1SF8A

Crystal structure of the carboxy-terminal domain of htpg, the e. coli hsp90
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
SFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEVKYIFELNPDHVLVKRAADTEDEAKFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the carboxy-terminal dimerization domain of htpG, the Escherichia coli Hsp90, reveals a potential substrate binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords Chaperone protein htpG
total genus 32
structure length 115
sequence length 115
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2004-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1sf8A00
3Q6NA 3Q6MA 1SF8A 2CGEA 2IOQA 3HJCA
chains in the Genus database with same CATH superfamily
2R7VA 3G50A 1HW2A 4C7OB 2I15A 4J7YA 2M64A 2C03A 4MVMA 1KTMA 2R7UA 1C17M 4YT2A 2A68F 1BBHA 1NFOA 3QMKA 2AVKA 3M4BA 1VLSA 3S29A 1H9TA 2L6FA 1D1AA 3NYLA 3CSKA 3H65A 4BG0A 2A0UA 3G4XA 1YZCA 3EG9A 3I5QA 2KC3A 4LDRA 3B9QA 3MYFA 4PFOA 3FOOA 5AGFA 2A6EF 4DVYP 3UGOA 3QW0A 4BJ6A 3NKEA 2ETSA 3CZ6A 5DLJA 5EHHA 4XPXA 1QQ3A 2L6HA 1T6IA 4MNDA 2ZXPA 4CJGA 2PF4E 3VYWA 2AWCA 3W4YA 2J0XA 4DJ9A 1JPNA 3HKKA 4RD9A 4JZAA 3X2QC 3C62A 5CI8A 2OU6A 3FAPB 2X51A 4IWBA 4EHPA 4PJJA 1HW1A 3LNMB 5KYUB 2YL0A 3U9MA 4JVSA 3ZC4A 5KYYA 1LE4A 1PD0A 1OW8A 4ULVA 1PCXA 4ZLCA 5KYXA 2OKUA 5AC5A 5IY5C 4CS7A 1MMAA 2P1AA 3PCVA 1EA8A 4N4WA 3LNRA 2D5RB 3JRMO 1MNDA 3FXHA 3RF3A 2IOQA 1LI7A 1YYJA 2JPUA 3K66A 3ABKC 1NZEA 3Q6NA 1AEPA 4P6IC 3IQCA 3EZHA 3MYIA 1Z7Qc 2HMZA 3EPVA 4G78A 3S28A 2M4EA 2XL4A 3RH3A 4EIYA 5FCLA 1RMVA 3MBGA 2GA0A 3K1IC 3X1OA 2P7VA 2EINC 3M1CB 3GORA 4LLCA 1O3UA 3NMKA 4QI2A 2L9JA 2AWYA 3HNIA 3K6BA 4K1OA 1VYKA 2J0WA 2UUHA 1A7DA 2ZXWC 4LACB 5CI9A 3PHF2 3U8VA 3C63A 1KNYA 4U5CE 5B3SC 3LEVA 1H9GA 1A0BA 4OD5A 1D0ZA 4E18A 4BJ5A 1T6QA 3LAYA 1CGME 2CDQA 2A6HF 2KYHA 2KSFA 4WABA 4OINF 3ABMC 5E3AA 3T4RA 3BEHA 4LDKA 3ZWIA 4ER9A 2RSEB 2VCAA 3AGTA 2ICWG 2IXOA 1PD1A 1YVIA 4FESA 5E2QA 3JYHA 4H4KC 1HY5A 1CGOA 2EIMC 3IHUA 3AG1C 3GEIA 4IRUA 1S7ZA 4DBRA 2E87A 1VK5A 3L34A 4PJNA 2R9RB 3A11A 1GGQA 2Z15A 3FMSA 4EUKB 4XEFA 1FFHA 3EH2A 1JMWA 4CIPA 1I4ZA 1V55C 2H7BA 4YN0B 5KYUA 1H7IA 2YLGA 4NTFA 1DOWA 5D91A 1Z23A 4X0RA 2CGEA 1RCPA 2GAQA 2H8AA 5A69A 1FFTC 2I8BA 3A9CA 2WVOA 5F5HA 3US6A 4M63A 4E17A 1OCOC 5A6KA 2R7QA 3RIPA 2YHSA 3EHMA 3NMIA 3PMRA 2WVQA 1TQGA 3CEXA 2EPNA 1QSPA 2IXMA 4G7ZF 3C8GB 3E70C 3DJNB 1V54C 2XLVA 3LESA 2FFHA 1CPQA 3SXYA 3V5ZA 5L0GA 2VH3A 3M79A 1S05A 4KNWA 1F1MA 4OIPF 3ZTZA 1ZU5A 2L7AA 4E0IA 3ABLC 1V74B 1K40A 4W8KA 5JVEA 1WGWA 3TULA 3DE8A 3EZIA 3RQGA 3KH2A 2NUPB 3VAYA 2XLHA 4W8PA 4UDVA 1RJ9A 1UG7A 3B0VC 2J7PA 3AGUA 3B29A 3RQEA 4LDQA 2ASRA 2OG2A 3EGXB 1J8MF 4JEBA 1YA9A 4JCHA 3EGDB 4WJ0A 3I5PA 5JUAA 1O5HA 3H2VA 2HKVA 2J9WA 2NSFA 2XM4A 3ASOC 1FAPB 3JTLO 2KW3C 4JC7A 3ZVRA 1AUEA 4CBEA 4CSAC 2V26A 3NKDA 4Z9JA 3VRCA 2W45A 2J9UA 1LKXA 1C02A 3U9JA 2HV6A 4P9TA 3ZQYA 4GQHA 5T1DB 4CX9A 4DOZA 4MW3A 3KL4A 1VB5A 2HJMA 2Q4FA 2QLAA 1MMDA 4I3MA 3EFOB 1D0YA 3TD7A 5L0FA 2Y3GA 3V5XA 2HSBA 2Q9CA 1YA7O 3VM6A 1LVKA 1SR2A 4PK4A 1TWCA 2VCBA 3O6XA 4CDVA 4PR9A 3IQ5A 1BZ4A 3K33A 4PJLA 4JIOA 1QLEC 3LLIA 4CSAA 4YL0A 3TK0A 1A7EA 2OEXA 2XLOA 1OXBA 4JJGA 5L3VA 4XQ1A 3HNLA 4OIOF 1M57C 3GODA 5D92A 3U3BA 1GM5A 2LP4A 3QTHA 4NQFA 3W2VA 5L0CA 3JCUQ 4U5GA 3ZIBA 3CAXA 5COGA 3T6GB 4G7HF 1N1CA 1UFBA 1QVXA 2EIKC 2R25A 3JZ0A 4WGZA 4IAQA 4J32B 4MVSA 1NFNA 3UR3C 5COMA 4BJTA 4C3DA 3AJMA 1J8YF 3IQ6A 3J06A 4DRIB 4RDAA 1MNEA 4E7SA 1FTSA 2YVKA 3OA1A 5DQZA 3SYNA 3PDMP 1LPEA 1TWGA 3R7CA 3RW0A 1QPUA 4EBBA 1M2VA 2CNWD 4CS8A 2XM0A 1JRAA 1JR8A 5T3WA 2ZPAA 3WAQA 3U8PA 4Z9HA 4XWJA 3GEHA 2JD3A 1G4US 1JPJA 1T9KA 5T3TA 3EJNA 1FNTc 4F4BA 2CCYA 3U3FA 1IZMA 4PJMA 1ZHYA 4OIRF 2GDCA 4YT4A 4CIHA 3S84A 2V3CC 5KYWB 1FR0A 1XWJA 2GWWA 3E9VA 3N0TA 3RYLA 1D1CA 2NPUA 4HE8D 2B0JA 5DS6A 3GM2A 5L0JA 1VTMP 1NBBA 2EPOA 3C7JA 1TFKB 5JS5A 5KYYB 3R2PA 5KYNA 3MX3A 3O10A 3DE9A 4K0DA 3SEOA 4YL1A 5DQTA 1ZVZA 4I44A 1BDJB 1NLXA 3OEOA 4EBJA 4IGGA 2YRFA 2Q7RA 2YL1A 2CNWA 2MYSA 1BR2A 3QZCA 4MTFA 4PFPA 1Y6DA 2Y3HA 4E7ZA 5BQHA 2J9VA 2Y39A 2XS1A 3EQLF 4GEHA 1U6HA 2G3KA 2YQYA 1K04A 3DJUB 4JURI 1R4TA 3DKAA 4OD4A 1Z63A 2LQGA 4C3BA 5TJ5E 4KC9A 3GWNA 4FX5A 4JTDB 4DRHB 1Z3IX 2X0CA 2XL6A 2NG1A 2FAPB 2VB6A 3DAGA 3B0PA 2XXAB 2WZGA 3L8IA 3LLKA 2MHRA 1L3PA 1WTYA 3VF0A 2DYRC 3UMIA 256BA 4MVUA 2J46A 4CDYA 1T01A 3FOPA 3U2MA 2TMVP 3AQBA 4AE4B 1K05A 3DAFA 3KPHA 1ZYRF 2BL2A 2R7OA 4ONSA 2NUPA 4BEMJ 1JOGA 4O6NA 1E84A 2R7RA 2G62A 1U0BB 3HJCA 1YZAA 1ORYA 3S27A 4C7OA 5A6BD 4FWVA 1LI5A 3EH1A 3EGXA 3S9OA 2R7SA 5L3QA 5A6AA 3EGDA 4YL3A 3GWLA 3WHNA 5BQGA 2WB7A 4LLEA 1ZZPA 4MTGA 5E33A 3S0XA 3EHNA 3QVZA 1EI7A 4HFKB 3UGPA 3EG9B 2KJGA 1LS4A 2W4MA 4IAOA 2PBEA 1I4YA 4QDLA 4BJ5C 3FHDA 1APCA 2XLEA 1XZQA 2W9YA 2MWQA 4L6RA 4YJWA 5DS4A 1ZU4A 2A69F 5AC4A 1V4AA 1AVOB 2R03A 3JSZA 4EBKA 5HSWA 2Q3TA 4MVOA 5EK0A 3B71A 4K7BA 4MQ9F 2L6GA 3S90A 1WN0A 1IW7F 1Z6AA 2B0HA 3FAJA 2Q9AA 5HV9A 1LIHA 1M2OA 1ST6A 1JAFA 4YK5A 3SXKA 3TOMA 3M4CA 1YDIA 2EPMX 2P0NA 5KYXB 1ORJA 1TKNA 4EWCA 3Q7LA 1RKEB 3OWTA 3UMHA 2VASA 3LJBA 2QE9A 1R5ID 3GM3A 2FGYA 3UNGC 1GS9A 3DM9B 3K1HA 5E3CA 4I1MA 1HE1A 3ZG1A 1SMYF 4AK9A 1L7CA 4OIQF 3RKOF 3NRHA 3HTKC 3K7DA 4PACA 3LUTB 4G0HA 4XLPF 2J7PD 3ZTMA 1HMDA 1U89A 4O6YA 2HZ8A 2NUTB 3KYJA 1VMAA 2EILC 2XL8A 4DXWA 1Q0MA 2J45A 4E0HA 4N6HA 3C8ZA 1TR2A 5COFA 4AL0A 3ZDLA 2YL7A 5DVWA 1TWAA 1D0XA 3Q6MA 1MMGA 5L0HA 4Q5SF 2PX3A 2XLWA 4N06A 1M2VB 1OCCC 2OOCA 4O7GA 1YYXA 1SF8A 2GFHA 3AOUA 3QW1A 2A0BA 4MVZA 4CS9C 1YAUO 4D4XA 1W2WA 2DGJA 3SZRA 1WWPA 3T9OA 3POVA 2CW0F 2H7OA 2XLDA 3N2ZB 4FAPB 2R7XA 4BJ6C 1Y4CA 4P9FA 3JSEO 1EKYA 3WG7C 3WODF 3JRTA 4JTAB 4JJFA 4QI0A 1LS1A 3FVYA 3L1MA 3NMJA 1A7VA 1WOLA 2PFDA 3N24A 3K1IA 1CPRA 2HFIA 3QVYA 5K0IA 2PP4A 5FZTA 2C04A 3KKBA 2Y69C 2XSEA 3DI5A 4XEVA 3GEEA 5B1BC 1MMNA 4CS9A 3M15A 5JSLA 2YZSA 3ASNC 4JE9A 4JKVA 5A6BA 1EQ1A 3BRJA 5L0IA 4H54A 3CQZA 3GM1A 1QZXA 2WVNA 3I4UA 2KK1A 1FMWA 1RXQA 3T6BA 3AG3C 3MLGA 4JW1A 3SXMA 3IQTA 3NG1A 3Q7GA 2YKZA 3O39A 1MQVA 1QKRA 3JT1A 3SXZA 2CYDA 1G4WR 2KQ9A 1NU7D 1T6UA 2HS5A 1NU9C 2OJQA 1ZHTA 2WZFA 1XZPA 1E83A 1OCRC 5B3IA 2LCHA 4KBLA 2YL3A 1HMOA 2XXAA 4U5HA 2HUJA 1OW6A 2WZLA 4N6CA 2VC9A 3H2UA 3MFNA 3T6JA 3TJ6A 4Q4ZF 2R02A 2R05A 2YEVA 2ZXRA 4HFFB 4NTBA 1M56C 1BR4A 1RJ9B 3TQOA 3W2WA 2LD6A 3LS1A 4O6MA 3C8GD 4JTCB 4DVZA 5KYWA 1G5ZA 1OKKD 2NSGA 3TJ5A 1I5NA 4IJJA 4XEKA 3AG2C 1VLTA 1OR3A 2A1DD 1OW7A 3HLZA 3IEEA 5JP7A 3SNHA 3V5YA 4BPMA 4U5FE 2HMQA 1A41A 2HJ3A 4RBNA 2YLIA 1E86A 5F28E 1E85A 4IB4A 3F47A 5A6JA 1E2XA 2DI3A 5DS5A 2IYLD 4XLNF 2DB4A 2EPLX 2BC5A 2D4UA 1ZHZA 1CGNA 1OXKA 3G4ZA 4BEJA 2KGOA 4D4NA 3L0IA 4CS8C 4YT8A 3U0CA 3EFOA 4NTAA 2OEVA 1BR1A 1DOVA 2IBFA 3LEOA 1H6GA 3DMDA 3KMIA 2BE5F 3DM5A 3TOLA 1Z5ZA 1OQCA 1PV3A 3GANA 1LM3B 2PX0A 3NDBB 3JYYA 4A4AA 3RQFA 1G8XA 4JEAA 2F22A 4U9DA 1VYIA 3IPMO 4U5DE 3NYMA 1C03A 4BJ1A 4MW8A 1LE2A 5CIVA 4IARA 1OR2A 3KYIA 1OCZC 2P61A 3ITFA 2Q9BA 2AU5A 2QY9A 2XS8A 2Q00A 3C18A 3LS0A 2XLMA 3W8IA 3W8HA 3UMKA 4AL1A 4XTKA 4Q7CA 2EIJC 2W4BA 1ZHXA 2YWAA 3SP1A 4I1OB 3AG4C 2P6VA 2LSEA 4DRJB 2J8WA 2KNHA 5JRAA 3HNJA 4J7TA 5BUOA 1GQAA 4LERA 4U9EA 2PNOA 1NG1A 3NYJA 2JX0A 2HSQA 4G7OF 2H7VC 1Q0GA 3HNKA 1M6TA 1SZIA 4R32A 3B0UX 4A2NB 3RVYA 4CJOA 4YWQA 5EGYA 3F46A 4NY3A 4O79A 4WGYA 2LIGA 1VOMA 2XRHA 3U5SA 5BQIA 3AQCA 1T5OA 1YLMA 3DWWA 3L8JA 2NUTA 4ZLDA 1TWHA 2IXPA 1OKKA 2EPKX 3FDQA 3RFYA 1SYQA 5JLIA 1ZHWA 2DYSC 3DXJF 2LFDA 2Y3DA 3O55A 4XPYA 3RVZA 4XPWA 5B1AC 4MS2A 1Q0FA 4U5EE 2UUIA 4ULWA 3DZAA 5GPGB 4ANJA 1WASA 4NC3A 4EKWA 2QUPA 2RD9A 1WATA 4MTOA 4DBQA 1RKCA 1YARO 4J30B 4U5BE 4NCQA 2Y3BA 2OQMA 3ZQVA 1B68A 3ATPA 4HEAJ 2LK4A 2ZXOA 4YT5A 2HV7A 4B6IA 1ORSC 1ZW2A 3ECSA 5JT4A 5L0DA 1O87A 1D1BA 1YJGA 2ZD9A 1TFOB 4GYTA 3C8GA 3U2LA 2WL8A 4JCZA 1RKEA 4AX2A 2R7WA 1NSGB 4KI2A 1KU2A 1HE9A 4Z9IA 2J9BA 3ZSUA 2G3VA 3V7OA 2YLDA 5F5FA 1Q0DA 1FMVA 4CDAA 2O9XA 4JRZA 2OCCC 2R7TA 2QTVA 4MVRA 4MVQA 2VCCA 2L81A 1Q0KA 1ZW3A 2IM8A 3DD7A 2IXNA 4AE4A 4C3EA 2AP3A 2LFFA 4KNVA 2QNLA 2OJED
chains in the Genus database with same CATH topology
2R7VA 4C7OB 2C03A 2R7UA 4YT2A 2A68F 3QMKA 3S29A 1D1AA 3NYLA 3CSKA 3H65A 4BG0A 3EG9A 3I5QA 4PFOA 3UGOA 3B9QA 4DVYP 2A6EF 4BJ6A 3NKEA 3CZ6A 5DLJA 5EHHA 4MNDA 2ZXPA 2PF4E 3VYWA 2J0XA 1JPNA 4RD9A 4JZAA 3X2QC 5CI8A 4IWBA 2X51A 4PJJA 5KYUB 3ZC4A 4JVSA 5KYYA 1PD0A 1PCXA 4ZLCA 5KYXA 5IY5C 4CS7A 1MMAA 3LNRA 2D5RB 1MNDA 2IOQA 3K66A 3ABKC 1NZEA 3Q6NA 4P6IC 3EZHA 3EPVA 3S28A 2M4EA 2XL4A 3RH3A 5FCLA 3K1IC 3X1OA 2P7VA 2EINC 3M1CB 4LLCA 4QI2A 2L9JA 3K6BA 1VYKA 2J0WA 2ZXWC 4LACB 5CI9A 3PHF2 4U5CE 5B3SC 3LEVA 4OD5A 1D0ZA 4BJ5A 3LAYA 2CDQA 2A6HF 4OINF 3ABMC 5E3AA 3T4RA 2IXOA 5E2QA 1PD1A 4FESA 3JYHA 4H4KC 2EIMC 3AG1C 4IRUA 1S7ZA 4DBRA 2E87A 1VK5A 3L34A 4PJNA 2Z15A 1FFHA 3EH2A 1V55C 2H7BA 4YN0B 5KYUA 5D91A 1Z23A 4X0RA 2CGEA 1FFTC 2I8BA 5F5HA 2WVOA 4M63A 1OCOC 2R7QA 3RIPA 2YHSA 3EHMA 3PMRA 2WVQA 2IXMA 4G7ZF 3E70C 3DJNB 1V54C 3LESA 2FFHA 2VH3A 4KNWA 4OIPF 1ZU5A 3ABLC 4W8KA 1WGWA 3EZIA 3KH2A 2NUPB 3VAYA 1RJ9A 3B0VC 2J7PA 2OG2A 3EGXB 1J8MF 4JCHA 3EGDB 4WJ0A 3I5PA 1O5HA 2J9WA 3ASOC 2KW3C 3ZVRA 4CBEA 4CSAC 2V26A 3NKDA 2W45A 2J9UA 1LKXA 2HV6A 5T1DB 4DOZA 3KL4A 1MMDA 4I3MA 3EFOB 1D0YA 3TD7A 2Y3GA 2Q9CA 1LVKA 4PK4A 1TWCA 3O6XA 3K33A 4PJLA 1QLEC 3LLIA 4CSAA 4JJGA 5L3VA 4OIOF 1M57C 3GODA 5D92A 3W2VA 3JCUQ 4U5GA 3ZIBA 4G7HF 1N1CA 2EIKC 4J32B 3UR3C 4BJTA 4C3DA 1J8YF 4RDAA 1MNEA 4E7SA 1FTSA 3OA1A 5DQZA 3SYNA 1TWGA 4EBBA 1M2VA 2CNWD 4CS8A 5T3WA 2ZPAA 4XWJA 2JD3A 1JPJA 5T3TA 3EJNA 4F4BA 4YT4A 1IZMA 4PJMA 1ZHYA 4OIRF 4CIHA 2V3CC 5KYWB 3RYLA 3E9VA 3N0TA 5DS6A 1D1CA 4HE8D 2B0JA 5KYYB 5KYNA 3MX3A 4K0DA 3SEOA 5DQTA 4I44A 3OEOA 2CNWA 2MYSA 1BR2A 3QZCA 4PFPA 2Y3HA 4E7ZA 2J9VA 4GEHA 2Y39A 3EQLF 4JURI 2G3KA 3DJUB 4OD4A 1Z63A 4C3BA 4KC9A 4FX5A 1Z3IX 2NG1A 2VB6A 3DAGA 3B0PA 2XXAB 2WZGA 3LLKA 2DYRC 3UMIA 2J46A 3AQBA 4AE4B 3DAFA 1ZYRF 2R7OA 2NUPA 4O6NA 2R7RA 2G62A 3HJCA 3S27A 4C7OA 4FWVA 3EH1A 3EGXA 2R7SA 5L3QA 3EGDA 2WB7A 4LLEA 5E33A 3S0XA 3EHNA 4HFKB 3UGPA 3EG9B 2KJGA 2W4MA 4IAOA 4QDLA 4BJ5C 3FHDA 2W9YA 2MWQA 4YJWA 5DS4A 1ZU4A 2A69F 3JSZA 5HSWA 2Q3TA 4K7BA 4MQ9F 1IW7F 1Z6AA 3FAJA 2Q9AA 1M2OA 1ST6A 5KYXB 1TKNA 4EWCA 3Q7LA 3OWTA 3UMHA 2VASA 3LJBA 2FGYA 3UNGC 3DM9B 3K1HA 5E3CA 4I1MA 3ZG1A 1SMYF 4AK9A 4OIQF 3RKOF 3NRHA 3HTKC 3K7DA 4G0HA 4XLPF 2J7PD 4O6YA 2NUTB 1VMAA 2EILC 2J45A 1TR2A 5DVWA 1TWAA 1D0XA 3Q6MA 1MMGA 4Q5SF 2PX3A 4N06A 1M2VB 1OCCC 4O7GA 4CS9C 1SF8A 2GFHA 1W2WA 2DGJA 3SZRA 3POVA 2CW0F 2H7OA 3N2ZB 2R7XA 4BJ6C 3WG7C 3WODF 3JRTA 4JJFA 4QI0A 1LS1A 3FVYA 2PFDA 3N24A 2PP4A 2C04A 3KKBA 2Y69C 2XSEA 5B1BC 1MMNA 4CS9A 2YZSA 3ASNC 3CQZA 3T6BA 1QZXA 2WVNA 3I4UA 1FMWA 3AG3C 3MLGA 4JW1A 3NG1A 3Q7GA 3O39A 3JT1A 2KQ9A 1NU7D 1NU9C 1ZHTA 2WZFA 1OCRC 4KBLA 2XXAA 4U5HA 2WZLA 3T6JA 4Q4ZF 2YEVA 2ZXRA 4HFFB 1M56C 1BR4A 1RJ9B 3W2WA 3LS1A 4O6MA 4DVZA 5KYWA 1OKKD 4IJJA 3SNHA 3AG2C 2A1DD 3HLZA 3IEEA 4U5FE 4RBNA 3F47A 5DS5A 2IYLD 4XLNF 4BEJA 1ZHZA 4YT8A 2KGOA 3L0IA 4CS8C 3EFOA 1BR1A 3DMDA 3KMIA 2BE5F 3DM5A 1Z5ZA 3GANA 2PX0A 3NDBB 1G8XA 1VYIA 4U5DE 3NYMA 4BJ1A 1OCZC 3ITFA 2Q9BA 2QY9A 3W8HA 3W8IA 3LS0A 3UMKA 4XTKA 4Q7CA 2EIJC 2W4BA 1ZHXA 3SP1A 4I1OB 3AG4C 2P6VA 2LSEA 2KNHA 5BUOA 4LERA 3NYJA 1NG1A 4G7OF 2H7VC 3B0UX 1SZIA 4A2NB 5EGYA 4YWQA 3F46A 4NY3A 4O79A 1VOMA 2XRHA 3AQCA 4ZLDA 2NUTA 1TWHA 2IXPA 1OKKA 3FDQA 3RFYA 1ZHWA 2DYSC 3DXJF 4DBQA 2Y3DA 5B1AC 4U5EE 4ULWA 3DZAA 4ANJA 4J30B 4U5BE 2Y3BA 4HEAJ 2ZXOA 4YT5A 2HV7A 4B6IA 3ECSA 1O87A 1D1BA 4GYTA 4AX2A 2WL8A 2R7WA 4KI2A 1KU2A 3ZSUA 2G3VA 3V7OA 5F5FA 1FMVA 2O9XA 2OCCC 2R7TA 2QTVA 2L81A 4C3EA 3DD7A 4AE4A 2IXNA 4KNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6N A;  3Q6M A;  1SF8 A;  2CGE A;  2IOQ A;  3HJC A; 
#chains in the Genus database with same CATH topology
 2R7V A;  3G50 A;  1HW2 A;  4C7O B;  2I15 A;  4J7Y A;  2M64 A;  2C03 A;  4MVM A;  1KTM A;  2R7U A;  1C17 M;  4YT2 A;  2A68 F;  1BBH A;  1NFO A;  3QMK A;  2AVK A;  3M4B A;  1VLS A;  3S29 A;  1H9T A;  2L6F A;  1D1A A;  3NYL A;  3CSK A;  3H65 A;  4BG0 A;  2A0U A;  3G4X A;  1YZC A;  3EG9 A;  3I5Q A;  2KC3 A;  4LDR A;  3B9Q A;  3MYF A;  4PFO A;  3FOO A;  5AGF A;  2A6E F;  4DVY P;  3UGO A;  3QW0 A;  4BJ6 A;  3NKE A;  2ETS A;  3CZ6 A;  5DLJ A;  5EHH A;  4XPX A;  1QQ3 A;  2L6H A;  1T6I A;  4MND A;  2ZXP A;  4CJG A;  2PF4 E;  3VYW A;  2AWC A;  3W4Y A;  2J0X A;  4DJ9 A;  1JPN A;  3HKK A;  4RD9 A;  4JZA A;  3X2Q C;  3C62 A;  5CI8 A;  2OU6 A;  3FAP B;  2X51 A;  4IWB A;  4EHP A;  4PJJ A;  1HW1 A;  3LNM B;  5KYU B;  2YL0 A;  3U9M A;  4JVS A;  3ZC4 A;  5KYY A;  1LE4 A;  1PD0 A;  1OW8 A;  4ULV A;  1PCX A;  4ZLC A;  5KYX A;  2OKU A;  5AC5 A;  5IY5 C;  4CS7 A;  1MMA A;  2P1A A;  3PCV A;  1EA8 A;  4N4W A;  3LNR A;  2D5R B;  3JRM O;  1MND A;  3FXH A;  3RF3 A;  2IOQ A;  1LI7 A;  1YYJ A;  2JPU A;  3K66 A;  3ABK C;  1NZE A;  3Q6N A;  1AEP A;  4P6I C;  3IQC A;  3EZH A;  3MYI A;  1Z7Q c;  2HMZ A;  3EPV A;  4G78 A;  3S28 A;  2M4E A;  2XL4 A;  3RH3 A;  4EIY A;  5FCL A;  1RMV A;  3MBG A;  2GA0 A;  3K1I C;  3X1O A;  2P7V A;  2EIN C;  3M1C B;  3GOR A;  4LLC A;  1O3U A;  3NMK A;  4QI2 A;  2L9J A;  2AWY A;  3HNI A;  3K6B A;  4K1O A;  1VYK A;  2J0W A;  2UUH A;  1A7D A;  2ZXW C;  4LAC B;  5CI9 A;  3PHF 2;  3U8V A;  3C63 A;  1KNY A;  4U5C E;  5B3S C;  3LEV A;  1H9G A;  1A0B A;  4OD5 A;  1D0Z A;  4E18 A;  4BJ5 A;  1T6Q A;  3LAY A;  1CGM E;  2CDQ A;  2A6H F;  2KYH A;  2KSF A;  4WAB A;  4OIN F;  3ABM C;  5E3A A;  3T4R A;  3BEH A;  4LDK A;  3ZWI A;  4ER9 A;  2RSE B;  2VCA A;  3AGT A;  2ICW G;  2IXO A;  1PD1 A;  1YVI A;  4FES A;  5E2Q A;  3JYH A;  4H4K C;  1HY5 A;  1CGO A;  2EIM C;  3IHU A;  3AG1 C;  3GEI A;  4IRU A;  1S7Z A;  4DBR A;  2E87 A;  1VK5 A;  3L34 A;  4PJN A;  2R9R B;  3A11 A;  1GGQ A;  2Z15 A;  3FMS A;  4EUK B;  4XEF A;  1FFH A;  3EH2 A;  1JMW A;  4CIP A;  1I4Z A;  1V55 C;  2H7B A;  4YN0 B;  5KYU A;  1H7I A;  2YLG A;  4NTF A;  1DOW A;  5D91 A;  1Z23 A;  4X0R A;  2CGE A;  1RCP A;  2GAQ A;  2H8A A;  5A69 A;  1FFT C;  2I8B A;  3A9C A;  2WVO A;  5F5H A;  3US6 A;  4M63 A;  4E17 A;  1OCO C;  5A6K A;  2R7Q A;  3RIP A;  2YHS A;  3EHM A;  3NMI A;  3PMR A;  2WVQ A;  1TQG A;  3CEX A;  2EPN A;  1QSP A;  2IXM A;  4G7Z F;  3C8G B;  3E70 C;  3DJN B;  1V54 C;  2XLV A;  3LES A;  2FFH A;  1CPQ A;  3SXY A;  3V5Z A;  5L0G A;  2VH3 A;  3M79 A;  1S05 A;  4KNW A;  1F1M A;  4OIP F;  3ZTZ A;  1ZU5 A;  2L7A A;  4E0I A;  3ABL C;  1V74 B;  1K40 A;  4W8K A;  5JVE A;  1WGW A;  3TUL A;  3DE8 A;  3EZI A;  3RQG A;  3KH2 A;  2NUP B;  3VAY A;  2XLH A;  4W8P A;  4UDV A;  1RJ9 A;  1UG7 A;  3B0V C;  2J7P A;  3AGU A;  3B29 A;  3RQE A;  4LDQ A;  2ASR A;  2OG2 A;  3EGX B;  1J8M F;  4JEB A;  1YA9 A;  4JCH A;  3EGD B;  4WJ0 A;  3I5P A;  5JUA A;  1O5H A;  3H2V A;  2HKV A;  2J9W A;  2NSF A;  2XM4 A;  3ASO C;  1FAP B;  3JTL O;  2KW3 C;  4JC7 A;  3ZVR A;  1AUE A;  4CBE A;  4CSA C;  2V26 A;  3NKD A;  4Z9J A;  3VRC A;  2W45 A;  2J9U A;  1LKX A;  1C02 A;  3U9J A;  2HV6 A;  4P9T A;  3ZQY A;  4GQH A;  5T1D B;  4CX9 A;  4DOZ A;  4MW3 A;  3KL4 A;  1VB5 A;  2HJM A;  2Q4F A;  2QLA A;  1MMD A;  4I3M A;  3EFO B;  1D0Y A;  3TD7 A;  5L0F A;  2Y3G A;  3V5X A;  2HSB A;  2Q9C A;  1YA7 O;  3VM6 A;  1LVK A;  1SR2 A;  4PK4 A;  1TWC A;  2VCB A;  3O6X A;  4CDV A;  4PR9 A;  3IQ5 A;  1BZ4 A;  3K33 A;  4PJL A;  4JIO A;  1QLE C;  3LLI A;  4CSA A;  4YL0 A;  3TK0 A;  1A7E A;  2OEX A;  2XLO A;  1OXB A;  4JJG A;  5L3V A;  4XQ1 A;  3HNL A;  4OIO F;  1M57 C;  3GOD A;  5D92 A;  3U3B A;  1GM5 A;  2LP4 A;  3QTH A;  4NQF A;  3W2V A;  5L0C A;  3JCU Q;  4U5G A;  3ZIB A;  3CAX A;  5COG A;  3T6G B;  4G7H F;  1N1C A;  1UFB A;  1QVX A;  2EIK C;  2R25 A;  3JZ0 A;  4WGZ A;  4IAQ A;  4J32 B;  4MVS A;  1NFN A;  3UR3 C;  5COM A;  4BJT A;  4C3D A;  3AJM A;  1J8Y F;  3IQ6 A;  3J06 A;  4DRI B;  4RDA A;  1MNE A;  4E7S A;  1FTS A;  2YVK A;  3OA1 A;  5DQZ A;  3SYN A;  3PDM P;  1LPE A;  1TWG A;  3R7C A;  3RW0 A;  1QPU A;  4EBB A;  1M2V A;  2CNW D;  4CS8 A;  2XM0 A;  1JRA A;  1JR8 A;  5T3W A;  2ZPA A;  3WAQ A;  3U8P A;  4Z9H A;  4XWJ A;  3GEH A;  2JD3 A;  1G4U S;  1JPJ A;  1T9K A;  5T3T A;  3EJN A;  1FNT c;  4F4B A;  2CCY A;  3U3F A;  1IZM A;  4PJM A;  1ZHY A;  4OIR F;  2GDC A;  4YT4 A;  4CIH A;  3S84 A;  2V3C C;  5KYW B;  1FR0 A;  1XWJ A;  2GWW A;  3E9V A;  3N0T A;  3RYL A;  1D1C A;  2NPU A;  4HE8 D;  2B0J A;  5DS6 A;  3GM2 A;  5L0J A;  1VTM P;  1NBB A;  2EPO A;  3C7J A;  1TFK B;  5JS5 A;  5KYY B;  3R2P A;  5KYN A;  3MX3 A;  3O10 A;  3DE9 A;  4K0D A;  3SEO A;  4YL1 A;  5DQT A;  1ZVZ A;  4I44 A;  1BDJ B;  1NLX A;  3OEO A;  4EBJ A;  4IGG A;  2YRF A;  2Q7R A;  2YL1 A;  2CNW A;  2MYS A;  1BR2 A;  3QZC A;  4MTF A;  4PFP A;  1Y6D A;  2Y3H A;  4E7Z A;  5BQH A;  2J9V A;  2Y39 A;  2XS1 A;  3EQL F;  4GEH A;  1U6H A;  2G3K A;  2YQY A;  1K04 A;  3DJU B;  4JUR I;  1R4T A;  3DKA A;  4OD4 A;  1Z63 A;  2LQG A;  4C3B A;  5TJ5 E;  4KC9 A;  3GWN A;  4FX5 A;  4JTD B;  4DRH B;  1Z3I X;  2X0C A;  2XL6 A;  2NG1 A;  2FAP B;  2VB6 A;  3DAG A;  3B0P A;  2XXA B;  2WZG A;  3L8I A;  3LLK A;  2MHR A;  1L3P A;  1WTY A;  3VF0 A;  2DYR C;  3UMI A;  256B A;  4MVU A;  2J46 A;  4CDY A;  1T01 A;  3FOP A;  3U2M A;  2TMV P;  3AQB A;  4AE4 B;  1K05 A;  3DAF A;  3KPH A;  1ZYR F;  2BL2 A;  2R7O A;  4ONS A;  2NUP A;  4BEM J;  1JOG A;  4O6N A;  1E84 A;  2R7R A;  2G62 A;  1U0B B;  3HJC A;  1YZA A;  1ORY A;  3S27 A;  4C7O A;  5A6B D;  4FWV A;  1LI5 A;  3EH1 A;  3EGX A;  3S9O A;  2R7S A;  5L3Q A;  5A6A A;  3EGD A;  4YL3 A;  3GWL A;  3WHN A;  5BQG A;  2WB7 A;  4LLE A;  1ZZP A;  4MTG A;  5E33 A;  3S0X A;  3EHN A;  3QVZ A;  1EI7 A;  4HFK B;  3UGP A;  3EG9 B;  2KJG A;  1LS4 A;  2W4M A;  4IAO A;  2PBE A;  1I4Y A;  4QDL A;  4BJ5 C;  3FHD A;  1APC A;  2XLE A;  1XZQ A;  2W9Y A;  2MWQ A;  4L6R A;  4YJW A;  5DS4 A;  1ZU4 A;  2A69 F;  5AC4 A;  1V4A A;  1AVO B;  2R03 A;  3JSZ A;  4EBK A;  5HSW A;  2Q3T A;  4MVO A;  5EK0 A;  3B71 A;  4K7B A;  4MQ9 F;  2L6G A;  3S90 A;  1WN0 A;  1IW7 F;  1Z6A A;  2B0H A;  3FAJ A;  2Q9A A;  5HV9 A;  1LIH A;  1M2O A;  1ST6 A;  1JAF A;  4YK5 A;  3SXK A;  3TOM A;  3M4C A;  1YDI A;  2EPM X;  2P0N A;  5KYX B;  1ORJ A;  1TKN A;  4EWC A;  3Q7L A;  1RKE B;  3OWT A;  3UMH A;  2VAS A;  3LJB A;  2QE9 A;  1R5I D;  3GM3 A;  2FGY A;  3UNG C;  1GS9 A;  3DM9 B;  3K1H A;  5E3C A;  4I1M A;  1HE1 A;  3ZG1 A;  1SMY F;  4AK9 A;  1L7C A;  4OIQ F;  3RKO F;  3NRH A;  3HTK C;  3K7D A;  4PAC A;  3LUT B;  4G0H A;  4XLP F;  2J7P D;  3ZTM A;  1HMD A;  1U89 A;  4O6Y A;  2HZ8 A;  2NUT B;  3KYJ A;  1VMA A;  2EIL C;  2XL8 A;  4DXW A;  1Q0M A;  2J45 A;  4E0H A;  4N6H A;  3C8Z A;  1TR2 A;  5COF A;  4AL0 A;  3ZDL A;  2YL7 A;  5DVW A;  1TWA A;  1D0X A;  3Q6M A;  1MMG A;  5L0H A;  4Q5S F;  2PX3 A;  2XLW A;  4N06 A;  1M2V B;  1OCC C;  2OOC A;  4O7G A;  1YYX A;  1SF8 A;  2GFH A;  3AOU A;  3QW1 A;  2A0B A;  4MVZ A;  4CS9 C;  1YAU O;  4D4X A;  1W2W A;  2DGJ A;  3SZR A;  1WWP A;  3T9O A;  3POV A;  2CW0 F;  2H7O A;  2XLD A;  3N2Z B;  4FAP B;  2R7X A;  4BJ6 C;  1Y4C A;  4P9F A;  3JSE O;  1EKY A;  3WG7 C;  3WOD F;  3JRT A;  4JTA B;  4JJF A;  4QI0 A;  1LS1 A;  3FVY A;  3L1M A;  3NMJ A;  1A7V A;  1WOL A;  2PFD A;  3N24 A;  3K1I A;  1CPR A;  2HFI A;  3QVY A;  5K0I A;  2PP4 A;  5FZT A;  2C04 A;  3KKB A;  2Y69 C;  2XSE A;  3DI5 A;  4XEV A;  3GEE A;  5B1B C;  1MMN A;  4CS9 A;  3M15 A;  5JSL A;  2YZS A;  3ASN C;  4JE9 A;  4JKV A;  5A6B A;  1EQ1 A;  3BRJ A;  5L0I A;  4H54 A;  3CQZ A;  3GM1 A;  1QZX A;  2WVN A;  3I4U A;  2KK1 A;  1FMW A;  1RXQ A;  3T6B A;  3AG3 C;  3MLG A;  4JW1 A;  3SXM A;  3IQT A;  3NG1 A;  3Q7G A;  2YKZ A;  3O39 A;  1MQV A;  1QKR A;  3JT1 A;  3SXZ A;  2CYD A;  1G4W R;  2KQ9 A;  1NU7 D;  1T6U A;  2HS5 A;  1NU9 C;  2OJQ A;  1ZHT A;  2WZF A;  1XZP A;  1E83 A;  1OCR C;  5B3I A;  2LCH A;  4KBL A;  2YL3 A;  1HMO A;  2XXA A;  4U5H A;  2HUJ A;  1OW6 A;  2WZL A;  4N6C A;  2VC9 A;  3H2U A;  3MFN A;  3T6J A;  3TJ6 A;  4Q4Z F;  2R02 A;  2R05 A;  2YEV A;  2ZXR A;  4HFF B;  4NTB A;  1M56 C;  1BR4 A;  1RJ9 B;  3TQO A;  3W2W A;  2LD6 A;  3LS1 A;  4O6M A;  3C8G D;  4JTC B;  4DVZ A;  5KYW A;  1G5Z A;  1OKK D;  2NSG A;  3TJ5 A;  1I5N A;  4IJJ A;  4XEK A;  3AG2 C;  1VLT A;  1OR3 A;  2A1D D;  1OW7 A;  3HLZ A;  3IEE A;  5JP7 A;  3SNH A;  3V5Y A;  4BPM A;  4U5F E;  2HMQ A;  1A41 A;  2HJ3 A;  4RBN A;  2YLI A;  1E86 A;  5F28 E;  1E85 A;  4IB4 A;  3F47 A;  5A6J A;  1E2X A;  2DI3 A;  5DS5 A;  2IYL D;  4XLN F;  2DB4 A;  2EPL X;  2BC5 A;  2D4U A;  1ZHZ A;  1CGN A;  1OXK A;  3G4Z A;  4BEJ A;  2KGO A;  4D4N A;  3L0I A;  4CS8 C;  4YT8 A;  3U0C A;  3EFO A;  4NTA A;  2OEV A;  1BR1 A;  1DOV A;  2IBF A;  3LEO A;  1H6G A;  3DMD A;  3KMI A;  2BE5 F;  3DM5 A;  3TOL A;  1Z5Z A;  1OQC A;  1PV3 A;  3GAN A;  1LM3 B;  2PX0 A;  3NDB B;  3JYY A;  4A4A A;  3RQF A;  1G8X A;  4JEA A;  2F22 A;  4U9D A;  1VYI A;  3IPM O;  4U5D E;  3NYM A;  1C03 A;  4BJ1 A;  4MW8 A;  1LE2 A;  5CIV A;  4IAR A;  1OR2 A;  3KYI A;  1OCZ C;  2P61 A;  3ITF A;  2Q9B A;  2AU5 A;  2QY9 A;  2XS8 A;  2Q00 A;  3C18 A;  3LS0 A;  2XLM A;  3W8I A;  3W8H A;  3UMK A;  4AL1 A;  4XTK A;  4Q7C A;  2EIJ C;  2W4B A;  1ZHX A;  2YWA A;  3SP1 A;  4I1O B;  3AG4 C;  2P6V A;  2LSE A;  4DRJ B;  2J8W A;  2KNH A;  5JRA A;  3HNJ A;  4J7T A;  5BUO A;  1GQA A;  4LER A;  4U9E A;  2PNO A;  1NG1 A;  3NYJ A;  2JX0 A;  2HSQ A;  4G7O F;  2H7V C;  1Q0G A;  3HNK A;  1M6T A;  1SZI A;  4R32 A;  3B0U X;  4A2N B;  3RVY A;  4CJO A;  4YWQ A;  5EGY A;  3F46 A;  4NY3 A;  4O79 A;  4WGY A;  2LIG A;  1VOM A;  2XRH A;  3U5S A;  5BQI A;  3AQC A;  1T5O A;  1YLM A;  3DWW A;  3L8J A;  2NUT A;  4ZLD A;  1TWH A;  2IXP A;  1OKK A;  2EPK X;  3FDQ A;  3RFY A;  1SYQ A;  5JLI A;  1ZHW A;  2DYS C;  3DXJ F;  2LFD A;  2Y3D A;  3O55 A;  4XPY A;  3RVZ A;  4XPW A;  5B1A C;  4MS2 A;  1Q0F A;  4U5E E;  2UUI A;  4ULW A;  3DZA A;  5GPG B;  4ANJ A;  1WAS A;  4NC3 A;  4EKW A;  2QUP A;  2RD9 A;  1WAT A;  4MTO A;  4DBQ A;  1RKC A;  1YAR O;  4J30 B;  4U5B E;  4NCQ A;  2Y3B A;  2OQM A;  3ZQV A;  1B68 A;  3ATP A;  4HEA J;  2LK4 A;  2ZXO A;  4YT5 A;  2HV7 A;  4B6I A;  1ORS C;  1ZW2 A;  3ECS A;  5JT4 A;  5L0D A;  1O87 A;  1D1B A;  1YJG A;  2ZD9 A;  1TFO B;  4GYT A;  3C8G A;  3U2L A;  2WL8 A;  4JCZ A;  1RKE A;  4AX2 A;  2R7W A;  1NSG B;  4KI2 A;  1KU2 A;  1HE9 A;  4Z9I A;  2J9B A;  3ZSU A;  2G3V A;  3V7O A;  2YLD A;  5F5F A;  1Q0D A;  1FMV A;  4CDA A;  2O9X A;  4JRZ A;  2OCC C;  2R7T A;  2QTV A;  4MVR A;  4MVQ A;  2VCC A;  2L81 A;  1Q0K A;  1ZW3 A;  2IM8 A;  3DD7 A;  2IXN A;  4AE4 A;  4C3E A;  2AP3 A;  2LFF A;  4KNV A;  2QNL A;  2OJE D; 
#chains in the Genus database with same CATH homology
 2R7V A;  4C7O B;  2C03 A;  2R7U A;  4YT2 A;  2A68 F;  3QMK A;  3S29 A;  1D1A A;  3NYL A;  3CSK A;  3H65 A;  4BG0 A;  3EG9 A;  3I5Q A;  4PFO A;  3UGO A;  3B9Q A;  4DVY P;  2A6E F;  4BJ6 A;  3NKE A;  3CZ6 A;  5DLJ A;  5EHH A;  4MND A;  2ZXP A;  2PF4 E;  3VYW A;  2J0X A;  1JPN A;  4RD9 A;  4JZA A;  3X2Q C;  5CI8 A;  4IWB A;  2X51 A;  4PJJ A;  5KYU B;  3ZC4 A;  4JVS A;  5KYY A;  1PD0 A;  1PCX A;  4ZLC A;  5KYX A;  5IY5 C;  4CS7 A;  1MMA A;  3LNR A;  2D5R B;  1MND A;  2IOQ A;  3K66 A;  3ABK C;  1NZE A;  3Q6N A;  4P6I C;  3EZH A;  3EPV A;  3S28 A;  2M4E A;  2XL4 A;  3RH3 A;  5FCL A;  3K1I C;  3X1O A;  2P7V A;  2EIN C;  3M1C B;  4LLC A;  4QI2 A;  2L9J A;  3K6B A;  1VYK A;  2J0W A;  2ZXW C;  4LAC B;  5CI9 A;  3PHF 2;  4U5C E;  5B3S C;  3LEV A;  4OD5 A;  1D0Z A;  4BJ5 A;  3LAY A;  2CDQ A;  2A6H F;  4OIN F;  3ABM C;  5E3A A;  3T4R A;  2IXO A;  5E2Q A;  1PD1 A;  4FES A;  3JYH A;  4H4K C;  2EIM C;  3AG1 C;  4IRU A;  1S7Z A;  4DBR A;  2E87 A;  1VK5 A;  3L34 A;  4PJN A;  2Z15 A;  1FFH A;  3EH2 A;  1V55 C;  2H7B A;  4YN0 B;  5KYU A;  5D91 A;  1Z23 A;  4X0R A;  2CGE A;  1FFT C;  2I8B A;  5F5H A;  2WVO A;  4M63 A;  1OCO C;  2R7Q A;  3RIP A;  2YHS A;  3EHM A;  3PMR A;  2WVQ A;  2IXM A;  4G7Z F;  3E70 C;  3DJN B;  1V54 C;  3LES A;  2FFH A;  2VH3 A;  4KNW A;  4OIP F;  1ZU5 A;  3ABL C;  4W8K A;  1WGW A;  3EZI A;  3KH2 A;  2NUP B;  3VAY A;  1RJ9 A;  3B0V C;  2J7P A;  2OG2 A;  3EGX B;  1J8M F;  4JCH A;  3EGD B;  4WJ0 A;  3I5P A;  1O5H A;  2J9W A;  3ASO C;  2KW3 C;  3ZVR A;  4CBE A;  4CSA C;  2V26 A;  3NKD A;  2W45 A;  2J9U A;  1LKX A;  2HV6 A;  5T1D B;  4DOZ A;  3KL4 A;  1MMD A;  4I3M A;  3EFO B;  1D0Y A;  3TD7 A;  2Y3G A;  2Q9C A;  1LVK A;  4PK4 A;  1TWC A;  3O6X A;  3K33 A;  4PJL A;  1QLE C;  3LLI A;  4CSA A;  4JJG A;  5L3V A;  4OIO F;  1M57 C;  3GOD A;  5D92 A;  3W2V A;  3JCU Q;  4U5G A;  3ZIB A;  4G7H F;  1N1C A;  2EIK C;  4J32 B;  3UR3 C;  4BJT A;  4C3D A;  1J8Y F;  4RDA A;  1MNE A;  4E7S A;  1FTS A;  3OA1 A;  5DQZ A;  3SYN A;  1TWG A;  4EBB A;  1M2V A;  2CNW D;  4CS8 A;  5T3W A;  2ZPA A;  4XWJ A;  2JD3 A;  1JPJ A;  5T3T A;  3EJN A;  4F4B A;  4YT4 A;  1IZM A;  4PJM A;  1ZHY A;  4OIR F;  4CIH A;  2V3C C;  5KYW B;  3RYL A;  3E9V A;  3N0T A;  5DS6 A;  1D1C A;  4HE8 D;  2B0J A;  5KYY B;  5KYN A;  3MX3 A;  4K0D A;  3SEO A;  5DQT A;  4I44 A;  3OEO A;  2CNW A;  2MYS A;  1BR2 A;  3QZC A;  4PFP A;  2Y3H A;  4E7Z A;  2J9V A;  4GEH A;  2Y39 A;  3EQL F;  4JUR I;  2G3K A;  3DJU B;  4OD4 A;  1Z63 A;  4C3B A;  4KC9 A;  4FX5 A;  1Z3I X;  2NG1 A;  2VB6 A;  3DAG A;  3B0P A;  2XXA B;  2WZG A;  3LLK A;  2DYR C;  3UMI A;  2J46 A;  3AQB A;  4AE4 B;  3DAF A;  1ZYR F;  2R7O A;  2NUP A;  4O6N A;  2R7R A;  2G62 A;  3HJC A;  3S27 A;  4C7O A;  4FWV A;  3EH1 A;  3EGX A;  2R7S A;  5L3Q A;  3EGD A;  2WB7 A;  4LLE A;  5E33 A;  3S0X A;  3EHN A;  4HFK B;  3UGP A;  3EG9 B;  2KJG A;  2W4M A;  4IAO A;  4QDL A;  4BJ5 C;  3FHD A;  2W9Y A;  2MWQ A;  4YJW A;  5DS4 A;  1ZU4 A;  2A69 F;  3JSZ A;  5HSW A;  2Q3T A;  4K7B A;  4MQ9 F;  1IW7 F;  1Z6A A;  3FAJ A;  2Q9A A;  1M2O A;  1ST6 A;  5KYX B;  1TKN A;  4EWC A;  3Q7L A;  3OWT A;  3UMH A;  2VAS A;  3LJB A;  2FGY A;  3UNG C;  3DM9 B;  3K1H A;  5E3C A;  4I1M A;  3ZG1 A;  1SMY F;  4AK9 A;  4OIQ F;  3RKO F;  3NRH A;  3HTK C;  3K7D A;  4G0H A;  4XLP F;  2J7P D;  4O6Y A;  2NUT B;  1VMA A;  2EIL C;  2J45 A;  1TR2 A;  5DVW A;  1TWA A;  1D0X A;  3Q6M A;  1MMG A;  4Q5S F;  2PX3 A;  4N06 A;  1M2V B;  1OCC C;  4O7G A;  4CS9 C;  1SF8 A;  2GFH A;  1W2W A;  2DGJ A;  3SZR A;  3POV A;  2CW0 F;  2H7O A;  3N2Z B;  2R7X A;  4BJ6 C;  3WG7 C;  3WOD F;  3JRT A;  4JJF A;  4QI0 A;  1LS1 A;  3FVY A;  2PFD A;  3N24 A;  2PP4 A;  2C04 A;  3KKB A;  2Y69 C;  2XSE A;  5B1B C;  1MMN A;  4CS9 A;  2YZS A;  3ASN C;  3CQZ A;  3T6B A;  1QZX A;  2WVN A;  3I4U A;  1FMW A;  3AG3 C;  3MLG A;  4JW1 A;  3NG1 A;  3Q7G A;  3O39 A;  3JT1 A;  2KQ9 A;  1NU7 D;  1NU9 C;  1ZHT A;  2WZF A;  1OCR C;  4KBL A;  2XXA A;  4U5H A;  2WZL A;  3T6J A;  4Q4Z F;  2YEV A;  2ZXR A;  4HFF B;  1M56 C;  1BR4 A;  1RJ9 B;  3W2W A;  3LS1 A;  4O6M A;  4DVZ A;  5KYW A;  1OKK D;  4IJJ A;  3SNH A;  3AG2 C;  2A1D D;  3HLZ A;  3IEE A;  4U5F E;  4RBN A;  3F47 A;  5DS5 A;  2IYL D;  4XLN F;  4BEJ A;  1ZHZ A;  4YT8 A;  2KGO A;  3L0I A;  4CS8 C;  3EFO A;  1BR1 A;  3DMD A;  3KMI A;  2BE5 F;  3DM5 A;  1Z5Z A;  3GAN A;  2PX0 A;  3NDB B;  1G8X A;  1VYI A;  4U5D E;  3NYM A;  4BJ1 A;  1OCZ C;  3ITF A;  2Q9B A;  2QY9 A;  3W8H A;  3W8I A;  3LS0 A;  3UMK A;  4XTK A;  4Q7C A;  2EIJ C;  2W4B A;  1ZHX A;  3SP1 A;  4I1O B;  3AG4 C;  2P6V A;  2LSE A;  2KNH A;  5BUO A;  4LER A;  3NYJ A;  1NG1 A;  4G7O F;  2H7V C;  3B0U X;  1SZI A;  4A2N B;  5EGY A;  4YWQ A;  3F46 A;  4NY3 A;  4O79 A;  1VOM A;  2XRH A;  3AQC A;  4ZLD A;  2NUT A;  1TWH A;  2IXP A;  1OKK A;  3FDQ A;  3RFY A;  1ZHW A;  2DYS C;  3DXJ F;  4DBQ A;  2Y3D A;  5B1A C;  4U5E E;  4ULW A;  3DZA A;  4ANJ A;  4J30 B;  4U5B E;  2Y3B A;  4HEA J;  2ZXO A;  4YT5 A;  2HV7 A;  4B6I A;  3ECS A;  1O87 A;  1D1B A;  4GYT A;  4AX2 A;  2WL8 A;  2R7W A;  4KI2 A;  1KU2 A;  3ZSU A;  2G3V A;  3V7O A;  5F5F A;  1FMV A;  2O9X A;  2OCC C;  2R7T A;  2QTV A;  2L81 A;  4C3E A;  3DD7 A;  4AE4 A;  2IXN A;  4KNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...