2J9U A;  5JUA A;  4BJ5 C;  3V5X A;  4LDK A;  2DI3 A;  4DVY P;  1QSP A;  4XLN F;  4EIY A;  3EFO A;  2P7V A;  5COG A;  1PD0 A;  5D91 A;  3RIP A;  1S05 A;  3GWL A;  5CI9 A;  4OIN F;  1DOW A;  1RXQ A;  4PFO A;  1IZM A;  4H54 A;  2L6F A;  4XEV A;  2Q7R A;  1WN0 A;  3TUL A;  4KC9 A;  3RQG A;  3FOO A;  1LVK A;  3UNG C;  5D92 A;  2OCC C;  2VB6 A;  3Q7L A;  4U9E A;  1KU2 A;  5T1D B;  2QUP A;  2XLD A;  1QKR A;  3QMK A;  4JC7 A;  5JSL A;  1A7V A;  2LQG A;  1VB5 A;  3EG9 A;  1VTM P;  2XLV A;  3C8G A;  3ZC4 A;  4MVM A;  3GOD A;  2H8A A;  2M4E A;  4M63 A;  1PV3 A;  2H7B A;  2R25 A;  3H2U A;  4OD5 A;  3K6B A;  4N06 A;  4JTD B;  2DYS C;  2MYS A;  2XXA A;  5CIV A;  1XZQ A;  5IY5 C;  5E3C A;  3Q7G A;  1I4Y A;  3MFN A;  2YZS A;  3GOR A;  2X0C A;  3C18 A;  4BEJ A;  1SYQ A;  2EIK C;  2DYR C;  3ABK C;  3N0T A;  4FAP B;  2NUP B;  2WL8 A;  3MLG A;  1MMG A;  3RF3 A;  4CJO A;  1WAS A;  4EHP A;  5FZT A;  5DS4 A;  1UG7 A;  2YRF A;  1M6T A;  1ZHX A;  2KQ9 A;  3EGX B;  3RKO F;  5B3S C;  1EQ1 A;  1ZU4 A;  2J0X A;  2LSE A;  3VF0 A;  4R32 A;  2R7T A;  3EZI A;  3U2L A;  1YAU O;  2HS5 A;  1JRA A;  1VYK A;  3W4Y A;  1E84 A;  4RBN A;  1ORJ A;  4JJF A;  1M2O A;  3FVY A;  3UR3 C;  4EUK B;  3M4B A;  2L7A A;  2YL3 A;  3K7D A;  1GQA A;  256B A;  4BJT A;  4OIP F;  2ZXW C;  2EIM C;  2VAS A;  1FTS A;  2F22 A;  3O6X A;  4HE8 D;  4W8K A;  2H7V C;  2HMQ A;  2TMV P;  1EA8 A;  3HNK A;  1MMA A;  1OW6 A;  1OR3 A;  4U5D E;  1HY5 A;  4EBJ A;  2YEV A;  4U5F E;  3W2V A;  2YLI A;  1RJ9 B;  1LPE A;  4K7B A;  3S27 A;  3JTL O;  2AWY A;  1VOM A;  2AVK A;  2ZXO A;  3ZSU A;  4C3D A;  4RD9 A;  1FR0 A;  1D0Z A;  1U89 A;  1AVO B;  5T3T A;  2Y3G A;  2Q00 A;  5F5F A;  1MMN A;  1LM3 B;  2XXA B;  3AOU A;  1T6I A;  2OQM A;  4NTF A;  2XL4 A;  5KYX B;  2R7V A;  5KYW A;  1TWG A;  1TWC A;  3AG1 C;  3WHN A;  1LIH A;  1C02 A;  2L6G A;  3NMK A;  5TJ5 E;  1K40 A;  2KC3 A;  2OG2 A;  4ULV A;  1OQC A;  1R4T A;  2PNO A;  4DRI B;  3ABL C;  2CDQ A;  4WJ0 A;  3CSK A;  3RVY A;  3UGP A;  1VYI A;  4AE4 B;  4XPX A;  1BR1 A;  2L6H A;  5E33 A;  5L3Q A;  4IAQ A;  2WVO A;  4EKW A;  2YL1 A;  4C7O A;  2IXP A;  2W4M A;  5B3I A;  4JEA A;  4O7G A;  3TD7 A;  4L6R A;  1W2W A;  2J9B A;  3AJM A;  1BR2 A;  2CCY A;  4YN0 B;  1LS1 A;  3GM2 A;  2XL8 A;  1A41 A;  1LI5 A;  4GQH A;  5A6A A;  1TFO B;  3IPM O;  2V26 A;  5JVE A;  3DM9 B;  1KTM A;  2JD3 A;  4LER A;  3TQO A;  3A11 A;  4JTA B;  2YL0 A;  1WTY A;  2C04 A;  3JSE O;  2VCB A;  4U5E E;  3VM6 A;  2VCA A;  4C3E A;  2XM0 A;  3U9M A;  1D1C A;  2OJQ A;  4ER9 A;  4G7H F;  3KPH A;  4IJJ A;  3ITF A;  1QPU A;  4CDV A;  1A7D A;  2MWQ A;  4JEB A;  5DQZ A;  2VCC A;  1OW7 A;  4DRH B;  2YVK A;  3AGU A;  3QW0 A;  2I8B A;  2XLM A;  3HNI A;  4DOZ A;  3U8V A;  4YT4 A;  2KW3 C;  3I4U A;  1HW2 A;  2R7S A;  1RKE B;  5DQT A;  1H9T A;  1LE2 A;  3C63 A;  4CIP A;  1YA7 O;  2LFF A;  2IBF A;  2XSE A;  3RQF A;  2JPU A;  1WGW A;  4IRU A;  1BBH A;  1LE4 A;  3CEX A;  4HEA J;  1CPR A;  1D0Y A;  3W8I A;  3QVZ A;  4MTF A;  3RYL A;  4ANJ A;  1BDJ B;  4G78 A;  4O79 A;  2IYL D;  4YT8 A;  1V55 C;  1Z5Z A;  2D5R B;  2HKV A;  3CZ6 A;  3JSZ A;  2Q9B A;  2RD9 A;  3HKK A;  2X51 A;  3LLI A;  4LLE A;  1RCP A;  2PFD A;  3B71 A;  3M1C B;  4XPY A;  4YJW A;  4CS9 A;  2XLH A;  3KMI A;  3J06 A;  4PJN A;  3MYI A;  1TWH A;  4U5B E;  2PP4 A;  3B9Q A;  4JIO A;  5L0J A;  4DVZ A;  3GEH A;  4JJG A;  1M57 C;  3AG2 C;  3LUT B;  1OW8 A;  2FFH A;  1S7Z A;  3SYN A;  3EPV A;  3GEI A;  3TJ6 A;  3VAY A;  4I1O B;  5A6K A;  3S0X A;  3RQE A;  1M56 C;  1O5H A;  2HFI A;  3FOP A;  2R7W A;  2J9V A;  3M4C A;  2B0J A;  4MW8 A;  5JRA A;  1F1M A;  4IAR A;  3U2M A;  1ORS C;  4DRJ B;  2J7P A;  2D4U A;  3Q6M A;  3LS1 A;  2P1A A;  2GAQ A;  2XLO A;  1YZC A;  5AC4 A;  5EGY A;  3B29 A;  2Y39 A;  2XS1 A;  1OKK A;  1KNY A;  1YLM A;  1LI7 A;  4P9F A;  3ZQV A;  2HJM A;  4GEH A;  4BG0 A;  4E7Z A;  4E0H A;  4A4A A;  4HFK B;  3OEO A;  2IM8 A;  2A0U A;  2LIG A;  2VC9 A;  4CS8 A;  2KK1 A;  4JE9 A;  2J45 A;  3X1O A;  3WAQ A;  4MND A;  4ZLD A;  2DB4 A;  3UMH A;  3DJN B;  1NFN A;  2Q3T A;  1YDI A;  3UMK A;  3ZIB A;  2KSF A;  2AP3 A;  2QNL A;  5BQH A;  5AGF A;  2ZXR A;  1YA9 A;  4LLC A;  4P6I C;  3RH3 A;  3U3F A;  2Q9C A;  4W8P A;  3T6J A;  5L0I A;  3S90 A;  4Q5S F;  1OCC C;  3NDB B;  5COF A;  4PFP A;  1T6U A;  4MVQ A;  1FMV A;  1J8M F;  2Y3H A;  4NTA A;  5T3W A;  1IW7 F;  1LKX A;  2LCH A;  3C62 A;  3IQ5 A;  2DGJ A;  4NCQ A;  3N24 A;  2A69 F;  1Z23 A;  3CAX A;  3DI5 A;  3DKA A;  3GAN A;  4O6M A;  5KYN A;  1Z63 A;  3PCV A;  3NYJ A;  1ZVZ A;  3UGO A;  2O9X A;  3R2P A;  4B6I A;  5A6J A;  3AQC A;  1OCR C;  3V5Y A;  4IAO A;  2UUH A;  1VMA A;  4CDY A;  1Y4C A;  3JZ0 A;  2YHS A;  4FWV A;  3SXY A;  1M2V B;  2HJ3 A;  2LFD A;  1PCX A;  2J8W A;  2OEV A;  3WG7 C;  5JS5 A;  2NSF A;  3EGD B;  3H65 A;  1OCZ C;  3NMI A;  4PJJ A;  4BPM A;  4LAC B;  1CPQ A;  1V74 B;  3QW1 A;  1YZA A;  2UUI A;  3LS0 A;  2Y69 C;  4EBK A;  3G4Z A;  4JRZ A;  3JYY A;  1FAP B;  3DXJ F;  3OA1 A;  4MVR A;  4O6N A;  1E83 A;  4MVZ A;  4MVO A;  3ZVR A;  3JRT A;  2EIN C;  1BZ4 A;  2WVN A;  4CS9 C;  3GM3 A;  1ZHZ A;  3B0P A;  2AWC A;  3PDM P;  2GA0 A;  2CGE A;  1ZW3 A;  4XLP F;  1K05 A;  2LK4 A;  3RW0 A;  3W2W A;  1ST6 A;  2G62 A;  3KYI A;  3RFY A;  5A6B D;  4QI0 A;  3MYF A;  3L34 A;  4MTG A;  4HFF B;  2NUP A;  2QY9 A;  2WB7 A;  3V5Z A;  2HV7 A;  3KH2 A;  2R9R B;  3DE8 A;  2XS8 A;  3UMI A;  1O3U A;  1MMD A;  5E2Q A;  3MBG A;  3IEE A;  5FCL A;  3EGX A;  1N1C A;  3L8J A;  5B1B C;  4ZLC A;  4RDA A;  4WGY A;  2EIL C;  3LLK A;  1JR8 A;  5KYU B;  2LP4 A;  3AG3 C;  1HE9 A;  4PAC A;  2RSE B;  3SEO A;  4CIH A;  2R03 A;  5HSW A;  1SR2 A;  3K1I A;  2EPK X;  2YQY A;  2W45 A;  3LEO A;  3T4R A;  1ZHW A;  3MX3 A;  2CNW D;  2NUT B;  4J7Y A;  3SNH A;  4CS8 C;  2ZD9 A;  3ZTZ A;  4YWQ A;  2L81 A;  4XTK A;  1WAT A;  3L1M A;  2XRH A;  4AL1 A;  2BL2 A;  3K66 A;  4YL0 A;  3NKD A;  4PR9 A;  3SXZ A;  1RJ9 A;  4E17 A;  1E85 A;  2FGY A;  3ZQY A;  2R7U A;  3PMR A;  3JRM O;  1I4Z A;  2XM4 A;  3ATP A;  3DMD A;  3HNL A;  3IHU A;  3POV A;  1ZHY A;  4NY3 A;  4E7S A;  5KYY B;  5L0G A;  5BQI A;  1OXB A;  4XEK A;  2PX0 A;  1Z7Q c;  2QLA A;  4YT5 A;  2WZF A;  5KYX A;  4CSA A;  4N6C A;  5F5H A;  3ABM C;  3IQ6 A;  4WGZ A;  1OXK A;  1T9K A;  3EHM A;  3JYH A;  4PJM A;  4AK9 A;  4FES A;  2Z15 A;  5F28 E;  2KYH A;  3HJC A;  3F47 A;  1RMV A;  4MTO A;  4YL3 A;  2XL6 A;  3DJU B;  2HUJ A;  3HTK C;  3L8I A;  1C03 A;  2ASR A;  2MHR A;  4OD4 A;  2R7X A;  4CS7 A;  2ZXP A;  4MVU A;  4AE4 A;  2C03 A;  3K33 A;  2A6E F;  5DLJ A;  2R05 A;  5EHH A;  3C8G D;  4XPW A;  3TK0 A;  3ASN C;  2FAP B;  3ZTM A;  2YWA A;  4WAB A;  3FDQ A;  1FMW A;  1H7I A;  3KL4 A;  3AQB A;  4G7Z F;  3G50 A;  1ZU5 A;  5B1A C;  3DWW A;  4IB4 A;  2G3K A;  1FNT c;  4AL0 A;  1YYX A;  4OIR F;  3FMS A;  4IWB A;  3OWT A;  4G7O F;  3I5Q A;  1JPN A;  2R7Q A;  3EZH A;  3LES A;  2OU6 A;  3BEH A;  3ASO C;  1TQG A;  3AG4 C;  2G3V A;  3NMJ A;  5GPG B;  1J8Y F;  3EG9 B;  3S9O A;  3V7O A;  4YK5 A;  1VLS A;  3C8G B;  3EH1 A;  3IQC A;  3S29 A;  3T6G B;  1C17 M;  1TFK B;  3FXH A;  4JZA A;  4D4X A;  3EHN A;  1G4U S;  1QLE C;  3EJN A;  1YAR O;  2HSB A;  2L9J A;  3KYJ A;  1TKN A;  4JW1 A;  2YLG A;  2IXM A;  3SP1 A;  2A1D D;  4OIQ F;  1U0B B;  3DM5 A;  1JMW A;  1TWA A;  4BEM J;  2AU5 A;  5DS5 A;  3B0U X;  1E2X A;  2HSQ A;  4J7T A;  1SF8 A;  1A0B A;  5A6B A;  4CBE A;  3NG1 A;  1I5N A;  1XWJ A;  2Q4F A;  3M79 A;  3O55 A;  1MNE A;  1H6G A;  2HZ8 A;  1RKE A;  3PHF 2;  4K0D A;  2WZG A;  4Z9J A;  3K1I C;  4AX2 A;  3S84 A;  3NKE A;  1HMD A;  3BRJ A;  2OEX A;  3A9C A;  3R7C A;  2I15 A;  1HMO A;  1T6Q A;  3E70 C;  3HNJ A;  3QZC A;  4LDR A;  3SXK A;  4DXW A;  1BR4 A;  5L0C A;  2ETS A;  4U5G A;  1Z3I X;  1D0X A;  3JCU Q;  4CX9 A;  3GEE A;  2YL7 A;  1OCO C;  1GS9 A;  1XZP A;  2P6V A;  1ZW2 A;  1ZZP A;  2BE5 F;  1JOG A;  1NSG B;  2ICW G;  2P61 A;  5HV9 A;  4N6H A;  4KI2 A;  3U9J A;  4Q7C A;  4DBQ A;  4CSA C;  4Q4Z F;  3US6 A;  4I44 A;  1QZX A;  2R7R A;  1H9G A;  4NC3 A;  4N4W A;  5EK0 A;  5L3V A;  4DJ9 A;  1HW1 A;  3GM1 A;  1GM5 A;  4OIO F;  1ZHT A;  3C7J A;  3DAF A;  3ZDL A;  4J32 B;  1L3P A;  3H2V A;  1CGM E;  4A2N B;  3EQL F;  2VH3 A;  4BJ6 A;  5KYW B;  1CGO A;  2R02 A;  1UFB A;  3O10 A;  4Z9H A;  4H4K C;  3DZA A;  3FAJ A;  2XLW A;  2HMZ A;  2J0W A;  1AUE A;  2M64 A;  3NYM A;  3TJ5 A;  4KBL A;  2CW0 F;  3LNR A;  2PBE A;  1OR2 A;  3S28 A;  1Q0G A;  3FHD A;  2P0N A;  4EBB A;  1CGN A;  3SZR A;  1K04 A;  3DE9 A;  4QDL A;  1MQV A;  1D1B A;  2WVQ A;  4C7O B;  1EI7 A;  2QTV A;  3LAY A;  4CJG A;  1JAF A;  1R5I D;  4P9T A;  3LEV A;  3M15 A;  2QE9 A;  2Y3D A;  3L0I A;  4PK4 A;  5L0H A;  2IXO A;  1G8X A;  2J46 A;  4DBR A;  1GGQ A;  2J9W A;  1NZE A;  3CQZ A;  1VK5 A;  3NYL A;  4J30 B;  3DD7 A;  5JLI A;  3E9V A;  3U0C A;  5DS6 A;  1DOV A;  4QI2 A;  2OJE D;  4PJL A;  1HE1 A;  2EPO A;  2IOQ A;  3TOM A;  4JCZ A;  4U5C E;  2A68 F;  3Q6N A;  3I5P A;  1NLX A;  2EIJ C;  4I3M A;  2R7O A;  4IGG A;  3SXM A;  3U8P A;  4E0I A;  5L0F A;  1VLT A;  1A7E A;  1FFH A;  2EPL X;  3LJB A;  4GYT A;  2NG1 A;  3T9O A;  1ZYR F;  5CI8 A;  5E3A A;  3NRH A;  1M2V A;  3VRC A;  4BJ5 A;  2ZPA A;  5K0I A;  4EWC A;  4X0R A;  3EGD A;  1YJG A;  4NTB A;  1TR2 A;  3G4X A;  1MND A;  1QQ3 A;  4G0H A;  5A69 A;  3K1H A;  2GDC A;  3TOL A;  4U9D A;  2YKZ A;  4U5H A;  4FX5 A;  5DVW A;  4JTC B;  4I1M A;  2Y3B A;  2CYD A;  3LNM B;  3U5S A;  1O87 A;  4D4N A;  1LS4 A;  2H7O A;  1YVI A;  2KNH A;  1V4A A;  4F4B A;  4YL1 A;  1PD1 A;  1Q0M A;  1Q0K A;  3X2Q C;  4XQ1 A;  2KJG A;  4XEF A;  2W9Y A;  1NG1 A;  1QVX A;  2J7P D;  4KNW A;  1JPJ A;  4ONS A;  1NU7 D;  1NBB A;  4BJ6 C;  1AEP A;  4BJ1 A;  4K1O A;  1YYJ A;  2A0B A;  2EPN A;  1OKK D;  3EFO B;  5AC5 A;  1D1A A;  1T5O A;  5BQG A;  1WOL A;  2B0H A;  3FAP B;  1SZI A;  3WOD F;  5JT4 A;  2KGO A;  2XLE A;  1NU9 C;  2OKU A;  1G5Z A;  4NQF A;  2W4B A;  4JUR I;  5KYU A;  1G4W R;  5COM A;  2NPU A;  4O6Y A;  2PX3 A;  3ECS A;  2NUT A;  2EPM X;  2PF4 E;  2LD6 A;  1APC A;  2HV6 A;  1B68 A;  1Q0D A;  1WWP A;  1Z6A A;  2GFH A;  2OOC A;  3C8Z A;  2A6H F;  4MS2 A;  1ORY A;  4MW3 A;  3ZG1 A;  3ZWI A;  4E18 A;  1RKC A;  3JT1 A;  4LDQ A;  3AGT A;  3QVY A;  4YT2 A;  4MQ9 F;  4MVS A;  3EH2 A;  3T6B A;  5L0D A;  3O39 A;  4UDV A;  2GWW A;  3F46 A;  3RVZ A;  1NFO A;  5JP7 A;  1Y6D A;  4C3B A;  3B0V C;  5KYY A;  1E86 A;  3GWN A;  4ULW A;  1L7C A;  2V3C C;  2CNW A; 
#chains in the Genus database with same CATH homology
 2P1A A;  2NSG A;  2HKV A;  2RD9 A;  3DI5 A;  3DKA A;  2QE9 A;  3QTH A;  2F22 A;  5COM A;  5CIV A;  2OU6 A;  2NSF A;  3GOR A;  4N6C A;  5COG A;  2QNL A;  1RXQ A;  5COF A;  2YQY A;  2OQM A;  3CEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...