3DWWA

Electron crystallographic structure of human microsomal prostaglandin e synthase 1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
142
structure length
142
Chain Sequence
PALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Prostaglandin E synthase
publication title Structural basis for induced formation of the inflammatory mediator prostaglandin E2
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 142
sequence length 142
chains with identical sequence B, C
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2008-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 3dwwA00
4YL3A 4YL0A 2H8AA 4YL1A 4J7YA 5BQIA 5BQGA 2UUIA 4BPMA 4JC7A 4NTFA 2PNOA 2UUHA 4AL0A 3DWWA 4JRZA 3HKKA 3LEOA 4JCZA 2Q7RA 4AL1A 4J7TA 4NTBA 4NTAA 4YK5A 3PCVA 5BQHA 4WABA 5K0IA 5HV9A 3B29A
chains in the Genus database with same CATH superfamily
4M63A 1NLXA 3SEOA 2H8AA 4CJGA 1YVIA 2ZXWC 2JX0A 3AOUA 1Q0GA 3GWLA 4JKVA 4O6MA 4PACA 5GPGB 3RQEA 3O39A 3TJ5A 2CNWD 1VK5A 3JTLO 1M56C 2VB6A 4DXWA 3Q6MA 2CW0F 2RSEB 3HNLA 2J0XA 3M15A 3UNGC 2TMVP 3T6BA 1LI5A 4Z9IA 1F1MA 3U0CA 5T3TA 4JTDB 1GGQA 1YAUO 2IBFA 3AG2C 3PMRA 3W2WA 4Q5SF 1TWHA 2ZPAA 2NSFA 3KPHA 3OA1A 2J9BA 4J7TA 2HKVA 1C17M 1G4WR 4F4BA 4N06A 5B3IA 1VOMA 4YN0B 3EFOB 4ER9A 2CGEA 3DMDA 2A6HF 2Q4FA 1KU2A 3GWNA 3QTHA 5JT4A 1RKEB 1Q0FA 4MVZA 2G3VA 4MVUA 3B29A 4YT5A 1RMVA 4G7OF 3ZQVA 2LFDA 3EHMA 4Z9HA 4MNDA 1T5OA 4P9TA 4JTCB 1H9TA 3IHUA 1LI7A 2YVKA 4XQ1A 4NTFA 4YJWA 3T6JA 4E7SA 4CDVA 1UG7A 1J8YF 2YWAA 1TQGA 1LM3B 1MNEA 3E9VA 3K7DA 5TJ5E 3GANA 4P6IC 3C8GA 5D92A 2H7OA 1NG1A 4BJ6A 4JCZA 1JRAA 3K66A 3IQTA 4YT4A 3SXKA 4EUKB 4YT2A 4AE4B 3M79A 2PP4A 4EIYA 2RD9A 3L34A 3VRCA 3POVA 1OCRC 1WGWA 1WATA 3ATPA 2W4BA 2B0HA 1ZW3A 4NCQA 5L0JA 1YYJA 2Y69C 3G50A 3M4BA 3V5ZA 3H65A 3ZTMA 3NKDA 4PJMA 1E2XA 2GDCA 3KL4A 4ANJA 3RYLA 2A6EF 3UMKA 1V54C 3R7CA 4CX9A 1LE2A 4HE8D 4LLCA 3TOLA 4IGGA 4KI2A 1OCOC 1ZW2A 2XLHA 5FCLA 2XL6A 3NDBB 2WZFA 1OCCC 3O10A 1H6GA 1MMDA 4G0HA 1SZIA 4X0RA 1PCXA 1ZHZA 2L6GA 3Q7GA 5AC4A 1QLEC 1JPJA 2Y3HA 4P9FA 3SP1A 4EBKA 3N0TA 3U3FA 1TFOB 1E85A 2EPNA 2IXNA 2LK4A 2ZD9A 4OD4A 1JPNA 1T6QA 3F47A 5A6BA 3C8ZA 1A7EA 4JURI 4FAPB 5DS5A 2WB7A 4XPYA 1FFHA 3VAYA 3HNIA 5B1AC 4LDQA 1XZQA 4PK4A 3LESA 1FFTC 3TOMA 1K04A 1M2VB 2D5RB 2VCCA 1VLTA 2XLEA 1OW7A 4IRUA 5DQTA 4IWBA 3VM6A 4H4KC 4CJOA 5L0IA 5BQIA 3U8VA 1LIHA 5AGFA 3EH2A 2PX3A 3JRMO 2VASA 1ORSC 3DE9A 3FOPA 3GM1A 3US6A 5A6AA 1W2WA 1FTSA 3SNHA 4XLNF 3DXJF 3RW0A 3DM9B 2P7VA 3FAJA 4KC9A 2R03A 3A11A 2XXAA 2YLDA 1R5ID 2WL8A 3DJUB 3EHNA 1O5HA 1V4AA 4Z9JA 4JE9A 3RVZA 4D4NA 4JJGA 3GEIA 3U8PA 4MVOA 1VB5A 2L9JA 4NTBA 1S05A 2XM0A 4OIRF 3W8IA 3SXYA 3V5YA 1OXBA 3L8IA 3N2ZB 2HSBA 2KSFA 1Q0KA 1ZHTA 2GWWA 1YA9A 3EGDA 4U5EE 2W45A 3ABMC 3X1OA 5KYYB 1NFOA 3NMJA 1I4ZA 1O3UA 4AX2A 2Y39A 2CYDA 5JS5A 2QTVA 1U0BB 4I3MA 3WHNA 4LACB 1XZPA 1TR2A 3B0PA 4MTOA 4U9DA 4BEJA 2ZXPA 5KYUB 4LDRA 4PFOA 2DI3A 2CCYA 3ASOC 1VYKA 2IM8A 2NUTA 2OOCA 2DGJA 2OEVA 2VCAA 2HFIA 3GORA 3S0XA 1OR3A 2J9UA 5A6JA 5B1BC 3JCUQ 4DOZA 3ASNC 1Z5ZA 3OEOA 3WAQA 1CGME 2VC9A 2KK1A 1SF8A 3EQLF 5T3WA 3H2UA 1QQ3A 3C63A 4U5GA 2YQYA 5KYXA 3JYHA 4JJFA 3ZIBA 1OCZC 1RKCA 2XLVA 2ETSA 4C3BA 2R7TA 2XLOA 1OW8A 3S84A 4CDYA 3LEVA 1Z7Qc 2EIMC 1M2OA 4LERA 4CS9A 4MTFA 2H7VC 4YL3A 1FNTc 2EILC 1OKKA 3V5XA 3DI5A 4IARA 2KNHA 1H9GA 2Q9BA 3QMKA 1Y4CA 2EPOA 4DVZA 2P1AA 3L1MA 4U5FE 3LLKA 1OR2A 2AWYA 1BBHA 2KGOA 3HNJA 5FZTA 2R7RA 2HV6A 4JEAA 1QZXA 1EQ1A 4CS8A 1Q0DA 3JRTA 2LP4A 3ITFA 2OKUA 2OJQA 1E84A 3U5SA 1D1BA 1VLSA 2VH3A 1OXKA 2A0UA 3BEHA 4O79A 3TK0A 5L3QA 3MYIA 3K1IA 3QW1A 3LS0A 5K0IA 1HY5A 2R7QA 1AUEA 3GEEA 2CNWA 3QVZA 2OCCC 3FOOA 2QE9A 1A7VA 5L0HA 2YLIA 4QDLA 2HMZA 1ORYA 4DRIB 2HV7A 1WTYA 3J06A 2L7AA 4MVMA 2Z15A 4C3DA 2R7OA 2R7VA 2J9WA 2PNOA 3DZAA 2HZ8A 5JVEA 1I4YA 2ZXRA 5HSWA 1QPUA 4C3EA 1TWAA 4EBBA 2E87A 4E17A 2WZGA 4J30B 2XS1A 5A6KA 3W8HA 2J9VA 2MYSA 3SXMA 3O55A 3LNMB 3FAPB 4YK5A 2KQ9A 4DJ9A 3UR3C 2NUPB 1D0XA 3EG9B 5COGA 5L3VA 1WN0A 2X0CA 3EFOA 4JZAA 5L0GA 2L6FA 4LDKA 3GM3A 3KYJA 1HW2A 3E70C 4O6NA 1EKYA 1CGOA 3PHF2 1E83A 1YZAA 2FAPB 2Y3BA 1BR2A 3ZTZA 2YKZA 1U6HA 2L81A 3GODA 1WASA 3F46A 3TJ6A 4CS9C 3EZHA 3QW0A 3WODF 4JEBA 4BPMA 5CI9A 1HMOA 2PFDA 5IY5C 1ZYRF 3RH3A 4E18A 4B6IA 4XTKA 3SXZA 4KNVA 4EKWA 4XPWA 1YA7O 3AJMA 4U9EA 4AL0A 1RJ9B 4CDAA 3U2MA 3T4RA 3I5PA 3KKBA 1D1CA 3DAGA 3MX3A 2J0WA 3IQ6A 3DKAA 4CSAA 4BG0A 4CS8C 3U3BA 2J7PD 3O6XA 5L0DA 4AE4A 4W8KA 4RDAA 1NSGB 3EGXB 2QNLA 2YLGA 5L0FA 5KYWB 2W9YA 4G7HF 3B0UX 4MTGA 1U89A 3ABLC 2HUJA 3MLGA 2OG2A 3H2VA 1PD1A 3AG3C 2GA0A 3ABKC 3TQOA 3W2VA 3SYNA 1T6UA 4OINF 2LCHA 2A69F 3G4ZA 1TWGA 3JT1A 4LLEA 1JR8A 1GS9A 2EPKX 1HMDA 3GEHA 3L0IA 2KJGA 4ONSA 3RQFA 4EBJA 2IYLD 2WZLA 4JRZA 3MBGA 1ZZPA 5DVWA 3UMHA 3HTKC 2IOQA 1I5NA 3RF3A 2Q3TA 3FVYA 1UFBA 3DD7A 2B0JA 2Y3GA 1SR2A 4BJ6C 3EGDB 3T9OA 1YZCA 4BJ5A 4C7OB 3B0VC 2LSEA 5DQZA 1LPEA 1NZEA 2R05A 3I5QA 3X2QC 4PJJA 1TKNA 4BJ1A 3AG1C 4ZLDA 2YL3A 1M2VA 5CIVA 4GEHA 2NUTB 3JYYA 4UDVA 2FFHA 4FESA 2AVKA 1ST6A 2BL2A 1KNYA 1VYIA 1Z3IX 4PJNA 3AG4C 5T1DB 3A9CA 4BJTA 4D4XA 4J32B 1DOWA 1OQCA 3QZCA 4MQ9F 1FR0A 2J46A 4MW3A 4CBEA 1BDJB 2XSEA 1ZHXA 1O87A 3N24A 1CGNA 1Z6AA 2KC3A 3ZQYA 4XLPF 4BJ5C 3HJCA 4G7ZF 3Q6NA 2J8WA 4JVSA 4WGZA 1NU9C 4ULWA 2EPMX 3DM5A 4NQFA 4YL1A 5KYYA 1QSPA 4GQHA 4XEVA 1RXQA 1VMAA 2LIGA 3TD7A 3HLZA 4G78A 3CEXA 5KYUA 2XLMA 3C7JA 4DBRA 4ZLCA 3FDQA 2R7UA 4HFFB 1IW7F 4HFKB 4IAOA 2KW3C 1PV3A 4WJ0A 1N1CA 2DB4A 2F22A 3KMIA 4CIHA 1OKKD 3JSZA 2ICWG 1ZVZA 4RD9A 3DWWA 1BR4A 4YT8A 3S29A 1SYQA 2XL8A 2XL4A 4WGYA 4CIPA 2YL0A 2KYHA 3UGOA 2Y3DA 5E2QA 5F5HA 4QI0A 3TULA 3UMIA 4U5HA 4NTAA 1AVOB 2WVNA 1B68A 3QVYA 3C62A 3KYIA 3IEEA 3U2LA 5HV9A 3L8JA 2XLWA 1FMVA 3IQCA 4H54A 3M1CB 5COMA 3ECSA 2BC5A 3FXHA 4FWVA 3EJNA 4JCHA 4MS2A 4XEKA 2I15A 3GM2A 1MMNA 2CDQA 5JP7A 3RIPA 3ZC4A 4DBQA 5F28E 3S28A 4XEFA 2J45A 2X51A 4JC7A 3LS1A 3NYLA 4BEMJ 5EGYA 4OIOF 1NU7D 3UGPA 3C18A 3SZRA 3C8GB 3VYWA 1G4US 2QLAA 3LJBA 4JTAB 5AC5A 1XWJA 3LEOA 1MMGA 1V74B 2AP3A 2PX0A 2QY9A 3LAYA 3NRHA 4U5CE 5E33A 1HE9A 1ZHWA 3MYFA 2DYSC 3LLIA 5D91A 5E3AA 3NYJA 1L3PA 1MQVA 1YYXA 3G4XA 5JLIA 2R7XA 4GYTA 2JD3A 3JSEO 5EHHA 4XPXA 2WVQA 3C8GD 2HJMA 3HNKA 2D4UA 2GAQA 5L0CA 2OQMA 2OEXA 2Q9AA 1CPRA 4CS7A 5BQHA 2DYRC 3VF0A 2QUPA 1G5ZA 4KNWA 4XWJA 1D0YA 4JW1A 3FMSA 5BUOA 4YWQA 2L6HA 4I1OB 4K0DA 3U9MA 3B71A 1NBBA 4Q4ZF 1IZMA 1RKEA 3R2PA 4OIQF 3Q7LA 1JMWA 4J7YA 2HMQA 2R9RB 5BQGA 3ZDLA 1RCPA 4I44A 4K1OA 2G62A 3RKOF 2MWQA 4ULVA 1DOVA 4OD5A 3W4YA 1JOGA 5E3CA 2R02A 4AK9A 2MHRA 4MVSA 1TFKB 2YZSA 1K40A 2BE5F 1PD0A 5DLJA 4PFPA 1BZ4A 4I1MA 3U9JA 1T01A 2M4EA 2Q7RA 1T6IA 2IXPA 4A2NB 4AL1A 1CPQA 1EA8A 4DRJB 2HSQA 4A4AA 1LKXA 3FHDA 5DS6A 4N6CA 3AQCA 1AEPA 2NSGA 2XM4A 2AU5A 4IB4A 5EK0A 1BR1A 1ZHYA 2EIKC 2FGYA 2NUPA 1Z23A 3EG9A 2LQGA 3DJNB 4WABA 3EPVA 1GM5A 3ZG1A 2Q9CA 2P61A 4JIOA 5KYNA 5A6BD 2R7SA 3DE8A 2EPLX 3K1IC 4NC3A 1LS4A 3S27A 1SMYF 3RVYA 4K7BA 1TWCA 1Z63A 3K1HA 2GFHA 1H7IA 1A41A 3MFNA 2A68F 2J7PA 1GQAA 2UUHA 4E0HA 4OIPF 2XXAB 1MMAA 1R4TA 2JPUA 2PF4E 3B9QA 4MVQA 4MW8A 2V26A 1LS1A 3KH2A 1WWPA 2A0BA 1RJ9A 2C04A 3HKKA 3V7OA 1VTMP 3AGTA 4MVRA 4IJJA 2ZXOA 4U5BE 1HE1A 2A1DD 4O6YA 3DAFA 3NMKA 5COFA 2C03A 2W4MA 4PJLA 4W8PA 2WVOA 1V55C 2EIJC 2HS5A 1A0BA 3EGXA 2PBEA 3BRJA 5KYWA 2P6VA 2VCBA 3IQ5A 4DVYP 3ZWIA 2LFFA 1YLMA 2R7WA 1ZU5A 3ZSUA 1J8MF 2H7BA 3LUTB 1M57C 3OWTA 2R25A 2V3CC 1JAFA 1G8XA 3CZ6A 3K6BA 4DRHB 3JZ0A 1A7DA 5F5FA 3EZIA 2YL1A 3K33A 4L6RA 4QI2A 2P0NA 1Y6DA 5JSLA 3CAXA 3CSKA 1FMWA 1Q0MA 2I8BA 2M64A 2HJ3A 3AGUA 4U5DE 3NG1A 2YL7A 1EI7A 4EWCA 5KYXB 2O9XA 4HEAJ 4NY3A 1LE4A 4FX5A 3I4UA 3WG7C 3PCVA 1MNDA 1HW1A 3CQZA 4CSAC 4C7OA 1T9KA 2NPUA 1S7ZA 2YRFA 1K05A 1OW6A 1QVXA 1D1AA 3S9OA 3T6GB 5JUAA 2Q00A 1ORJA 1YARO 1M6TA 1WOLA 4YL0A 2LD6A 2OJED 2YEVA 1YJGA 1L7CA 3PDMP 2UUIA 2XS8A 3ZVRA 2EINC 3NMIA 3NYMA 4KBLA 1ZU4A 1C02A 2XLDA 3RQGA 2XRHA 3RFYA 256BA 1C03A 3S90A 5JRAA 2IXOA 5DS4A 2OU6A 3LNRA 1FAPB 4EHPA 3EH1A 1D0ZA 5A69A 1NFNA 2ASRA 2G3KA 3NKEA 5CI8A 3IPMO 5B3SC 4IAQA 1QKRA 1APCA 4E7ZA 1YDIA 1LVKA 3AQBA 4N6HA 2NG1A 2YHSA 4E0IA 1KTMA 3M4CA 4O7GA 1E86A 2AWCA 4N4WA 4R32A 4PR9A 2IXMA 4Q7CA 4RBNA
chains in the Genus database with same CATH topology
4YL3A 4YL0A 2H8AA 4YL1A 4J7YA 5BQIA 5BQGA 2UUIA 4BPMA 4JC7A 4NTFA 2PNOA 2UUHA 4AL0A 3DWWA 4JRZA 3HKKA 3LEOA 4JCZA 2Q7RA 4AL1A 4J7TA 4NTBA 4NTAA 4YK5A 3PCVA 5BQHA 4WABA 5K0IA 5HV9A 3B29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL3 A;  4YL0 A;  2H8A A;  4YL1 A;  4J7Y A;  5BQI A;  5BQG A;  2UUI A;  4BPM A;  4JC7 A;  4NTF A;  2PNO A;  2UUH A;  4AL0 A;  3DWW A;  4JRZ A;  3HKK A;  3LEO A;  4JCZ A;  2Q7R A;  4AL1 A;  4J7T A;  4NTB A;  4NTA A;  4YK5 A;  3PCV A;  5BQH A;  4WAB A;  5K0I A;  5HV9 A;  3B29 A; 
#chains in the Genus database with same CATH topology
 4M63 A;  1NLX A;  3SEO A;  2H8A A;  4CJG A;  1YVI A;  2ZXW C;  2JX0 A;  3AOU A;  1Q0G A;  3GWL A;  4JKV A;  4O6M A;  4PAC A;  5GPG B;  3RQE A;  3O39 A;  3TJ5 A;  2CNW D;  1VK5 A;  3JTL O;  1M56 C;  2VB6 A;  4DXW A;  3Q6M A;  2CW0 F;  2RSE B;  3HNL A;  2J0X A;  3M15 A;  3UNG C;  2TMV P;  3T6B A;  1LI5 A;  4Z9I A;  1F1M A;  3U0C A;  5T3T A;  4JTD B;  1GGQ A;  1YAU O;  2IBF A;  3AG2 C;  3PMR A;  3W2W A;  4Q5S F;  1TWH A;  2ZPA A;  2NSF A;  3KPH A;  3OA1 A;  2J9B A;  4J7T A;  2HKV A;  1C17 M;  1G4W R;  4F4B A;  4N06 A;  5B3I A;  1VOM A;  4YN0 B;  3EFO B;  4ER9 A;  2CGE A;  3DMD A;  2A6H F;  2Q4F A;  1KU2 A;  3GWN A;  3QTH A;  5JT4 A;  1RKE B;  1Q0F A;  4MVZ A;  2G3V A;  4MVU A;  3B29 A;  4YT5 A;  1RMV A;  4G7O F;  3ZQV A;  2LFD A;  3EHM A;  4Z9H A;  4MND A;  1T5O A;  4P9T A;  4JTC B;  1H9T A;  3IHU A;  1LI7 A;  2YVK A;  4XQ1 A;  4NTF A;  4YJW A;  3T6J A;  4E7S A;  4CDV A;  1UG7 A;  1J8Y F;  2YWA A;  1TQG A;  1LM3 B;  1MNE A;  3E9V A;  3K7D A;  5TJ5 E;  3GAN A;  4P6I C;  3C8G A;  5D92 A;  2H7O A;  1NG1 A;  4BJ6 A;  4JCZ A;  1JRA A;  3K66 A;  3IQT A;  4YT4 A;  3SXK A;  4EUK B;  4YT2 A;  4AE4 B;  3M79 A;  2PP4 A;  4EIY A;  2RD9 A;  3L34 A;  3VRC A;  3POV A;  1OCR C;  1WGW A;  1WAT A;  3ATP A;  2W4B A;  2B0H A;  1ZW3 A;  4NCQ A;  5L0J A;  1YYJ A;  2Y69 C;  3G50 A;  3M4B A;  3V5Z A;  3H65 A;  3ZTM A;  3NKD A;  4PJM A;  1E2X A;  2GDC A;  3KL4 A;  4ANJ A;  3RYL A;  2A6E F;  3UMK A;  1V54 C;  3R7C A;  4CX9 A;  1LE2 A;  4HE8 D;  4LLC A;  3TOL A;  4IGG A;  4KI2 A;  1OCO C;  1ZW2 A;  2XLH A;  5FCL A;  2XL6 A;  3NDB B;  2WZF A;  1OCC C;  3O10 A;  1H6G A;  1MMD A;  4G0H A;  1SZI A;  4X0R A;  1PCX A;  1ZHZ A;  2L6G A;  3Q7G A;  5AC4 A;  1QLE C;  1JPJ A;  2Y3H A;  4P9F A;  3SP1 A;  4EBK A;  3N0T A;  3U3F A;  1TFO B;  1E85 A;  2EPN A;  2IXN A;  2LK4 A;  2ZD9 A;  4OD4 A;  1JPN A;  1T6Q A;  3F47 A;  5A6B A;  3C8Z A;  1A7E A;  4JUR I;  4FAP B;  5DS5 A;  2WB7 A;  4XPY A;  1FFH A;  3VAY A;  3HNI A;  5B1A C;  4LDQ A;  1XZQ A;  4PK4 A;  3LES A;  1FFT C;  3TOM A;  1K04 A;  1M2V B;  2D5R B;  2VCC A;  1VLT A;  2XLE A;  1OW7 A;  4IRU A;  5DQT A;  4IWB A;  3VM6 A;  4H4K C;  4CJO A;  5L0I A;  5BQI A;  3U8V A;  1LIH A;  5AGF A;  3EH2 A;  2PX3 A;  3JRM O;  2VAS A;  1ORS C;  3DE9 A;  3FOP A;  3GM1 A;  3US6 A;  5A6A A;  1W2W A;  1FTS A;  3SNH A;  4XLN F;  3DXJ F;  3RW0 A;  3DM9 B;  2P7V A;  3FAJ A;  4KC9 A;  2R03 A;  3A11 A;  2XXA A;  2YLD A;  1R5I D;  2WL8 A;  3DJU B;  3EHN A;  1O5H A;  1V4A A;  4Z9J A;  4JE9 A;  3RVZ A;  4D4N A;  4JJG A;  3GEI A;  3U8P A;  4MVO A;  1VB5 A;  2L9J A;  4NTB A;  1S05 A;  2XM0 A;  4OIR F;  3W8I A;  3SXY A;  3V5Y A;  1OXB A;  3L8I A;  3N2Z B;  2HSB A;  2KSF A;  1Q0K A;  1ZHT A;  2GWW A;  1YA9 A;  3EGD A;  4U5E E;  2W45 A;  3ABM C;  3X1O A;  5KYY B;  1NFO A;  3NMJ A;  1I4Z A;  1O3U A;  4AX2 A;  2Y39 A;  2CYD A;  5JS5 A;  2QTV A;  1U0B B;  4I3M A;  3WHN A;  4LAC B;  1XZP A;  1TR2 A;  3B0P A;  4MTO A;  4U9D A;  4BEJ A;  2ZXP A;  5KYU B;  4LDR A;  4PFO A;  2DI3 A;  2CCY A;  3ASO C;  1VYK A;  2IM8 A;  2NUT A;  2OOC A;  2DGJ A;  2OEV A;  2VCA A;  2HFI A;  3GOR A;  3S0X A;  1OR3 A;  2J9U A;  5A6J A;  5B1B C;  3JCU Q;  4DOZ A;  3ASN C;  1Z5Z A;  3OEO A;  3WAQ A;  1CGM E;  2VC9 A;  2KK1 A;  1SF8 A;  3EQL F;  5T3W A;  3H2U A;  1QQ3 A;  3C63 A;  4U5G A;  2YQY A;  5KYX A;  3JYH A;  4JJF A;  3ZIB A;  1OCZ C;  1RKC A;  2XLV A;  2ETS A;  4C3B A;  2R7T A;  2XLO A;  1OW8 A;  3S84 A;  4CDY A;  3LEV A;  1Z7Q c;  2EIM C;  1M2O A;  4LER A;  4CS9 A;  4MTF A;  2H7V C;  4YL3 A;  1FNT c;  2EIL C;  1OKK A;  3V5X A;  3DI5 A;  4IAR A;  2KNH A;  1H9G A;  2Q9B A;  3QMK A;  1Y4C A;  2EPO A;  4DVZ A;  2P1A A;  3L1M A;  4U5F E;  3LLK A;  1OR2 A;  2AWY A;  1BBH A;  2KGO A;  3HNJ A;  5FZT A;  2R7R A;  2HV6 A;  4JEA A;  1QZX A;  1EQ1 A;  4CS8 A;  1Q0D A;  3JRT A;  2LP4 A;  3ITF A;  2OKU A;  2OJQ A;  1E84 A;  3U5S A;  1D1B A;  1VLS A;  2VH3 A;  1OXK A;  2A0U A;  3BEH A;  4O79 A;  3TK0 A;  5L3Q A;  3MYI A;  3K1I A;  3QW1 A;  3LS0 A;  5K0I A;  1HY5 A;  2R7Q A;  1AUE A;  3GEE A;  2CNW A;  3QVZ A;  2OCC C;  3FOO A;  2QE9 A;  1A7V A;  5L0H A;  2YLI A;  4QDL A;  2HMZ A;  1ORY A;  4DRI B;  2HV7 A;  1WTY A;  3J06 A;  2L7A A;  4MVM A;  2Z15 A;  4C3D A;  2R7O A;  2R7V A;  2J9W A;  2PNO A;  3DZA A;  2HZ8 A;  5JVE A;  1I4Y A;  2ZXR A;  5HSW A;  1QPU A;  4C3E A;  1TWA A;  4EBB A;  2E87 A;  4E17 A;  2WZG A;  4J30 B;  2XS1 A;  5A6K A;  3W8H A;  2J9V A;  2MYS A;  3SXM A;  3O55 A;  3LNM B;  3FAP B;  4YK5 A;  2KQ9 A;  4DJ9 A;  3UR3 C;  2NUP B;  1D0X A;  3EG9 B;  5COG A;  5L3V A;  1WN0 A;  2X0C A;  3EFO A;  4JZA A;  5L0G A;  2L6F A;  4LDK A;  3GM3 A;  3KYJ A;  1HW2 A;  3E70 C;  4O6N A;  1EKY A;  1CGO A;  3PHF 2;  1E83 A;  1YZA A;  2FAP B;  2Y3B A;  1BR2 A;  3ZTZ A;  2YKZ A;  1U6H A;  2L81 A;  3GOD A;  1WAS A;  3F46 A;  3TJ6 A;  4CS9 C;  3EZH A;  3QW0 A;  3WOD F;  4JEB A;  4BPM A;  5CI9 A;  1HMO A;  2PFD A;  5IY5 C;  1ZYR F;  3RH3 A;  4E18 A;  4B6I A;  4XTK A;  3SXZ A;  4KNV A;  4EKW A;  4XPW A;  1YA7 O;  3AJM A;  4U9E A;  4AL0 A;  1RJ9 B;  4CDA A;  3U2M A;  3T4R A;  3I5P A;  3KKB A;  1D1C A;  3DAG A;  3MX3 A;  2J0W A;  3IQ6 A;  3DKA A;  4CSA A;  4BG0 A;  4CS8 C;  3U3B A;  2J7P D;  3O6X A;  5L0D A;  4AE4 A;  4W8K A;  4RDA A;  1NSG B;  3EGX B;  2QNL A;  2YLG A;  5L0F A;  5KYW B;  2W9Y A;  4G7H F;  3B0U X;  4MTG A;  1U89 A;  3ABL C;  2HUJ A;  3MLG A;  2OG2 A;  3H2V A;  1PD1 A;  3AG3 C;  2GA0 A;  3ABK C;  3TQO A;  3W2V A;  3SYN A;  1T6U A;  4OIN F;  2LCH A;  2A69 F;  3G4Z A;  1TWG A;  3JT1 A;  4LLE A;  1JR8 A;  1GS9 A;  2EPK X;  1HMD A;  3GEH A;  3L0I A;  2KJG A;  4ONS A;  3RQF A;  4EBJ A;  2IYL D;  2WZL A;  4JRZ A;  3MBG A;  1ZZP A;  5DVW A;  3UMH A;  3HTK C;  2IOQ A;  1I5N A;  3RF3 A;  2Q3T A;  3FVY A;  1UFB A;  3DD7 A;  2B0J A;  2Y3G A;  1SR2 A;  4BJ6 C;  3EGD B;  3T9O A;  1YZC A;  4BJ5 A;  4C7O B;  3B0V C;  2LSE A;  5DQZ A;  1LPE A;  1NZE A;  2R05 A;  3I5Q A;  3X2Q C;  4PJJ A;  1TKN A;  4BJ1 A;  3AG1 C;  4ZLD A;  2YL3 A;  1M2V A;  5CIV A;  4GEH A;  2NUT B;  3JYY A;  4UDV A;  2FFH A;  4FES A;  2AVK A;  1ST6 A;  2BL2 A;  1KNY A;  1VYI A;  1Z3I X;  4PJN A;  3AG4 C;  5T1D B;  3A9C A;  4BJT A;  4D4X A;  4J32 B;  1DOW A;  1OQC A;  3QZC A;  4MQ9 F;  1FR0 A;  2J46 A;  4MW3 A;  4CBE A;  1BDJ B;  2XSE A;  1ZHX A;  1O87 A;  3N24 A;  1CGN A;  1Z6A A;  2KC3 A;  3ZQY A;  4XLP F;  4BJ5 C;  3HJC A;  4G7Z F;  3Q6N A;  2J8W A;  4JVS A;  4WGZ A;  1NU9 C;  4ULW A;  2EPM X;  3DM5 A;  4NQF A;  4YL1 A;  5KYY A;  1QSP A;  4GQH A;  4XEV A;  1RXQ A;  1VMA A;  2LIG A;  3TD7 A;  3HLZ A;  4G78 A;  3CEX A;  5KYU A;  2XLM A;  3C7J A;  4DBR A;  4ZLC A;  3FDQ A;  2R7U A;  4HFF B;  1IW7 F;  4HFK B;  4IAO A;  2KW3 C;  1PV3 A;  4WJ0 A;  1N1C A;  2DB4 A;  2F22 A;  3KMI A;  4CIH A;  1OKK D;  3JSZ A;  2ICW G;  1ZVZ A;  4RD9 A;  3DWW A;  1BR4 A;  4YT8 A;  3S29 A;  1SYQ A;  2XL8 A;  2XL4 A;  4WGY A;  4CIP A;  2YL0 A;  2KYH A;  3UGO A;  2Y3D A;  5E2Q A;  5F5H A;  4QI0 A;  3TUL A;  3UMI A;  4U5H A;  4NTA A;  1AVO B;  2WVN A;  1B68 A;  3QVY A;  3C62 A;  3KYI A;  3IEE A;  3U2L A;  5HV9 A;  3L8J A;  2XLW A;  1FMV A;  3IQC A;  4H54 A;  3M1C B;  5COM A;  3ECS A;  2BC5 A;  3FXH A;  4FWV A;  3EJN A;  4JCH A;  4MS2 A;  4XEK A;  2I15 A;  3GM2 A;  1MMN A;  2CDQ A;  5JP7 A;  3RIP A;  3ZC4 A;  4DBQ A;  5F28 E;  3S28 A;  4XEF A;  2J45 A;  2X51 A;  4JC7 A;  3LS1 A;  3NYL A;  4BEM J;  5EGY A;  4OIO F;  1NU7 D;  3UGP A;  3C18 A;  3SZR A;  3C8G B;  3VYW A;  1G4U S;  2QLA A;  3LJB A;  4JTA B;  5AC5 A;  1XWJ A;  3LEO A;  1MMG A;  1V74 B;  2AP3 A;  2PX0 A;  2QY9 A;  3LAY A;  3NRH A;  4U5C E;  5E33 A;  1HE9 A;  1ZHW A;  3MYF A;  2DYS C;  3LLI A;  5D91 A;  5E3A A;  3NYJ A;  1L3P A;  1MQV A;  1YYX A;  3G4X A;  5JLI A;  2R7X A;  4GYT A;  2JD3 A;  3JSE O;  5EHH A;  4XPX A;  2WVQ A;  3C8G D;  2HJM A;  3HNK A;  2D4U A;  2GAQ A;  5L0C A;  2OQM A;  2OEX A;  2Q9A A;  1CPR A;  4CS7 A;  5BQH A;  2DYR C;  3VF0 A;  2QUP A;  1G5Z A;  4KNW A;  4XWJ A;  1D0Y A;  4JW1 A;  3FMS A;  5BUO A;  4YWQ A;  2L6H A;  4I1O B;  4K0D A;  3U9M A;  3B71 A;  1NBB A;  4Q4Z F;  1IZM A;  1RKE A;  3R2P A;  4OIQ F;  3Q7L A;  1JMW A;  4J7Y A;  2HMQ A;  2R9R B;  5BQG A;  3ZDL A;  1RCP A;  4I44 A;  4K1O A;  2G62 A;  3RKO F;  2MWQ A;  4ULV A;  1DOV A;  4OD5 A;  3W4Y A;  1JOG A;  5E3C A;  2R02 A;  4AK9 A;  2MHR A;  4MVS A;  1TFK B;  2YZS A;  1K40 A;  2BE5 F;  1PD0 A;  5DLJ A;  4PFP A;  1BZ4 A;  4I1M A;  3U9J A;  1T01 A;  2M4E A;  2Q7R A;  1T6I A;  2IXP A;  4A2N B;  4AL1 A;  1CPQ A;  1EA8 A;  4DRJ B;  2HSQ A;  4A4A A;  1LKX A;  3FHD A;  5DS6 A;  4N6C A;  3AQC A;  1AEP A;  2NSG A;  2XM4 A;  2AU5 A;  4IB4 A;  5EK0 A;  1BR1 A;  1ZHY A;  2EIK C;  2FGY A;  2NUP A;  1Z23 A;  3EG9 A;  2LQG A;  3DJN B;  4WAB A;  3EPV A;  1GM5 A;  3ZG1 A;  2Q9C A;  2P61 A;  4JIO A;  5KYN A;  5A6B D;  2R7S A;  3DE8 A;  2EPL X;  3K1I C;  4NC3 A;  1LS4 A;  3S27 A;  1SMY F;  3RVY A;  4K7B A;  1TWC A;  1Z63 A;  3K1H A;  2GFH A;  1H7I A;  1A41 A;  3MFN A;  2A68 F;  2J7P A;  1GQA A;  2UUH A;  4E0H A;  4OIP F;  2XXA B;  1MMA A;  1R4T A;  2JPU A;  2PF4 E;  3B9Q A;  4MVQ A;  4MW8 A;  2V26 A;  1LS1 A;  3KH2 A;  1WWP A;  2A0B A;  1RJ9 A;  2C04 A;  3HKK A;  3V7O A;  1VTM P;  3AGT A;  4MVR A;  4IJJ A;  2ZXO A;  4U5B E;  1HE1 A;  2A1D D;  4O6Y A;  3DAF A;  3NMK A;  5COF A;  2C03 A;  2W4M A;  4PJL A;  4W8P A;  2WVO A;  1V55 C;  2EIJ C;  2HS5 A;  1A0B A;  3EGX A;  2PBE A;  3BRJ A;  5KYW A;  2P6V A;  2VCB A;  3IQ5 A;  4DVY P;  3ZWI A;  2LFF A;  1YLM A;  2R7W A;  1ZU5 A;  3ZSU A;  1J8M F;  2H7B A;  3LUT B;  1M57 C;  3OWT A;  2R25 A;  2V3C C;  1JAF A;  1G8X A;  3CZ6 A;  3K6B A;  4DRH B;  3JZ0 A;  1A7D A;  5F5F A;  3EZI A;  2YL1 A;  3K33 A;  4L6R A;  4QI2 A;  2P0N A;  1Y6D A;  5JSL A;  3CAX A;  3CSK A;  1FMW A;  1Q0M A;  2I8B A;  2M64 A;  2HJ3 A;  3AGU A;  4U5D E;  3NG1 A;  2YL7 A;  1EI7 A;  4EWC A;  5KYX B;  2O9X A;  4HEA J;  4NY3 A;  1LE4 A;  4FX5 A;  3I4U A;  3WG7 C;  3PCV A;  1MND A;  1HW1 A;  3CQZ A;  4CSA C;  4C7O A;  1T9K A;  2NPU A;  1S7Z A;  2YRF A;  1K05 A;  1OW6 A;  1QVX A;  1D1A A;  3S9O A;  3T6G B;  5JUA A;  2Q00 A;  1ORJ A;  1YAR O;  1M6T A;  1WOL A;  4YL0 A;  2LD6 A;  2OJE D;  2YEV A;  1YJG A;  1L7C A;  3PDM P;  2UUI A;  2XS8 A;  3ZVR A;  2EIN C;  3NMI A;  3NYM A;  4KBL A;  1ZU4 A;  1C02 A;  2XLD A;  3RQG A;  2XRH A;  3RFY A;  256B A;  1C03 A;  3S90 A;  5JRA A;  2IXO A;  5DS4 A;  2OU6 A;  3LNR A;  1FAP B;  4EHP A;  3EH1 A;  1D0Z A;  5A69 A;  1NFN A;  2ASR A;  2G3K A;  3NKE A;  5CI8 A;  3IPM O;  5B3S C;  4IAQ A;  1QKR A;  1APC A;  4E7Z A;  1YDI A;  1LVK A;  3AQB A;  4N6H A;  2NG1 A;  2YHS A;  4E0I A;  1KTM A;  3M4C A;  4O7G A;  1E86 A;  2AWC A;  4N4W A;  4R32 A;  4PR9 A;  2IXM A;  4Q7C A;  4RBN A; 
#chains in the Genus database with same CATH homology
 4YL3 A;  4YL0 A;  2H8A A;  4YL1 A;  4J7Y A;  5BQI A;  5BQG A;  2UUI A;  4BPM A;  4JC7 A;  4NTF A;  2PNO A;  2UUH A;  4AL0 A;  3DWW A;  4JRZ A;  3HKK A;  3LEO A;  4JCZ A;  2Q7R A;  4AL1 A;  4J7T A;  4NTB A;  4NTA A;  4YK5 A;  3PCV A;  5BQH A;  4WAB A;  5K0I A;  5HV9 A;  3B29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...