2QE9A

Crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
171
structure length
165
Chain Sequence
HHHHHENLYFQGMMKFFEYNWQVRDQWFTWCHQLTTEELLKNRLGGVENILYTLFHIIDVEYSWIRAIQGKEDIAVQFADYQTLNKVKSLSNTFRTEIIDVLQTHELVSVPWETGVLYTRDEILHHIIAHEIHHIGQLSVWARELKLSPVSASFIGRTLKPIHSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein BSU10800 (YP_054576.1) from Bacillus subtilis at 1.90 A resolution
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Uncharacterized protein yizA
total genus 53
structure length 165
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05163 DinB DinB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2qe9A01
4N6CA 5COGA 2NSFA 2HKVA 2YQYA 2QNLA 5COMA 3GORA 3QTHA 2F22A 2OQMA 5COFA 2OU6A 2P1AA 3CEXA 1RXQA 3DI5A 3DKAA 2RD9A 5CIVA 2NSGA 2QE9A
chains in the Genus database with same CATH superfamily
3AQCA 1K04A 1BBHA 4N6CA 4CJGA 4E0HA 3I4UA 2YLGA 5AC4A 3O55A 5TJ5E 4GQHA 1OKKA 2J7PA 4MVSA 3LLKA 2WVQA 3C8GB 2D5RB 4BPMA 3U9MA 5DQTA 5L0GA 2XS1A 3I5PA 2XXAB 1RKEA 3EHMA 1G5ZA 2XL4A 2JD3A 3V5XA 2QUPA 1YZCA 3QW1A 5DS4A 1G4US 3ZG1A 3SP1A 1D1BA 4ONSA 1LE4A 1QPUA 3HNKA 3CEXA 1B68A 4CSAA 3K6BA 2Q9AA 4QI0A 3EH1A 2XLWA 4W8KA 3POVA 4MVUA 3X1OA 3QMKA 4ANJA 2IXMA 2A68F 3RVZA 5A6BA 2AWYA 3GM3A 1QLEC 4E0IA 1EKYA 3ECSA 1GM5A 2UUHA 4LLEA 4KBLA 1BR1A 4O7GA 3N0TA 4MVZA 1PD0A 2HKVA 3K1IA 1VTMP 1OCOC 1YDIA 4ULWA 1Z5ZA 2NUTB 3LNMB 2A0BA 2Y69C 4N4WA 4QDLA 3B0UX 4IAOA 3EH2A 2H7OA 4K1OA 1WWPA 4JCZA 2R7VA 3GEHA 1D0XA 2CCYA 4HE8D 4C3BA 4MVOA 4JJGA 1WTYA 2R7QA 4DJ9A 1TWAA 3Q7LA 4DBQA 2R7XA 3WODF 2AWCA 1YYXA 2L6GA 3L1MA 4CS9C 2VCBA 1V4AA 3PDMP 5D92A 4OIPF 1IW7F 4PFPA 3DM9B 2RD9A 4O6YA 1CPQA 3W8HA 3NYJA 2OJED 1RCPA 3EQLF 3FDQA 4JIOA 4CDYA 3K1HA 2LQGA 2ZXWC 2DB4A 3DJNB 1KNYA 1LPEA 4CS9A 3DAFA 3T6GB 1ORYA 2CNWA 3KKBA 2EPNA 3RIPA 3ZC4A 3G4XA 3U9JA 1SYQA 1Z6AA 1G8XA 1D0ZA 1WASA 3QVYA 1SF8A 2H7BA 4AE4A 1DOWA 3FXHA 1QQ3A 3KYJA 2IM8A 4MTOA 2OG2A 1WOLA 1J8YF 4LDRA 3S29A 2HFIA 4XEKA 4EBBA 2ASRA 3PMRA 1TQGA 1EI7A 1EA8A 3AG3C 3O6XA 4P6IC 1NG1A 1WN0A 4HFKB 3S9OA 1BZ4A 5EK0A 2GFHA 3LS0A 4OINF 1HY5A 3M4CA 4JCHA 2IYLD 2Q00A 1BDJB 5JVEA 3AOUA 3K1IC 1Z23A 2OCCC 2KGOA 4CIHA 2P6VA 3QVZA 1TKNA 3AJMA 4JURI 4J7TA 3X2QC 2YLDA 4N06A 3KH2A 1NZEA 1XWJA 3LESA 3M79A 3ZIBA 1FAPB 2LK4A 4BJ5C 1CGME 2D4UA 1NFOA 2BC5A 3W2VA 2NUPA 2HJ3A 2F22A 2WZLA 4MTGA 3RKOF 2XLMA 2MWQA 3IQCA 4C7OA 2L81A 2GDCA 3DE9A 4MW3A 2R9RB 2R02A 3IPMO 4JKVA 4LDKA 2YWAA 2VC9A 3N2ZB 4EWCA 5EHHA 1TWCA 4G78A 1HE1A 1RKCA 3NRHA 4PFOA 3WG7C 4B6IA 2EIKC 4I1OB 3GWNA 2HSQA 3H2VA 3PHF2 1OKKD 3B71A 4Z9IA 2HV7A 4CS7A 3A11A 256BA 2OKUA 3NMKA 3Q6NA 4JE9A 4DRIB 3L8JA 5JUAA 1E84A 1FNTc 3TJ6A 1BR4A 5JSLA 3UNGC 3JYHA 3EG9A 2LSEA 3HLZA 2YLIA 3RH3A 4DXWA 2IOQA 2KC3A 3K66A 2A6HF 1CGNA 3W2WA 4BJ6A 5GPGB 2LD6A 1ZW2A 5K0IA 1K40A 1PD1A 2FAPB 3FMSA 4XPYA 1A41A 1JPJA 3DAGA 3TJ5A 1FR0A 2EPMX 3Q7GA 2YL0A 3NYLA 2XLDA 3DXJF 3V5YA 3E70C 4NCQA 1TWGA 2QE9A 4CBEA 2J9WA 2KW3C 2AP3A 2L6FA 4JTDB 5T3WA 4ZLCA 3EZHA 2GAQA 1O87A 2H7VC 2J45A 1H7IA 5FCLA 2PF4E 2YVKA 1Q0DA 2VCAA 1AEPA 4H54A 1PV3A 1OXKA 1SMYF 3ASNC 4MW8A 2R7SA 2Q9CA 4HEAJ 4XTKA 2R05A 5L0HA 2WVNA 1GS9A 2C04A 3HKKA 1LI5A 4MVMA 4IJJA 3ZTZA 4ER9A 2L7AA 4MTFA 2HSBA 3O10A 1OW6A 1I5NA 1NU7D 1FFTC 1BR2A 3EZIA 3FOPA 4GYTA 2HJMA 5KYXA 3ZQYA 5E2QA 4GEHA 5HV9A 1NBBA 4UDVA 5KYYA 2OU6A 5DS6A 2X51A 2ZXRA 4DVZA 2GWWA 2E87A 4E18A 4G0HA 1APCA 1JMWA 4JRZA 4NC3A 5KYYB 2HV6A 3UMIA 2FGYA 5HSWA 3ABMC 4KI2A 2WZFA 3B0PA 1A7DA 2PBEA 1HMOA 4I44A 4JW1A 3RVYA 4CIPA 1M2OA 5F5FA 1T9KA 4F4BA 2EPOA 3KYIA 4ZLDA 1YZAA 5L3VA 2OJQA 2HMQA 5L0DA 1OR3A 2NSFA 2PX3A 2I15A 2W4BA 5B1BC 2UUIA 2YEVA 4BJ6C 1NSGB 2WVOA 3FOOA 4MQ9F 2NUPB 4OIRF 5A6JA 2O9XA 1H9TA 2Q4FA 5A6AA 4JVSA 3RQEA 3QTHA 3LJBA 3Q6MA 4RDAA 3FVYA 4YWQA 4DBRA 2J7PD 1Q0FA 5L0IA 2P61A 1ZU4A 1RKEB 1NFNA 3TK0A 5BQHA 3NMIA 3CAXA 3ZVRA 2J9BA 1M57C 2YL7A 3O39A 1L3PA 5D91A 4FWVA 3U3BA 4BJTA 4KC9A 5JRAA 4Q5SF 1J8MF 2HZ8A 3K33A 2LFDA 3ITFA 4U5CE 2DI3A 5KYUA 3U8VA 3V7OA 2KK1A 2IXPA 3E9VA 3JZ0A 1A0BA 4EBKA 5IY5C 1Q0KA 4W8PA 3AQBA 2Y3GA 3C8ZA 2LFFA 2YRFA 2WZGA 3AGTA 2ICWG 3EG9B 2Y3HA 5DLJA 2FFHA 1OCCC 3UMHA 4A2NB 3T6BA 3VM6A 1LE2A 5DS5A 1MQVA 5L0CA 4JEBA 1ZVZA 3NKDA 5B3IA 1MMGA 1E85A 4CDVA 2B0HA 4U5EE 3U8PA 1T01A 3GM1A 2EILC 2Y39A 1HE9A 1YLMA 3EHNA 1AUEA 5L3QA 3MYFA 2A0UA 4K0DA 3IQ5A 2NPUA 3LAYA 2W9YA 4JC7A 4XWJA 4EBJA 3GANA 1R4TA 1OCRC 1R5ID 3F47A 3SYNA 3KMIA 3VYWA 1V54C 2W45A 4KNWA 1YYJA 2A1DD 3G50A 1YAUO 4FESA 2ZD9A 3TOMA 2LIGA 5JS5A 1TFKB 4XQ1A 2L6HA 1D0YA 3ZSUA 3W4YA 3TD7A 4C7OB 2PFDA 5DVWA 2DYSC 2R7TA 1H9GA 5JP7A 2JX0A 3TULA 3SXZA 3FAJA 2XLEA 4O6NA 2J0WA 4OIOF 1AVOB 2J9VA 2LCHA 2QTVA 2YHSA 2MYSA 1VB5A 2V26A 1C02A 1TFOB 2DGJA 3DZAA 4IRUA 2J8WA 5AGFA 3HTKC 3CSKA 5CIVA 1C03A 3NYMA 4PACA 4XPXA 2CNWD 3T4RA 1UFBA 3ZWIA 3TOLA 2P7VA 4WGYA 4D4NA 4DRJB 3ZDLA 5B3SC 1YJGA 3AGUA 3JRMO 2ZPAA 4LDQA 4J7YA 3JYYA 5KYWA 3VRCA 5E3CA 3LS1A 1FFHA 3A9CA 4PJMA 3C62A 2KJGA 2KYHA 2QNLA 3SNHA 4YT8A 4YK5A 3DD7A 4G7OF 4RD9A 3GM2A 1SZIA 3G4ZA 1OCZC 1MNEA 4CDAA 4IB4A 4Q4ZF 2B0JA 3EGXB 3OWTA 2XLHA 2EPLX 4YN0B 4QI2A 3LLIA 4O79A 3LNRA 3AG4C 2M4EA 4U5BE 3EGDB 3FAPB 3DKAA 5KYUB 3S28A 2JPUA 3U2LA 1VYKA 1U89A 3U2MA 4CX9A 4FAPB 3SZRA 1Y6DA 3GODA 4XEVA 4I3MA 1T5OA 1ZHXA 1DOVA 1H6GA 1OW8A 1KU2A 2AU5A 3MFNA 3RFYA 3L0IA 2P0NA 1YARO 1C17M 4U9DA 3RYLA 3NMJA 3PCVA 4YT5A 2XXAA 2PX0A 1FMWA 2KQ9A 2XL8A 2C03A 3EFOA 5CI8A 3AG1C 2PNOA 2WL8A 1LKXA 1ZHYA 3C8GD 3JT1A 4IAQA 1Z7Qc 1I4YA 2VH3A 3GORA 3NG1A 4N6HA 3DM5A 2YKZA 4G7ZF 4D4XA 2V3CC 1VOMA 4LERA 1KTMA 2L9JA 4MVRA 3OA1A 1E86A 3C18A 1ZYRF 3FHDA 4AE4B 3US6A 3LUTB 3OEOA 2YL1A 1ZZPA 4EIYA 3SXYA 4LACB 1LS4A 2R7WA 2QLAA 4Z9JA 1WGWA 1O5HA 2KSFA 2XLVA 1RMVA 1JPNA 5B1AC 3J06A 5AC5A 3AG2C 3DMDA 4OD4A 2A69F 1VK5A 1LS1A 3EGDA 3I5QA 1FMVA 1XZPA 3N24A 2NUTA 3UMKA 4AK9A 5CI9A 3U0CA 1JR8A 1TR2A 2OOCA 2VASA 3S90A 1M6TA 2EINC 4PK4A 3QW0A 4KNVA 4BEMJ 1ZHZA 4XPWA 4C3EA 5BQIA 2W4MA 3S0XA 4PJNA 4MS2A 1F1MA 4CJOA 1VYIA 2EIJC 2MHRA 4U5DE 3RF3A 1V55C 2VCCA 5F5HA 2CGEA 5FZTA 1QKRA 1MMNA 4U5GA 3S27A 2YL3A 4NTBA 4LLCA 1QZXA 1I4ZA 2Y3DA 1HW2A 4U5FE 2J0XA 2Y3BA 4P9FA 4EKWA 1L7CA 4K7BA 5A69A 2H8AA 2R7OA 2NSGA 4PR9A 1ST6A 3HJCA 4WABA 2G3VA 4CS8C 4E7SA 3M4BA 4M63A 1TWHA 1FTSA 3ABLC 5BUOA 4MVQA 3RQFA 1RJ9B 3R2PA 2X0CA 2XLOA 1GQAA 2ZXPA 5JT4A 3UGOA 1OQCA 1NU9C 3EJNA 4E7ZA 3EPVA 1Z63A 1LM3B 4JTAB 3SXKA 1OW7A 2BE5F 4IWBA 2R7RA 3K7DA 1S7ZA 3EGXA 3H2UA 1JOGA 2LP4A 4IGGA 1WATA 2CYDA 1HW1A 3ZTMA 1Q0GA 3L8IA 4JEAA 1D1CA 5DQZA 1XZQA 1PCXA 1ZHWA 3T9OA 1E83A 4G7HF 4XLNF 3T6JA 1JRAA 2NG1A 5KYNA 1ZHTA 3IQTA 4X0RA 1YA7O 1O3UA 3LEOA 4OD5A 3L34A 4WJ0A 2I8BA 3C7JA 2YZSA 2A6EF 3ASOC 2OEXA 3DWWA 2ETSA 3U3FA 5EGYA 4Z9HA 4I1MA 1EQ1A 4ULVA 1OR2A 2J9UA 2Q9BA 2VB6A 4JTCB 3WHNA 5COGA 3HNJA 4J32B 5KYXB 2DYRC 3JSZA 4YL0A 3JSEO 1JAFA 1MNDA 2G3KA 4XLPF 3S84A 3MYIA 3RQGA 1CGOA 2IBFA 2HS5A 3CZ6A 4H4KC 3F46A 5KYWB 2PP4A 2OQMA 1S05A 4WGZA 2Z15A 3DJUB 3RW0A 2AVKA 4CSAC 4BG0A 1M56C 3M1CB 5E3AA 5T3TA 4HFFB 4P9TA 4YJWA 3B9QA 1RJ9A 2R7UA 3HNIA 3KPHA 1SR2A 1V74B 4CS8A 4O6MA 4NY3A 5E33A 3B0VC 1NLXA 2EPKX 2HUJA 4A4AA 1VLSA 1VMAA 3GEEA 3NDBB 3B29A 1ORJA 3GWLA 3MLGA 1YVIA 1YA9A 2XM4A 2YQYA 3GEIA 3H65A 3LEVA 4XEFA 4J30B 1MMAA 4NQFA 3UR3C 3ZQVA 2TMVP 1M2VB 1D1AA 2IXNA 1CPRA 1T6QA 3U5SA 3VF0A 1IZMA 2RSEB 1QVXA 3IEEA 1Z3IX 1M2VA 3JTLO 4PJJA 1HMDA 1LIHA 4L6RA 3JCUQ 2KNHA 1OXBA 1ZW3A 3ABKC 3C8GA 3MBGA 3JRTA 5A6KA 5F28E 1A7VA 1GGQA 1QSPA 1RXQA 3R7CA 4BJ1A 4JJFA 4DRHB 5L0JA 3QZCA 4EUKB 2XM0A 2R25A 2J46A 2XL6A 5T1DB 3IHUA 1MMDA 3BRJA 3EFOB 4FX5A 4YL1A 3SXMA 4DOZA 4MNDA 4NTAA 1LVKA 2IXOA 3SEOA 3M15A 2GA0A 3HNLA 3VAYA 5L0FA 4YL3A 2XS8A 3W8IA 1T6UA 4NTFA 2ZXOA 3UGPA 2OEVA 3CQZA 4R32A 3MX3A 2CDQA 4BEJA 3TQOA 4EHPA 4RBNA 2R03A 1E2XA 3NKEA 3WAQA 4U9EA 4AL0A 5COMA 2XRHA 1UG7A 4AL1A 3BEHA 4BJ5A 3KL4A 4OIQF 1LI7A 1A7EA 1ORSC 1U6HA 4IARA 2HMZA 4E17A 1Q0MA 5COFA 1K05A 3ATPA 3C63A 2P1AA 4Q7CA 1VLTA 1G4WR 2Q7RA 4DVYP 4JZAA 5A6BD 2WB7A 2XSEA 4YT4A 5JLIA 2EIMC 1W2WA 1ZU5A 5BQGA 2BL2A 2Q3TA 2QY9A 3DI5A 2M64A 2G62A 2CW0F 1Y4CA 3V5ZA 4C3DA 3DE8A 4PJLA 1N1CA 4U5HA 3IQ6A 4YT2A 1T6IA 1U0BB 4AX2A
chains in the Genus database with same CATH topology
4N6CA 5COGA 2NSFA 2HKVA 2YQYA 2QNLA 5COMA 3GORA 3QTHA 2F22A 2OQMA 5COFA 2OU6A 2P1AA 3CEXA 1RXQA 3DI5A 3DKAA 2RD9A 5CIVA 2NSGA 2QE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6C A;  5COG A;  2NSF A;  2HKV A;  2YQY A;  2QNL A;  5COM A;  3GOR A;  3QTH A;  2F22 A;  2OQM A;  5COF A;  2OU6 A;  2P1A A;  3CEX A;  1RXQ A;  3DI5 A;  3DKA A;  2RD9 A;  5CIV A;  2NSG A;  2QE9 A; 
#chains in the Genus database with same CATH topology
 3AQC A;  1K04 A;  1BBH A;  4N6C A;  4CJG A;  4E0H A;  3I4U A;  2YLG A;  5AC4 A;  3O55 A;  5TJ5 E;  4GQH A;  1OKK A;  2J7P A;  4MVS A;  3LLK A;  2WVQ A;  3C8G B;  2D5R B;  4BPM A;  3U9M A;  5DQT A;  5L0G A;  2XS1 A;  3I5P A;  2XXA B;  1RKE A;  3EHM A;  1G5Z A;  2XL4 A;  2JD3 A;  3V5X A;  2QUP A;  1YZC A;  3QW1 A;  5DS4 A;  1G4U S;  3ZG1 A;  3SP1 A;  1D1B A;  4ONS A;  1LE4 A;  1QPU A;  3HNK A;  3CEX A;  1B68 A;  4CSA A;  3K6B A;  2Q9A A;  4QI0 A;  3EH1 A;  2XLW A;  4W8K A;  3POV A;  4MVU A;  3X1O A;  3QMK A;  4ANJ A;  2IXM A;  2A68 F;  3RVZ A;  5A6B A;  2AWY A;  3GM3 A;  1QLE C;  4E0I A;  1EKY A;  3ECS A;  1GM5 A;  2UUH A;  4LLE A;  4KBL A;  1BR1 A;  4O7G A;  3N0T A;  4MVZ A;  1PD0 A;  2HKV A;  3K1I A;  1VTM P;  1OCO C;  1YDI A;  4ULW A;  1Z5Z A;  2NUT B;  3LNM B;  2A0B A;  2Y69 C;  4N4W A;  4QDL A;  3B0U X;  4IAO A;  3EH2 A;  2H7O A;  4K1O A;  1WWP A;  4JCZ A;  2R7V A;  3GEH A;  1D0X A;  2CCY A;  4HE8 D;  4C3B A;  4MVO A;  4JJG A;  1WTY A;  2R7Q A;  4DJ9 A;  1TWA A;  3Q7L A;  4DBQ A;  2R7X A;  3WOD F;  2AWC A;  1YYX A;  2L6G A;  3L1M A;  4CS9 C;  2VCB A;  1V4A A;  3PDM P;  5D92 A;  4OIP F;  1IW7 F;  4PFP A;  3DM9 B;  2RD9 A;  4O6Y A;  1CPQ A;  3W8H A;  3NYJ A;  2OJE D;  1RCP A;  3EQL F;  3FDQ A;  4JIO A;  4CDY A;  3K1H A;  2LQG A;  2ZXW C;  2DB4 A;  3DJN B;  1KNY A;  1LPE A;  4CS9 A;  3DAF A;  3T6G B;  1ORY A;  2CNW A;  3KKB A;  2EPN A;  3RIP A;  3ZC4 A;  3G4X A;  3U9J A;  1SYQ A;  1Z6A A;  1G8X A;  1D0Z A;  1WAS A;  3QVY A;  1SF8 A;  2H7B A;  4AE4 A;  1DOW A;  3FXH A;  1QQ3 A;  3KYJ A;  2IM8 A;  4MTO A;  2OG2 A;  1WOL A;  1J8Y F;  4LDR A;  3S29 A;  2HFI A;  4XEK A;  4EBB A;  2ASR A;  3PMR A;  1TQG A;  1EI7 A;  1EA8 A;  3AG3 C;  3O6X A;  4P6I C;  1NG1 A;  1WN0 A;  4HFK B;  3S9O A;  1BZ4 A;  5EK0 A;  2GFH A;  3LS0 A;  4OIN F;  1HY5 A;  3M4C A;  4JCH A;  2IYL D;  2Q00 A;  1BDJ B;  5JVE A;  3AOU A;  3K1I C;  1Z23 A;  2OCC C;  2KGO A;  4CIH A;  2P6V A;  3QVZ A;  1TKN A;  3AJM A;  4JUR I;  4J7T A;  3X2Q C;  2YLD A;  4N06 A;  3KH2 A;  1NZE A;  1XWJ A;  3LES A;  3M79 A;  3ZIB A;  1FAP B;  2LK4 A;  4BJ5 C;  1CGM E;  2D4U A;  1NFO A;  2BC5 A;  3W2V A;  2NUP A;  2HJ3 A;  2F22 A;  2WZL A;  4MTG A;  3RKO F;  2XLM A;  2MWQ A;  3IQC A;  4C7O A;  2L81 A;  2GDC A;  3DE9 A;  4MW3 A;  2R9R B;  2R02 A;  3IPM O;  4JKV A;  4LDK A;  2YWA A;  2VC9 A;  3N2Z B;  4EWC A;  5EHH A;  1TWC A;  4G78 A;  1HE1 A;  1RKC A;  3NRH A;  4PFO A;  3WG7 C;  4B6I A;  2EIK C;  4I1O B;  3GWN A;  2HSQ A;  3H2V A;  3PHF 2;  1OKK D;  3B71 A;  4Z9I A;  2HV7 A;  4CS7 A;  3A11 A;  256B A;  2OKU A;  3NMK A;  3Q6N A;  4JE9 A;  4DRI B;  3L8J A;  5JUA A;  1E84 A;  1FNT c;  3TJ6 A;  1BR4 A;  5JSL A;  3UNG C;  3JYH A;  3EG9 A;  2LSE A;  3HLZ A;  2YLI A;  3RH3 A;  4DXW A;  2IOQ A;  2KC3 A;  3K66 A;  2A6H F;  1CGN A;  3W2W A;  4BJ6 A;  5GPG B;  2LD6 A;  1ZW2 A;  5K0I A;  1K40 A;  1PD1 A;  2FAP B;  3FMS A;  4XPY A;  1A41 A;  1JPJ A;  3DAG A;  3TJ5 A;  1FR0 A;  2EPM X;  3Q7G A;  2YL0 A;  3NYL A;  2XLD A;  3DXJ F;  3V5Y A;  3E70 C;  4NCQ A;  1TWG A;  2QE9 A;  4CBE A;  2J9W A;  2KW3 C;  2AP3 A;  2L6F A;  4JTD B;  5T3W A;  4ZLC A;  3EZH A;  2GAQ A;  1O87 A;  2H7V C;  2J45 A;  1H7I A;  5FCL A;  2PF4 E;  2YVK A;  1Q0D A;  2VCA A;  1AEP A;  4H54 A;  1PV3 A;  1OXK A;  1SMY F;  3ASN C;  4MW8 A;  2R7S A;  2Q9C A;  4HEA J;  4XTK A;  2R05 A;  5L0H A;  2WVN A;  1GS9 A;  2C04 A;  3HKK A;  1LI5 A;  4MVM A;  4IJJ A;  3ZTZ A;  4ER9 A;  2L7A A;  4MTF A;  2HSB A;  3O10 A;  1OW6 A;  1I5N A;  1NU7 D;  1FFT C;  1BR2 A;  3EZI A;  3FOP A;  4GYT A;  2HJM A;  5KYX A;  3ZQY A;  5E2Q A;  4GEH A;  5HV9 A;  1NBB A;  4UDV A;  5KYY A;  2OU6 A;  5DS6 A;  2X51 A;  2ZXR A;  4DVZ A;  2GWW A;  2E87 A;  4E18 A;  4G0H A;  1APC A;  1JMW A;  4JRZ A;  4NC3 A;  5KYY B;  2HV6 A;  3UMI A;  2FGY A;  5HSW A;  3ABM C;  4KI2 A;  2WZF A;  3B0P A;  1A7D A;  2PBE A;  1HMO A;  4I44 A;  4JW1 A;  3RVY A;  4CIP A;  1M2O A;  5F5F A;  1T9K A;  4F4B A;  2EPO A;  3KYI A;  4ZLD A;  1YZA A;  5L3V A;  2OJQ A;  2HMQ A;  5L0D A;  1OR3 A;  2NSF A;  2PX3 A;  2I15 A;  2W4B A;  5B1B C;  2UUI A;  2YEV A;  4BJ6 C;  1NSG B;  2WVO A;  3FOO A;  4MQ9 F;  2NUP B;  4OIR F;  5A6J A;  2O9X A;  1H9T A;  2Q4F A;  5A6A A;  4JVS A;  3RQE A;  3QTH A;  3LJB A;  3Q6M A;  4RDA A;  3FVY A;  4YWQ A;  4DBR A;  2J7P D;  1Q0F A;  5L0I A;  2P61 A;  1ZU4 A;  1RKE B;  1NFN A;  3TK0 A;  5BQH A;  3NMI A;  3CAX A;  3ZVR A;  2J9B A;  1M57 C;  2YL7 A;  3O39 A;  1L3P A;  5D91 A;  4FWV A;  3U3B A;  4BJT A;  4KC9 A;  5JRA A;  4Q5S F;  1J8M F;  2HZ8 A;  3K33 A;  2LFD A;  3ITF A;  4U5C E;  2DI3 A;  5KYU A;  3U8V A;  3V7O A;  2KK1 A;  2IXP A;  3E9V A;  3JZ0 A;  1A0B A;  4EBK A;  5IY5 C;  1Q0K A;  4W8P A;  3AQB A;  2Y3G A;  3C8Z A;  2LFF A;  2YRF A;  2WZG A;  3AGT A;  2ICW G;  3EG9 B;  2Y3H A;  5DLJ A;  2FFH A;  1OCC C;  3UMH A;  4A2N B;  3T6B A;  3VM6 A;  1LE2 A;  5DS5 A;  1MQV A;  5L0C A;  4JEB A;  1ZVZ A;  3NKD A;  5B3I A;  1MMG A;  1E85 A;  4CDV A;  2B0H A;  4U5E E;  3U8P A;  1T01 A;  3GM1 A;  2EIL C;  2Y39 A;  1HE9 A;  1YLM A;  3EHN A;  1AUE A;  5L3Q A;  3MYF A;  2A0U A;  4K0D A;  3IQ5 A;  2NPU A;  3LAY A;  2W9Y A;  4JC7 A;  4XWJ A;  4EBJ A;  3GAN A;  1R4T A;  1OCR C;  1R5I D;  3F47 A;  3SYN A;  3KMI A;  3VYW A;  1V54 C;  2W45 A;  4KNW A;  1YYJ A;  2A1D D;  3G50 A;  1YAU O;  4FES A;  2ZD9 A;  3TOM A;  2LIG A;  5JS5 A;  1TFK B;  4XQ1 A;  2L6H A;  1D0Y A;  3ZSU A;  3W4Y A;  3TD7 A;  4C7O B;  2PFD A;  5DVW A;  2DYS C;  2R7T A;  1H9G A;  5JP7 A;  2JX0 A;  3TUL A;  3SXZ A;  3FAJ A;  2XLE A;  4O6N A;  2J0W A;  4OIO F;  1AVO B;  2J9V A;  2LCH A;  2QTV A;  2YHS A;  2MYS A;  1VB5 A;  2V26 A;  1C02 A;  1TFO B;  2DGJ A;  3DZA A;  4IRU A;  2J8W A;  5AGF A;  3HTK C;  3CSK A;  5CIV A;  1C03 A;  3NYM A;  4PAC A;  4XPX A;  2CNW D;  3T4R A;  1UFB A;  3ZWI A;  3TOL A;  2P7V A;  4WGY A;  4D4N A;  4DRJ B;  3ZDL A;  5B3S C;  1YJG A;  3AGU A;  3JRM O;  2ZPA A;  4LDQ A;  4J7Y A;  3JYY A;  5KYW A;  3VRC A;  5E3C A;  3LS1 A;  1FFH A;  3A9C A;  4PJM A;  3C62 A;  2KJG A;  2KYH A;  2QNL A;  3SNH A;  4YT8 A;  4YK5 A;  3DD7 A;  4G7O F;  4RD9 A;  3GM2 A;  1SZI A;  3G4Z A;  1OCZ C;  1MNE A;  4CDA A;  4IB4 A;  4Q4Z F;  2B0J A;  3EGX B;  3OWT A;  2XLH A;  2EPL X;  4YN0 B;  4QI2 A;  3LLI A;  4O79 A;  3LNR A;  3AG4 C;  2M4E A;  4U5B E;  3EGD B;  3FAP B;  3DKA A;  5KYU B;  3S28 A;  2JPU A;  3U2L A;  1VYK A;  1U89 A;  3U2M A;  4CX9 A;  4FAP B;  3SZR A;  1Y6D A;  3GOD A;  4XEV A;  4I3M A;  1T5O A;  1ZHX A;  1DOV A;  1H6G A;  1OW8 A;  1KU2 A;  2AU5 A;  3MFN A;  3RFY A;  3L0I A;  2P0N A;  1YAR O;  1C17 M;  4U9D A;  3RYL A;  3NMJ A;  3PCV A;  4YT5 A;  2XXA A;  2PX0 A;  1FMW A;  2KQ9 A;  2XL8 A;  2C03 A;  3EFO A;  5CI8 A;  3AG1 C;  2PNO A;  2WL8 A;  1LKX A;  1ZHY A;  3C8G D;  3JT1 A;  4IAQ A;  1Z7Q c;  1I4Y A;  2VH3 A;  3GOR A;  3NG1 A;  4N6H A;  3DM5 A;  2YKZ A;  4G7Z F;  4D4X A;  2V3C C;  1VOM A;  4LER A;  1KTM A;  2L9J A;  4MVR A;  3OA1 A;  1E86 A;  3C18 A;  1ZYR F;  3FHD A;  4AE4 B;  3US6 A;  3LUT B;  3OEO A;  2YL1 A;  1ZZP A;  4EIY A;  3SXY A;  4LAC B;  1LS4 A;  2R7W A;  2QLA A;  4Z9J A;  1WGW A;  1O5H A;  2KSF A;  2XLV A;  1RMV A;  1JPN A;  5B1A C;  3J06 A;  5AC5 A;  3AG2 C;  3DMD A;  4OD4 A;  2A69 F;  1VK5 A;  1LS1 A;  3EGD A;  3I5Q A;  1FMV A;  1XZP A;  3N24 A;  2NUT A;  3UMK A;  4AK9 A;  5CI9 A;  3U0C A;  1JR8 A;  1TR2 A;  2OOC A;  2VAS A;  3S90 A;  1M6T A;  2EIN C;  4PK4 A;  3QW0 A;  4KNV A;  4BEM J;  1ZHZ A;  4XPW A;  4C3E A;  5BQI A;  2W4M A;  3S0X A;  4PJN A;  4MS2 A;  1F1M A;  4CJO A;  1VYI A;  2EIJ C;  2MHR A;  4U5D E;  3RF3 A;  1V55 C;  2VCC A;  5F5H A;  2CGE A;  5FZT A;  1QKR A;  1MMN A;  4U5G A;  3S27 A;  2YL3 A;  4NTB A;  4LLC A;  1QZX A;  1I4Z A;  2Y3D A;  1HW2 A;  4U5F E;  2J0X A;  2Y3B A;  4P9F A;  4EKW A;  1L7C A;  4K7B A;  5A69 A;  2H8A A;  2R7O A;  2NSG A;  4PR9 A;  1ST6 A;  3HJC A;  4WAB A;  2G3V A;  4CS8 C;  4E7S A;  3M4B A;  4M63 A;  1TWH A;  1FTS A;  3ABL C;  5BUO A;  4MVQ A;  3RQF A;  1RJ9 B;  3R2P A;  2X0C A;  2XLO A;  1GQA A;  2ZXP A;  5JT4 A;  3UGO A;  1OQC A;  1NU9 C;  3EJN A;  4E7Z A;  3EPV A;  1Z63 A;  1LM3 B;  4JTA B;  3SXK A;  1OW7 A;  2BE5 F;  4IWB A;  2R7R A;  3K7D A;  1S7Z A;  3EGX A;  3H2U A;  1JOG A;  2LP4 A;  4IGG A;  1WAT A;  2CYD A;  1HW1 A;  3ZTM A;  1Q0G A;  3L8I A;  4JEA A;  1D1C A;  5DQZ A;  1XZQ A;  1PCX A;  1ZHW A;  3T9O A;  1E83 A;  4G7H F;  4XLN F;  3T6J A;  1JRA A;  2NG1 A;  5KYN A;  1ZHT A;  3IQT A;  4X0R A;  1YA7 O;  1O3U A;  3LEO A;  4OD5 A;  3L34 A;  4WJ0 A;  2I8B A;  3C7J A;  2YZS A;  2A6E F;  3ASO C;  2OEX A;  3DWW A;  2ETS A;  3U3F A;  5EGY A;  4Z9H A;  4I1M A;  1EQ1 A;  4ULV A;  1OR2 A;  2J9U A;  2Q9B A;  2VB6 A;  4JTC B;  3WHN A;  5COG A;  3HNJ A;  4J32 B;  5KYX B;  2DYR C;  3JSZ A;  4YL0 A;  3JSE O;  1JAF A;  1MND A;  2G3K A;  4XLP F;  3S84 A;  3MYI A;  3RQG A;  1CGO A;  2IBF A;  2HS5 A;  3CZ6 A;  4H4K C;  3F46 A;  5KYW B;  2PP4 A;  2OQM A;  1S05 A;  4WGZ A;  2Z15 A;  3DJU B;  3RW0 A;  2AVK A;  4CSA C;  4BG0 A;  1M56 C;  3M1C B;  5E3A A;  5T3T A;  4HFF B;  4P9T A;  4YJW A;  3B9Q A;  1RJ9 A;  2R7U A;  3HNI A;  3KPH A;  1SR2 A;  1V74 B;  4CS8 A;  4O6M A;  4NY3 A;  5E33 A;  3B0V C;  1NLX A;  2EPK X;  2HUJ A;  4A4A A;  1VLS A;  1VMA A;  3GEE A;  3NDB B;  3B29 A;  1ORJ A;  3GWL A;  3MLG A;  1YVI A;  1YA9 A;  2XM4 A;  2YQY A;  3GEI A;  3H65 A;  3LEV A;  4XEF A;  4J30 B;  1MMA A;  4NQF A;  3UR3 C;  3ZQV A;  2TMV P;  1M2V B;  1D1A A;  2IXN A;  1CPR A;  1T6Q A;  3U5S A;  3VF0 A;  1IZM A;  2RSE B;  1QVX A;  3IEE A;  1Z3I X;  1M2V A;  3JTL O;  4PJJ A;  1HMD A;  1LIH A;  4L6R A;  3JCU Q;  2KNH A;  1OXB A;  1ZW3 A;  3ABK C;  3C8G A;  3MBG A;  3JRT A;  5A6K A;  5F28 E;  1A7V A;  1GGQ A;  1QSP A;  1RXQ A;  3R7C A;  4BJ1 A;  4JJF A;  4DRH B;  5L0J A;  3QZC A;  4EUK B;  2XM0 A;  2R25 A;  2J46 A;  2XL6 A;  5T1D B;  3IHU A;  1MMD A;  3BRJ A;  3EFO B;  4FX5 A;  4YL1 A;  3SXM A;  4DOZ A;  4MND A;  4NTA A;  1LVK A;  2IXO A;  3SEO A;  3M15 A;  2GA0 A;  3HNL A;  3VAY A;  5L0F A;  4YL3 A;  2XS8 A;  3W8I A;  1T6U A;  4NTF A;  2ZXO A;  3UGP A;  2OEV A;  3CQZ A;  4R32 A;  3MX3 A;  2CDQ A;  4BEJ A;  3TQO A;  4EHP A;  4RBN A;  2R03 A;  1E2X A;  3NKE A;  3WAQ A;  4U9E A;  4AL0 A;  5COM A;  2XRH A;  1UG7 A;  4AL1 A;  3BEH A;  4BJ5 A;  3KL4 A;  4OIQ F;  1LI7 A;  1A7E A;  1ORS C;  1U6H A;  4IAR A;  2HMZ A;  4E17 A;  1Q0M A;  5COF A;  1K05 A;  3ATP A;  3C63 A;  2P1A A;  4Q7C A;  1VLT A;  1G4W R;  2Q7R A;  4DVY P;  4JZA A;  5A6B D;  2WB7 A;  2XSE A;  4YT4 A;  5JLI A;  2EIM C;  1W2W A;  1ZU5 A;  5BQG A;  2BL2 A;  2Q3T A;  2QY9 A;  3DI5 A;  2M64 A;  2G62 A;  2CW0 F;  1Y4C A;  3V5Z A;  4C3D A;  3DE8 A;  4PJL A;  1N1C A;  4U5H A;  3IQ6 A;  4YT2 A;  1T6I A;  1U0B B;  4AX2 A; 
#chains in the Genus database with same CATH homology
 4N6C A;  5COG A;  2NSF A;  2HKV A;  2YQY A;  2QNL A;  5COM A;  3GOR A;  3QTH A;  2F22 A;  2OQM A;  5COF A;  2OU6 A;  2P1A A;  3CEX A;  1RXQ A;  3DI5 A;  3DKA A;  2RD9 A;  5CIV A;  2NSG A;  2QE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...