1SF8A

Crystal structure of the carboxy-terminal domain of htpg, the e. coli hsp90
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
b'SFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEVKYIFELNPDHVLVKRAADTEDEAKFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein htpG
publication title The crystal structure of the carboxy-terminal dimerization domain of htpG, the Escherichia coli Hsp90, reveals a potential substrate binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 32
structure length 115
sequence length 115
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2004-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1sf8A00
2IOQA 2CGEA 3Q6NA 3Q6MA 1SF8A 3HJCA
chains in the Genus database with same CATH superfamily
3UMHA 4JEBA 3O55A 3GEHA 2B0HA 4MNDA 3VYWA 1WOLA 4U9DA 2W4MA 4PJMA 5L0JA 3KYIA 4U5EE 3WODF 1VLSA 3QVZA 2Q9CA 1QKRA 4JCZA 4W8PA 1WN0A 1T01A 2WZGA 3C8GA 4PFOA 5JSLA 3PDMP 2VC9A 3LEOA 3NYJA 3EHMA 3B0VC 1JRAA 2LFFA 5JP7A 3T9OA 2PBEA 3NRHA 4O6YA 4Z9IA 2ZPAA 2NUTB 5DLJA 3C8GB 4G78A 1I4YA 2XM0A 3W8HA 3ZQYA 2YLIA 2EIJC 3A11A 3GM2A 3TOLA 2XLWA 4XWJA 5E3AA 3LLKA 4D4NA 1A0BA 2KQ9A 3ZVRA 4AE4A 4EBKA 4IAQA 4J32B 1WATA 5F5HA 3DD7A 1M6TA 4GQHA 2R9RB 2OEXA 3AG1C 3MX3A 4PJNA 1M57C 3RQEA 3S90A 1YJGA 5AC5A 5B3IA 4OD5A 2PX0A 2OG2A 4UDVA 2W4BA 2AWCA 4E7ZA 3HJCA 2R05A 4EIYA 3ZDLA 1EQ1A 5D92A 2IXOA 4GYTA 2YQYA 3EFOA 3NYLA 4BJTA 1UG7A 5B3SC 1RMVA 4MVRA 4DXWA 4OIPF 2KSFA 1BDJB 3DJNB 1M2VA 1G8XA 5A6KA 1VK5A 3LJBA 5EK0A 5DQZA 3EFOB 5B1AC 1Q0FA 1A7EA 2XS1A 3G4XA 3HTKC 1TWHA 2JX0A 1O5HA 3FXHA 3JTLO 4U5CE 3QW1A 1CPQA 2XLHA 1ZHZA 3Q6MA 1GS9A 4XEFA 4C3EA 4Q4ZF 2J8WA 4ZLDA 3AG2C 4NC3A 1OW6A 2DYSC 1RXQA 1TWAA 2YHSA 4P6IC 1RKEA 2P6VA 3POVA 3FOPA 1VYKA 2A69F 4ULWA 2NUPB 1LS1A 4KI2A 1ZW2A 3C63A 3ECSA 4CJGA 2DI3A 2QTVA 1G5ZA 3LNMB 5GPGB 1NFOA 1H9GA 1RKEB 4N4WA 3T4RA 1KU2A 3L1MA 3TJ5A 3TD7A 4MTFA 2OEVA 4AX2A 1AEPA 2A0BA 1OCRC 3ABMC 3HNKA 3O6XA 3Q7GA 1V54C 2GDCA 3CQZA 2X0CA 3V5YA 4YT2A 1V4AA 4O6NA 1V55C 3US6A 1TR2A 4NY3A 1U6HA 3K7DA 2P7VA 1G4US 5D91A 3NMKA 2KGOA 1K04A 1TKNA 4DVZA 1ZHYA 1NU7D 1BR1A 3DAGA 3DM9B 3HNLA 2ASRA 4CS8A 4MVSA 2BC5A 3JSEO 2P1AA 2NG1A 1NFNA 4E7SA 3T6GB 1YARO 2IBFA 4K1OA 3QW0A 3C8GD 1NSGB 3U2MA 5L0CA 4K0DA 1GGQA 2V3CC 4YL0A 1Z5ZA 3ZTZA 1D0ZA 2HV6A 2EPKX 5B1BC 1YYJA 2CDQA 3L34A 2L7AA 4MQ9F 2L6HA 3ZQVA 1B68A 2WZLA 4JTAB 4I1MA 3GANA 4BPMA 3U8VA 4C3DA 1CGME 4O79A 2I8BA 4H4KC 5BQIA 2AVKA 1Z7Qc 5BQHA 4U5GA 5KYWB 4OIQF 2YKZA 3KL4A 1VMAA 2Z15A 4U5FE 3VAYA 4D4XA 1VLTA 5JT4A 4XEKA 4O6MA 2VCCA 2OCCC 5CI9A 1O87A 4XLNF 3RFYA 3GWLA 4DRHB 3NDBB 4QDLA 3TQOA 3RF3A 1YZAA 3JT1A 1HW2A 3LS1A 3WG7C 2ZD9A 4N06A 2VH3A 2I15A 2VB6A 3TOMA 2BL2A 4C7OA 3FMSA 2RD9A 4CS9A 4IGGA 3GODA 2OKUA 2R7RA 1U0BB 1RCPA 3LNRA 2YEVA 1A41A 3K6BA 1T9KA 3FAPB 3JRTA 2R02A 3V5ZA 3QMKA 1M2OA 3SXMA 3WAQA 4C7OB 1A7VA 5A6AA 4N6CA 2AP3A 3AQCA 4OIOF 4ZLCA 2YL0A 3N24A 2ZXRA 1ORJA 3X2QC 1SR2A 2HZ8A 1C17M 3RH3A 2PF4E 3W2WA 2OOCA 3IPMO 2CYDA 4G0HA 1KTMA 4PK4A 2GFHA 3MFNA 2D5RB 3OA1A 4WABA 5E33A 4QI2A 3DXJF 1VYIA 3FAJA 3TK0A 3NKDA 4OIRF 2XLVA 2UUIA 3L0IA 2IXMA 3S29A 4LACB 1DOWA 2LK4A 1KNYA 2C03A 3IQCA 5EGYA 3R2PA 3AGUA 4BEJA 1M56C 1XZPA 3ZWIA 5F28E 5COGA 1Z6AA 3ABKC 1E86A 3BEHA 3B29A 1WGWA 3MBGA 4W8KA 3SNHA 2R7OA 3CSKA 1BR2A 4MW8A 1LIHA 1T6QA 4U9EA 3KKBA 4GEHA 2A0UA 2NUTA 2HKVA 1MMNA 2XSEA 5A69A 3B71A 1JOGA 3H2VA 4P9TA 4CSAA 2XLEA 4NCQA 5A6BD 2IYLD 3F46A 4U5HA 1VTMP 1FFTC 4AK9A 1AUEA 1ST6A 1WASA 1XZQA 2LQGA 3QTHA 4U5DE 4A2NB 3RIPA 5JVEA 4ULVA 4JTDB 2H8AA 1SYQA 2UUHA 3ASNC 4CS8C 4YT4A 3U9JA 2PNOA 4L6RA 3K1HA 4DOZA 3VRCA 3HLZA 4I44A 3ATPA 4BJ5A 2IXNA 1T6IA 3S9OA 1LM3B 4J7YA 1NU9C 2P61A 5BQGA 2IM8A 1OXKA 3IHUA 3EH2A 2QLAA 2PFDA 2A6HF 1E2XA 3M4CA 1JR8A 3DJUB 3LEVA 2W45A 3U3FA 4JJGA 4AL0A 1K05A 3AQBA 3VM6A 5JUAA 2Y69C 3JCUQ 4N6HA 1APCA 4JJFA 3M15A 1D1CA 3HNIA 2R03A 3EJNA 4MW3A 4IRUA 2CNWD 1CGNA 2EILC 3S0XA 1OXBA 2HUJA 3EGDB 3MLGA 2LSEA 4FWVA 1JMWA 2HS5A 4LDRA 1QSPA 2XLDA 3M4BA 4HFFB 2XL6A 4MVZA 4R32A 4E17A 4P9FA 2XS8A 2NUPA 3SZRA 3GM3A 2EPLX 3I5PA 1D1AA 2YWAA 1C02A 2HJ3A 3W2VA 4BJ1A 4NTBA 2Y3HA 4C3BA 4CS9C 5HSWA 5AGFA 2HSBA 5L0HA 2F22A 2G3VA 1MMGA 3QZCA 1SMYF 1MQVA 1QZXA 2EIMC 3DMDA 4IAOA 5CI8A 1BBHA 2RSEB 2C04A 1T6UA 2R7UA 2H7BA 2JPUA 3GM1A 4HE8D 3ZSUA 2VCBA 1ORSC 1LI5A 3X1OA 2Q00A 2EPMX 3EZHA 4WJ0A 1ZHTA 3G4ZA 2Q3TA 5KYXB 2LCHA 1PD0A 2FAPB 3G50A 2Q7RA 5T3TA 3RKOF 5A6BA 1PD1A 3ASOC 2J0WA 3MYIA 1YYXA 3JSZA 1HMOA 3B0UX 1ZYRF 3EG9B 3AG3C 4ONSA 4YWQA 1MNEA 4BJ6A 3C18A 2YLDA 4MVMA 4LLCA 3TULA 4KNVA 5KYWA 4HEAJ 1TFOB 3C7JA 2G3KA 4B6IA 1OCOC 4CSAC 1K40A 1LKXA 3ABLC 2EPOA 2YL7A 4BG0A 1BR4A 4XEVA 1LPEA 1Q0MA 3U9MA 4JVSA 3CAXA 3C8ZA 4JW1A 1G4WR 3L8IA 3SXZA 2J45A 1L7CA 4RDAA 2WVQA 4DRJB 4FESA 2KJGA 4E18A 1OKKD 1ZHXA 3DWWA 5L3QA 1TWCA 3K33A 3HNJA 3ZG1A 5EHHA 4BJ5C 2L9JA 4EWCA 4XQ1A 2Q4FA 5COMA 3C62A 2J7PA 2M4EA 4OINF 2R7WA 4U5BE 4XPYA 3M79A 1YVIA 2CNWA 3DM5A 3KMIA 5KYNA 1QLEC 3B0PA 5FZTA 2KW3C 3CEXA 1LI7A 1ZHWA 2GA0A 1OW7A 1JPJA 4IWBA 3RW0A 1T5OA 1QQ3A 3SXYA 1FMVA 3F47A 2ETSA 2ZXWC 1MNDA 3JYHA 5F5FA 4FAPB 3O10A 4KC9A 3LLIA 3SP1A 2YZSA 1NG1A 2CCYA 4JEAA 4QI0A 4CDYA 4JKVA 2OJQA 4LERA 4O7GA 1OR3A 2ICWG 5BUOA 4JRZA 1LS4A 2ZXPA 2W9YA 2HJMA 5KYUB 1HMDA 2PP4A 1UFBA 3UGPA 4J7TA 2R25A 2WVOA 2A6EF 4JCHA 2J9UA 4LLEA 4MVUA 4X0RA 4JE9A 1ORYA 3V7OA 3OWTA 4DRIB 4YJWA 1I5NA 2L6GA 3NKEA 4EUKB 3DAFA 2AWYA 1R4TA 4NQFA 2A1DD 3VF0A 4CJOA 1RJ9B 4EBJA 3DI5A 2XXAB 3PMRA 1OW8A 1NZEA 2XRHA 2YLGA 4DJ9A 3EQLF 3W4YA 2HSQA 3ZTMA 2J9BA 1JPNA 4JURI 3LESA 1FAPB 4G7HF 3LAYA 5FCLA 3DZAA 1O3UA 2HMZA 2NSFA 4LDQA 2V26A 1Q0GA 4LDKA 4MVQA 3W8IA 4JTCB 4XLPF 3M1CB 3S28A 1HE9A 2AU5A 3A9CA 1BZ4A 2Y3BA 3UNGC 1QPUA 4JZAA 4BJ6C 1YA9A 3EGXB 1OKKA 2Y3DA 1LVKA 2Q9BA 2WZFA 1MMAA 5DS5A 2LP4A 5K0IA 1GM5A 1YZCA 1TFKB 3KPHA 3KH2A 3GWNA 3I5QA 3JRMO 1OCZC 2VCAA 5DQTA 2LIGA 3K66A 3WHNA 3DE9A 4KNWA 3EGDA 1CPRA 1OCCC 2EPNA 3OEOA 4YN0B 5TJ5E 2HMQA 4ANJA 2J7PD 1YAUO 5DS6A 2XL4A 3BRJA 2EINC 3UGOA 2MHRA 1YA7O 3AG4C 2QNLA 2XL8A 2QY9A 3NG1A 5DS4A 3K1IA 4CBEA 4IARA 3ITFA 4RD9A 2R7SA 1ZVZA 4WGZA 5A6JA 1FFHA 1Y4CA 2BE5F 5E2QA 4AE4B 1LE4A 4DVYP 4K7BA 3UMKA 3R7CA 3AJMA 2IXPA 2R7XA 3NYMA 4XPWA 2J0XA 3T6JA 2GWWA 2LD6A 1E83A 3RVYA 4PACA 2YL1A 1ZZPA 1PCXA 1YLMA 2Y39A 1PV3A 2J46A 1A7DA 4PFPA 1H9TA 2DB4A 3U3BA 5HV9A 5AC4A 3L8JA 4MS2A 2EIKC 3LS0A 3GEIA 2Q9AA 3AOUA 5KYXA 1H7IA 2D4UA 2KNHA 5JS5A 3E9VA 3GEEA 4EHPA 4PJJA 4E0HA 4CX9A 2VASA 2XM4A 4MTGA 1Y6DA 4YT8A 5JLIA 3MYFA 3J06A 1M2VB 2X51A 3B9QA 4A4AA 3U2LA 1Q0DA 4JC7A 1ZW3A 3EG9A 3RQGA 2KYHA 3H65A 4NTFA 1FR0A 2FFHA 1H6GA 2KC3A 2H7OA 3QVYA 3TJ6A 1ZU5A 5L0GA 2R7QA 1SZIA 2NSGA 3IQ6A 1OQCA 2DGJA 1D0XA 2MWQA 1Q0KA 3EZIA 3DKAA 4YL1A 4CIPA 3UR3C 1Z63A 4DBRA 2GAQA 3NMIA 2QE9A 2JD3A 1HW1A 3AGTA 1E84A 2NPUA 4PR9A 5COFA 1XWJA 1WTYA 3EPVA 4EKWA 256BA 2CGEA 2PX3A 2E87A 1GQAA 3O39A 1RKCA 4Z9JA 2OQMA 5T1DB 1VOMA 1TQGA 4F4BA 1U89A 1OR2A 5CIVA 2R7VA 3V5XA 2YRFA 2OU6A 3EH1A 4EBBA 3IEEA 2HFIA 3IQTA 3SXKA 5L0DA 4G7OF 4FX5A 2L81A 1NBBA 1WWPA 2MYSA 3NMJA 3I4UA 3U8PA 4E0IA 5KYYA 3RQFA 3HKKA 4AL1A 3Q7LA 2WB7A 1L3PA 3CZ6A 3H2UA 1IW7F 1S05A 4I3MA 2A68F 3ZIBA 1QVXA 3GORA 4RBNA 3LUTB 1EA8A 3RYLA 3RVZA 4BEMJ 3FDQA 4JIOA 3ZC4A 2KK1A 5E3CA 2ZXOA 5KYYB 2R7TA 1DOVA 1SF8A 2HV7A 2LFDA 4H54A 3U0CA 2Y3GA 1LE2A 4I1OB 1FMWA 4WGYA 1J8MF 1FTSA 1MMDA 4J30B 3KYJA 2G62A 1JAFA 1F1MA 5T3WA 1TWGA 3SYNA 2XLOA 2FGYA 1Z3IX 4Q5SF 1S7ZA 4CIHA 3FHDA 2M64A 3DE8A 1D0YA 1R5ID 3N2ZB 4Q7CA 5KYUA 3FVYA 1C03A 1CGOA 2WL8A 3K1IC 4G7ZF 2TMVP 1ZU4A 3UMIA 4PJLA 2YVKA 4YT5A 4CDAA 2J9VA 3SEOA 4MTOA 4MVOA 4CS7A 4KBLA 2CW0F 1AVOB 2IOQA 2QUPA 3Q6NA 4IB4A 4OD4A 2XLMA 4YK5A 1RJ9A 5IY5C 2J9WA 2YL3A 5L3VA 2XXAA 4XPXA 4YL3A 1W2WA 2WVNA 3JYYA 4M63A 5L0FA 2P0NA 2O9XA 1EI7A 4DBQA 1J8YF 1HY5A 3T6BA 3S84A 2L6FA 1E85A 1VB5A 4NTAA 1N1CA 3PHF2 3JZ0A 1Z23A 5L0IA 3FOOA 3U5SA 1IZMA 3E70C 3S27A 2DYRC 3PCVA 4Z9HA 1V74B 3N0TA 1FNTc 3EHNA 5DVWA 4CDVA 1I4ZA 2B0JA 4ER9A 2OJED 1HE1A 1YDIA 1EKYA 2H7VC 5JRAA 3IQ5A 3EGXA 4HFKB 4XTKA 4IJJA 1NLXA 1D1BA
chains in the Genus database with same CATH topology
3UMHA 4MNDA 3VYWA 2W4MA 4PJMA 3WODF 4U5EE 2Q9CA 4PFOA 2WZGA 2V3CC 3NYJA 3EHMA 3B0VC 3NRHA 4O6YA 2ZPAA 2NUTB 5DLJA 3W8HA 2EIJC 4XWJA 5E3AA 3LLKA 2KQ9A 3ZVRA 4AE4A 4J32B 5F5HA 3DD7A 3AG1C 3MX3A 4PJNA 1M57C 4OD5A 2PX0A 2OG2A 2W4BA 4E7ZA 3HJCA 5D92A 2IXOA 4GYTA 4BJTA 3EFOA 3NYLA 5B3SC 4OIPF 3DJNB 1M2VA 1G8XA 1VK5A 3LJBA 5DQZA 3EFOB 5B1AC 3HTKC 1TWHA 4U5CE 1O5HA 1ZHZA 3Q6MA 4C3EA 4Q4ZF 4ZLDA 3AG2C 1TWAA 2DYSC 2YHSA 4P6IC 3POVA 2P6VA 1VYKA 2A69F 4ULWA 2NUPB 1LS1A 4KI2A 3ECSA 2QTVA 3T4RA 1KU2A 3TD7A 4AX2A 3ABMC 1OCRC 3O6XA 3Q7GA 1V54C 3CQZA 4YT2A 4O6NA 1V55C 1TR2A 4NY3A 3K7DA 2P7VA 5D91A 4DVZA 2KGOA 1TKNA 1ZHYA 1NU7D 1BR1A 3DAGA 3DM9B 4CS8A 2NG1A 4E7SA 4K0DA 1Z5ZA 1D0ZA 2HV6A 5B1BC 2CDQA 3L34A 4MQ9F 4C3DA 2WZLA 4I1MA 3GANA 4O79A 2I8BA 4H4KC 4U5GA 5KYWB 4OIQF 3KL4A 1VMAA 2Z15A 4U5FE 3VAYA 2R7TA 4O6MA 4XLNF 2OCCC 5CI9A 1O87A 3RFYA 3NDBB 4QDLA 3JT1A 3LS1A 3WG7C 4N06A 2VH3A 2VB6A 4C7OA 4CS9A 3GODA 2R7RA 3LNRA 2YEVA 3K6BA 3JRTA 3QMKA 1M2OA 4C7OB 3AQCA 4OIOF 4ZLCA 3N24A 2ZXRA 3X2QC 3RH3A 2PF4E 3W2WA 4G0HA 4PK4A 2GFHA 2D5RB 3OA1A 5E33A 4QI2A 3DXJF 1VYIA 3FAJA 3NKDA 4OIRF 3L0IA 2IXMA 3S29A 4LACB 5EGYA 2C03A 4BEJA 1M56C 1Z6AA 3ABKC 1WGWA 4W8KA 3SNHA 2R7OA 3CSKA 1BR2A 3KKBA 4GEHA 2NUTA 1MMNA 2XSEA 4CSAA 2IYLD 3F46A 4U5HA 1FFTC 4AK9A 1ST6A 4U5DE 4A2NB 3RIPA 4YT4A 3ASNC 4CS8C 4DOZA 3K1HA 3HLZA 4I44A 4BJ5A 2IXNA 1NU9C 3EH2A 2PFDA 2A6HF 3DJUB 3LEVA 2W45A 4JJGA 3AQBA 2Y69C 3JCUQ 4JJFA 1D1CA 3EJNA 4IRUA 2CNWD 2EILC 3S0XA 3EGDB 3MLGA 2LSEA 4FWVA 4HFFB 2NUPA 3SZRA 3I5PA 1D1AA 3W2VA 4BJ1A 4CS9C 4C3BA 2Y3HA 5HSWA 2G3VA 1MMGA 3QZCA 3DMDA 1QZXA 1SMYF 2EIMC 4IAOA 5CI8A 2C04A 2R7UA 2H7BA 4HE8D 3ZSUA 3X1OA 3EZHA 4WJ0A 1ZHTA 2Q3TA 5KYXB 1PD0A 3RKOF 5T3TA 1PD1A 3ASOC 2J0WA 3JSZA 3B0UX 1ZYRF 3EG9B 3AG3C 4YWQA 1MNEA 4BJ6A 4LLCA 4KNVA 5KYWA 4HEAJ 4B6IA 2G3KA 1OCOC 4CSAC 1LKXA 3ABLC 4BG0A 1BR4A 4JVSA 4JW1A 2J45A 4RDAA 2WVQA 4FESA 2KJGA 1OKKD 1ZHXA 5L3QA 1TWCA 3K33A 3ZG1A 5EHHA 4BJ5C 2L9JA 4EWCA 2J7PA 2M4EA 4OINF 2R7WA 4U5BE 2CNWA 3DM5A 3KMIA 5KYNA 1QLEC 3B0PA 2KW3C 1ZHWA 4IWBA 1JPJA 1FMVA 3F47A 2ZXWC 1MNDA 3JYHA 5F5FA 4KC9A 3LLIA 3SP1A 2YZSA 1NG1A 4QI0A 4LERA 5BUOA 4O7GA 2ZXPA 2W9YA 5KYUB 2PP4A 4JCHA 2WVOA 4LLEA 2A6EF 4X0RA 2J9UA 3V7OA 3OWTA 4YJWA 3NKEA 3DAFA 2A1DD 1RJ9B 2XXAB 3PMRA 1NZEA 2XRHA 3EQLF 1JPNA 4JURI 3LESA 4G7HF 3LAYA 5FCLA 3DZAA 2V26A 3W8IA 4XLPF 3M1CB 3S28A 2Y3BA 3UNGC 4JZAA 4BJ6C 3EGXB 1OKKA 2Y3DA 1LVKA 2Q9BA 2WZFA 1MMAA 5DS5A 3KH2A 3I5QA 1OCZC 5DQTA 3K66A 4KNWA 3EGDA 1OCCC 3OEOA 4YN0B 4ANJA 2J7PD 5DS6A 2XL4A 2EINC 3UGOA 3AG4C 2QY9A 3NG1A 5DS4A 4CBEA 3ITFA 4RD9A 2R7SA 1FFHA 2BE5F 5E2QA 4AE4B 4DVYP 4K7BA 3UMKA 2R7XA 2IXPA 3NYMA 2J0XA 3T6JA 1PCXA 2Y39A 2J46A 4PFPA 2EIKC 3LS0A 2Q9AA 5KYXA 2KNHA 3E9VA 4YT8A 4PJJA 2VASA 1M2VB 2X51A 3B9QA 3EG9A 3H65A 2FFHA 2H7OA 1ZU5A 2R7QA 1SZIA 2DGJA 1D0XA 2MWQA 3EZIA 1Z63A 3UR3C 4DBRA 2JD3A 3EPVA 2CGEA 2PX3A 2E87A 3O39A 5T1DB 1VOMA 4F4BA 2R7VA 3EH1A 4EBBA 3IEEA 4G7OF 4FX5A 2L81A 2MYSA 3I4UA 5KYYA 4Q5SF 3Q7LA 2WB7A 3CZ6A 1IW7F 4I3MA 2A68F 3ZIBA 4RBNA 3RYLA 3FDQA 3ZC4A 5E3CA 2ZXOA 5KYYB 1SF8A 2HV7A 2Y3GA 4I1OB 1FMWA 1J8MF 1FTSA 1MMDA 4J30B 2G62A 5T3WA 1TWGA 3SYNA 2FGYA 1Z3IX 1S7ZA 4CIHA 3FHDA 1D0YA 4Q7CA 3N2ZB 5KYUA 3FVYA 2WL8A 3K1IC 4G7ZF 1ZU4A 3UMIA 4PJLA 4YT5A 2J9VA 3SEOA 4CS7A 4KBLA 2CW0F 2IOQA 3Q6NA 4OD4A 5L3VA 3UGPA 5IY5C 1RJ9A 2J9WA 2XXAA 1W2WA 2WVNA 4M63A 2O9XA 4DBQA 1J8YF 3T6BA 1N1CA 3PHF2 1Z23A 1IZMA 3E70C 3S27A 2DYRC 3N0TA 3EHNA 5DVWA 2B0JA 2H7VC 3EGXA 4HFKB 4XTKA 4IJJA 1D1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IOQ A;  2CGE A;  3Q6N A;  3Q6M A;  1SF8 A;  3HJC A; 
#chains in the Genus database with same CATH topology
 3UMH A;  4JEB A;  3O55 A;  3GEH A;  2B0H A;  4MND A;  3VYW A;  1WOL A;  4U9D A;  2W4M A;  4PJM A;  5L0J A;  3KYI A;  4U5E E;  3WOD F;  1VLS A;  3QVZ A;  2Q9C A;  1QKR A;  4JCZ A;  4W8P A;  1WN0 A;  1T01 A;  2WZG A;  3C8G A;  4PFO A;  5JSL A;  3PDM P;  2VC9 A;  3LEO A;  3NYJ A;  3EHM A;  3B0V C;  1JRA A;  2LFF A;  5JP7 A;  3T9O A;  2PBE A;  3NRH A;  4O6Y A;  4Z9I A;  2ZPA A;  2NUT B;  5DLJ A;  3C8G B;  4G78 A;  1I4Y A;  2XM0 A;  3W8H A;  3ZQY A;  2YLI A;  2EIJ C;  3A11 A;  3GM2 A;  3TOL A;  2XLW A;  4XWJ A;  5E3A A;  3LLK A;  4D4N A;  1A0B A;  2KQ9 A;  3ZVR A;  4AE4 A;  4EBK A;  4IAQ A;  4J32 B;  1WAT A;  5F5H A;  3DD7 A;  1M6T A;  4GQH A;  2R9R B;  2OEX A;  3AG1 C;  3MX3 A;  4PJN A;  1M57 C;  3RQE A;  3S90 A;  1YJG A;  5AC5 A;  5B3I A;  4OD5 A;  2PX0 A;  2OG2 A;  4UDV A;  2W4B A;  2AWC A;  4E7Z A;  3HJC A;  2R05 A;  4EIY A;  3ZDL A;  1EQ1 A;  5D92 A;  2IXO A;  4GYT A;  2YQY A;  3EFO A;  3NYL A;  4BJT A;  1UG7 A;  5B3S C;  1RMV A;  4MVR A;  4DXW A;  4OIP F;  2KSF A;  1BDJ B;  3DJN B;  1M2V A;  1G8X A;  5A6K A;  1VK5 A;  3LJB A;  5EK0 A;  5DQZ A;  3EFO B;  5B1A C;  1Q0F A;  1A7E A;  2XS1 A;  3G4X A;  3HTK C;  1TWH A;  2JX0 A;  1O5H A;  3FXH A;  3JTL O;  4U5C E;  3QW1 A;  1CPQ A;  2XLH A;  1ZHZ A;  3Q6M A;  1GS9 A;  4XEF A;  4C3E A;  4Q4Z F;  2J8W A;  4ZLD A;  3AG2 C;  4NC3 A;  1OW6 A;  2DYS C;  1RXQ A;  1TWA A;  2YHS A;  4P6I C;  1RKE A;  2P6V A;  3POV A;  3FOP A;  1VYK A;  2A69 F;  4ULW A;  2NUP B;  1LS1 A;  4KI2 A;  1ZW2 A;  3C63 A;  3ECS A;  4CJG A;  2DI3 A;  2QTV A;  1G5Z A;  3LNM B;  5GPG B;  1NFO A;  1H9G A;  1RKE B;  4N4W A;  3T4R A;  1KU2 A;  3L1M A;  3TJ5 A;  3TD7 A;  4MTF A;  2OEV A;  4AX2 A;  1AEP A;  2A0B A;  1OCR C;  3ABM C;  3HNK A;  3O6X A;  3Q7G A;  1V54 C;  2GDC A;  3CQZ A;  2X0C A;  3V5Y A;  4YT2 A;  1V4A A;  4O6N A;  1V55 C;  3US6 A;  1TR2 A;  4NY3 A;  1U6H A;  3K7D A;  2P7V A;  1G4U S;  5D91 A;  3NMK A;  2KGO A;  1K04 A;  1TKN A;  4DVZ A;  1ZHY A;  1NU7 D;  1BR1 A;  3DAG A;  3DM9 B;  3HNL A;  2ASR A;  4CS8 A;  4MVS A;  2BC5 A;  3JSE O;  2P1A A;  2NG1 A;  1NFN A;  4E7S A;  3T6G B;  1YAR O;  2IBF A;  4K1O A;  3QW0 A;  3C8G D;  1NSG B;  3U2M A;  5L0C A;  4K0D A;  1GGQ A;  2V3C C;  4YL0 A;  1Z5Z A;  3ZTZ A;  1D0Z A;  2HV6 A;  2EPK X;  5B1B C;  1YYJ A;  2CDQ A;  3L34 A;  2L7A A;  4MQ9 F;  2L6H A;  3ZQV A;  1B68 A;  2WZL A;  4JTA B;  4I1M A;  3GAN A;  4BPM A;  3U8V A;  4C3D A;  1CGM E;  4O79 A;  2I8B A;  4H4K C;  5BQI A;  2AVK A;  1Z7Q c;  5BQH A;  4U5G A;  5KYW B;  4OIQ F;  2YKZ A;  3KL4 A;  1VMA A;  2Z15 A;  4U5F E;  3VAY A;  4D4X A;  1VLT A;  5JT4 A;  4XEK A;  4O6M A;  2VCC A;  2OCC C;  5CI9 A;  1O87 A;  4XLN F;  3RFY A;  3GWL A;  4DRH B;  3NDB B;  4QDL A;  3TQO A;  3RF3 A;  1YZA A;  3JT1 A;  1HW2 A;  3LS1 A;  3WG7 C;  2ZD9 A;  4N06 A;  2VH3 A;  2I15 A;  2VB6 A;  3TOM A;  2BL2 A;  4C7O A;  3FMS A;  2RD9 A;  4CS9 A;  4IGG A;  3GOD A;  2OKU A;  2R7R A;  1U0B B;  1RCP A;  3LNR A;  2YEV A;  1A41 A;  3K6B A;  1T9K A;  3FAP B;  3JRT A;  2R02 A;  3V5Z A;  3QMK A;  1M2O A;  3SXM A;  3WAQ A;  4C7O B;  1A7V A;  5A6A A;  4N6C A;  2AP3 A;  3AQC A;  4OIO F;  4ZLC A;  2YL0 A;  3N24 A;  2ZXR A;  1ORJ A;  3X2Q C;  1SR2 A;  2HZ8 A;  1C17 M;  3RH3 A;  2PF4 E;  3W2W A;  2OOC A;  3IPM O;  2CYD A;  4G0H A;  1KTM A;  4PK4 A;  2GFH A;  3MFN A;  2D5R B;  3OA1 A;  4WAB A;  5E33 A;  4QI2 A;  3DXJ F;  1VYI A;  3FAJ A;  3TK0 A;  3NKD A;  4OIR F;  2XLV A;  2UUI A;  3L0I A;  2IXM A;  3S29 A;  4LAC B;  1DOW A;  2LK4 A;  1KNY A;  2C03 A;  3IQC A;  5EGY A;  3R2P A;  3AGU A;  4BEJ A;  1M56 C;  1XZP A;  3ZWI A;  5F28 E;  5COG A;  1Z6A A;  3ABK C;  1E86 A;  3BEH A;  3B29 A;  1WGW A;  3MBG A;  4W8K A;  3SNH A;  2R7O A;  3CSK A;  1BR2 A;  4MW8 A;  1LIH A;  1T6Q A;  4U9E A;  3KKB A;  4GEH A;  2A0U A;  2NUT A;  2HKV A;  1MMN A;  2XSE A;  5A69 A;  3B71 A;  1JOG A;  3H2V A;  4P9T A;  4CSA A;  2XLE A;  4NCQ A;  5A6B D;  2IYL D;  3F46 A;  4U5H A;  1VTM P;  1FFT C;  4AK9 A;  1AUE A;  1ST6 A;  1WAS A;  1XZQ A;  2LQG A;  3QTH A;  4U5D E;  4A2N B;  3RIP A;  5JVE A;  4ULV A;  4JTD B;  2H8A A;  1SYQ A;  2UUH A;  3ASN C;  4CS8 C;  4YT4 A;  3U9J A;  2PNO A;  4L6R A;  3K1H A;  4DOZ A;  3VRC A;  3HLZ A;  4I44 A;  3ATP A;  4BJ5 A;  2IXN A;  1T6I A;  3S9O A;  1LM3 B;  4J7Y A;  1NU9 C;  2P61 A;  5BQG A;  2IM8 A;  1OXK A;  3IHU A;  3EH2 A;  2QLA A;  2PFD A;  2A6H F;  1E2X A;  3M4C A;  1JR8 A;  3DJU B;  3LEV A;  2W45 A;  3U3F A;  4JJG A;  4AL0 A;  1K05 A;  3AQB A;  3VM6 A;  5JUA A;  2Y69 C;  3JCU Q;  4N6H A;  1APC A;  4JJF A;  3M15 A;  1D1C A;  3HNI A;  2R03 A;  3EJN A;  4MW3 A;  4IRU A;  2CNW D;  1CGN A;  2EIL C;  3S0X A;  1OXB A;  2HUJ A;  3EGD B;  3MLG A;  2LSE A;  4FWV A;  1JMW A;  2HS5 A;  4LDR A;  1QSP A;  2XLD A;  3M4B A;  4HFF B;  2XL6 A;  4MVZ A;  4R32 A;  4E17 A;  4P9F A;  2XS8 A;  2NUP A;  3SZR A;  3GM3 A;  2EPL X;  3I5P A;  1D1A A;  2YWA A;  1C02 A;  2HJ3 A;  3W2V A;  4BJ1 A;  4NTB A;  2Y3H A;  4C3B A;  4CS9 C;  5HSW A;  5AGF A;  2HSB A;  5L0H A;  2F22 A;  2G3V A;  1MMG A;  3QZC A;  1SMY F;  1MQV A;  1QZX A;  2EIM C;  3DMD A;  4IAO A;  5CI8 A;  1BBH A;  2RSE B;  2C04 A;  1T6U A;  2R7U A;  2H7B A;  2JPU A;  3GM1 A;  4HE8 D;  3ZSU A;  2VCB A;  1ORS C;  1LI5 A;  3X1O A;  2Q00 A;  2EPM X;  3EZH A;  4WJ0 A;  1ZHT A;  3G4Z A;  2Q3T A;  5KYX B;  2LCH A;  1PD0 A;  2FAP B;  3G50 A;  2Q7R A;  5T3T A;  3RKO F;  5A6B A;  1PD1 A;  3ASO C;  2J0W A;  3MYI A;  1YYX A;  3JSZ A;  1HMO A;  3B0U X;  1ZYR F;  3EG9 B;  3AG3 C;  4ONS A;  4YWQ A;  1MNE A;  4BJ6 A;  3C18 A;  2YLD A;  4MVM A;  4LLC A;  3TUL A;  4KNV A;  5KYW A;  4HEA J;  1TFO B;  3C7J A;  2G3K A;  4B6I A;  1OCO C;  4CSA C;  1K40 A;  1LKX A;  3ABL C;  2EPO A;  2YL7 A;  4BG0 A;  1BR4 A;  4XEV A;  1LPE A;  1Q0M A;  3U9M A;  4JVS A;  3CAX A;  3C8Z A;  4JW1 A;  1G4W R;  3L8I A;  3SXZ A;  2J45 A;  1L7C A;  4RDA A;  2WVQ A;  4DRJ B;  4FES A;  2KJG A;  4E18 A;  1OKK D;  1ZHX A;  3DWW A;  5L3Q A;  1TWC A;  3K33 A;  3HNJ A;  3ZG1 A;  5EHH A;  4BJ5 C;  2L9J A;  4EWC A;  4XQ1 A;  2Q4F A;  5COM A;  3C62 A;  2J7P A;  2M4E A;  4OIN F;  2R7W A;  4U5B E;  4XPY A;  3M79 A;  1YVI A;  2CNW A;  3DM5 A;  3KMI A;  5KYN A;  1QLE C;  3B0P A;  5FZT A;  2KW3 C;  3CEX A;  1LI7 A;  1ZHW A;  2GA0 A;  1OW7 A;  1JPJ A;  4IWB A;  3RW0 A;  1T5O A;  1QQ3 A;  3SXY A;  1FMV A;  3F47 A;  2ETS A;  2ZXW C;  1MND A;  3JYH A;  5F5F A;  4FAP B;  3O10 A;  4KC9 A;  3LLI A;  3SP1 A;  2YZS A;  1NG1 A;  2CCY A;  4JEA A;  4QI0 A;  4CDY A;  4JKV A;  2OJQ A;  4LER A;  4O7G A;  1OR3 A;  2ICW G;  5BUO A;  4JRZ A;  1LS4 A;  2ZXP A;  2W9Y A;  2HJM A;  5KYU B;  1HMD A;  2PP4 A;  1UFB A;  3UGP A;  4J7T A;  2R25 A;  2WVO A;  2A6E F;  4JCH A;  2J9U A;  4LLE A;  4MVU A;  4X0R A;  4JE9 A;  1ORY A;  3V7O A;  3OWT A;  4DRI B;  4YJW A;  1I5N A;  2L6G A;  3NKE A;  4EUK B;  3DAF A;  2AWY A;  1R4T A;  4NQF A;  2A1D D;  3VF0 A;  4CJO A;  1RJ9 B;  4EBJ A;  3DI5 A;  2XXA B;  3PMR A;  1OW8 A;  1NZE A;  2XRH A;  2YLG A;  4DJ9 A;  3EQL F;  3W4Y A;  2HSQ A;  3ZTM A;  2J9B A;  1JPN A;  4JUR I;  3LES A;  1FAP B;  4G7H F;  3LAY A;  5FCL A;  3DZA A;  1O3U A;  2HMZ A;  2NSF A;  4LDQ A;  2V26 A;  1Q0G A;  4LDK A;  4MVQ A;  3W8I A;  4JTC B;  4XLP F;  3M1C B;  3S28 A;  1HE9 A;  2AU5 A;  3A9C A;  1BZ4 A;  2Y3B A;  3UNG C;  1QPU A;  4JZA A;  4BJ6 C;  1YA9 A;  3EGX B;  1OKK A;  2Y3D A;  1LVK A;  2Q9B A;  2WZF A;  1MMA A;  5DS5 A;  2LP4 A;  5K0I A;  1GM5 A;  1YZC A;  1TFK B;  3KPH A;  3KH2 A;  3GWN A;  3I5Q A;  3JRM O;  1OCZ C;  2VCA A;  5DQT A;  2LIG A;  3K66 A;  3WHN A;  3DE9 A;  4KNW A;  3EGD A;  1CPR A;  1OCC C;  2EPN A;  3OEO A;  4YN0 B;  5TJ5 E;  2HMQ A;  4ANJ A;  2J7P D;  1YAU O;  5DS6 A;  2XL4 A;  3BRJ A;  2EIN C;  3UGO A;  2MHR A;  1YA7 O;  3AG4 C;  2QNL A;  2XL8 A;  2QY9 A;  3NG1 A;  5DS4 A;  3K1I A;  4CBE A;  4IAR A;  3ITF A;  4RD9 A;  2R7S A;  1ZVZ A;  4WGZ A;  5A6J A;  1FFH A;  1Y4C A;  2BE5 F;  5E2Q A;  4AE4 B;  1LE4 A;  4DVY P;  4K7B A;  3UMK A;  3R7C A;  3AJM A;  2IXP A;  2R7X A;  3NYM A;  4XPW A;  2J0X A;  3T6J A;  2GWW A;  2LD6 A;  1E83 A;  3RVY A;  4PAC A;  2YL1 A;  1ZZP A;  1PCX A;  1YLM A;  2Y39 A;  1PV3 A;  2J46 A;  1A7D A;  4PFP A;  1H9T A;  2DB4 A;  3U3B A;  5HV9 A;  5AC4 A;  3L8J A;  4MS2 A;  2EIK C;  3LS0 A;  3GEI A;  2Q9A A;  3AOU A;  5KYX A;  1H7I A;  2D4U A;  2KNH A;  5JS5 A;  3E9V A;  3GEE A;  4EHP A;  4PJJ A;  4E0H A;  4CX9 A;  2VAS A;  2XM4 A;  4MTG A;  1Y6D A;  4YT8 A;  5JLI A;  3MYF A;  3J06 A;  1M2V B;  2X51 A;  3B9Q A;  4A4A A;  3U2L A;  1Q0D A;  4JC7 A;  1ZW3 A;  3EG9 A;  3RQG A;  2KYH A;  3H65 A;  4NTF A;  1FR0 A;  2FFH A;  1H6G A;  2KC3 A;  2H7O A;  3QVY A;  3TJ6 A;  1ZU5 A;  5L0G A;  2R7Q A;  1SZI A;  2NSG A;  3IQ6 A;  1OQC A;  2DGJ A;  1D0X A;  2MWQ A;  1Q0K A;  3EZI A;  3DKA A;  4YL1 A;  4CIP A;  3UR3 C;  1Z63 A;  4DBR A;  2GAQ A;  3NMI A;  2QE9 A;  2JD3 A;  1HW1 A;  3AGT A;  1E84 A;  2NPU A;  4PR9 A;  5COF A;  1XWJ A;  1WTY A;  3EPV A;  4EKW A;  256B A;  2CGE A;  2PX3 A;  2E87 A;  1GQA A;  3O39 A;  1RKC A;  4Z9J A;  2OQM A;  5T1D B;  1VOM A;  1TQG A;  4F4B A;  1U89 A;  1OR2 A;  5CIV A;  2R7V A;  3V5X A;  2YRF A;  2OU6 A;  3EH1 A;  4EBB A;  3IEE A;  2HFI A;  3IQT A;  3SXK A;  5L0D A;  4G7O F;  4FX5 A;  2L81 A;  1NBB A;  1WWP A;  2MYS A;  3NMJ A;  3I4U A;  3U8P A;  4E0I A;  5KYY A;  3RQF A;  3HKK A;  4AL1 A;  3Q7L A;  2WB7 A;  1L3P A;  3CZ6 A;  3H2U A;  1IW7 F;  1S05 A;  4I3M A;  2A68 F;  3ZIB A;  1QVX A;  3GOR A;  4RBN A;  3LUT B;  1EA8 A;  3RYL A;  3RVZ A;  4BEM J;  3FDQ A;  4JIO A;  3ZC4 A;  2KK1 A;  5E3C A;  2ZXO A;  5KYY B;  2R7T A;  1DOV A;  1SF8 A;  2HV7 A;  2LFD A;  4H54 A;  3U0C A;  2Y3G A;  1LE2 A;  4I1O B;  1FMW A;  4WGY A;  1J8M F;  1FTS A;  1MMD A;  4J30 B;  3KYJ A;  2G62 A;  1JAF A;  1F1M A;  5T3W A;  1TWG A;  3SYN A;  2XLO A;  2FGY A;  1Z3I X;  4Q5S F;  1S7Z A;  4CIH A;  3FHD A;  2M64 A;  3DE8 A;  1D0Y A;  1R5I D;  3N2Z B;  4Q7C A;  5KYU A;  3FVY A;  1C03 A;  1CGO A;  2WL8 A;  3K1I C;  4G7Z F;  2TMV P;  1ZU4 A;  3UMI A;  4PJL A;  2YVK A;  4YT5 A;  4CDA A;  2J9V A;  3SEO A;  4MTO A;  4MVO A;  4CS7 A;  4KBL A;  2CW0 F;  1AVO B;  2IOQ A;  2QUP A;  3Q6N A;  4IB4 A;  4OD4 A;  2XLM A;  4YK5 A;  1RJ9 A;  5IY5 C;  2J9W A;  2YL3 A;  5L3V A;  2XXA A;  4XPX A;  4YL3 A;  1W2W A;  2WVN A;  3JYY A;  4M63 A;  5L0F A;  2P0N A;  2O9X A;  1EI7 A;  4DBQ A;  1J8Y F;  1HY5 A;  3T6B A;  3S84 A;  2L6F A;  1E85 A;  1VB5 A;  4NTA A;  1N1C A;  3PHF 2;  3JZ0 A;  1Z23 A;  5L0I A;  3FOO A;  3U5S A;  1IZM A;  3E70 C;  3S27 A;  2DYR C;  3PCV A;  4Z9H A;  1V74 B;  3N0T A;  1FNT c;  3EHN A;  5DVW A;  4CDV A;  1I4Z A;  2B0J A;  4ER9 A;  2OJE D;  1HE1 A;  1YDI A;  1EKY A;  2H7V C;  5JRA A;  3IQ5 A;  3EGX A;  4HFK B;  4XTK A;  4IJJ A;  1NLX A;  1D1B A; 
#chains in the Genus database with same CATH homology
 3UMH A;  4MND A;  3VYW A;  2W4M A;  4PJM A;  3WOD F;  4U5E E;  2Q9C A;  4PFO A;  2WZG A;  2V3C C;  3NYJ A;  3EHM A;  3B0V C;  3NRH A;  4O6Y A;  2ZPA A;  2NUT B;  5DLJ A;  3W8H A;  2EIJ C;  4XWJ A;  5E3A A;  3LLK A;  2KQ9 A;  3ZVR A;  4AE4 A;  4J32 B;  5F5H A;  3DD7 A;  3AG1 C;  3MX3 A;  4PJN A;  1M57 C;  4OD5 A;  2PX0 A;  2OG2 A;  2W4B A;  4E7Z A;  3HJC A;  5D92 A;  2IXO A;  4GYT A;  4BJT A;  3EFO A;  3NYL A;  5B3S C;  4OIP F;  3DJN B;  1M2V A;  1G8X A;  1VK5 A;  3LJB A;  5DQZ A;  3EFO B;  5B1A C;  3HTK C;  1TWH A;  4U5C E;  1O5H A;  1ZHZ A;  3Q6M A;  4C3E A;  4Q4Z F;  4ZLD A;  3AG2 C;  1TWA A;  2DYS C;  2YHS A;  4P6I C;  3POV A;  2P6V A;  1VYK A;  2A69 F;  4ULW A;  2NUP B;  1LS1 A;  4KI2 A;  3ECS A;  2QTV A;  3T4R A;  1KU2 A;  3TD7 A;  4AX2 A;  3ABM C;  1OCR C;  3O6X A;  3Q7G A;  1V54 C;  3CQZ A;  4YT2 A;  4O6N A;  1V55 C;  1TR2 A;  4NY3 A;  3K7D A;  2P7V A;  5D91 A;  4DVZ A;  2KGO A;  1TKN A;  1ZHY A;  1NU7 D;  1BR1 A;  3DAG A;  3DM9 B;  4CS8 A;  2NG1 A;  4E7S A;  4K0D A;  1Z5Z A;  1D0Z A;  2HV6 A;  5B1B C;  2CDQ A;  3L34 A;  4MQ9 F;  4C3D A;  2WZL A;  4I1M A;  3GAN A;  4O79 A;  2I8B A;  4H4K C;  4U5G A;  5KYW B;  4OIQ F;  3KL4 A;  1VMA A;  2Z15 A;  4U5F E;  3VAY A;  2R7T A;  4O6M A;  4XLN F;  2OCC C;  5CI9 A;  1O87 A;  3RFY A;  3NDB B;  4QDL A;  3JT1 A;  3LS1 A;  3WG7 C;  4N06 A;  2VH3 A;  2VB6 A;  4C7O A;  4CS9 A;  3GOD A;  2R7R A;  3LNR A;  2YEV A;  3K6B A;  3JRT A;  3QMK A;  1M2O A;  4C7O B;  3AQC A;  4OIO F;  4ZLC A;  3N24 A;  2ZXR A;  3X2Q C;  3RH3 A;  2PF4 E;  3W2W A;  4G0H A;  4PK4 A;  2GFH A;  2D5R B;  3OA1 A;  5E33 A;  4QI2 A;  3DXJ F;  1VYI A;  3FAJ A;  3NKD A;  4OIR F;  3L0I A;  2IXM A;  3S29 A;  4LAC B;  5EGY A;  2C03 A;  4BEJ A;  1M56 C;  1Z6A A;  3ABK C;  1WGW A;  4W8K A;  3SNH A;  2R7O A;  3CSK A;  1BR2 A;  3KKB A;  4GEH A;  2NUT A;  1MMN A;  2XSE A;  4CSA A;  2IYL D;  3F46 A;  4U5H A;  1FFT C;  4AK9 A;  1ST6 A;  4U5D E;  4A2N B;  3RIP A;  4YT4 A;  3ASN C;  4CS8 C;  4DOZ A;  3K1H A;  3HLZ A;  4I44 A;  4BJ5 A;  2IXN A;  1NU9 C;  3EH2 A;  2PFD A;  2A6H F;  3DJU B;  3LEV A;  2W45 A;  4JJG A;  3AQB A;  2Y69 C;  3JCU Q;  4JJF A;  1D1C A;  3EJN A;  4IRU A;  2CNW D;  2EIL C;  3S0X A;  3EGD B;  3MLG A;  2LSE A;  4FWV A;  4HFF B;  2NUP A;  3SZR A;  3I5P A;  1D1A A;  3W2V A;  4BJ1 A;  4CS9 C;  4C3B A;  2Y3H A;  5HSW A;  2G3V A;  1MMG A;  3QZC A;  3DMD A;  1QZX A;  1SMY F;  2EIM C;  4IAO A;  5CI8 A;  2C04 A;  2R7U A;  2H7B A;  4HE8 D;  3ZSU A;  3X1O A;  3EZH A;  4WJ0 A;  1ZHT A;  2Q3T A;  5KYX B;  1PD0 A;  3RKO F;  5T3T A;  1PD1 A;  3ASO C;  2J0W A;  3JSZ A;  3B0U X;  1ZYR F;  3EG9 B;  3AG3 C;  4YWQ A;  1MNE A;  4BJ6 A;  4LLC A;  4KNV A;  5KYW A;  4HEA J;  4B6I A;  2G3K A;  1OCO C;  4CSA C;  1LKX A;  3ABL C;  4BG0 A;  1BR4 A;  4JVS A;  4JW1 A;  2J45 A;  4RDA A;  2WVQ A;  4FES A;  2KJG A;  1OKK D;  1ZHX A;  5L3Q A;  1TWC A;  3K33 A;  3ZG1 A;  5EHH A;  4BJ5 C;  2L9J A;  4EWC A;  2J7P A;  2M4E A;  4OIN F;  2R7W A;  4U5B E;  2CNW A;  3DM5 A;  3KMI A;  5KYN A;  1QLE C;  3B0P A;  2KW3 C;  1ZHW A;  4IWB A;  1JPJ A;  1FMV A;  3F47 A;  2ZXW C;  1MND A;  3JYH A;  5F5F A;  4KC9 A;  3LLI A;  3SP1 A;  2YZS A;  1NG1 A;  4QI0 A;  4LER A;  5BUO A;  4O7G A;  2ZXP A;  2W9Y A;  5KYU B;  2PP4 A;  4JCH A;  2WVO A;  4LLE A;  2A6E F;  4X0R A;  2J9U A;  3V7O A;  3OWT A;  4YJW A;  3NKE A;  3DAF A;  2A1D D;  1RJ9 B;  2XXA B;  3PMR A;  1NZE A;  2XRH A;  3EQL F;  1JPN A;  4JUR I;  3LES A;  4G7H F;  3LAY A;  5FCL A;  3DZA A;  2V26 A;  3W8I A;  4XLP F;  3M1C B;  3S28 A;  2Y3B A;  3UNG C;  4JZA A;  4BJ6 C;  3EGX B;  1OKK A;  2Y3D A;  1LVK A;  2Q9B A;  2WZF A;  1MMA A;  5DS5 A;  3KH2 A;  3I5Q A;  1OCZ C;  5DQT A;  3K66 A;  4KNW A;  3EGD A;  1OCC C;  3OEO A;  4YN0 B;  4ANJ A;  2J7P D;  5DS6 A;  2XL4 A;  2EIN C;  3UGO A;  3AG4 C;  2QY9 A;  3NG1 A;  5DS4 A;  4CBE A;  3ITF A;  4RD9 A;  2R7S A;  1FFH A;  2BE5 F;  5E2Q A;  4AE4 B;  4DVY P;  4K7B A;  3UMK A;  2R7X A;  2IXP A;  3NYM A;  2J0X A;  3T6J A;  1PCX A;  2Y39 A;  2J46 A;  4PFP A;  2EIK C;  3LS0 A;  2Q9A A;  5KYX A;  2KNH A;  3E9V A;  4YT8 A;  4PJJ A;  2VAS A;  1M2V B;  2X51 A;  3B9Q A;  3EG9 A;  3H65 A;  2FFH A;  2H7O A;  1ZU5 A;  2R7Q A;  1SZI A;  2DGJ A;  1D0X A;  2MWQ A;  3EZI A;  1Z63 A;  3UR3 C;  4DBR A;  2JD3 A;  3EPV A;  2CGE A;  2PX3 A;  2E87 A;  3O39 A;  5T1D B;  1VOM A;  4F4B A;  2R7V A;  3EH1 A;  4EBB A;  3IEE A;  4G7O F;  4FX5 A;  2L81 A;  2MYS A;  3I4U A;  5KYY A;  4Q5S F;  3Q7L A;  2WB7 A;  3CZ6 A;  1IW7 F;  4I3M A;  2A68 F;  3ZIB A;  4RBN A;  3RYL A;  3FDQ A;  3ZC4 A;  5E3C A;  2ZXO A;  5KYY B;  1SF8 A;  2HV7 A;  2Y3G A;  4I1O B;  1FMW A;  1J8M F;  1FTS A;  1MMD A;  4J30 B;  2G62 A;  5T3W A;  1TWG A;  3SYN A;  2FGY A;  1Z3I X;  1S7Z A;  4CIH A;  3FHD A;  1D0Y A;  4Q7C A;  3N2Z B;  5KYU A;  3FVY A;  2WL8 A;  3K1I C;  4G7Z F;  1ZU4 A;  3UMI A;  4PJL A;  4YT5 A;  2J9V A;  3SEO A;  4CS7 A;  4KBL A;  2CW0 F;  2IOQ A;  3Q6N A;  4OD4 A;  5L3V A;  3UGP A;  5IY5 C;  1RJ9 A;  2J9W A;  2XXA A;  1W2W A;  2WVN A;  4M63 A;  2O9X A;  4DBQ A;  1J8Y F;  3T6B A;  1N1C A;  3PHF 2;  1Z23 A;  1IZM A;  3E70 C;  3S27 A;  2DYR C;  3N0T A;  3EHN A;  5DVW A;  2B0J A;  2H7V C;  3EGX A;  4HFK B;  4XTK A;  4IJJ A;  1D1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...