1SF8A

Crystal structure of the carboxy-terminal domain of htpg, the e. coli hsp90
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
SFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEVKYIFELNPDHVLVKRAADTEDEAKFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Chaperone protein htpG
publication title The crystal structure of the carboxy-terminal dimerization domain of htpG, the Escherichia coli Hsp90, reveals a potential substrate binding site.
pubmed doi rcsb
source organism Escherichia coli
total genus 32
structure length 115
sequence length 115
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2004-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1sf8A00
2CGEA 3Q6NA 2IOQA 3HJCA 3Q6MA 1SF8A
chains in the Genus database with same CATH superfamily
2JPUA 4JTDB 1VMAA 3JTLO 3S84A 3LEVA 1AUEA 3EH1A 3VRCA 3W4YA 1WOLA 4I3MA 1OCRC 1O5HA 1TKNA 2KQ9A 3FMSA 4X0RA 3RVZA 1JAFA 3SYNA 3LUTB 3U3BA 4U5EE 3UMHA 1WN0A 1D0YA 5KYWB 3TOMA 4R32A 2NPUA 3JRMO 4CJGA 1PCXA 1Q0KA 2VCAA 3B0PA 2BL2A 3RW0A 2X51A 2J8WA 2L7AA 2QTVA 2XL6A 3AQBA 1V55C 3GM2A 4BEJA 1TR2A 2EPMX 3DXJF 4LLCA 2LIGA 1QLEC 5DQTA 1GM5A 1Z23A 3GM1A 4L6RA 4YL0A 4JKVA 3EZIA 4MS2A 4ULWA 5E3CA 1VB5A 2EINC 4NCQA 3WHNA 3FHDA 2J0XA 4JCZA 4YL1A 3PDMP 2GFHA 4QI2A 5HV9A 4FX5A 3CZ6A 4XEVA 1VTMP 3CSKA 3KPHA 4RD9A 4BEMJ 3ZQYA 3DKAA 3KYJA 1BDJB 4UDVA 2HSBA 3EZHA 4BJ5A 3K6BA 3VYWA 2RD9A 3EQLF 2MYSA 1RKCA 3AGTA 5E2QA 1LIHA 4KNWA 3AG4C 4JEAA 4C3EA 5JRAA 5BQHA 4PR9A 1N1CA 2GWWA 4YJWA 2Q3TA 3DAFA 2LSEA 2VC9A 3FAJA 3HJCA 3OEOA 5B1BC 2HMZA 2LFFA 3IHUA 4IARA 1T6UA 2A0BA 1OCOC 3V7OA 1GS9A 1OKKD 2G62A 2YKZA 4NY3A 2CDQA 4OD4A 4PACA 1HE9A 4RDAA 4JW1A 2XLEA 2BC5A 3K1IA 1OW6A 4PJJA 2XLVA 2R7QA 4BJ6A 1L7CA 2A0UA 1ZZPA 4LDRA 3WG7C 2XM0A 4P9FA 2ZXWC 1VLSA 4EIYA 3B29A 3M4CA 1K04A 3KKBA 1TWGA 3ZG1A 3ZC4A 4EBBA 1O87A 4C3DA 5L0FA 1LI7A 4M63A 3EFOA 3EGDA 1DOWA 2IM8A 1UG7A 4NC3A 4A2NB 2Q9AA 3H2VA 3K66A 4DXWA 5A6JA 1EQ1A 3HLZA 3LLKA 2YLDA 3U8VA 4EBKA 4CS7A 3ASNC 1T5OA 3G4ZA 2AP3A 3NDBB 2Z15A 2VH3A 1LVKA 3M1CB 2XXAB 2JD3A 5L3VA 1H7IA 3EGXA 3G50A 2GDCA 3KH2A 1A7VA 2CYDA 1EI7A 3ABKC 1KNYA 4PK4A 3B9QA 1E86A 3X1OA 1YLMA 2R9RB 1G5ZA 2XL4A 1AEPA 1OXKA 2L6FA 5CIVA 2EPLX 4GQHA 1M2VB 2OEVA 3H2UA 3LESA 3MYFA 1HW1A 4JCHA 5T1DB 2P1AA 4IAQA 2YHSA 4H54A 1GGQA 3EH2A 3GEEA 2QLAA 3B0UX 2Y3GA 3C8GB 3TJ6A 2F22A 1Q0GA 2XS8A 1A7EA 5JT4A 3C63A 3VAYA 4JTCB 2R7RA 3Q6MA 4JVSA 4MVMA 1VOMA 1NSGB 3O55A 3LS0A 1D0ZA 3DD7A 2G3VA 1RMVA 5B3IA 2OCCC 1E84A 1ORJA 1ORSC 3O39A 4G7OF 1BBHA 2WVNA 2KK1A 2L9JA 1Q0FA 2OJQA 2EILC 4IJJA 4MNDA 5JSLA 4ANJA 2EPNA 4DRJB 1KTMA 1BR2A 5BUOA 1HMDA 1TWHA 3UMKA 3EHNA 3N0TA 4I1OB 4U5CE 3WAQA 3S90A 3I5PA 1EA8A 1M56C 4MTOA 1ZW3A 5F28E 5DS4A 1FNTc 1Z3IX 2Q9BA 2MWQA 2A69F 1IZMA 2UUIA 1D1CA 3DI5A 2A6HF 2V26A 4IAOA 1NLXA 4JC7A 4MVOA 1FR0A 2Q4FA 3MYIA 5COGA 3SNHA 3ABMC 2KW3C 3S9OA 2IXNA 4NTAA 3U8PA 1CGNA 3F46A 3GEHA 1BZ4A 4Q7CA 4Z9HA 3ZTMA 2YL7A 4CBEA 1YA7O 3C8GD 4MVQA 3KL4A 1QPUA 4N06A 2XM4A 2RSEB 1YJGA 2YRFA 3C7JA 4YT5A 4J7TA 3N2ZB 1OKKA 3U9MA 1XWJA 5HSWA 4YT2A 3DAGA 2NUTB 2XSEA 3L1MA 3Q6NA 1V74B 2YVKA 3IEEA 5D92A 4K0DA 4YWQA 1Z7Qc 4CIPA 3ZVRA 2YEVA 2YL3A 1E2XA 4DRIB 1OW7A 4WGZA 2LD6A 3UGOA 4ONSA 2IXOA 1QQ3A 2BE5F 4O6MA 2JX0A 2Q9CA 3F47A 3L34A 3QVYA 4MVUA 4Z9IA 3RFYA 5L0HA 3EPVA 3MBGA 4W8PA 3NG1A 5A6AA 3MLGA 3BEHA 3DM5A 4FESA 3G4XA 1LM3B 2MHRA 3RYLA 2NUPA 3H65A 3ZSUA 5A69A 2R7WA 2PP4A 1TWAA 4XPXA 4NTBA 1J8YF 2H7OA 1RCPA 3HNLA 1TWCA 4U9DA 3SXYA 4N6CA 3V5XA 4CX9A 3AQCA 1BR4A 1YA9A 1Z63A 2AWCA 2OQMA 1R5ID 3SP1A 3VM6A 5A6BD 2OG2A 4HE8D 4A4AA 1QVXA 1VYIA 1NU7D 4LLEA 4JIOA 5JUAA 2LP4A 5CI9A 3RQFA 3ZQVA 3NRHA 3C18A 4AL0A 2R7SA 5CI8A 2KYHA 2Q00A 1QKRA 1Q0DA 3FDQA 2IYLD 4BG0A 4ZLCA 2YZSA 1K05A 3DMDA 2PX0A 1IW7F 1H9GA 2W4MA 2YLIA 4PFOA 5DS6A 3PMRA 5KYXB 4C7OB 4PJLA 4G7HF 1KU2A 2W45A 4AE4B 4CSAC 1LS4A 3OA1A 3Q7GA 3ABLC 4YL3A 3TJ5A 1C03A 2CNWA 2L6HA 4CIHA 3TK0A 1PD0A 4XQ1A 1YVIA 3M15A 4B6IA 1FMWA 3R2PA 5L0CA 3JYYA 1LPEA 3NMIA 1G8XA 2HSQA 4OIRF 1T6QA 1XZQA 2CGEA 3A9CA 1J8MF 4P9TA 3L8JA 3RF3A 1YZCA 2IXMA 1MMAA 4JRZA 3J06A 2Y69C 5IY5C 2XS1A 3PCVA 1NU9C 3WODF 1H6GA 4KBLA 1PV3A 2X0CA 3W8HA 4HEAJ 1C02A 2AWYA 4YT4A 4RBNA 2XLDA 2ZPAA 3NMKA 1ZU4A 3RQEA 3W2VA 4D4NA 2VCCA 3S27A 4DBRA 2HV6A 5A6KA 1T01A 4IB4A 1VYKA 2J45A 4D4XA 4OIPF 2XLMA 4G7ZF 4DBQA 5DQZA 3LNRA 1RKEA 4FWVA 3I4UA 2HMQA 4QI0A 2PFDA 3ZDLA 2ZD9A 4N4WA 2KSFA 3SXKA 1HMOA 3RQGA 1YZAA 2NSGA 3DZAA 4JURI 4IGGA 2WL8A 2UUHA 3DE8A 2ZXOA 4YK5A 4ER9A 3Q7LA 3JRTA 3DE9A 1W2WA 4MQ9F 3U0CA 1ZW2A 3EG9A 4BJTA 2R7VA 1A0BA 3HKKA 2R05A 2I8BA 1QSPA 4Z9JA 3I5QA 1WATA 2AVKA 3AGUA 5T3TA 1ZVZA 3EHMA 2HJMA 1JR8A 1ZHWA 3UNGC 4GEHA 2WB7A 3M79A 4KI2A 4CJOA 1QZXA 3IPMO 4XPWA 1CGOA 1NFNA 3US6A 2R02A 4CDVA 2P7VA 3JZ0A 1D0XA 2IOQA 5KYYA 2O9XA 3U5SA 4CS8C 1MMNA 2V3CC 2E87A 2YLGA 1APCA 4WABA 3HNKA 1RJ9A 2DB4A 3LJBA 4XPYA 3JT1A 2J9BA 1V54C 4U5HA 4Q5SF 2ASRA 3AJMA 4O6NA 4F4BA 5EGYA 1AVOB 5KYUA 4KC9A 2TMVP 1ZHZA 1MMGA 1S7ZA 2CW0F 2LQGA 2WVQA 1FTSA 4MTFA 3GODA 3IQ5A 4LDKA 4DJ9A 5KYWA 3K33A 1WASA 3FOPA 2J46A 1DOVA 4I1MA 4E18A 3DJNB 2VASA 3EFOB 3NYLA 3TD7A 4EHPA 1UFBA 3EGDB 5JLIA 3FOOA 3SEOA 4PJMA 1HY5A 4DRHB 2DYSC 3LS1A 3GORA 4NTFA 2OOCA 2A6EF 5TJ5E 3U9JA 1HE1A 4CS8A 1JPNA 1A7DA 3C8ZA 3EGXB 3ZTZA 2AU5A 4U5DE 1OW8A 4YN0B 3K7DA 3L0IA 3ZIBA 3FAPB 2OKUA 4MVZA 3QTHA 3K1HA 1A41A 1I4YA 3V5YA 4N6HA 4JZAA 5BQIA 1YARO 1VLTA 3FVYA 4H4KC 4U5BE 3T9OA 1M6TA 3T6BA 3W2WA 1ZHYA 1LE4A 1U6HA 2M64A 2Y3DA 2CCYA 4MW8A 3EJNA 3HNIA 4YT8A 3CAXA 3IQTA 5JS5A 5L0JA 5FZTA 2GAQA 4C3BA 4HFKB 5JVEA 3KYIA 1FFHA 4O6YA 3LAYA 1ZYRF 5F5FA 3AG1C 3HNJA 1PD1A 3U2LA 1E83A 1E85A 2FGYA 2C04A 4G0HA 2ZXPA 4LDQA 4LACB 2HS5A 4K7BA 4MVRA 3QMKA 3O6XA 3RVYA 2KJGA 4E7ZA 2J7PD 4XLNF 4MW3A 1T6IA 1Y4CA 2QUPA 2EPKX 4JJGA 2HV7A 3ASOC 2HFIA 3JCUQ 5EK0A 4DVZA 2ETSA 4J30B 2XLWA 2XRHA 2DI3A 1U0BB 1SMYF 2L6GA 1ZHTA 3AG2C 4WGYA 1FFTC 4E17A 2B0HA 4O79A 4J32B 2OU6A 2KGOA 1V4AA 3LLIA 5B3SC 3GWLA 4MTGA 3GEIA 4BJ5C 3RKOF 1MMDA 1OR2A 3O10A 4U5FE 2G3KA 4CDAA 1NG1A 2A1DD 5T3WA 3DJUB 1JMWA 4ULVA 5AC5A 5FCLA 2D4UA 4DVYP 5L3QA 2M4EA 3UR3C 3UGPA 3LNMB 1Y6DA 3SXZA 5L0DA 1MNDA 1EKYA 1LE2A 3ATPA 1O3UA 2J9VA 2KNHA 3T6GB 2XXAA 2PF4E 4GYTA 2Q7RA 3U2MA 1LI5A 1CPRA 3KMIA 5COMA 1SZIA 4EUKB 4WJ0A 1YYXA 3GANA 1GQAA 1S05A 4JE9A 1XZPA 1ST6A 3GWNA 3K1IC 2PBEA 4BJ6C 4OIOF 3L8IA 4EWCA 4FAPB 1TFKB 4Q4ZF 2ICWG 1M2VA 4HFFB 3U3FA 2B0JA 3SZRA 3AOUA 3TQOA 3SXMA 3QVZA 3DWWA 3TOLA 2OEXA 4BPMA 1OXBA 3IQCA 3C8GA 3IQ6A 1FMVA 2Y3HA 4J7YA 3QW1A 2XLOA 4U5GA 5DVWA 3T6JA 2J9UA 1WGWA 3E9VA 4CSAA 2NUPB 2HJ3A 1YAUO 4NQFA 4QDLA 4E0IA 4AK9A 2ZXRA 4AL1A 3FXHA 1OR3A 2NG1A 3CQZA 4CS9C 4KNVA 3POVA 1TQGA 3QZCA 5L0IA 1M57C 1I4ZA 1I5NA 2H7BA 2PX3A 2YWAA 1T9KA 2FFHA 4XLPF 1LKXA 4IWBA 5K0IA 4PJNA 3B0VC 5DS5A 3S28A 4JEBA 3CEXA 1L3PA 2LCHA 2Y39A 3A11A 2R25A 1ZU5A 1B68A 4O7GA 2VB6A 1MQVA 3R7CA 2I15A 1HW2A 2W9YA 1OCCC 5F5HA 2R7XA 5GPGB 4W8KA 5E33A 1D1BA 5KYUB 3MFNA 2QNLA 2D5RB 5E3AA 2P61A 4I44A 1NBBA 3V5ZA 4XTKA 2EIJC 3RIPA 5AGFA 1R4TA 1WTYA 2LK4A 2J7PA 1U89A 2QY9A 2VCBA 3T4RA 4CS9A 5JP7A 5AC4A 3N24A 3OWTA 1MNEA 1WWPA 2DYRC 1NFOA 2R03A 2XL8A 3RH3A 5A6BA 4XWJA 5KYNA 1H9TA 2EIKC 1F1MA 1FAPB 2EIMC 3BRJA 1YYJA 5COFA 2NUTA 2C03A 1ORYA 4CDYA 2KC3A 4EKWA 3MX3A 2J0WA 3GM3A 1SF8A 3NYMA 5BQGA 2YQYA 3C62A 5EHHA 2WVOA 3DM9B 4ZLDA 4IRUA 4XEFA 3UMIA 1G4US 1G4WR 2HZ8A 1Z6AA 1D1AA 3M4BA 4LERA 2W4BA 1JRAA 4OINF 5DLJA 2L81A 1SYQA 2HUJA 3B71A 4K1OA 3TULA 2P0NA 3LEOA 1ZHXA 2J9WA 3JSZA 2R7UA 1C17M 2Y3BA 2PNOA 2A68F 3JSEO 4U9EA 5KYYB 1RXQA 4XEKA 2NSFA 1YDIA 2XLHA 1RKEB 2H7VC 2CNWD 2R7OA 2WZLA 2QE9A 4G78A 1LS1A 1K40A 3ECSA 2GA0A 3W8IA 3VF0A 3NKEA 3NMJA 4DOZA 1TFOB 4P6IC 3PHF2 1SR2A 1M2OA 2IXPA 3HTKC 2FAPB 4EBJA 1JOGA 1CPQA 3AG3C 3X2QC 2WZGA 3EG9B 4MVSA 3S0XA 2R7TA 4OIQF 3QW0A 1Q0MA 3ZWIA 3E70C 1OCZC 3JYHA 4E7SA 1CGME 2WZFA 4PFPA 2OJED 2H8AA 3NKDA 1Z5ZA 1OQCA 3NYJA 4JTAB 5B1AC 4AX2A 1JPJA 1VK5A 2EPOA 4OD5A 5KYXA 4BJ1A 4C7OA 1BR1A 256BA 5D91A 2LFDA 4AE4A 2DGJA 4E0HA 3ITFA 2YL1A 3S29A 5L0GA 2YL0A 1NZEA 2HKVA 4JJFA 1RJ9B 2IBFA 2P6VA
chains in the Genus database with same CATH topology
1VMAA 3LEVA 3EH1A 4I3MA 4X0RA 1OCRC 1O5HA 1TKNA 2KQ9A 3SYNA 5KYUB 5KYYB 3UMHA 5KYWB 4U5EE 1D0YA 1PCXA 3B0PA 2X51A 2QTVA 3AQBA 1V55C 4BEJA 1TR2A 3DXJF 4LLCA 1QLEC 5DQTA 1Z23A 3EZIA 4ULWA 5E3CA 2EINC 4QI2A 3FHDA 2J0XA 2GFHA 4FX5A 3CZ6A 3CSKA 4RD9A 3EZHA 4BJ5A 3K6BA 3VYWA 3EQLF 2MYSA 5E2QA 4KNWA 3AG4C 4C3EA 1N1CA 4YJWA 2Q3TA 3DAFA 2LSEA 3FAJA 3HJCA 3OEOA 5B1BC 3V7OA 1OCOC 4NY3A 1OKKD 2G62A 4OD4A 4RDAA 2CDQA 4CBEA 4JW1A 4PJJA 4BJ6A 2R7QA 3WG7C 2ZXWC 3KKBA 1TWGA 3ZG1A 3ZC4A 4EBBA 1O87A 4C3DA 4M63A 3EFOA 3EGDA 4A2NB 2Q9AA 3K66A 3HLZA 3LLKA 4CS7A 3ASNC 3NDBB 2Z15A 2VH3A 1LVKA 3M1CB 2XXAB 2JD3A 5L3VA 3EGXA 3KH2A 3ABKC 4PK4A 3B9QA 3X1OA 2XL4A 1M2VB 3LESA 5T1DB 4JCHA 2YHSA 3EH2A 3B0UX 2Y3GA 3VAYA 2R7RA 3Q6MA 4JVSA 1VOMA 3LS0A 1D0ZA 3DD7A 2G3VA 2OCCC 3O39A 4G7OF 2WVNA 2L9JA 2EILC 4IJJA 4MNDA 4ANJA 1BR2A 5BUOA 1TWHA 3UMKA 3EHNA 3N0TA 4I1OB 4U5CE 3I5PA 1M56C 5DS4A 1Z3IX 2Q9BA 2MWQA 2A69F 1IZMA 4IAOA 1D1CA 2A6HF 2V26A 3SNHA 3ABMC 2KW3C 2IXNA 3F46A 4Q7CA 3KL4A 4N06A 4YT5A 3N2ZB 1OKKA 5HSWA 4YT2A 3DAGA 2NUTB 2XSEA 3Q6NA 3IEEA 5D92A 4K0DA 4YWQA 3ZVRA 2YEVA 3UGOA 2IXOA 2BE5F 4O6MA 2Q9CA 3F47A 3L34A 3RFYA 3EPVA 3NG1A 3MLGA 4FESA 3DM5A 3RYLA 2NUPA 3H65A 3ZSUA 2R7WA 2PP4A 1TWAA 1J8YF 2H7OA 1TWCA 3AQCA 1BR4A 1Z63A 3SP1A 2OG2A 4HE8D 1VYIA 1NU7D 4LLEA 5CI9A 3NRHA 2R7SA 5CI8A 3FDQA 2IYLD 4BG0A 4ZLCA 2YZSA 4Q4ZF 3DMDA 2PX0A 1IW7F 4PFOA 2W4MA 5DS6A 5KYXB 4C7OB 3PMRA 4PJLA 4G7HF 1KU2A 2W45A 4AE4B 4CSAC 3Q7GA 3OA1A 3ABLC 2CNWA 4CIHA 1PD0A 4B6IA 1FMWA 1G8XA 4OIRF 2CGEA 1J8MF 2IXMA 1MMAA 2Y69C 5IY5C 3WODF 1NU9C 4KBLA 3W8HA 4HEAJ 4YT4A 4RBNA 2ZPAA 1ZU4A 3W2VA 4DBRA 3S27A 2HV6A 1VYKA 2J45A 4OIPF 4G7ZF 4DBQA 5DQZA 3LNRA 4FWVA 3I4UA 4QI0A 2PFDA 3DZAA 4JURI 2WL8A 2ZXOA 3Q7LA 3JRTA 1W2WA 4MQ9F 3EG9A 4BJTA 2R7VA 2I8BA 3I5QA 5T3TA 3EHMA 1ZHWA 3UNGC 4GEHA 2WB7A 4KI2A 1QZXA 2P7VA 1D0XA 2IOQA 2O9XA 4CS8C 1MMNA 2V3CC 2E87A 1RJ9A 3LJBA 3JT1A 1V54C 4U5HA 4Q5SF 4O6NA 4F4BA 5EGYA 5KYUA 4KC9A 1ZHZA 1MMGA 1S7ZA 2CW0F 2WVQA 5KYYA 1FTSA 5KYWA 3GODA 3K33A 2J46A 4I1MA 3DJNB 2VASA 3EFOB 3NYLA 3TD7A 3EGDB 3SEOA 4PJMA 2DYSC 3LS1A 2A6EF 4CS8A 1JPNA 3EGXB 4U5DE 4YN0B 3K7DA 3L0IA 3ZIBA 3K1HA 4JZAA 3FVYA 4H4KC 4U5BE 3T6BA 3W2WA 1ZHYA 2Y3DA 3EJNA 4YT8A 4C3BA 4HFKB 1FFHA 4O6YA 3LAYA 1ZYRF 5F5FA 3AG1C 1PD1A 2FGYA 2C04A 4G0HA 2ZXPA 4LACB 4K7BA 3QMKA 3O6XA 2KJGA 4E7ZA 2J7PD 4XLNF 4JJGA 2HV7A 3ASOC 3JCUQ 4DVZA 4J30B 2XRHA 1SMYF 1ZHTA 3AG2C 1FFTC 4O79A 4J32B 2KGOA 3LLIA 5B3SC 4BJ5C 3RKOF 1MMDA 4U5FE 2G3KA 1NG1A 2A1DD 5T3WA 3DJUB 5FCLA 5L3QA 4DVYP 2M4EA 3UR3C 3UGPA 1MNDA 2J9VA 2KNHA 2XXAA 2PF4E 4GYTA 3KMIA 1SZIA 4WJ0A 3GANA 1ST6A 3K1IC 4BJ6C 4OIOF 4EWCA 1M2VA 4HFFB 2B0JA 3SZRA 1FMVA 2Y3HA 4U5GA 5DVWA 3T6JA 2J9UA 1WGWA 3E9VA 4CSAA 2NUPB 4QDLA 4AK9A 2ZXRA 2NG1A 3CQZA 4CS9C 4KNVA 3POVA 3QZCA 1M57C 2PX3A 2H7BA 2FFHA 4XLPF 1LKXA 4IWBA 4PJNA 3B0VC 5DS5A 3S28A 2Y39A 1ZU5A 4O7GA 2VB6A 2W9YA 1OCCC 5F5HA 2R7XA 4W8KA 5E33A 1D1BA 2D5RB 5E3AA 4I44A 4XTKA 2EIJC 3RIPA 3T4RA 2J7PA 2QY9A 4CS9A 3N24A 3OWTA 1MNEA 3RH3A 2DYRC 5KYNA 4XWJA 2EIKC 2EIMC 2NUTA 2C03A 3MX3A 2J0WA 3NYMA 1SF8A 5EHHA 2WVOA 3DM9B 4ZLDA 4IRUA 3UMIA 1Z6AA 1D1AA 4LERA 2W4BA 4OINF 5DLJA 2L81A 1ZHXA 2J9WA 3JSZA 2R7UA 2Y3BA 2A68F 2H7VC 2CNWD 2R7OA 2WZLA 1LS1A 3ECSA 3W8IA 3NKEA 4DOZA 4P6IC 3PHF2 1M2OA 2IXPA 3HTKC 3AG3C 3X2QC 2WZGA 3EG9B 3S0XA 2R7TA 4OIQF 3E70C 1OCZC 3JYHA 4E7SA 2WZFA 4PFPA 3NKDA 5B1AC 1Z5ZA 3NYJA 4AX2A 1JPJA 1VK5A 4OD5A 5KYXA 4BJ1A 4C7OA 1BR1A 5D91A 4AE4A 2DGJA 3ITFA 3S29A 1NZEA 4JJFA 1RJ9B 2P6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CGE A;  3Q6N A;  2IOQ A;  3HJC A;  3Q6M A;  1SF8 A; 
#chains in the Genus database with same CATH topology
 2JPU A;  4JTD B;  1VMA A;  3JTL O;  3S84 A;  3LEV A;  1AUE A;  3EH1 A;  3VRC A;  3W4Y A;  1WOL A;  4I3M A;  1OCR C;  1O5H A;  1TKN A;  2KQ9 A;  3FMS A;  4X0R A;  3RVZ A;  1JAF A;  3SYN A;  3LUT B;  3U3B A;  4U5E E;  3UMH A;  1WN0 A;  1D0Y A;  5KYW B;  3TOM A;  4R32 A;  2NPU A;  3JRM O;  4CJG A;  1PCX A;  1Q0K A;  2VCA A;  3B0P A;  2BL2 A;  3RW0 A;  2X51 A;  2J8W A;  2L7A A;  2QTV A;  2XL6 A;  3AQB A;  1V55 C;  3GM2 A;  4BEJ A;  1TR2 A;  2EPM X;  3DXJ F;  4LLC A;  2LIG A;  1QLE C;  5DQT A;  1GM5 A;  1Z23 A;  3GM1 A;  4L6R A;  4YL0 A;  4JKV A;  3EZI A;  4MS2 A;  4ULW A;  5E3C A;  1VB5 A;  2EIN C;  4NCQ A;  3WHN A;  3FHD A;  2J0X A;  4JCZ A;  4YL1 A;  3PDM P;  2GFH A;  4QI2 A;  5HV9 A;  4FX5 A;  3CZ6 A;  4XEV A;  1VTM P;  3CSK A;  3KPH A;  4RD9 A;  4BEM J;  3ZQY A;  3DKA A;  3KYJ A;  1BDJ B;  4UDV A;  2HSB A;  3EZH A;  4BJ5 A;  3K6B A;  3VYW A;  2RD9 A;  3EQL F;  2MYS A;  1RKC A;  3AGT A;  5E2Q A;  1LIH A;  4KNW A;  3AG4 C;  4JEA A;  4C3E A;  5JRA A;  5BQH A;  4PR9 A;  1N1C A;  2GWW A;  4YJW A;  2Q3T A;  3DAF A;  2LSE A;  2VC9 A;  3FAJ A;  3HJC A;  3OEO A;  5B1B C;  2HMZ A;  2LFF A;  3IHU A;  4IAR A;  1T6U A;  2A0B A;  1OCO C;  3V7O A;  1GS9 A;  1OKK D;  2G62 A;  2YKZ A;  4NY3 A;  2CDQ A;  4OD4 A;  4PAC A;  1HE9 A;  4RDA A;  4JW1 A;  2XLE A;  2BC5 A;  3K1I A;  1OW6 A;  4PJJ A;  2XLV A;  2R7Q A;  4BJ6 A;  1L7C A;  2A0U A;  1ZZP A;  4LDR A;  3WG7 C;  2XM0 A;  4P9F A;  2ZXW C;  1VLS A;  4EIY A;  3B29 A;  3M4C A;  1K04 A;  3KKB A;  1TWG A;  3ZG1 A;  3ZC4 A;  4EBB A;  1O87 A;  4C3D A;  5L0F A;  1LI7 A;  4M63 A;  3EFO A;  3EGD A;  1DOW A;  2IM8 A;  1UG7 A;  4NC3 A;  4A2N B;  2Q9A A;  3H2V A;  3K66 A;  4DXW A;  5A6J A;  1EQ1 A;  3HLZ A;  3LLK A;  2YLD A;  3U8V A;  4EBK A;  4CS7 A;  3ASN C;  1T5O A;  3G4Z A;  2AP3 A;  3NDB B;  2Z15 A;  2VH3 A;  1LVK A;  3M1C B;  2XXA B;  2JD3 A;  5L3V A;  1H7I A;  3EGX A;  3G50 A;  2GDC A;  3KH2 A;  1A7V A;  2CYD A;  1EI7 A;  3ABK C;  1KNY A;  4PK4 A;  3B9Q A;  1E86 A;  3X1O A;  1YLM A;  2R9R B;  1G5Z A;  2XL4 A;  1AEP A;  1OXK A;  2L6F A;  5CIV A;  2EPL X;  4GQH A;  1M2V B;  2OEV A;  3H2U A;  3LES A;  3MYF A;  1HW1 A;  4JCH A;  5T1D B;  2P1A A;  4IAQ A;  2YHS A;  4H54 A;  1GGQ A;  3EH2 A;  3GEE A;  2QLA A;  3B0U X;  2Y3G A;  3C8G B;  3TJ6 A;  2F22 A;  1Q0G A;  2XS8 A;  1A7E A;  5JT4 A;  3C63 A;  3VAY A;  4JTC B;  2R7R A;  3Q6M A;  4JVS A;  4MVM A;  1VOM A;  1NSG B;  3O55 A;  3LS0 A;  1D0Z A;  3DD7 A;  2G3V A;  1RMV A;  5B3I A;  2OCC C;  1E84 A;  1ORJ A;  1ORS C;  3O39 A;  4G7O F;  1BBH A;  2WVN A;  2KK1 A;  2L9J A;  1Q0F A;  2OJQ A;  2EIL C;  4IJJ A;  4MND A;  5JSL A;  4ANJ A;  2EPN A;  4DRJ B;  1KTM A;  1BR2 A;  5BUO A;  1HMD A;  1TWH A;  3UMK A;  3EHN A;  3N0T A;  4I1O B;  4U5C E;  3WAQ A;  3S90 A;  3I5P A;  1EA8 A;  1M56 C;  4MTO A;  1ZW3 A;  5F28 E;  5DS4 A;  1FNT c;  1Z3I X;  2Q9B A;  2MWQ A;  2A69 F;  1IZM A;  2UUI A;  1D1C A;  3DI5 A;  2A6H F;  2V26 A;  4IAO A;  1NLX A;  4JC7 A;  4MVO A;  1FR0 A;  2Q4F A;  3MYI A;  5COG A;  3SNH A;  3ABM C;  2KW3 C;  3S9O A;  2IXN A;  4NTA A;  3U8P A;  1CGN A;  3F46 A;  3GEH A;  1BZ4 A;  4Q7C A;  4Z9H A;  3ZTM A;  2YL7 A;  4CBE A;  1YA7 O;  3C8G D;  4MVQ A;  3KL4 A;  1QPU A;  4N06 A;  2XM4 A;  2RSE B;  1YJG A;  2YRF A;  3C7J A;  4YT5 A;  4J7T A;  3N2Z B;  1OKK A;  3U9M A;  1XWJ A;  5HSW A;  4YT2 A;  3DAG A;  2NUT B;  2XSE A;  3L1M A;  3Q6N A;  1V74 B;  2YVK A;  3IEE A;  5D92 A;  4K0D A;  4YWQ A;  1Z7Q c;  4CIP A;  3ZVR A;  2YEV A;  2YL3 A;  1E2X A;  4DRI B;  1OW7 A;  4WGZ A;  2LD6 A;  3UGO A;  4ONS A;  2IXO A;  1QQ3 A;  2BE5 F;  4O6M A;  2JX0 A;  2Q9C A;  3F47 A;  3L34 A;  3QVY A;  4MVU A;  4Z9I A;  3RFY A;  5L0H A;  3EPV A;  3MBG A;  4W8P A;  3NG1 A;  5A6A A;  3MLG A;  3BEH A;  3DM5 A;  4FES A;  3G4X A;  1LM3 B;  2MHR A;  3RYL A;  2NUP A;  3H65 A;  3ZSU A;  5A69 A;  2R7W A;  2PP4 A;  1TWA A;  4XPX A;  4NTB A;  1J8Y F;  2H7O A;  1RCP A;  3HNL A;  1TWC A;  4U9D A;  3SXY A;  4N6C A;  3V5X A;  4CX9 A;  3AQC A;  1BR4 A;  1YA9 A;  1Z63 A;  2AWC A;  2OQM A;  1R5I D;  3SP1 A;  3VM6 A;  5A6B D;  2OG2 A;  4HE8 D;  4A4A A;  1QVX A;  1VYI A;  1NU7 D;  4LLE A;  4JIO A;  5JUA A;  2LP4 A;  5CI9 A;  3RQF A;  3ZQV A;  3NRH A;  3C18 A;  4AL0 A;  2R7S A;  5CI8 A;  2KYH A;  2Q00 A;  1QKR A;  1Q0D A;  3FDQ A;  2IYL D;  4BG0 A;  4ZLC A;  2YZS A;  1K05 A;  3DMD A;  2PX0 A;  1IW7 F;  1H9G A;  2W4M A;  2YLI A;  4PFO A;  5DS6 A;  3PMR A;  5KYX B;  4C7O B;  4PJL A;  4G7H F;  1KU2 A;  2W45 A;  4AE4 B;  4CSA C;  1LS4 A;  3OA1 A;  3Q7G A;  3ABL C;  4YL3 A;  3TJ5 A;  1C03 A;  2CNW A;  2L6H A;  4CIH A;  3TK0 A;  1PD0 A;  4XQ1 A;  1YVI A;  3M15 A;  4B6I A;  1FMW A;  3R2P A;  5L0C A;  3JYY A;  1LPE A;  3NMI A;  1G8X A;  2HSQ A;  4OIR F;  1T6Q A;  1XZQ A;  2CGE A;  3A9C A;  1J8M F;  4P9T A;  3L8J A;  3RF3 A;  1YZC A;  2IXM A;  1MMA A;  4JRZ A;  3J06 A;  2Y69 C;  5IY5 C;  2XS1 A;  3PCV A;  1NU9 C;  3WOD F;  1H6G A;  4KBL A;  1PV3 A;  2X0C A;  3W8H A;  4HEA J;  1C02 A;  2AWY A;  4YT4 A;  4RBN A;  2XLD A;  2ZPA A;  3NMK A;  1ZU4 A;  3RQE A;  3W2V A;  4D4N A;  2VCC A;  3S27 A;  4DBR A;  2HV6 A;  5A6K A;  1T01 A;  4IB4 A;  1VYK A;  2J45 A;  4D4X A;  4OIP F;  2XLM A;  4G7Z F;  4DBQ A;  5DQZ A;  3LNR A;  1RKE A;  4FWV A;  3I4U A;  2HMQ A;  4QI0 A;  2PFD A;  3ZDL A;  2ZD9 A;  4N4W A;  2KSF A;  3SXK A;  1HMO A;  3RQG A;  1YZA A;  2NSG A;  3DZA A;  4JUR I;  4IGG A;  2WL8 A;  2UUH A;  3DE8 A;  2ZXO A;  4YK5 A;  4ER9 A;  3Q7L A;  3JRT A;  3DE9 A;  1W2W A;  4MQ9 F;  3U0C A;  1ZW2 A;  3EG9 A;  4BJT A;  2R7V A;  1A0B A;  3HKK A;  2R05 A;  2I8B A;  1QSP A;  4Z9J A;  3I5Q A;  1WAT A;  2AVK A;  3AGU A;  5T3T A;  1ZVZ A;  3EHM A;  2HJM A;  1JR8 A;  1ZHW A;  3UNG C;  4GEH A;  2WB7 A;  3M79 A;  4KI2 A;  4CJO A;  1QZX A;  3IPM O;  4XPW A;  1CGO A;  1NFN A;  3US6 A;  2R02 A;  4CDV A;  2P7V A;  3JZ0 A;  1D0X A;  2IOQ A;  5KYY A;  2O9X A;  3U5S A;  4CS8 C;  1MMN A;  2V3C C;  2E87 A;  2YLG A;  1APC A;  4WAB A;  3HNK A;  1RJ9 A;  2DB4 A;  3LJB A;  4XPY A;  3JT1 A;  2J9B A;  1V54 C;  4U5H A;  4Q5S F;  2ASR A;  3AJM A;  4O6N A;  4F4B A;  5EGY A;  1AVO B;  5KYU A;  4KC9 A;  2TMV P;  1ZHZ A;  1MMG A;  1S7Z A;  2CW0 F;  2LQG A;  2WVQ A;  1FTS A;  4MTF A;  3GOD A;  3IQ5 A;  4LDK A;  4DJ9 A;  5KYW A;  3K33 A;  1WAS A;  3FOP A;  2J46 A;  1DOV A;  4I1M A;  4E18 A;  3DJN B;  2VAS A;  3EFO B;  3NYL A;  3TD7 A;  4EHP A;  1UFB A;  3EGD B;  5JLI A;  3FOO A;  3SEO A;  4PJM A;  1HY5 A;  4DRH B;  2DYS C;  3LS1 A;  3GOR A;  4NTF A;  2OOC A;  2A6E F;  5TJ5 E;  3U9J A;  1HE1 A;  4CS8 A;  1JPN A;  1A7D A;  3C8Z A;  3EGX B;  3ZTZ A;  2AU5 A;  4U5D E;  1OW8 A;  4YN0 B;  3K7D A;  3L0I A;  3ZIB A;  3FAP B;  2OKU A;  4MVZ A;  3QTH A;  3K1H A;  1A41 A;  1I4Y A;  3V5Y A;  4N6H A;  4JZA A;  5BQI A;  1YAR O;  1VLT A;  3FVY A;  4H4K C;  4U5B E;  3T9O A;  1M6T A;  3T6B A;  3W2W A;  1ZHY A;  1LE4 A;  1U6H A;  2M64 A;  2Y3D A;  2CCY A;  4MW8 A;  3EJN A;  3HNI A;  4YT8 A;  3CAX A;  3IQT A;  5JS5 A;  5L0J A;  5FZT A;  2GAQ A;  4C3B A;  4HFK B;  5JVE A;  3KYI A;  1FFH A;  4O6Y A;  3LAY A;  1ZYR F;  5F5F A;  3AG1 C;  3HNJ A;  1PD1 A;  3U2L A;  1E83 A;  1E85 A;  2FGY A;  2C04 A;  4G0H A;  2ZXP A;  4LDQ A;  4LAC B;  2HS5 A;  4K7B A;  4MVR A;  3QMK A;  3O6X A;  3RVY A;  2KJG A;  4E7Z A;  2J7P D;  4XLN F;  4MW3 A;  1T6I A;  1Y4C A;  2QUP A;  2EPK X;  4JJG A;  2HV7 A;  3ASO C;  2HFI A;  3JCU Q;  5EK0 A;  4DVZ A;  2ETS A;  4J30 B;  2XLW A;  2XRH A;  2DI3 A;  1U0B B;  1SMY F;  2L6G A;  1ZHT A;  3AG2 C;  4WGY A;  1FFT C;  4E17 A;  2B0H A;  4O79 A;  4J32 B;  2OU6 A;  2KGO A;  1V4A A;  3LLI A;  5B3S C;  3GWL A;  4MTG A;  3GEI A;  4BJ5 C;  3RKO F;  1MMD A;  1OR2 A;  3O10 A;  4U5F E;  2G3K A;  4CDA A;  1NG1 A;  2A1D D;  5T3W A;  3DJU B;  1JMW A;  4ULV A;  5AC5 A;  5FCL A;  2D4U A;  4DVY P;  5L3Q A;  2M4E A;  3UR3 C;  3UGP A;  3LNM B;  1Y6D A;  3SXZ A;  5L0D A;  1MND A;  1EKY A;  1LE2 A;  3ATP A;  1O3U A;  2J9V A;  2KNH A;  3T6G B;  2XXA A;  2PF4 E;  4GYT A;  2Q7R A;  3U2M A;  1LI5 A;  1CPR A;  3KMI A;  5COM A;  1SZI A;  4EUK B;  4WJ0 A;  1YYX A;  3GAN A;  1GQA A;  1S05 A;  4JE9 A;  1XZP A;  1ST6 A;  3GWN A;  3K1I C;  2PBE A;  4BJ6 C;  4OIO F;  3L8I A;  4EWC A;  4FAP B;  1TFK B;  4Q4Z F;  2ICW G;  1M2V A;  4HFF B;  3U3F A;  2B0J A;  3SZR A;  3AOU A;  3TQO A;  3SXM A;  3QVZ A;  3DWW A;  3TOL A;  2OEX A;  4BPM A;  1OXB A;  3IQC A;  3C8G A;  3IQ6 A;  1FMV A;  2Y3H A;  4J7Y A;  3QW1 A;  2XLO A;  4U5G A;  5DVW A;  3T6J A;  2J9U A;  1WGW A;  3E9V A;  4CSA A;  2NUP B;  2HJ3 A;  1YAU O;  4NQF A;  4QDL A;  4E0I A;  4AK9 A;  2ZXR A;  4AL1 A;  3FXH A;  1OR3 A;  2NG1 A;  3CQZ A;  4CS9 C;  4KNV A;  3POV A;  1TQG A;  3QZC A;  5L0I A;  1M57 C;  1I4Z A;  1I5N A;  2H7B A;  2PX3 A;  2YWA A;  1T9K A;  2FFH A;  4XLP F;  1LKX A;  4IWB A;  5K0I A;  4PJN A;  3B0V C;  5DS5 A;  3S28 A;  4JEB A;  3CEX A;  1L3P A;  2LCH A;  2Y39 A;  3A11 A;  2R25 A;  1ZU5 A;  1B68 A;  4O7G A;  2VB6 A;  1MQV A;  3R7C A;  2I15 A;  1HW2 A;  2W9Y A;  1OCC C;  5F5H A;  2R7X A;  5GPG B;  4W8K A;  5E33 A;  1D1B A;  5KYU B;  3MFN A;  2QNL A;  2D5R B;  5E3A A;  2P61 A;  4I44 A;  1NBB A;  3V5Z A;  4XTK A;  2EIJ C;  3RIP A;  5AGF A;  1R4T A;  1WTY A;  2LK4 A;  2J7P A;  1U89 A;  2QY9 A;  2VCB A;  3T4R A;  4CS9 A;  5JP7 A;  5AC4 A;  3N24 A;  3OWT A;  1MNE A;  1WWP A;  2DYR C;  1NFO A;  2R03 A;  2XL8 A;  3RH3 A;  5A6B A;  4XWJ A;  5KYN A;  1H9T A;  2EIK C;  1F1M A;  1FAP B;  2EIM C;  3BRJ A;  1YYJ A;  5COF A;  2NUT A;  2C03 A;  1ORY A;  4CDY A;  2KC3 A;  4EKW A;  3MX3 A;  2J0W A;  3GM3 A;  1SF8 A;  3NYM A;  5BQG A;  2YQY A;  3C62 A;  5EHH A;  2WVO A;  3DM9 B;  4ZLD A;  4IRU A;  4XEF A;  3UMI A;  1G4U S;  1G4W R;  2HZ8 A;  1Z6A A;  1D1A A;  3M4B A;  4LER A;  2W4B A;  1JRA A;  4OIN F;  5DLJ A;  2L81 A;  1SYQ A;  2HUJ A;  3B71 A;  4K1O A;  3TUL A;  2P0N A;  3LEO A;  1ZHX A;  2J9W A;  3JSZ A;  2R7U A;  1C17 M;  2Y3B A;  2PNO A;  2A68 F;  3JSE O;  4U9E A;  5KYY B;  1RXQ A;  4XEK A;  2NSF A;  1YDI A;  2XLH A;  1RKE B;  2H7V C;  2CNW D;  2R7O A;  2WZL A;  2QE9 A;  4G78 A;  1LS1 A;  1K40 A;  3ECS A;  2GA0 A;  3W8I A;  3VF0 A;  3NKE A;  3NMJ A;  4DOZ A;  1TFO B;  4P6I C;  3PHF 2;  1SR2 A;  1M2O A;  2IXP A;  3HTK C;  2FAP B;  4EBJ A;  1JOG A;  1CPQ A;  3AG3 C;  3X2Q C;  2WZG A;  3EG9 B;  4MVS A;  3S0X A;  2R7T A;  4OIQ F;  3QW0 A;  1Q0M A;  3ZWI A;  3E70 C;  1OCZ C;  3JYH A;  4E7S A;  1CGM E;  2WZF A;  4PFP A;  2OJE D;  2H8A A;  3NKD A;  1Z5Z A;  1OQC A;  3NYJ A;  4JTA B;  5B1A C;  4AX2 A;  1JPJ A;  1VK5 A;  2EPO A;  4OD5 A;  5KYX A;  4BJ1 A;  4C7O A;  1BR1 A;  256B A;  5D91 A;  2LFD A;  4AE4 A;  2DGJ A;  4E0H A;  3ITF A;  2YL1 A;  3S29 A;  5L0G A;  2YL0 A;  1NZE A;  2HKV A;  4JJF A;  1RJ9 B;  2IBF A;  2P6V A; 
#chains in the Genus database with same CATH homology
 1VMA A;  3LEV A;  3EH1 A;  4I3M A;  4X0R A;  1OCR C;  1O5H A;  1TKN A;  2KQ9 A;  3SYN A;  5KYU B;  5KYY B;  3UMH A;  5KYW B;  4U5E E;  1D0Y A;  1PCX A;  3B0P A;  2X51 A;  2QTV A;  3AQB A;  1V55 C;  4BEJ A;  1TR2 A;  3DXJ F;  4LLC A;  1QLE C;  5DQT A;  1Z23 A;  3EZI A;  4ULW A;  5E3C A;  2EIN C;  4QI2 A;  3FHD A;  2J0X A;  2GFH A;  4FX5 A;  3CZ6 A;  3CSK A;  4RD9 A;  3EZH A;  4BJ5 A;  3K6B A;  3VYW A;  3EQL F;  2MYS A;  5E2Q A;  4KNW A;  3AG4 C;  4C3E A;  1N1C A;  4YJW A;  2Q3T A;  3DAF A;  2LSE A;  3FAJ A;  3HJC A;  3OEO A;  5B1B C;  3V7O A;  1OCO C;  4NY3 A;  1OKK D;  2G62 A;  4OD4 A;  4RDA A;  2CDQ A;  4CBE A;  4JW1 A;  4PJJ A;  4BJ6 A;  2R7Q A;  3WG7 C;  2ZXW C;  3KKB A;  1TWG A;  3ZG1 A;  3ZC4 A;  4EBB A;  1O87 A;  4C3D A;  4M63 A;  3EFO A;  3EGD A;  4A2N B;  2Q9A A;  3K66 A;  3HLZ A;  3LLK A;  4CS7 A;  3ASN C;  3NDB B;  2Z15 A;  2VH3 A;  1LVK A;  3M1C B;  2XXA B;  2JD3 A;  5L3V A;  3EGX A;  3KH2 A;  3ABK C;  4PK4 A;  3B9Q A;  3X1O A;  2XL4 A;  1M2V B;  3LES A;  5T1D B;  4JCH A;  2YHS A;  3EH2 A;  3B0U X;  2Y3G A;  3VAY A;  2R7R A;  3Q6M A;  4JVS A;  1VOM A;  3LS0 A;  1D0Z A;  3DD7 A;  2G3V A;  2OCC C;  3O39 A;  4G7O F;  2WVN A;  2L9J A;  2EIL C;  4IJJ A;  4MND A;  4ANJ A;  1BR2 A;  5BUO A;  1TWH A;  3UMK A;  3EHN A;  3N0T A;  4I1O B;  4U5C E;  3I5P A;  1M56 C;  5DS4 A;  1Z3I X;  2Q9B A;  2MWQ A;  2A69 F;  1IZM A;  4IAO A;  1D1C A;  2A6H F;  2V26 A;  3SNH A;  3ABM C;  2KW3 C;  2IXN A;  3F46 A;  4Q7C A;  3KL4 A;  4N06 A;  4YT5 A;  3N2Z B;  1OKK A;  5HSW A;  4YT2 A;  3DAG A;  2NUT B;  2XSE A;  3Q6N A;  3IEE A;  5D92 A;  4K0D A;  4YWQ A;  3ZVR A;  2YEV A;  3UGO A;  2IXO A;  2BE5 F;  4O6M A;  2Q9C A;  3F47 A;  3L34 A;  3RFY A;  3EPV A;  3NG1 A;  3MLG A;  4FES A;  3DM5 A;  3RYL A;  2NUP A;  3H65 A;  3ZSU A;  2R7W A;  2PP4 A;  1TWA A;  1J8Y F;  2H7O A;  1TWC A;  3AQC A;  1BR4 A;  1Z63 A;  3SP1 A;  2OG2 A;  4HE8 D;  1VYI A;  1NU7 D;  4LLE A;  5CI9 A;  3NRH A;  2R7S A;  5CI8 A;  3FDQ A;  2IYL D;  4BG0 A;  4ZLC A;  2YZS A;  4Q4Z F;  3DMD A;  2PX0 A;  1IW7 F;  4PFO A;  2W4M A;  5DS6 A;  5KYX B;  4C7O B;  3PMR A;  4PJL A;  4G7H F;  1KU2 A;  2W45 A;  4AE4 B;  4CSA C;  3Q7G A;  3OA1 A;  3ABL C;  2CNW A;  4CIH A;  1PD0 A;  4B6I A;  1FMW A;  1G8X A;  4OIR F;  2CGE A;  1J8M F;  2IXM A;  1MMA A;  2Y69 C;  5IY5 C;  3WOD F;  1NU9 C;  4KBL A;  3W8H A;  4HEA J;  4YT4 A;  4RBN A;  2ZPA A;  1ZU4 A;  3W2V A;  4DBR A;  3S27 A;  2HV6 A;  1VYK A;  2J45 A;  4OIP F;  4G7Z F;  4DBQ A;  5DQZ A;  3LNR A;  4FWV A;  3I4U A;  4QI0 A;  2PFD A;  3DZA A;  4JUR I;  2WL8 A;  2ZXO A;  3Q7L A;  3JRT A;  1W2W A;  4MQ9 F;  3EG9 A;  4BJT A;  2R7V A;  2I8B A;  3I5Q A;  5T3T A;  3EHM A;  1ZHW A;  3UNG C;  4GEH A;  2WB7 A;  4KI2 A;  1QZX A;  2P7V A;  1D0X A;  2IOQ A;  2O9X A;  4CS8 C;  1MMN A;  2V3C C;  2E87 A;  1RJ9 A;  3LJB A;  3JT1 A;  1V54 C;  4U5H A;  4Q5S F;  4O6N A;  4F4B A;  5EGY A;  5KYU A;  4KC9 A;  1ZHZ A;  1MMG A;  1S7Z A;  2CW0 F;  2WVQ A;  5KYY A;  1FTS A;  5KYW A;  3GOD A;  3K33 A;  2J46 A;  4I1M A;  3DJN B;  2VAS A;  3EFO B;  3NYL A;  3TD7 A;  3EGD B;  3SEO A;  4PJM A;  2DYS C;  3LS1 A;  2A6E F;  4CS8 A;  1JPN A;  3EGX B;  4U5D E;  4YN0 B;  3K7D A;  3L0I A;  3ZIB A;  3K1H A;  4JZA A;  3FVY A;  4H4K C;  4U5B E;  3T6B A;  3W2W A;  1ZHY A;  2Y3D A;  3EJN A;  4YT8 A;  4C3B A;  4HFK B;  1FFH A;  4O6Y A;  3LAY A;  1ZYR F;  5F5F A;  3AG1 C;  1PD1 A;  2FGY A;  2C04 A;  4G0H A;  2ZXP A;  4LAC B;  4K7B A;  3QMK A;  3O6X A;  2KJG A;  4E7Z A;  2J7P D;  4XLN F;  4JJG A;  2HV7 A;  3ASO C;  3JCU Q;  4DVZ A;  4J30 B;  2XRH A;  1SMY F;  1ZHT A;  3AG2 C;  1FFT C;  4O79 A;  4J32 B;  2KGO A;  3LLI A;  5B3S C;  4BJ5 C;  3RKO F;  1MMD A;  4U5F E;  2G3K A;  1NG1 A;  2A1D D;  5T3W A;  3DJU B;  5FCL A;  5L3Q A;  4DVY P;  2M4E A;  3UR3 C;  3UGP A;  1MND A;  2J9V A;  2KNH A;  2XXA A;  2PF4 E;  4GYT A;  3KMI A;  1SZI A;  4WJ0 A;  3GAN A;  1ST6 A;  3K1I C;  4BJ6 C;  4OIO F;  4EWC A;  1M2V A;  4HFF B;  2B0J A;  3SZR A;  1FMV A;  2Y3H A;  4U5G A;  5DVW A;  3T6J A;  2J9U A;  1WGW A;  3E9V A;  4CSA A;  2NUP B;  4QDL A;  4AK9 A;  2ZXR A;  2NG1 A;  3CQZ A;  4CS9 C;  4KNV A;  3POV A;  3QZC A;  1M57 C;  2PX3 A;  2H7B A;  2FFH A;  4XLP F;  1LKX A;  4IWB A;  4PJN A;  3B0V C;  5DS5 A;  3S28 A;  2Y39 A;  1ZU5 A;  4O7G A;  2VB6 A;  2W9Y A;  1OCC C;  5F5H A;  2R7X A;  4W8K A;  5E33 A;  1D1B A;  2D5R B;  5E3A A;  4I44 A;  4XTK A;  2EIJ C;  3RIP A;  3T4R A;  2J7P A;  2QY9 A;  4CS9 A;  3N24 A;  3OWT A;  1MNE A;  3RH3 A;  2DYR C;  5KYN A;  4XWJ A;  2EIK C;  2EIM C;  2NUT A;  2C03 A;  3MX3 A;  2J0W A;  3NYM A;  1SF8 A;  5EHH A;  2WVO A;  3DM9 B;  4ZLD A;  4IRU A;  3UMI A;  1Z6A A;  1D1A A;  4LER A;  2W4B A;  4OIN F;  5DLJ A;  2L81 A;  1ZHX A;  2J9W A;  3JSZ A;  2R7U A;  2Y3B A;  2A68 F;  2H7V C;  2CNW D;  2R7O A;  2WZL A;  1LS1 A;  3ECS A;  3W8I A;  3NKE A;  4DOZ A;  4P6I C;  3PHF 2;  1M2O A;  2IXP A;  3HTK C;  3AG3 C;  3X2Q C;  2WZG A;  3EG9 B;  3S0X A;  2R7T A;  4OIQ F;  3E70 C;  1OCZ C;  3JYH A;  4E7S A;  2WZF A;  4PFP A;  3NKD A;  5B1A C;  1Z5Z A;  3NYJ A;  4AX2 A;  1JPJ A;  1VK5 A;  4OD5 A;  5KYX A;  4BJ1 A;  4C7O A;  1BR1 A;  5D91 A;  4AE4 A;  2DGJ A;  3ITF A;  3S29 A;  1NZE A;  4JJF A;  1RJ9 B;  2P6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...