3DWWA

Electron crystallographic structure of human microsomal prostaglandin e synthase 1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
142
structure length
142
Chain Sequence
PALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin E synthase
publication title Structural basis for induced formation of the inflammatory mediator prostaglandin E2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 36
structure length 142
sequence length 142
chains with identical sequence B, C
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2008-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 3dwwA00
4JC7A 4YL1A 2PNOA 4J7YA 4NTFA 4BPMA 5HV9A 3DWWA 3HKKA 4YK5A 2H8AA 5K0IA 4J7TA 2UUIA 4YL0A 4AL0A 5BQHA 4JRZA 4JCZA 5BQGA 3PCVA 4NTAA 2Q7RA 5BQIA 3LEOA 2UUHA 4YL3A 4NTBA 4AL1A 3B29A 4WABA
chains in the Genus database with same CATH superfamily
2WL8A 4J7YA 4M63A 2L7AA 2HMZA 4N06A 4CDVA 5IY5C 2GA0A 4EKWA 4MVSA 1FMVA 1ZHZA 4CS7A 4AE4A 4U5EE 3QTHA 1JPNA 4PFPA 4UDVA 3NMKA 4DVZA 4I1MA 1ZZPA 3JYHA 4ONSA 4CBEA 2GDCA 3L8IA 5T3TA 4KI2A 2Q7RA 3NDBB 2KYHA 1YJGA 3ZQYA 3B0VC 1CGME 3LS1A 2WZGA 5T3WA 1E83A 2LQGA 1R5ID 2A1DD 2P6VA 1EI7A 1Z63A 1JR8A 2AWYA 4MQ9F 4BEJA 4CS8C 2XM4A 1EQ1A 5DQZA 2LCHA 4EWCA 3UR3C 1RJ9B 3MYFA 1BZ4A 2YZSA 3C8GB 2XLMA 2FFHA 5A6AA 1FFTC 1WATA 3AOUA 4O7GA 2H7VC 2JPUA 3B0PA 3GWNA 1ZU4A 1W2WA 2OKUA 3IQTA 3LAYA 3E70C 2J9UA 4PR9A 2XS8A 1JAFA 4Z9HA 5E2QA 5KYUB 5A6BD 1GM5A 2BC5A 2NUPB 1TFKB 4U5BE 3PMRA 2WVNA 3B71A 2I8BA 1EA8A 3C18A 2XLOA 3CSKA 2YLGA 4Z9JA 2DYRC 3SEOA 4DRHB 5BQIA 2Q4FA 4ER9A 3HNKA 1NLXA 2Y69C 3QW0A 1RKCA 3KKBA 3ZSUA 4BJ6C 4BJ5A 1OXKA 1LM3B 2O9XA 3DMDA 2ZD9A 3US6A 3FOPA 1J8YF 1FFHA 2QLAA 1YZCA 4G7HF 3WAQA 4C3BA 3HJCA 1T6UA 3JZ0A 2KJGA 5AC4A 3NG1A 4CSAC 3V5YA 1BR2A 5E3CA 2YL1A 1K40A 1TKNA 1OCOC 3X1OA 1G5ZA 3GEIA 5CIVA 1HE1A 3UNGC 3BEHA 2KK1A 4I3MA 2ZXPA 3DWWA 4QI0A 4PJLA 3RKOF 2L9JA 2OG2A 1LS1A 3EGDA 1XZPA 3WG7C 1YVIA 1ZHTA 3WODF 1GQAA 2NSFA 3GM2A 3RQGA 1LIHA 1LE4A 1MNDA 3JCUQ 4XQ1A 5EGYA 3JTLO 3Q6NA 2XM0A 3K1HA 4E0IA 1I4YA 4JJFA 256BA 3LEOA 2CNWD 3TQOA 3DE9A 2ZXRA 3HNJA 3LJBA 4ULWA 2HV6A 1O3UA 2F22A 2XSEA 4IAOA 1LE2A 4KBLA 4YJWA 3AGTA 1N1CA 3EQLF 1ZHYA 2PFDA 2LD6A 3NMIA 4PACA 1YYXA 3K1IC 4PJJA 5BUOA 1G8XA 2CGEA 2XLHA 3JSEO 2V3CC 3ZQVA 4OD4A 4K0DA 1ZHWA 1A0BA 2R7XA 3S27A 3TJ6A 2B0HA 5CI8A 1Z7Qc 2RD9A 3U5SA 5L3VA 3SXZA 2M4EA 1Y6DA 3GODA 3HKKA 4HFFB 3G4XA 2Y3DA 3I5QA 3A11A 4JEBA 3UGOA 2ICWG 2KNHA 3LESA 1F1MA 3EZHA 3FDQA 3LNRA 2IXNA 2NPUA 2L6HA 3CQZA 4FX5A 2CDQA 1U6HA 2J9BA 2FGYA 1ORJA 1MMDA 2XLVA 1YA7O 3HLZA 2G3VA 5L0DA 2ETSA 3PHF2 1EKYA 4I1OB 4BG0A 1JPJA 5KYYA 3RQEA 3I5PA 4MVUA 2LFFA 1M6TA 3N2ZB 1KNYA 1TWAA 1YAUO 2HFIA 3A9CA 3EZIA 4WGZA 5B1AC 3RFYA 1TFOB 3T6JA 3T6GB 5AGFA 2V26A 2YL3A 3FMSA 2QNLA 2OU6A 4FAPB 2MYSA 4DRIB 3GWLA 3NMJA 4C7OA 3RF3A 3H2VA 4IWBA 2XLDA 4IB4A 2HUJA 3KL4A 2HJ3A 3N0TA 3QW1A 4D4XA 4GEHA 2P7VA 2E87A 4O6MA 1MQVA 2IXMA 2KW3C 5L0GA 4KC9A 3LEVA 3EG9B 4NY3A 4IGGA 4MVZA 5HSWA 1G4US 2J45A 4JCZA 4BEMJ 1PD1A 4NTAA 5JSLA 1MMAA 4LLEA 2Y3BA 3W4YA 4AX2A 5DLJA 3Q7LA 2VCAA 1QKRA 1TQGA 3MBGA 1GGQA 2C04A 3M4CA 3O10A 3QVZA 1WWPA 1TWHA 3V7OA 2YWAA 4BJ5C 4LERA 4CS9C 2IXPA 3N24A 4JTDB 4FESA 1IW7F 2Z15A 5KYWA 3TOMA 4ZLCA 3AG1C 2R7TA 1WTYA 2H7BA 2KQ9A 2Q9AA 3U9JA 1E85A 3EGXA 1PCXA 4O79A 2J46A 2LK4A 1O5HA 4P9FA 2YL7A 4NC3A 1ORSC 2D5RB 3K33A 4IJJA 5K0IA 1OXBA 3QMKA 1V55C 2BE5F 4G7ZF 2IXOA 3EFOA 3BRJA 1YARO 4EBKA 2XLEA 1OCCC 3TK0A 4K1OA 2YLIA 3NYMA 4J32B 3C63A 3KPHA 5A69A 2CW0F 2D4UA 4MTGA 1RKEB 2YKZA 1OKKD 2HSQA 4Q7CA 2DI3A 3RVYA 3T9OA 4DOZA 1ZW2A 5B3IA 1DOWA 1H9GA 4YT5A 4ANJA 2XXAB 1AEPA 3S9OA 4YWQA 5E3AA 2NG1A 1PV3A 2R7VA 1R4TA 2QE9A 1VLSA 2EIMC 1LVKA 3ABMC 4J30B 1D0XA 4YN0B 4EIYA 2I15A 5COFA 4RDAA 2NSGA 1Z3IX 1KTMA 2VASA 1D0YA 3MFNA 2Y3GA 3POVA 2HSBA 1AUEA 3EHNA 3G50A 4MS2A 3ZDLA 3LUTB 5BQHA 1SF8A 5E33A 5GPGB 2XL4A 2UUHA 1SYQA 1TR2A 1FMWA 1OKKA 1VOMA 1LKXA 2A69F 2R9RB 1Q0KA 2EIJC 2X0CA 4BJTA 2EPOA 4NCQA 3W2VA 1J8MF 3AG2C 4P6IC 1FNTc 5DS6A 1T9KA 1VYIA 2MWQA 4HEAJ 4CJOA 4IAQA 4U5GA 4OIOF 1HW1A 3G4ZA 3OWTA 4WABA 4AE4B 3DD7A 3V5XA 2AVKA 2HMQA 4JC7A 1FTSA 1YZAA 2W9YA 2J0XA 1OCRC 4JCHA 1VB5A 4BPMA 3SP1A 2R7WA 1ZHXA 4WJ0A 2HV7A 1I4ZA 4BJ1A 1MMNA 4W8PA 5DVWA 4G7OF 1IZMA 1UG7A 5A6BA 4E0HA 1E84A 2YEVA 3OEOA 3RYLA 4A2NB 2ZXWC 3LS0A 3NKDA 3SXMA 4MVMA 3VRCA 5T1DB 4YL3A 4ZLDA 4OIRF 3TOLA 3C7JA 4NTBA 3FAPB 3RIPA 3S0XA 2CCYA 1AVOB 2WZLA 2J8WA 4R32A 2AP3A 5D92A 1B68A 2AWCA 5L3QA 2JX0A 1ZYRF 3ASOC 1RXQA 5DS4A 1V4AA 1V54C 4IRUA 3ATPA 1U0BB 2CYDA 2R7OA 4E7SA 2LIGA 3JRMO 4U5HA 1ZW3A 1A7DA 3S28A 1QPUA 2R7QA 3L1MA 3TJ5A 5TJ5E 4U9EA 2PF4E 4X0RA 4XEFA 4JURI 3C8ZA 5DQTA 4CJGA 1JRAA 2DB4A 1CGNA 4U9DA 1QSPA 3J06A 4JEAA 2HS5A 2CNWA 4OD5A 4PJNA 3GEEA 2IBFA 4CS8A 3NRHA 2Q00A 1GS9A 2LP4A 3IQ6A 2NUTA 3AQBA 3LLIA 2QY9A 4JTCB 3EGDB 2J9VA 3OA1A 4KNVA 1CPQA 3L8JA 4O6YA 3RH3A 1V74B 1JOGA 1SZIA 1T6QA 4NTFA 3NYLA 2OQMA 2PP4A 1HY5A 3DAFA 4XEVA 4NQFA 1APCA 4LDQA 3K66A 4FWVA 3DI5A 1SR2A 2Q3TA 2WZFA 3I4UA 3C8GD 4JZAA 2YQYA 3GEHA 5KYNA 1ORYA 2XS1A 4E17A 5F5HA 1OCZC 2Y39A 4JW1A 1NBBA 2EPLX 4EHPA 4LDRA 1BR1A 1K05A 2P0NA 2Q9BA 2Y3HA 4MTFA 2VCCA 1MNEA 2A68F 2LSEA 1E2XA 3JYYA 1L7CA 1NSGB 2YLDA 3FXHA 5L0IA 1NU7D 3O39A 2PBEA 3B0UX 4GQHA 2OEVA 4XEKA 3DM9B 5JP7A 4XWJA 4OIQF 4CSAA 2DGJA 3MLGA 3O55A 3IPMO 1BBHA 5L0JA 1VK5A 3DAGA 4YL1A 3JRTA 3MYIA 1PD0A 4N4WA 1NG1A 1RJ9A 3HNLA 3RVZA 3TULA 2DYSC 1NU9C 2HZ8A 4H4KC 2R7UA 1KU2A 2OEXA 4OINF 3SZRA 4E7ZA 1DOVA 1QQ3A 3QVYA 1Q0GA 1Z5ZA 1YLMA 2G3KA 3M15A 4A4AA 5KYXA 5KYYB 4QI2A 4XLPF 2NUTB 2A6EF 1Z6AA 3K7DA 3ZVRA 4HE8D 3IHUA 2C03A 2WVOA 2X51A 3AJMA 4C3DA 1BR4A 4U5FE 4C3EA 1H7IA 1XWJA 3K1IA 2YRFA 3WHNA 1E86A 3HNIA 4C7OB 4OIPF 3B29A 3H2UA 4JE9A 3SYNA 3DKAA 2L81A 3ECSA 5L0CA 2GAQA 1BDJB 3FVYA 3IQ5A 2L6GA 2FAPB 4N6HA 3FHDA 4PK4A 3SXYA 1WN0A 4LLCA 2PNOA 3UMKA 3ITFA 4P9TA 4DBRA 1T6IA 1A7VA 1TWGA 5JVEA 5JS5A 1D1CA 3U3FA 3HTKC 2EPMX 4O6NA 3AG3C 3IQCA 4YL0A 4Z9IA 1HMOA 2QTVA 1ST6A 2GFHA 4AK9A 1HMDA 5A6JA 3PCVA 4MW8A 3X2QC 2A6HF 4N6CA 3R7CA 3W8IA 5KYWB 2RSEB 2KGOA 2VCBA 3K6BA 4MW3A 3ABLC 1QZXA 1RCPA 2ASRA 3RW0A 5DS5A 5F5FA 3VYWA 4MVRA 5EK0A 3EGXB 4GYTA 2J9WA 2KC3A 1VYKA 3S29A 4AL1A 2H7OA 2J0WA 2A0BA 3AG4C 5L0FA 2OCCC 4Q4ZF 2R7RA 3T6BA 3DE8A 1OW7A 3JSZA 3S90A 1MMGA 3L0IA 2W4MA 3EFOB 5FZTA 3VM6A 5KYXB 1TWCA 2EIKC 2M64A 3Q7GA 3M79A 1D0ZA 2P61A 4MVQA 4IARA 2R05A 2ZXOA 2AU5A 1LS4A 4G0HA 4AL0A 4JJGA 2VB6A 5A6KA 3ASNC 4XLNF 2A0UA 3IEEA 1JMWA 3UMIA 3M1CB 3U0CA 4YT8A 3EHMA 1OR3A 2EPNA 2EINC 2W4BA 3ABKC 1O87A 3U2LA 4U5CE 3VF0A 3B9QA 1WGWA 2HJMA 4CS9A 1QVXA 2HKVA 3CAXA 1ZVZA 1OW6A 3DXJF 2J7PD 3U8VA 1G4WR 3UMHA 5B3SC 2EPKX 4K7BA 2R7SA 1ZU5A 3CZ6A 2XL8A 1A7EA 5COGA 5COMA 2OJQA 1Y4CA 4H54A 4RD9A 4RBNA 1C17M 3EPVA 1M2VA 4PFOA 5EHHA 5HV9A 2P1AA 4XPYA 5CI9A 3U9MA 4XTKA 3AGUA 2ZPAA 4DXWA 4MTOA 3U2MA 1Q0MA 1C02A 2UUIA 2B0JA 4DRJB 5AC5A 1Z23A 4JRZA 4LACB 3E9VA 1FR0A 5L0HA 1NFOA 1QLEC 2YHSA 3FOOA 3SNHA 4JKVA 5JT4A 3Q6MA 3QZCA 4F4BA 4YT2A 3EG9A 1NFNA 3GM3A 3DZAA 3AQCA 1VTMP 2J7PA 4L6RA 3C62A 2YL0A 3GANA 2WB7A 1OW8A 1OR2A 3LNMB 3MX3A 4CDYA 3PDMP 3DM5A 4Q5SF 3M4BA 1M57C 3NKEA 5F28E 2Q9CA 3KYIA 3EJNA 4U5DE 4PJMA 4G78A 4CDAA 1VMAA 3FAJA 4LDKA 4CIHA 1WASA 2PX3A 3GM1A 3U3BA 1K04A 3ZIBA 3L34A 3CEXA 5JUAA 3ZC4A 2OJED 3VAYA 4DVYP 1RMVA 2MHRA 1SMYF 1NZEA 2R02A 2VH3A 3DJUB 1VLTA 4J7TA 4MNDA 2IYLD 2G62A 3EH1A 1D1BA 2OOCA 1Q0FA 3KMIA 4XPXA 5B1BC 1A41A 4EUKB 1T01A 1D1AA 2EILC 4WGYA 3KH2A 3ZG1A 4DJ9A 4E18A 1WOLA 2TMVP 4CIPA 4BJ6A 3SXKA 1LPEA 1I5NA 2GWWA 1Q0DA 1M2VB 2YVKA 3JT1A 1C03A 3NYJA 5JRAA 1H6GA 2W45A 1XZQA 3R2PA 3RQFA 1RKEA 1M2OA 1H9TA 2IOQA 1CGOA 4MVOA 3T4RA 4CX9A 1HE9A 1YDIA 2R25A 3H65A 2XRHA 1T5OA 3TD7A 1YA9A 4YT4A 2XXAA 3ZWIA 2PX0A 1CPRA 1OQCA 1YYJA 4I44A 4DBQA 2KSFA 2R03A 3DJNB 3U8PA 1HW2A 4YK5A 4B6IA 2XLWA 2H8AA 2VC9A 2L6FA 4JTAB 4QDLA 4EBBA 4ULVA 4EBJA 3ZTMA 1LI7A 3C8GA 4HFKB 3F47A 2LFDA 1L3PA 2BL2A 3W2WA 3W8HA 2QUPA 3F46A 5BQGA 3V5ZA 3KYJA 3EH2A 5D91A 4W8KA 4JVSA 1UFBA 3O6XA 3LLKA 5KYUA 1LI5A 3UGPA 2NUPA 4JIOA 3S84A 1FAPB 1U89A 3ZTZA 1S05A 4XPWA 1S7ZA 4KNWA 2XL6A 5FCLA 2IM8A 4D4NA 1M56C 2JD3A 5JLIA 2WVQA 3GORA
chains in the Genus database with same CATH topology
4JC7A 4YL1A 2PNOA 4J7YA 4NTFA 4BPMA 5HV9A 3DWWA 3HKKA 4YK5A 2H8AA 5K0IA 4J7TA 2UUIA 4YL0A 4AL0A 5BQHA 4JRZA 4JCZA 5BQGA 3PCVA 4NTAA 2Q7RA 5BQIA 3LEOA 2UUHA 4YL3A 4NTBA 4AL1A 3B29A 4WABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JC7 A;  4YL1 A;  2PNO A;  4J7Y A;  4NTF A;  4BPM A;  5HV9 A;  3DWW A;  3HKK A;  4YK5 A;  2H8A A;  5K0I A;  4J7T A;  2UUI A;  4YL0 A;  4AL0 A;  5BQH A;  4JRZ A;  4JCZ A;  5BQG A;  3PCV A;  4NTA A;  2Q7R A;  5BQI A;  3LEO A;  2UUH A;  4YL3 A;  4NTB A;  4AL1 A;  3B29 A;  4WAB A; 
#chains in the Genus database with same CATH topology
 2WL8 A;  4J7Y A;  4M63 A;  2L7A A;  2HMZ A;  4N06 A;  4CDV A;  5IY5 C;  2GA0 A;  4EKW A;  4MVS A;  1FMV A;  1ZHZ A;  4CS7 A;  4AE4 A;  4U5E E;  3QTH A;  1JPN A;  4PFP A;  4UDV A;  3NMK A;  4DVZ A;  4I1M A;  1ZZP A;  3JYH A;  4ONS A;  4CBE A;  2GDC A;  3L8I A;  5T3T A;  4KI2 A;  2Q7R A;  3NDB B;  2KYH A;  1YJG A;  3ZQY A;  3B0V C;  1CGM E;  3LS1 A;  2WZG A;  5T3W A;  1E83 A;  2LQG A;  1R5I D;  2A1D D;  2P6V A;  1EI7 A;  1Z63 A;  1JR8 A;  2AWY A;  4MQ9 F;  4BEJ A;  4CS8 C;  2XM4 A;  1EQ1 A;  5DQZ A;  2LCH A;  4EWC A;  3UR3 C;  1RJ9 B;  3MYF A;  1BZ4 A;  2YZS A;  3C8G B;  2XLM A;  2FFH A;  5A6A A;  1FFT C;  1WAT A;  3AOU A;  4O7G A;  2H7V C;  2JPU A;  3B0P A;  3GWN A;  1ZU4 A;  1W2W A;  2OKU A;  3IQT A;  3LAY A;  3E70 C;  2J9U A;  4PR9 A;  2XS8 A;  1JAF A;  4Z9H A;  5E2Q A;  5KYU B;  5A6B D;  1GM5 A;  2BC5 A;  2NUP B;  1TFK B;  4U5B E;  3PMR A;  2WVN A;  3B71 A;  2I8B A;  1EA8 A;  3C18 A;  2XLO A;  3CSK A;  2YLG A;  4Z9J A;  2DYR C;  3SEO A;  4DRH B;  5BQI A;  2Q4F A;  4ER9 A;  3HNK A;  1NLX A;  2Y69 C;  3QW0 A;  1RKC A;  3KKB A;  3ZSU A;  4BJ6 C;  4BJ5 A;  1OXK A;  1LM3 B;  2O9X A;  3DMD A;  2ZD9 A;  3US6 A;  3FOP A;  1J8Y F;  1FFH A;  2QLA A;  1YZC A;  4G7H F;  3WAQ A;  4C3B A;  3HJC A;  1T6U A;  3JZ0 A;  2KJG A;  5AC4 A;  3NG1 A;  4CSA C;  3V5Y A;  1BR2 A;  5E3C A;  2YL1 A;  1K40 A;  1TKN A;  1OCO C;  3X1O A;  1G5Z A;  3GEI A;  5CIV A;  1HE1 A;  3UNG C;  3BEH A;  2KK1 A;  4I3M A;  2ZXP A;  3DWW A;  4QI0 A;  4PJL A;  3RKO F;  2L9J A;  2OG2 A;  1LS1 A;  3EGD A;  1XZP A;  3WG7 C;  1YVI A;  1ZHT A;  3WOD F;  1GQA A;  2NSF A;  3GM2 A;  3RQG A;  1LIH A;  1LE4 A;  1MND A;  3JCU Q;  4XQ1 A;  5EGY A;  3JTL O;  3Q6N A;  2XM0 A;  3K1H A;  4E0I A;  1I4Y A;  4JJF A;  256B A;  3LEO A;  2CNW D;  3TQO A;  3DE9 A;  2ZXR A;  3HNJ A;  3LJB A;  4ULW A;  2HV6 A;  1O3U A;  2F22 A;  2XSE A;  4IAO A;  1LE2 A;  4KBL A;  4YJW A;  3AGT A;  1N1C A;  3EQL F;  1ZHY A;  2PFD A;  2LD6 A;  3NMI A;  4PAC A;  1YYX A;  3K1I C;  4PJJ A;  5BUO A;  1G8X A;  2CGE A;  2XLH A;  3JSE O;  2V3C C;  3ZQV A;  4OD4 A;  4K0D A;  1ZHW A;  1A0B A;  2R7X A;  3S27 A;  3TJ6 A;  2B0H A;  5CI8 A;  1Z7Q c;  2RD9 A;  3U5S A;  5L3V A;  3SXZ A;  2M4E A;  1Y6D A;  3GOD A;  3HKK A;  4HFF B;  3G4X A;  2Y3D A;  3I5Q A;  3A11 A;  4JEB A;  3UGO A;  2ICW G;  2KNH A;  3LES A;  1F1M A;  3EZH A;  3FDQ A;  3LNR A;  2IXN A;  2NPU A;  2L6H A;  3CQZ A;  4FX5 A;  2CDQ A;  1U6H A;  2J9B A;  2FGY A;  1ORJ A;  1MMD A;  2XLV A;  1YA7 O;  3HLZ A;  2G3V A;  5L0D A;  2ETS A;  3PHF 2;  1EKY A;  4I1O B;  4BG0 A;  1JPJ A;  5KYY A;  3RQE A;  3I5P A;  4MVU A;  2LFF A;  1M6T A;  3N2Z B;  1KNY A;  1TWA A;  1YAU O;  2HFI A;  3A9C A;  3EZI A;  4WGZ A;  5B1A C;  3RFY A;  1TFO B;  3T6J A;  3T6G B;  5AGF A;  2V26 A;  2YL3 A;  3FMS A;  2QNL A;  2OU6 A;  4FAP B;  2MYS A;  4DRI B;  3GWL A;  3NMJ A;  4C7O A;  3RF3 A;  3H2V A;  4IWB A;  2XLD A;  4IB4 A;  2HUJ A;  3KL4 A;  2HJ3 A;  3N0T A;  3QW1 A;  4D4X A;  4GEH A;  2P7V A;  2E87 A;  4O6M A;  1MQV A;  2IXM A;  2KW3 C;  5L0G A;  4KC9 A;  3LEV A;  3EG9 B;  4NY3 A;  4IGG A;  4MVZ A;  5HSW A;  1G4U S;  2J45 A;  4JCZ A;  4BEM J;  1PD1 A;  4NTA A;  5JSL A;  1MMA A;  4LLE A;  2Y3B A;  3W4Y A;  4AX2 A;  5DLJ A;  3Q7L A;  2VCA A;  1QKR A;  1TQG A;  3MBG A;  1GGQ A;  2C04 A;  3M4C A;  3O10 A;  3QVZ A;  1WWP A;  1TWH A;  3V7O A;  2YWA A;  4BJ5 C;  4LER A;  4CS9 C;  2IXP A;  3N24 A;  4JTD B;  4FES A;  1IW7 F;  2Z15 A;  5KYW A;  3TOM A;  4ZLC A;  3AG1 C;  2R7T A;  1WTY A;  2H7B A;  2KQ9 A;  2Q9A A;  3U9J A;  1E85 A;  3EGX A;  1PCX A;  4O79 A;  2J46 A;  2LK4 A;  1O5H A;  4P9F A;  2YL7 A;  4NC3 A;  1ORS C;  2D5R B;  3K33 A;  4IJJ A;  5K0I A;  1OXB A;  3QMK A;  1V55 C;  2BE5 F;  4G7Z F;  2IXO A;  3EFO A;  3BRJ A;  1YAR O;  4EBK A;  2XLE A;  1OCC C;  3TK0 A;  4K1O A;  2YLI A;  3NYM A;  4J32 B;  3C63 A;  3KPH A;  5A69 A;  2CW0 F;  2D4U A;  4MTG A;  1RKE B;  2YKZ A;  1OKK D;  2HSQ A;  4Q7C A;  2DI3 A;  3RVY A;  3T9O A;  4DOZ A;  1ZW2 A;  5B3I A;  1DOW A;  1H9G A;  4YT5 A;  4ANJ A;  2XXA B;  1AEP A;  3S9O A;  4YWQ A;  5E3A A;  2NG1 A;  1PV3 A;  2R7V A;  1R4T A;  2QE9 A;  1VLS A;  2EIM C;  1LVK A;  3ABM C;  4J30 B;  1D0X A;  4YN0 B;  4EIY A;  2I15 A;  5COF A;  4RDA A;  2NSG A;  1Z3I X;  1KTM A;  2VAS A;  1D0Y A;  3MFN A;  2Y3G A;  3POV A;  2HSB A;  1AUE A;  3EHN A;  3G50 A;  4MS2 A;  3ZDL A;  3LUT B;  5BQH A;  1SF8 A;  5E33 A;  5GPG B;  2XL4 A;  2UUH A;  1SYQ A;  1TR2 A;  1FMW A;  1OKK A;  1VOM A;  1LKX A;  2A69 F;  2R9R B;  1Q0K A;  2EIJ C;  2X0C A;  4BJT A;  2EPO A;  4NCQ A;  3W2V A;  1J8M F;  3AG2 C;  4P6I C;  1FNT c;  5DS6 A;  1T9K A;  1VYI A;  2MWQ A;  4HEA J;  4CJO A;  4IAQ A;  4U5G A;  4OIO F;  1HW1 A;  3G4Z A;  3OWT A;  4WAB A;  4AE4 B;  3DD7 A;  3V5X A;  2AVK A;  2HMQ A;  4JC7 A;  1FTS A;  1YZA A;  2W9Y A;  2J0X A;  1OCR C;  4JCH A;  1VB5 A;  4BPM A;  3SP1 A;  2R7W A;  1ZHX A;  4WJ0 A;  2HV7 A;  1I4Z A;  4BJ1 A;  1MMN A;  4W8P A;  5DVW A;  4G7O F;  1IZM A;  1UG7 A;  5A6B A;  4E0H A;  1E84 A;  2YEV A;  3OEO A;  3RYL A;  4A2N B;  2ZXW C;  3LS0 A;  3NKD A;  3SXM A;  4MVM A;  3VRC A;  5T1D B;  4YL3 A;  4ZLD A;  4OIR F;  3TOL A;  3C7J A;  4NTB A;  3FAP B;  3RIP A;  3S0X A;  2CCY A;  1AVO B;  2WZL A;  2J8W A;  4R32 A;  2AP3 A;  5D92 A;  1B68 A;  2AWC A;  5L3Q A;  2JX0 A;  1ZYR F;  3ASO C;  1RXQ A;  5DS4 A;  1V4A A;  1V54 C;  4IRU A;  3ATP A;  1U0B B;  2CYD A;  2R7O A;  4E7S A;  2LIG A;  3JRM O;  4U5H A;  1ZW3 A;  1A7D A;  3S28 A;  1QPU A;  2R7Q A;  3L1M A;  3TJ5 A;  5TJ5 E;  4U9E A;  2PF4 E;  4X0R A;  4XEF A;  4JUR I;  3C8Z A;  5DQT A;  4CJG A;  1JRA A;  2DB4 A;  1CGN A;  4U9D A;  1QSP A;  3J06 A;  4JEA A;  2HS5 A;  2CNW A;  4OD5 A;  4PJN A;  3GEE A;  2IBF A;  4CS8 A;  3NRH A;  2Q00 A;  1GS9 A;  2LP4 A;  3IQ6 A;  2NUT A;  3AQB A;  3LLI A;  2QY9 A;  4JTC B;  3EGD B;  2J9V A;  3OA1 A;  4KNV A;  1CPQ A;  3L8J A;  4O6Y A;  3RH3 A;  1V74 B;  1JOG A;  1SZI A;  1T6Q A;  4NTF A;  3NYL A;  2OQM A;  2PP4 A;  1HY5 A;  3DAF A;  4XEV A;  4NQF A;  1APC A;  4LDQ A;  3K66 A;  4FWV A;  3DI5 A;  1SR2 A;  2Q3T A;  2WZF A;  3I4U A;  3C8G D;  4JZA A;  2YQY A;  3GEH A;  5KYN A;  1ORY A;  2XS1 A;  4E17 A;  5F5H A;  1OCZ C;  2Y39 A;  4JW1 A;  1NBB A;  2EPL X;  4EHP A;  4LDR A;  1BR1 A;  1K05 A;  2P0N A;  2Q9B A;  2Y3H A;  4MTF A;  2VCC A;  1MNE A;  2A68 F;  2LSE A;  1E2X A;  3JYY A;  1L7C A;  1NSG B;  2YLD A;  3FXH A;  5L0I A;  1NU7 D;  3O39 A;  2PBE A;  3B0U X;  4GQH A;  2OEV A;  4XEK A;  3DM9 B;  5JP7 A;  4XWJ A;  4OIQ F;  4CSA A;  2DGJ A;  3MLG A;  3O55 A;  3IPM O;  1BBH A;  5L0J A;  1VK5 A;  3DAG A;  4YL1 A;  3JRT A;  3MYI A;  1PD0 A;  4N4W A;  1NG1 A;  1RJ9 A;  3HNL A;  3RVZ A;  3TUL A;  2DYS C;  1NU9 C;  2HZ8 A;  4H4K C;  2R7U A;  1KU2 A;  2OEX A;  4OIN F;  3SZR A;  4E7Z A;  1DOV A;  1QQ3 A;  3QVY A;  1Q0G A;  1Z5Z A;  1YLM A;  2G3K A;  3M15 A;  4A4A A;  5KYX A;  5KYY B;  4QI2 A;  4XLP F;  2NUT B;  2A6E F;  1Z6A A;  3K7D A;  3ZVR A;  4HE8 D;  3IHU A;  2C03 A;  2WVO A;  2X51 A;  3AJM A;  4C3D A;  1BR4 A;  4U5F E;  4C3E A;  1H7I A;  1XWJ A;  3K1I A;  2YRF A;  3WHN A;  1E86 A;  3HNI A;  4C7O B;  4OIP F;  3B29 A;  3H2U A;  4JE9 A;  3SYN A;  3DKA A;  2L81 A;  3ECS A;  5L0C A;  2GAQ A;  1BDJ B;  3FVY A;  3IQ5 A;  2L6G A;  2FAP B;  4N6H A;  3FHD A;  4PK4 A;  3SXY A;  1WN0 A;  4LLC A;  2PNO A;  3UMK A;  3ITF A;  4P9T A;  4DBR A;  1T6I A;  1A7V A;  1TWG A;  5JVE A;  5JS5 A;  1D1C A;  3U3F A;  3HTK C;  2EPM X;  4O6N A;  3AG3 C;  3IQC A;  4YL0 A;  4Z9I A;  1HMO A;  2QTV A;  1ST6 A;  2GFH A;  4AK9 A;  1HMD A;  5A6J A;  3PCV A;  4MW8 A;  3X2Q C;  2A6H F;  4N6C A;  3R7C A;  3W8I A;  5KYW B;  2RSE B;  2KGO A;  2VCB A;  3K6B A;  4MW3 A;  3ABL C;  1QZX A;  1RCP A;  2ASR A;  3RW0 A;  5DS5 A;  5F5F A;  3VYW A;  4MVR A;  5EK0 A;  3EGX B;  4GYT A;  2J9W A;  2KC3 A;  1VYK A;  3S29 A;  4AL1 A;  2H7O A;  2J0W A;  2A0B A;  3AG4 C;  5L0F A;  2OCC C;  4Q4Z F;  2R7R A;  3T6B A;  3DE8 A;  1OW7 A;  3JSZ A;  3S90 A;  1MMG A;  3L0I A;  2W4M A;  3EFO B;  5FZT A;  3VM6 A;  5KYX B;  1TWC A;  2EIK C;  2M64 A;  3Q7G A;  3M79 A;  1D0Z A;  2P61 A;  4MVQ A;  4IAR A;  2R05 A;  2ZXO A;  2AU5 A;  1LS4 A;  4G0H A;  4AL0 A;  4JJG A;  2VB6 A;  5A6K A;  3ASN C;  4XLN F;  2A0U A;  3IEE A;  1JMW A;  3UMI A;  3M1C B;  3U0C A;  4YT8 A;  3EHM A;  1OR3 A;  2EPN A;  2EIN C;  2W4B A;  3ABK C;  1O87 A;  3U2L A;  4U5C E;  3VF0 A;  3B9Q A;  1WGW A;  2HJM A;  4CS9 A;  1QVX A;  2HKV A;  3CAX A;  1ZVZ A;  1OW6 A;  3DXJ F;  2J7P D;  3U8V A;  1G4W R;  3UMH A;  5B3S C;  2EPK X;  4K7B A;  2R7S A;  1ZU5 A;  3CZ6 A;  2XL8 A;  1A7E A;  5COG A;  5COM A;  2OJQ A;  1Y4C A;  4H54 A;  4RD9 A;  4RBN A;  1C17 M;  3EPV A;  1M2V A;  4PFO A;  5EHH A;  5HV9 A;  2P1A A;  4XPY A;  5CI9 A;  3U9M A;  4XTK A;  3AGU A;  2ZPA A;  4DXW A;  4MTO A;  3U2M A;  1Q0M A;  1C02 A;  2UUI A;  2B0J A;  4DRJ B;  5AC5 A;  1Z23 A;  4JRZ A;  4LAC B;  3E9V A;  1FR0 A;  5L0H A;  1NFO A;  1QLE C;  2YHS A;  3FOO A;  3SNH A;  4JKV A;  5JT4 A;  3Q6M A;  3QZC A;  4F4B A;  4YT2 A;  3EG9 A;  1NFN A;  3GM3 A;  3DZA A;  3AQC A;  1VTM P;  2J7P A;  4L6R A;  3C62 A;  2YL0 A;  3GAN A;  2WB7 A;  1OW8 A;  1OR2 A;  3LNM B;  3MX3 A;  4CDY A;  3PDM P;  3DM5 A;  4Q5S F;  3M4B A;  1M57 C;  3NKE A;  5F28 E;  2Q9C A;  3KYI A;  3EJN A;  4U5D E;  4PJM A;  4G78 A;  4CDA A;  1VMA A;  3FAJ A;  4LDK A;  4CIH A;  1WAS A;  2PX3 A;  3GM1 A;  3U3B A;  1K04 A;  3ZIB A;  3L34 A;  3CEX A;  5JUA A;  3ZC4 A;  2OJE D;  3VAY A;  4DVY P;  1RMV A;  2MHR A;  1SMY F;  1NZE A;  2R02 A;  2VH3 A;  3DJU B;  1VLT A;  4J7T A;  4MND A;  2IYL D;  2G62 A;  3EH1 A;  1D1B A;  2OOC A;  1Q0F A;  3KMI A;  4XPX A;  5B1B C;  1A41 A;  4EUK B;  1T01 A;  1D1A A;  2EIL C;  4WGY A;  3KH2 A;  3ZG1 A;  4DJ9 A;  4E18 A;  1WOL A;  2TMV P;  4CIP A;  4BJ6 A;  3SXK A;  1LPE A;  1I5N A;  2GWW A;  1Q0D A;  1M2V B;  2YVK A;  3JT1 A;  1C03 A;  3NYJ A;  5JRA A;  1H6G A;  2W45 A;  1XZQ A;  3R2P A;  3RQF A;  1RKE A;  1M2O A;  1H9T A;  2IOQ A;  1CGO A;  4MVO A;  3T4R A;  4CX9 A;  1HE9 A;  1YDI A;  2R25 A;  3H65 A;  2XRH A;  1T5O A;  3TD7 A;  1YA9 A;  4YT4 A;  2XXA A;  3ZWI A;  2PX0 A;  1CPR A;  1OQC A;  1YYJ A;  4I44 A;  4DBQ A;  2KSF A;  2R03 A;  3DJN B;  3U8P A;  1HW2 A;  4YK5 A;  4B6I A;  2XLW A;  2H8A A;  2VC9 A;  2L6F A;  4JTA B;  4QDL A;  4EBB A;  4ULV A;  4EBJ A;  3ZTM A;  1LI7 A;  3C8G A;  4HFK B;  3F47 A;  2LFD A;  1L3P A;  2BL2 A;  3W2W A;  3W8H A;  2QUP A;  3F46 A;  5BQG A;  3V5Z A;  3KYJ A;  3EH2 A;  5D91 A;  4W8K A;  4JVS A;  1UFB A;  3O6X A;  3LLK A;  5KYU A;  1LI5 A;  3UGP A;  2NUP A;  4JIO A;  3S84 A;  1FAP B;  1U89 A;  3ZTZ A;  1S05 A;  4XPW A;  1S7Z A;  4KNW A;  2XL6 A;  5FCL A;  2IM8 A;  4D4N A;  1M56 C;  2JD3 A;  5JLI A;  2WVQ A;  3GOR A; 
#chains in the Genus database with same CATH homology
 4JC7 A;  4YL1 A;  2PNO A;  4J7Y A;  4NTF A;  4BPM A;  5HV9 A;  3DWW A;  3HKK A;  4YK5 A;  2H8A A;  5K0I A;  4J7T A;  2UUI A;  4YL0 A;  4AL0 A;  5BQH A;  4JRZ A;  4JCZ A;  5BQG A;  3PCV A;  4NTA A;  2Q7R A;  5BQI A;  3LEO A;  2UUH A;  4YL3 A;  4NTB A;  4AL1 A;  3B29 A;  4WAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...