3DWWA

Electron crystallographic structure of human microsomal prostaglandin e synthase 1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
142
structure length
142
Chain Sequence
PALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin E synthase
publication title Structural basis for induced formation of the inflammatory mediator prostaglandin E2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 36
structure length 142
sequence length 142
chains with identical sequence B, C
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2008-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 3dwwA00
4YL3A 4NTFA 4BPMA 2UUIA 5K0IA 5BQIA 4J7YA 4NTAA 4WABA 4YL1A 4YK5A 4JRZA 2Q7RA 3B29A 5BQGA 4AL0A 2PNOA 3LEOA 4NTBA 3DWWA 4JCZA 2UUHA 5HV9A 4AL1A 4JC7A 2H8AA 4YL0A 3PCVA 4J7TA 3HKKA 5BQHA
chains in the Genus database with same CATH superfamily
2D5RB 2M4EA 2HMQA 1QQ3A 3RH3A 4Q7CA 3K1IA 4XPXA 2A0BA 3VRCA 2ZXWC 2WZGA 4WGYA 3N0TA 5JS5A 1Q0GA 1NBBA 2ICWG 4K0DA 2LFFA 4XTKA 2W4MA 4R32A 3UNGC 4YT4A 3RF3A 4ZLDA 3C18A 2BE5F 1M2VA 3EG9B 3NYJA 2KK1A 4G78A 4CSAA 4JTDB 2Q9CA 5KYXA 3CAXA 3HTKC 5B3SC 1CGME 3K7DA 2YKZA 1A7EA 3L1MA 3LEOA 2EINC 2QY9A 5JSLA 3VF0A 1R5ID 3C8GD 5HSWA 2I15A 5KYNA 3C7JA 2HSQA 4GEHA 3I4UA 2XXAB 4DRIB 4K1OA 4E0IA 5A6AA 3ZC4A 1V54C 1WTYA 3A9CA 1ST6A 2ASRA 2LFDA 1RXQA 4YL3A 3ZSUA 4E7SA 2H7BA 4OIPF 3ZG1A 2CYDA 1MNDA 1O87A 4CS9A 2XS1A 1BR4A 4WABA 2A0UA 3RKOF 3SZRA 5F28E 1YLMA 4LDQA 1H6GA 3G4ZA 4DVYP 2NPUA 1JAFA 4AL0A 3UGOA 2P1AA 3MYFA 5L3VA 4BJTA 2WL8A 5E3CA 3GEIA 4BJ5C 2QLAA 1BR2A 1VK5A 1LM3B 3IQTA 4MVQA 1O5HA 3NDBB 4U5HA 3T9OA 3DE8A 4B6IA 2WB7A 3O55A 3JRTA 3GEHA 1YDIA 2KQ9A 2Y69C 2YRFA 4OD4A 1PD1A 5JT4A 2Q9BA 4J7TA 4E18A 2HSBA 3CZ6A 2OU6A 3QVZA 5BQHA 1SYQA 3FHDA 4FAPB 1ORJA 3NMJA 4NTFA 4PR9A 1J8YF 1M2VB 2YLGA 3JSZA 4MVOA 4WGZA 2B0JA 3ZTZA 4E17A 3T6GB 5EGYA 5KYXB 3PHF2 5A6BA 4G7HF 1WASA 3ABMC 3KYJA 4U5FE 3O6XA 3FOPA 1VTMP 2WZFA 3EHMA 4YK5A 3VYWA 2R7RA 4JRZA 4BEJA 5KYWA 4BJ1A 2KYHA 2ZXRA 2A68F 1SR2A 2XL8A 3TOMA 3QMKA 1AVOB 1FMVA 2VCBA 4QI0A 1ZHYA 4EUKB 2P7VA 4MQ9F 4Z9HA 4RDAA 4WJ0A 3RQGA 4KNVA 2ZPAA 2LK4A 4IAQA 1KNYA 3NG1A 4IAOA 1TWHA 4CS8C 3LNMB 4YL0A 1C03A 5COGA 1T5OA 1ZZPA 3LESA 3NKEA 3AOUA 5KYYA 2J9WA 3UGPA 2YL1A 3GEEA 1CPQA 2OJQA 5JVEA 3HNJA 5K0IA 2CNWA 2TMVP 3S0XA 3HNKA 3ZDLA 4PJJA 4J7YA 5T3WA 3ZQVA 1T6IA 2X51A 3NYMA 1U6HA 1VYIA 4CJGA 2XRHA 1AEPA 1RKCA 2KSFA 3AJMA 2C03A 4H4KC 4IWBA 4CDYA 1Y6DA 1WN0A 2EIJC 1YZCA 3FMSA 3EJNA 3S27A 1VLSA 2EIMC 3ASOC 3ZTMA 1FFTC 1OCOC 2AWCA 2HJ3A 2PNOA 4ULWA 4MVMA 3G50A 4H54A 4BEMJ 1OKKD 4O79A 1LE4A 4DOZA 3SXZA 5FZTA 1T9KA 1FMWA 3JTLO 4BJ5A 1TWCA 5L0HA 1KTMA 5JP7A 3ZIBA 4MVRA 1BZ4A 2LSEA 4G0HA 4IJJA 3M15A 1Z23A 1I5NA 1E84A 2A69F 2CGEA 5KYWB 1HE9A 1NZEA 4YN0B 1LPEA 2HJMA 1GM5A 3EQLF 1NFNA 2PP4A 3EFOB 1RMVA 1WWPA 2HV6A 1TR2A 3RQFA 4U9DA 3C8GA 4FESA 4CDVA 2H7VC 2NG1A 3WHNA 3JT1A 4JJGA 2FAPB 1MMNA 2RD9A 2YVKA 3J06A 5L0GA 1OCCC 2P61A 1LIHA 4XPWA 4XLNF 2H7OA 2L6FA 3S84A 2MYSA 1C17M 1WATA 5KYYB 2VCAA 4Q5SF 2R7VA 2G3KA 4IB4A 3ABLC 3DM9B 4JCZA 1ZU5A 4AL1A 2O9XA 4N6CA 4JW1A 2Z15A 2WZLA 4D4NA 1PV3A 4U5GA 4Z9IA 2DGJA 1BBHA 2XLWA 4CS8A 1EA8A 3DAFA 2R05A 3K66A 3QZCA 2XLVA 1AUEA 3V7OA 3X1OA 5L0DA 2KNHA 2Y3HA 1FNTc 1C02A 3HNIA 5T1DB 1VMAA 2F22A 3B9QA 2Y39A 1Z7Qc 5B1BC 3SP1A 1E85A 3L34A 1UFBA 2KJGA 2YLDA 1A7VA 4ZLCA 2YEVA 4CS7A 4IRUA 5F5FA 3IHUA 4EKWA 3SEOA 2XL6A 5T3TA 4HEAJ 1M57C 3TQOA 3F46A 3E9VA 1N1CA 1MMAA 4JURI 3C8ZA 1LS1A 3HJCA 3S28A 3MLGA 1G4WR 1V74B 1XZQA 1EKYA 2NUPA 2Y3DA 1I4YA 3DJNB 2P0NA 4EBKA 2YWAA 4DRJB 2GFHA 4N6HA 2P6VA 4U5BE 4XQ1A 2H8AA 2YL0A 3C8GB 3DXJF 2HFIA 2OG2A 1WGWA 2D4UA 3LS0A 2EIKC 4Z9JA 2J0XA 5L0JA 3DMDA 5L0CA 2X0CA 3B71A 3ZVRA 3DI5A 2LCHA 2J7PA 2EPKX 2LIGA 4KC9A 1LVKA 2M64A 2CW0F 3FAPB 1RKEA 2A6EF 3U0CA 3F47A 1T01A 3EZHA 1YYXA 1JOGA 3X2QC 1U0BB 1OQCA 4EHPA 3QW0A 5DQZA 1HE1A 3DD7A 4JIOA 4QDLA 4U9EA 1EQ1A 3LJBA 2JPUA 4KBLA 2XSEA 4MVZA 1T6QA 4XEKA 4C7OA 4CBEA 2XS8A 5AC5A 2HMZA 2R03A 3R7CA 3DE9A 2J9VA 2YLIA 3I5PA 2J9UA 3TULA 1LKXA 3HNLA 3GM1A 2V3CC 3EGDA 1VOMA 1QVXA 2OJED 4W8KA 2L7AA 4XPYA 3U3FA 2XLOA 3KYIA 3MX3A 4NTAA 1ZHTA 2DI3A 1TQGA 3B0VC 2NUPB 4MW3A 5BUOA 3EGXA 2MHRA 3H2VA 3V5YA 3N2ZB 1A7DA 1TFKB 2R25A 3EFOA 4O6MA 2EPLX 2XM4A 3AG1C 3C63A 4JVSA 4DRHB 4XWJA 3QVYA 1T6UA 2JD3A 4AX2A 3NMIA 5F5HA 5E3AA 3EHNA 1JPJA 1YARO 1OW7A 3M1CB 4P6IC 4NQFA 3BRJA 2VB6A 4M63A 4PJLA 3JYHA 1Z5ZA 3JYYA 2VASA 4X0RA 4I1OB 2LQGA 4K7BA 3NYLA 1E86A 2J46A 1RKEB 3E70C 3L0IA 2LP4A 3MBGA 3MYIA 1EI7A 2ZXPA 2FGYA 1V4AA 3GWNA 1V55C 1YA7O 5A6KA 5JRAA 1ZHXA 2OOCA 2A1DD 2XM0A 1MMGA 4D4XA 3SXYA 3W8HA 1RJ9B 3JCUQ 3U2LA 3UMHA 3W8IA 4PACA 5A6JA 2YL3A 4HFFB 4C7OB 3AG2C 1HY5A 1ZW2A 3ECSA 2RSEB 2QUPA 3IQ6A 3UR3C 4YT8A 2L9JA 3EGDB 1YZAA 2XLMA 2Y3BA 3T4RA 3K33A 3BEHA 3IEEA 3Q7GA 2W4BA 3DZAA 1L7CA 3UMIA 4ER9A 2NSFA 5B3IA 1TFOB 1BDJB 1OXKA 5L0IA 3EGXB 2R7SA 3M4CA 4OIQF 3PDMP 4G7ZF 4N06A 1D0ZA 5A69A 1YYJA 3PMRA 1M6TA 4EWCA 3SXMA 4ANJA 1S05A 2G62A 3LLKA 3CSKA 4JZAA 1H9TA 5IY5C 1WOLA 2IBFA 2PX3A 4LLEA 5B1AC 3WODF 5EHHA 2Q3TA 3ABKC 1ZHZA 2VH3A 3AQBA 1JMWA 4JE9A 1QLEC 4JJFA 4JKVA 2NUTA 3T6BA 4DJ9A 1K40A 4U5DE 3OWTA 1JPNA 3TK0A 1XZPA 2R7UA 4HFKB 1HW2A 2R7TA 2OKUA 1JRAA 3AG3C 5A6BD 3GM3A 2ZD9A 4PFPA 4G7OF 2W9YA 3V5ZA 4AK9A 2VC9A 1K04A 2ETSA 3IQ5A 4O7GA 2JX0A 2OCCC 1SF8A 5COMA 1PCXA 3AQCA 3I5QA 1Q0MA 3KKBA 4NCQA 3US6A 1B68A 4C3BA 5DLJA 2YHSA 4LLCA 4CIHA 5KYUA 4MW8A 2PBEA 2AWYA 4LDRA 3KPHA 3R2PA 2PX0A 4JEBA 3POVA 1Z6AA 2KC3A 3CEXA 4LACB 4PJMA 1FR0A 3ATPA 1OCZC 2QE9A 1JR8A 4MVUA 3GM2A 5FCLA 4JCHA 1NSGB 1NFOA 1Q0KA 2OEVA 4PFOA 2QNLA 3NRHA 2L6HA 2AP3A 3HLZA 3DAGA 3RYLA 2FFHA 1MNEA 1NG1A 1ZVZA 3NKDA 4RBNA 4Q4ZF 4MVSA 1YAUO 4EBBA 4LDKA 2Q00A 1MMDA 1HMOA 1LI5A 4LERA 5HV9A 3MFNA 3H2UA 3M79A 3S9OA 4XLPF 1GS9A 4MTGA 1QSPA 2R7OA 1YA9A 3JRMO 3U8PA 4XEFA 3M4BA 4MTFA 4NC3A 2G3VA 2NUTB 1ZW3A 1VLTA 5JLIA 4I1MA 1D1CA 2I8BA 5CI8A 3GWLA 4F4BA 5E33A 3U8VA 2AU5A 3U9MA 1OCRC 1A41A 1FTSA 1LI7A 3GORA 2XLEA 1D1AA 3LNRA 4IGGA 3AG4C 3IPMO 4YL1A 1R4TA 1I4ZA 5DVWA 4A4AA 5DS6A 1TWGA 5L3QA 3FDQA 4I44A 1BR1A 1TWAA 1IW7F 2IXMA 3W2VA 1VYKA 3EZIA 1W2WA 2A6HF 2QTVA 2Q9AA 2CDQA 4CX9A 3RW0A 3DWWA 2DYSC 4CDAA 3NMKA 5KYUB 4QI2A 1GQAA 1RJ9A 2XLHA 1GGQA 3C62A 2L6GA 1OR3A 1APCA 3U5SA 2IM8A 4KI2A 1OR2A 2EPNA 1HMDA 1H7IA 1OW6A 1CPRA 3FXHA 5L0FA 2WVOA 3ASNC 1TKNA 4P9TA 1DOVA 1OW8A 4BPMA 4C3EA 3GANA 2MWQA 5DQTA 2GA0A 2J45A 1O3UA 4E7ZA 1ZYRF 1M2OA 3GODA 1OKKA 3U3BA 5E2QA 2IXPA 3UMKA 1QPUA 1D0YA 1S7ZA 2XLDA 4C3DA 4DVZA 2Q7RA 3T6JA 1E83A 2V26A 3ZQYA 3OEOA 2E87A 3QW1A 3AGTA 3W2WA 3WAQA 1CGOA 2PF4E 3IQCA 1L3PA 1HW1A 1Y4CA 1YVIA 3LUTB 4JTAB 2HUJA 3TD7A 2R9RB 1SZIA 3OA1A 3VM6A 1CGNA 3ITFA 2UUHA 4KNWA 3AGUA 2GWWA 1QKRA 2OQMA 1XWJA 3CQZA 4JEAA 4OINF 3SNHA 2J0WA 3K1HA 4DBQA 5CIVA 2BC5A 3LAYA 3SXKA 1NU7D 3HKKA 3L8JA 4I3MA 4EIYA 1M56C 1ZU4A 4BJ6C 1H9GA 1RCPA 2HV7A 3K6BA 1G5ZA 2NSGA 4AE4A 2UUIA 1DOWA 3KH2A 4O6YA 4FX5A 4NY3A 5DS4A 1D1BA 4HE8D 2L81A 3RIPA 3S29A 2KGOA 2W45A 4PJNA 3B0PA 1ORSC 3JZ0A 1ZHWA 5BQGA 4DBRA 2IXOA 3Q7LA 4YJWA 1VB5A 4A2NB 1SMYF 4ULVA 4BG0A 3DJUB 3LLIA 2J7PD 2YL7A 4W8PA 4J30B 5AGFA 2IXNA 5DS5A 1MQVA 2ZXOA 3N24A 4JC7A 3U9JA 2KW3C 4MNDA 3PCVA 1KU2A 3K1IC 4EBJA 1LS4A 3EH1A 4OIRF 3LEVA 3U2MA 2EPOA 2IYLD 3DM5A 4YT5A 3VAYA 1Q0DA 1OXBA 2J9BA 4IARA 2WVQA 4L6RA 1ORYA 3KL4A 4MS2A 4J32B 5AC4A 5BQIA 4RD9A 4JTCB 4CSAC 5COFA 4N4WA 2GDCA 1UG7A 4OIOF 1Z3IX 2XL4A 2BL2A 3EH2A 3KMIA 3O10A 3B29A 3O39A 3ZWIA 3S90A 2GAQA 3WG7C 256BA 3JSEO 4CIPA 1U89A 5TJ5E 3G4XA 4U5CE 1F1MA 2HS5A 4FWVA 2IOQA 2Y3GA 4E0HA 3EPVA 5EK0A 1Q0FA 3FVYA 3RFYA 2AVKA 3A11A 3EG9A 3LS1A 2OEXA 3RVZA 3TOLA 4AE4B 4CJOA 3L8IA 1NLXA 1A0BA 2EPMX 3SYNA 3TJ5A 2CCYA 2Q4FA 4CS9C 1Z63A 2J8WA 3B0UX 1LE2A 4GQHA 1FAPB 3DKAA 4O6NA 3H65A 1G8XA 2WVNA 4PK4A 4XEVA 1FFHA 3W4YA 4BJ6A 5JUAA 3FOOA 1QZXA 4MTOA 5GPGB 2XXAA 1K05A 3RQEA 2C04A 1E2XA 1NU9C 1PD0A 3FAJA 4GYTA 2YQYA 1YJGA 2R7WA 2R7QA 1D0XA 5D92A 2B0HA 1J8MF 3Q6MA 5D91A 4P9FA 1IZMA 2HKVA 2LD6A 4ONSA 3V5XA 2PFDA 2VCCA 2CNWD 2R02A 3Q6NA 2HZ8A 4NTBA 1G4US 5CI9A 4YWQA 2DB4A 3RVYA 3TJ6A 4DXWA 3QTHA 2DYRC 2EILC 2R7XA 4UDVA 4U5EE 4OD5A 4YT2A 2YZSA
chains in the Genus database with same CATH topology
4YL3A 4NTFA 4BPMA 2UUIA 5K0IA 5BQIA 4J7YA 4NTAA 4WABA 4YL1A 4YK5A 4JRZA 2Q7RA 3B29A 5BQGA 4AL0A 2PNOA 3LEOA 4NTBA 3DWWA 4JCZA 2UUHA 5HV9A 4AL1A 4JC7A 2H8AA 4YL0A 3PCVA 4J7TA 3HKKA 5BQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL3 A;  4NTF A;  4BPM A;  2UUI A;  5K0I A;  5BQI A;  4J7Y A;  4NTA A;  4WAB A;  4YL1 A;  4YK5 A;  4JRZ A;  2Q7R A;  3B29 A;  5BQG A;  4AL0 A;  2PNO A;  3LEO A;  4NTB A;  3DWW A;  4JCZ A;  2UUH A;  5HV9 A;  4AL1 A;  4JC7 A;  2H8A A;  4YL0 A;  3PCV A;  4J7T A;  3HKK A;  5BQH A; 
#chains in the Genus database with same CATH topology
 2D5R B;  2M4E A;  2HMQ A;  1QQ3 A;  3RH3 A;  4Q7C A;  3K1I A;  4XPX A;  2A0B A;  3VRC A;  2ZXW C;  2WZG A;  4WGY A;  3N0T A;  5JS5 A;  1Q0G A;  1NBB A;  2ICW G;  4K0D A;  2LFF A;  4XTK A;  2W4M A;  4R32 A;  3UNG C;  4YT4 A;  3RF3 A;  4ZLD A;  3C18 A;  2BE5 F;  1M2V A;  3EG9 B;  3NYJ A;  2KK1 A;  4G78 A;  4CSA A;  4JTD B;  2Q9C A;  5KYX A;  3CAX A;  3HTK C;  5B3S C;  1CGM E;  3K7D A;  2YKZ A;  1A7E A;  3L1M A;  3LEO A;  2EIN C;  2QY9 A;  5JSL A;  3VF0 A;  1R5I D;  3C8G D;  5HSW A;  2I15 A;  5KYN A;  3C7J A;  2HSQ A;  4GEH A;  3I4U A;  2XXA B;  4DRI B;  4K1O A;  4E0I A;  5A6A A;  3ZC4 A;  1V54 C;  1WTY A;  3A9C A;  1ST6 A;  2ASR A;  2LFD A;  1RXQ A;  4YL3 A;  3ZSU A;  4E7S A;  2H7B A;  4OIP F;  3ZG1 A;  2CYD A;  1MND A;  1O87 A;  4CS9 A;  2XS1 A;  1BR4 A;  4WAB A;  2A0U A;  3RKO F;  3SZR A;  5F28 E;  1YLM A;  4LDQ A;  1H6G A;  3G4Z A;  4DVY P;  2NPU A;  1JAF A;  4AL0 A;  3UGO A;  2P1A A;  3MYF A;  5L3V A;  4BJT A;  2WL8 A;  5E3C A;  3GEI A;  4BJ5 C;  2QLA A;  1BR2 A;  1VK5 A;  1LM3 B;  3IQT A;  4MVQ A;  1O5H A;  3NDB B;  4U5H A;  3T9O A;  3DE8 A;  4B6I A;  2WB7 A;  3O55 A;  3JRT A;  3GEH A;  1YDI A;  2KQ9 A;  2Y69 C;  2YRF A;  4OD4 A;  1PD1 A;  5JT4 A;  2Q9B A;  4J7T A;  4E18 A;  2HSB A;  3CZ6 A;  2OU6 A;  3QVZ A;  5BQH A;  1SYQ A;  3FHD A;  4FAP B;  1ORJ A;  3NMJ A;  4NTF A;  4PR9 A;  1J8Y F;  1M2V B;  2YLG A;  3JSZ A;  4MVO A;  4WGZ A;  2B0J A;  3ZTZ A;  4E17 A;  3T6G B;  5EGY A;  5KYX B;  3PHF 2;  5A6B A;  4G7H F;  1WAS A;  3ABM C;  3KYJ A;  4U5F E;  3O6X A;  3FOP A;  1VTM P;  2WZF A;  3EHM A;  4YK5 A;  3VYW A;  2R7R A;  4JRZ A;  4BEJ A;  5KYW A;  4BJ1 A;  2KYH A;  2ZXR A;  2A68 F;  1SR2 A;  2XL8 A;  3TOM A;  3QMK A;  1AVO B;  1FMV A;  2VCB A;  4QI0 A;  1ZHY A;  4EUK B;  2P7V A;  4MQ9 F;  4Z9H A;  4RDA A;  4WJ0 A;  3RQG A;  4KNV A;  2ZPA A;  2LK4 A;  4IAQ A;  1KNY A;  3NG1 A;  4IAO A;  1TWH A;  4CS8 C;  3LNM B;  4YL0 A;  1C03 A;  5COG A;  1T5O A;  1ZZP A;  3LES A;  3NKE A;  3AOU A;  5KYY A;  2J9W A;  3UGP A;  2YL1 A;  3GEE A;  1CPQ A;  2OJQ A;  5JVE A;  3HNJ A;  5K0I A;  2CNW A;  2TMV P;  3S0X A;  3HNK A;  3ZDL A;  4PJJ A;  4J7Y A;  5T3W A;  3ZQV A;  1T6I A;  2X51 A;  3NYM A;  1U6H A;  1VYI A;  4CJG A;  2XRH A;  1AEP A;  1RKC A;  2KSF A;  3AJM A;  2C03 A;  4H4K C;  4IWB A;  4CDY A;  1Y6D A;  1WN0 A;  2EIJ C;  1YZC A;  3FMS A;  3EJN A;  3S27 A;  1VLS A;  2EIM C;  3ASO C;  3ZTM A;  1FFT C;  1OCO C;  2AWC A;  2HJ3 A;  2PNO A;  4ULW A;  4MVM A;  3G50 A;  4H54 A;  4BEM J;  1OKK D;  4O79 A;  1LE4 A;  4DOZ A;  3SXZ A;  5FZT A;  1T9K A;  1FMW A;  3JTL O;  4BJ5 A;  1TWC A;  5L0H A;  1KTM A;  5JP7 A;  3ZIB A;  4MVR A;  1BZ4 A;  2LSE A;  4G0H A;  4IJJ A;  3M15 A;  1Z23 A;  1I5N A;  1E84 A;  2A69 F;  2CGE A;  5KYW B;  1HE9 A;  1NZE A;  4YN0 B;  1LPE A;  2HJM A;  1GM5 A;  3EQL F;  1NFN A;  2PP4 A;  3EFO B;  1RMV A;  1WWP A;  2HV6 A;  1TR2 A;  3RQF A;  4U9D A;  3C8G A;  4FES A;  4CDV A;  2H7V C;  2NG1 A;  3WHN A;  3JT1 A;  4JJG A;  2FAP B;  1MMN A;  2RD9 A;  2YVK A;  3J06 A;  5L0G A;  1OCC C;  2P61 A;  1LIH A;  4XPW A;  4XLN F;  2H7O A;  2L6F A;  3S84 A;  2MYS A;  1C17 M;  1WAT A;  5KYY B;  2VCA A;  4Q5S F;  2R7V A;  2G3K A;  4IB4 A;  3ABL C;  3DM9 B;  4JCZ A;  1ZU5 A;  4AL1 A;  2O9X A;  4N6C A;  4JW1 A;  2Z15 A;  2WZL A;  4D4N A;  1PV3 A;  4U5G A;  4Z9I A;  2DGJ A;  1BBH A;  2XLW A;  4CS8 A;  1EA8 A;  3DAF A;  2R05 A;  3K66 A;  3QZC A;  2XLV A;  1AUE A;  3V7O A;  3X1O A;  5L0D A;  2KNH A;  2Y3H A;  1FNT c;  1C02 A;  3HNI A;  5T1D B;  1VMA A;  2F22 A;  3B9Q A;  2Y39 A;  1Z7Q c;  5B1B C;  3SP1 A;  1E85 A;  3L34 A;  1UFB A;  2KJG A;  2YLD A;  1A7V A;  4ZLC A;  2YEV A;  4CS7 A;  4IRU A;  5F5F A;  3IHU A;  4EKW A;  3SEO A;  2XL6 A;  5T3T A;  4HEA J;  1M57 C;  3TQO A;  3F46 A;  3E9V A;  1N1C A;  1MMA A;  4JUR I;  3C8Z A;  1LS1 A;  3HJC A;  3S28 A;  3MLG A;  1G4W R;  1V74 B;  1XZQ A;  1EKY A;  2NUP A;  2Y3D A;  1I4Y A;  3DJN B;  2P0N A;  4EBK A;  2YWA A;  4DRJ B;  2GFH A;  4N6H A;  2P6V A;  4U5B E;  4XQ1 A;  2H8A A;  2YL0 A;  3C8G B;  3DXJ F;  2HFI A;  2OG2 A;  1WGW A;  2D4U A;  3LS0 A;  2EIK C;  4Z9J A;  2J0X A;  5L0J A;  3DMD A;  5L0C A;  2X0C A;  3B71 A;  3ZVR A;  3DI5 A;  2LCH A;  2J7P A;  2EPK X;  2LIG A;  4KC9 A;  1LVK A;  2M64 A;  2CW0 F;  3FAP B;  1RKE A;  2A6E F;  3U0C A;  3F47 A;  1T01 A;  3EZH A;  1YYX A;  1JOG A;  3X2Q C;  1U0B B;  1OQC A;  4EHP A;  3QW0 A;  5DQZ A;  1HE1 A;  3DD7 A;  4JIO A;  4QDL A;  4U9E A;  1EQ1 A;  3LJB A;  2JPU A;  4KBL A;  2XSE A;  4MVZ A;  1T6Q A;  4XEK A;  4C7O A;  4CBE A;  2XS8 A;  5AC5 A;  2HMZ A;  2R03 A;  3R7C A;  3DE9 A;  2J9V A;  2YLI A;  3I5P A;  2J9U A;  3TUL A;  1LKX A;  3HNL A;  3GM1 A;  2V3C C;  3EGD A;  1VOM A;  1QVX A;  2OJE D;  4W8K A;  2L7A A;  4XPY A;  3U3F A;  2XLO A;  3KYI A;  3MX3 A;  4NTA A;  1ZHT A;  2DI3 A;  1TQG A;  3B0V C;  2NUP B;  4MW3 A;  5BUO A;  3EGX A;  2MHR A;  3H2V A;  3V5Y A;  3N2Z B;  1A7D A;  1TFK B;  2R25 A;  3EFO A;  4O6M A;  2EPL X;  2XM4 A;  3AG1 C;  3C63 A;  4JVS A;  4DRH B;  4XWJ A;  3QVY A;  1T6U A;  2JD3 A;  4AX2 A;  3NMI A;  5F5H A;  5E3A A;  3EHN A;  1JPJ A;  1YAR O;  1OW7 A;  3M1C B;  4P6I C;  4NQF A;  3BRJ A;  2VB6 A;  4M63 A;  4PJL A;  3JYH A;  1Z5Z A;  3JYY A;  2VAS A;  4X0R A;  4I1O B;  2LQG A;  4K7B A;  3NYL A;  1E86 A;  2J46 A;  1RKE B;  3E70 C;  3L0I A;  2LP4 A;  3MBG A;  3MYI A;  1EI7 A;  2ZXP A;  2FGY A;  1V4A A;  3GWN A;  1V55 C;  1YA7 O;  5A6K A;  5JRA A;  1ZHX A;  2OOC A;  2A1D D;  2XM0 A;  1MMG A;  4D4X A;  3SXY A;  3W8H A;  1RJ9 B;  3JCU Q;  3U2L A;  3UMH A;  3W8I A;  4PAC A;  5A6J A;  2YL3 A;  4HFF B;  4C7O B;  3AG2 C;  1HY5 A;  1ZW2 A;  3ECS A;  2RSE B;  2QUP A;  3IQ6 A;  3UR3 C;  4YT8 A;  2L9J A;  3EGD B;  1YZA A;  2XLM A;  2Y3B A;  3T4R A;  3K33 A;  3BEH A;  3IEE A;  3Q7G A;  2W4B A;  3DZA A;  1L7C A;  3UMI A;  4ER9 A;  2NSF A;  5B3I A;  1TFO B;  1BDJ B;  1OXK A;  5L0I A;  3EGX B;  2R7S A;  3M4C A;  4OIQ F;  3PDM P;  4G7Z F;  4N06 A;  1D0Z A;  5A69 A;  1YYJ A;  3PMR A;  1M6T A;  4EWC A;  3SXM A;  4ANJ A;  1S05 A;  2G62 A;  3LLK A;  3CSK A;  4JZA A;  1H9T A;  5IY5 C;  1WOL A;  2IBF A;  2PX3 A;  4LLE A;  5B1A C;  3WOD F;  5EHH A;  2Q3T A;  3ABK C;  1ZHZ A;  2VH3 A;  3AQB A;  1JMW A;  4JE9 A;  1QLE C;  4JJF A;  4JKV A;  2NUT A;  3T6B A;  4DJ9 A;  1K40 A;  4U5D E;  3OWT A;  1JPN A;  3TK0 A;  1XZP A;  2R7U A;  4HFK B;  1HW2 A;  2R7T A;  2OKU A;  1JRA A;  3AG3 C;  5A6B D;  3GM3 A;  2ZD9 A;  4PFP A;  4G7O F;  2W9Y A;  3V5Z A;  4AK9 A;  2VC9 A;  1K04 A;  2ETS A;  3IQ5 A;  4O7G A;  2JX0 A;  2OCC C;  1SF8 A;  5COM A;  1PCX A;  3AQC A;  3I5Q A;  1Q0M A;  3KKB A;  4NCQ A;  3US6 A;  1B68 A;  4C3B A;  5DLJ A;  2YHS A;  4LLC A;  4CIH A;  5KYU A;  4MW8 A;  2PBE A;  2AWY A;  4LDR A;  3KPH A;  3R2P A;  2PX0 A;  4JEB A;  3POV A;  1Z6A A;  2KC3 A;  3CEX A;  4LAC B;  4PJM A;  1FR0 A;  3ATP A;  1OCZ C;  2QE9 A;  1JR8 A;  4MVU A;  3GM2 A;  5FCL A;  4JCH A;  1NSG B;  1NFO A;  1Q0K A;  2OEV A;  4PFO A;  2QNL A;  3NRH A;  2L6H A;  2AP3 A;  3HLZ A;  3DAG A;  3RYL A;  2FFH A;  1MNE A;  1NG1 A;  1ZVZ A;  3NKD A;  4RBN A;  4Q4Z F;  4MVS A;  1YAU O;  4EBB A;  4LDK A;  2Q00 A;  1MMD A;  1HMO A;  1LI5 A;  4LER A;  5HV9 A;  3MFN A;  3H2U A;  3M79 A;  3S9O A;  4XLP F;  1GS9 A;  4MTG A;  1QSP A;  2R7O A;  1YA9 A;  3JRM O;  3U8P A;  4XEF A;  3M4B A;  4MTF A;  4NC3 A;  2G3V A;  2NUT B;  1ZW3 A;  1VLT A;  5JLI A;  4I1M A;  1D1C A;  2I8B A;  5CI8 A;  3GWL A;  4F4B A;  5E33 A;  3U8V A;  2AU5 A;  3U9M A;  1OCR C;  1A41 A;  1FTS A;  1LI7 A;  3GOR A;  2XLE A;  1D1A A;  3LNR A;  4IGG A;  3AG4 C;  3IPM O;  4YL1 A;  1R4T A;  1I4Z A;  5DVW A;  4A4A A;  5DS6 A;  1TWG A;  5L3Q A;  3FDQ A;  4I44 A;  1BR1 A;  1TWA A;  1IW7 F;  2IXM A;  3W2V A;  1VYK A;  3EZI A;  1W2W A;  2A6H F;  2QTV A;  2Q9A A;  2CDQ A;  4CX9 A;  3RW0 A;  3DWW A;  2DYS C;  4CDA A;  3NMK A;  5KYU B;  4QI2 A;  1GQA A;  1RJ9 A;  2XLH A;  1GGQ A;  3C62 A;  2L6G A;  1OR3 A;  1APC A;  3U5S A;  2IM8 A;  4KI2 A;  1OR2 A;  2EPN A;  1HMD A;  1H7I A;  1OW6 A;  1CPR A;  3FXH A;  5L0F A;  2WVO A;  3ASN C;  1TKN A;  4P9T A;  1DOV A;  1OW8 A;  4BPM A;  4C3E A;  3GAN A;  2MWQ A;  5DQT A;  2GA0 A;  2J45 A;  1O3U A;  4E7Z A;  1ZYR F;  1M2O A;  3GOD A;  1OKK A;  3U3B A;  5E2Q A;  2IXP A;  3UMK A;  1QPU A;  1D0Y A;  1S7Z A;  2XLD A;  4C3D A;  4DVZ A;  2Q7R A;  3T6J A;  1E83 A;  2V26 A;  3ZQY A;  3OEO A;  2E87 A;  3QW1 A;  3AGT A;  3W2W A;  3WAQ A;  1CGO A;  2PF4 E;  3IQC A;  1L3P A;  1HW1 A;  1Y4C A;  1YVI A;  3LUT B;  4JTA B;  2HUJ A;  3TD7 A;  2R9R B;  1SZI A;  3OA1 A;  3VM6 A;  1CGN A;  3ITF A;  2UUH A;  4KNW A;  3AGU A;  2GWW A;  1QKR A;  2OQM A;  1XWJ A;  3CQZ A;  4JEA A;  4OIN F;  3SNH A;  2J0W A;  3K1H A;  4DBQ A;  5CIV A;  2BC5 A;  3LAY A;  3SXK A;  1NU7 D;  3HKK A;  3L8J A;  4I3M A;  4EIY A;  1M56 C;  1ZU4 A;  4BJ6 C;  1H9G A;  1RCP A;  2HV7 A;  3K6B A;  1G5Z A;  2NSG A;  4AE4 A;  2UUI A;  1DOW A;  3KH2 A;  4O6Y A;  4FX5 A;  4NY3 A;  5DS4 A;  1D1B A;  4HE8 D;  2L81 A;  3RIP A;  3S29 A;  2KGO A;  2W45 A;  4PJN A;  3B0P A;  1ORS C;  3JZ0 A;  1ZHW A;  5BQG A;  4DBR A;  2IXO A;  3Q7L A;  4YJW A;  1VB5 A;  4A2N B;  1SMY F;  4ULV A;  4BG0 A;  3DJU B;  3LLI A;  2J7P D;  2YL7 A;  4W8P A;  4J30 B;  5AGF A;  2IXN A;  5DS5 A;  1MQV A;  2ZXO A;  3N24 A;  4JC7 A;  3U9J A;  2KW3 C;  4MND A;  3PCV A;  1KU2 A;  3K1I C;  4EBJ A;  1LS4 A;  3EH1 A;  4OIR F;  3LEV A;  3U2M A;  2EPO A;  2IYL D;  3DM5 A;  4YT5 A;  3VAY A;  1Q0D A;  1OXB A;  2J9B A;  4IAR A;  2WVQ A;  4L6R A;  1ORY A;  3KL4 A;  4MS2 A;  4J32 B;  5AC4 A;  5BQI A;  4RD9 A;  4JTC B;  4CSA C;  5COF A;  4N4W A;  2GDC A;  1UG7 A;  4OIO F;  1Z3I X;  2XL4 A;  2BL2 A;  3EH2 A;  3KMI A;  3O10 A;  3B29 A;  3O39 A;  3ZWI A;  3S90 A;  2GAQ A;  3WG7 C;  256B A;  3JSE O;  4CIP A;  1U89 A;  5TJ5 E;  3G4X A;  4U5C E;  1F1M A;  2HS5 A;  4FWV A;  2IOQ A;  2Y3G A;  4E0H A;  3EPV A;  5EK0 A;  1Q0F A;  3FVY A;  3RFY A;  2AVK A;  3A11 A;  3EG9 A;  3LS1 A;  2OEX A;  3RVZ A;  3TOL A;  4AE4 B;  4CJO A;  3L8I A;  1NLX A;  1A0B A;  2EPM X;  3SYN A;  3TJ5 A;  2CCY A;  2Q4F A;  4CS9 C;  1Z63 A;  2J8W A;  3B0U X;  1LE2 A;  4GQH A;  1FAP B;  3DKA A;  4O6N A;  3H65 A;  1G8X A;  2WVN A;  4PK4 A;  4XEV A;  1FFH A;  3W4Y A;  4BJ6 A;  5JUA A;  3FOO A;  1QZX A;  4MTO A;  5GPG B;  2XXA A;  1K05 A;  3RQE A;  2C04 A;  1E2X A;  1NU9 C;  1PD0 A;  3FAJ A;  4GYT A;  2YQY A;  1YJG A;  2R7W A;  2R7Q A;  1D0X A;  5D92 A;  2B0H A;  1J8M F;  3Q6M A;  5D91 A;  4P9F A;  1IZM A;  2HKV A;  2LD6 A;  4ONS A;  3V5X A;  2PFD A;  2VCC A;  2CNW D;  2R02 A;  3Q6N A;  2HZ8 A;  4NTB A;  1G4U S;  5CI9 A;  4YWQ A;  2DB4 A;  3RVY A;  3TJ6 A;  4DXW A;  3QTH A;  2DYR C;  2EIL C;  2R7X A;  4UDV A;  4U5E E;  4OD5 A;  4YT2 A;  2YZS A; 
#chains in the Genus database with same CATH homology
 4YL3 A;  4NTF A;  4BPM A;  2UUI A;  5K0I A;  5BQI A;  4J7Y A;  4NTA A;  4WAB A;  4YL1 A;  4YK5 A;  4JRZ A;  2Q7R A;  3B29 A;  5BQG A;  4AL0 A;  2PNO A;  3LEO A;  4NTB A;  3DWW A;  4JCZ A;  2UUH A;  5HV9 A;  4AL1 A;  4JC7 A;  2H8A A;  4YL0 A;  3PCV A;  4J7T A;  3HKK A;  5BQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...