1SF8A

Crystal structure of the carboxy-terminal domain of htpg, the e. coli hsp90
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
SFIDRVKALLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEVKYIFELNPDHVLVKRAADTEDEAKFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein htpG
publication title The crystal structure of the carboxy-terminal dimerization domain of htpG, the Escherichia coli Hsp90, reveals a potential substrate binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 32
structure length 115
sequence length 115
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2004-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1sf8A00
3Q6NA 1SF8A 2CGEA 3HJCA 2IOQA 3Q6MA
chains in the Genus database with same CATH superfamily
4BEJA 1AUEA 3KKBA 5JP7A 3V5XA 4CJOA 1GGQA 2R7WA 5B1AC 2NSFA 1HW2A 2LD6A 4ZLDA 5F5HA 3I5PA 1KTMA 5D92A 1MMGA 5JSLA 5AC5A 1NSGB 5AGFA 2W9YA 3GWLA 2BC5A 4OIQF 3U3FA 4JJGA 1FFTC 4YN0B 2OG2A 2EIJC 3EPVA 3GWNA 2GDCA 4J7TA 4X0RA 4BG0A 4JTCB 1ZHXA 2J9WA 2ZXOA 4DVYP 3L1MA 1WN0A 2R7RA 1MQVA 1OKKD 2W4MA 1T9KA 2J8WA 5D91A 1VB5A 4Q5SF 4RD9A 3FMSA 3GEHA 2ZD9A 3WG7C 3ZVRA 3JZ0A 4BJ1A 1XWJA 3R2PA 1HY5A 2YKZA 4QDLA 4F4BA 2DYRC 1S7ZA 1UG7A 1Z3IX 5A6BA 2OCCC 4PFOA 2GFHA 4CDAA 3V5YA 4IB4A 1GM5A 2IXMA 1T6IA 2VCCA 3LLIA 3TJ5A 1M2VB 2OJQA 3A11A 4JC7A 4DXWA 1TQGA 2CDQA 3HJCA 2P1AA 3C63A 3AOUA 2R05A 5DLJA 4U9DA 1RKEA 3ZWIA 1R5ID 4WGZA 2HZ8A 2YRFA 2PX3A 2ASRA 2XL4A 4CSAA 2HV6A 4J32B 1A0BA 4O6NA 4OD5A 4DVZA 4O79A 3Q6MA 2YVKA 5JVEA 3NYMA 5BQIA 2EPLX 3QVYA 3CSKA 2H7BA 3HNIA 3NRHA 4U5GA 2AU5A 3M15A 1Q0DA 1JPJA 3HTKC 3JSZA 4XWJA 1D1AA 1E83A 4XTKA 5CI9A 5DQZA 1TFOB 2X0CA 2R25A 3RVZA 2B0JA 2VCBA 4XPWA 2R7TA 3F47A 3SP1A 4MVQA 1T6QA 1MMAA 2XLWA 1HW1A 2C04A 1LE4A 1JR8A 2OU6A 2J9UA 3DKAA 1ORSC 1YDIA 3K1HA 3MYFA 4OIPF 2YEVA 4YL1A 3S90A 1OW7A 4G7HF 1C02A 1NLXA 3FAPB 1M56C 5L0IA 3OWTA 1JPNA 1FFHA 1ZW3A 2I8BA 1BZ4A 4JEAA 4U5DE 3EFOA 3M4BA 1ZHZA 3RH3A 3ZDLA 1KNYA 2FAPB 4G78A 5KYUA 4CS7A 3J06A 4DRJB 4L6RA 1VLTA 2LP4A 1BDJB 1D1BA 3QTHA 2BL2A 4JE9A 4E17A 5K0IA 5KYWA 2R7SA 1D0ZA 3MBGA 4E7SA 1YYXA 1MNDA 1CGNA 2M4EA 5A6KA 4CBEA 3EHMA 2LFDA 3RVYA 1M6TA 3GORA 2XLOA 1F1MA 2Y3GA 2YLDA 3QW0A 4IGGA 4W8KA 2WB7A 4PJMA 5L0DA 1OCRC 3LAYA 3RKOF 3FDQA 5FCLA 4PR9A 4OIOF 1ZHWA 4P9FA 3UMIA 1A7VA 2EILC 1HE9A 3DE8A 2IM8A 4Q4ZF 4XPXA 1PD1A 1OXBA 3NYLA 1T6UA 3LLKA 2KYHA 3T6BA 1XZQA 3C8GA 3RW0A 5DVWA 4P6IC 3S9OA 3QMKA 4U5EE 2R9RB 3PHF2 2R02A 1C17M 4B6IA 3LS1A 1ZVZA 2XM4A 2HMQA 2OOCA 1WASA 1ZZPA 4E0HA 2P7VA 3A9CA 1OR2A 3DMDA 3KYIA 3S0XA 2ICWG 1TR2A 5FZTA 2G62A 5GPGB 3ZC4A 1K40A 3AG1C 4AL1A 3IEEA 1D0YA 3RF3A 3ZQVA 2J0WA 2YLIA 2E87A 2H8AA 2J7PD 1O87A 2JD3A 3Q7LA 5COGA 4JIOA 2GA0A 1G4WR 2NUTB 3B0VC 1FR0A 1OCZC 1YA9A 2PFDA 3K7DA 4J7YA 3WAQA 2KK1A 3WODF 2NUTA 2J0XA 4IAOA 2YZSA 3KH2A 1VYIA 1IW7F 2WZGA 2VCAA 3LEOA 2XLDA 4ER9A 2KJGA 3L34A 3K1IC 2PX0A 4K1OA 3ZTMA 3X2QC 4C3EA 4EHPA 3BEHA 3FVYA 1VTMP 3HKKA 2W4BA 4KNWA 2HSQA 3U5SA 1EKYA 4UDVA 5EHHA 2XXAA 2RSEB 3ABLC 4LLEA 1PD0A 1R4TA 3JYYA 2YLGA 1TWCA 2R03A 3TOLA 3SZRA 2WZFA 2UUHA 4EUKB 2G3KA 2HS5A 3ASNC 4DJ9A 4U5BE 3LNRA 2H7OA 4O7GA 1U0BB 2CYDA 4I3MA 1Z6AA 1ZU5A 1WWPA 3F46A 1Q0FA 1VLSA 4NTFA 2B0HA 3M4CA 1G8XA 5E33A 4P9TA 2YL3A 3X1OA 3FXHA 4D4XA 3K1IA 3MLGA 5F28E 3T4RA 2HJ3A 4C3DA 5L3VA 4MTFA 4WJ0A 3RQGA 3V7OA 5L0JA 1HMOA 2YL0A 2XRHA 1HMDA 1SYQA 1ST6A 4XEVA 1QZXA 2FGYA 4CSAC 1NG1A 1MNEA 2J9BA 3EG9A 1LI7A 3EZHA 1AVOB 2A6HF 3HNJA 1V4AA 4XLNF 3VM6A 5KYXA 4NCQA 4Z9JA 3JCUQ 5DS4A 1RMVA 1CGOA 4HFFB 4YT4A 3NKDA 2NG1A 3VYWA 5DQTA 5T3WA 2A0UA 4HFKB 2IXPA 2O9XA 1YZAA 3LNMB 4MVRA 1FMVA 1K04A 4K0DA 1RXQA 3IQCA 2V3CC 3C8GD 1RKEB 3L8JA 5T1DB 4CS8C 2CNWD 3B0UX 1L7CA 2J9VA 2ZXRA 3AG3C 5B1BC 1QLEC 3W8IA 4FX5A 1H9TA 3B29A 1DOVA 5TJ5E 4DOZA 3SXMA 2XSEA 3BRJA 3US6A 3ZSUA 2DB4A 1MMNA 5KYYA 3SYNA 5L0GA 3EGXB 4HEAJ 3GM2A 4O6MA 3K33A 5COFA 5A6AA 3S84A 3EGXA 3U2LA 4LLCA 2L9JA 2YWAA 5IY5C 1YAUO 4EIYA 2PNOA 2EPNA 1FTSA 1H7IA 2KGOA 1NFNA 2R7OA 5B3SC 2OJED 2PBEA 3EZIA 1D1CA 2YL7A 2G3VA 1YJGA 3EFOB 1H9GA 4CIPA 2YL1A 2Q9CA 5KYUB 1RKCA 3MFNA 4AX2A 2V26A 1FNTc 2XLMA 4AK9A 1BR1A 1LPEA 2Y39A 2Y69C 3ZTZA 1JOGA 2NUPA 3C18A 2P0NA 5KYWB 4G7ZF 2KC3A 2WVNA 3CEXA 4ZLCA 3ITFA 1IZMA 3SXZA 4YT8A 3SXYA 1VYKA 3ECSA 4XLPF 4C3BA 4CDVA 1AEPA 4EKWA 4Z9IA 2XLHA 1O5HA 3C8ZA 4G7OF 2Q9AA 5F5FA 2DYSC 2YQYA 4BEMJ 3IHUA 2EIMC 3O6XA 1Q0MA 3IPMO 3JT1A 3OEOA 5COMA 4YWQA 2QTVA 3C8GB 4JCZA 4LERA 3TQOA 1U6HA 1L3PA 2EPKX 3EH2A 3U3BA 1KU2A 1LI5A 3ZG1A 2Y3BA 3HNLA 3UGPA 4OD4A 4KI2A 4YK5A 3CAXA 3C62A 3ATPA 1M2OA 3DD7A 3H65A 2GWWA 1Q0GA 1OKKA 3KYJA 2WVQA 3W8HA 1EA8A 1V54C 4MVZA 2A0BA 2JPUA 1FAPB 4N6HA 1ZYRF 4BPMA 5DS6A 3TJ6A 1YARO 3M1CB 3VRCA 2LCHA 4JJFA 4E18A 1I5NA 2IBFA 2L81A 1VMAA 2UUIA 5BQHA 3MX3A 2H7VC 5JLIA 4C7OA 2W45A 2Q7RA 1YVIA 3SXKA 2L6FA 3FOPA 1LE2A 2D5RB 3IQ5A 4N4WA 2VB6A 3WHNA 4CJGA 4FAPB 5A6BD 4NC3A 5JUAA 2Q3TA 3CZ6A 3V5ZA 4JTAB 2EPOA 2EIKC 4JVSA 4CDYA 3RYLA 3FAJA 3UNGC 3ABMC 2R7QA 4XEKA 3EH1A 4JTDB 2TMVP 2QLAA 2XL6A 1HE1A 2RD9A 4EBBA 2EPMX 2AWYA 2LFFA 3FHDA 1S05A 2EINC 3Q7GA 5DS5A 4GQHA 3IQ6A 4WGYA 1NFOA 3VAYA 5JT4A 2XXAB 2DI3A 4E0IA 1J8YF 2BE5F 3ASOC 2J46A 1MMDA 2WVOA 1CGME 3TOMA 4U5FE 2NPUA 3JRTA 2CGEA 4E7ZA 3EJNA 3G50A 1T01A 3NMIA 5AC4A 3PMRA 2M64A 4JW1A 3JYHA 2HKVA 3H2VA 4LDRA 2NSGA 4H4KC 4IAQA 4IRUA 3R7CA 2A69F 4MVUA 3DM5A 2JX0A 1NU7D 3NKEA 2XLEA 3AJMA 4W8PA 3QVZA 1O3UA 4IARA 1GQAA 3W4YA 2D4UA 3EHNA 1YLMA 3QZCA 3UR3C 5EGYA 1BBHA 256BA 1APCA 1Y6DA 1ZU4A 1TFKB 2HUJA 1XZPA 2HFIA 2WZLA 1OW6A 1VOMA 4H54A 4YL3A 3W2WA 2VC9A 3NYJA 1NZEA 1I4ZA 4IWBA 3SNHA 2DGJA 3T6GB 1D0XA 2GAQA 1YA7O 2LSEA 5CIVA 2ZPAA 3OA1A 3RQFA 4MQ9F 3EG9B 1V74B 2AWCA 3GANA 5KYXB 4XPYA 2MYSA 3E9VA 4J30B 4NY3A 3N24A 1Y4CA 1EI7A 2IXOA 4JZAA 3SEOA 2LK4A 1LKXA 1FMWA 5EK0A 3AGUA 3L8IA 4OINF 1SZIA 2A68F 3TULA 4LDQA 4YJWA 3T6JA 3GEEA 2R7VA 2F22A 3B0PA 2P6VA 2XLVA 5KYNA 3K66A 5L0HA 1SF8A 3DM9B 1SMYF 3GM3A 4AL0A 2R7XA 1LVKA 2KSFA 4RBNA 1I4YA 3UMHA 3Q6NA 1QSPA 1UFBA 3LESA 4RDAA 3JRMO 3K6BA 1NU9C 1BR4A 4LACB 1GS9A 1A7EA 2QNLA 3S27A 1OCOC 1ORYA 2OEXA 4IJJA 1G4US 5KYYB 1E85A 3LEVA 4MTGA 2VASA 5E2QA 4U5CE 2OEVA 1QVXA 2Q9BA 4DRHB 1WGWA 1OCCC 3ZIBA 1M57C 2CCYA 4HE8D 1OQCA 3B9QA 2J7PA 4M63A 4NQFA 3O39A 5JRAA 4MW8A 4JURI 5T3TA 3T9OA 4DBRA 3U9JA 3POVA 3S29A 1V55C 3U2MA 4CS8A 4KBLA 2L6GA 1M2VA 1WTYA 2WL8A 3NG1A 4GYTA 1B68A 2QY9A 2A6EF 5L3QA 3GM1A 1QKRA 1RJ9B 2NUPB 2QUPA 3PCVA 4FWVA 2XM0A 4BJTA 3TD7A 1WATA 1CPQA 3O55A 4QI0A 3AQCA 2KNHA 3G4ZA 1J8MF 3CQZA 1E84A 1RJ9A 2X51A 4GEHA 1JMWA 5BUOA 2FFHA 4XQ1A 3DWWA 1QQ3A 4O6YA 3HNKA 2ETSA 4XEFA 1A41A 2XS8A 4R32A 4BJ6C 5JS5A 4BJ5C 4ULWA 1TWAA 4ULVA 4KC9A 3ZQYA 5A69A 1OR3A 1SR2A 1K05A 2XS1A 3PDMP 4NTBA 4PACA 3DAGA 1ZHTA 3EQLF 1LS1A 1C03A 4CX9A 2IYLD 3AGTA 3DJUB 4PJLA 3U8PA 1OW8A 2KQ9A 3IQTA 4WABA 4YT2A 2AP3A 1Z23A 5B3IA 2Q00A 5E3AA 2Y3DA 3FOOA 3DI5A 1BR2A 1G5ZA 1LIHA 5E3CA 2I15A 1YZCA 4OIRF 3TK0A 4CIHA 2IXNA 2QE9A 4MTOA 3AQBA 3U8VA 2ZXPA 1EQ1A 4PJJA 3C7JA 1YYJA 3MYIA 4YT5A 3GODA 4MS2A 3NMKA 4A2NB 4BJ6A 2HMZA 3LS0A 4BJ5A 2Q4FA 2OKUA 1TWHA 2C03A 1H6GA 1A7DA 1ORJA 1ZHYA 2P61A 2Z15A 1JAFA 3I5QA 1ZW2A 3N0TA 4EBKA 4C7OB 1OXKA 2OQMA 4JCHA 4U5HA 3ABKC 4I1MA 4YL0A 4ANJA 1Z63A 1TKNA 1PCXA 3G4XA 1Z7Qc 1DOWA 3B71A 3LUTB 5L0FA 3U0CA 2HV7A 4G0HA 3KMIA 1NBBA 4I1OB 4PJNA 2L6HA 2YHSA 3RQEA 3UMKA 1E2XA 1W2WA 2ZXWC 4PK4A 3DE9A 2CNWA 2Y3HA 1U89A 4JKVA 4LDKA 4MVSA 4CS9C 4MVOA 4JEBA 4U9EA 4Z9HA 5HV9A 5CI8A 4Q7CA 4DRIB 4DBQA 2HSBA 3HLZA 3DXJF 2LIGA 2R7UA 1CPRA 4ONSA 1PV3A 2XL8A 4JRZA 3RIPA 4EWCA 1LS4A 1LM3B 2IOQA 5L0CA 1QPUA 3S28A 1T5OA 2KW3C 3L0IA 4FESA 1VK5A 2CW0F 3KL4A 4I44A 3RFYA 1WOLA 4A4AA 3NDBB 3E70C 3I4UA 3JSEO 2MHRA 4MNDA 4MVMA 3U9MA 4AE4B 2J45A 3O10A 1E86A 3UGOA 3DZAA 3W2VA 2PF4E 4QI2A 3H2UA 3NMJA 2LQGA 3AG2C 3GEIA 4AE4A 4KNVA 4N06A 3DJNB 4NTAA 3LJBA 4CS9A 3VF0A 2A1DD 2VH3A 2MWQA 1N1CA 3M79A 2L7AA 3N2ZB 1Z5ZA 1RCPA 3EGDB 4K7BA 3JTLO 3QW1A 4D4NA 5A6JA 5HSWA 4N6CA 3EGDA 2HJMA 1JRAA 1Q0KA 3AG4C 2AVKA 3KPHA 4MW3A 5BQGA 1TWGA 2PP4A 4EBJA 3DAFA 4PFPA
chains in the Genus database with same CATH topology
4BEJA 3KKBA 2R7WA 5B1AC 4ZLDA 5F5HA 3I5PA 5D92A 1MMGA 2W9YA 4OIQF 1FFTC 4YN0B 2OG2A 2EIJC 3EPVA 4X0RA 4BG0A 1ZHXA 2J9WA 2ZXOA 4DVYP 2R7RA 1OKKD 2W4MA 4Q5SF 5D91A 4RD9A 3WG7C 3ZVRA 4BJ1A 4QDLA 4F4BA 2DYRC 1S7ZA 1Z3IX 2OCCC 4PFOA 2GFHA 2IXMA 3LLIA 1M2VB 2CDQA 3HJCA 5DLJA 2PX3A 2XL4A 4CSAA 2HV6A 4J32B 4O6NA 4OD5A 4DVZA 4O79A 3Q6MA 3NYMA 3CSKA 2H7BA 3NRHA 4U5GA 1JPJA 3HTKC 3JSZA 4XWJA 1D1AA 4XTKA 5CI9A 5DQZA 2B0JA 2R7TA 3F47A 3SP1A 1MMAA 4JJGA 2C04A 3NG1A 4CS8A 4OIPF 2J9UA 3K1HA 2YEVA 4G7HF 1M56C 3OWTA 1JPNA 1FFHA 2I8BA 4U5DE 3RH3A 3EFOA 1ZHZA 5KYUA 4CS7A 2R7SA 1D1BA 5KYWA 1D0ZA 4E7SA 1MNDA 2M4EA 4CBEA 3EHMA 2Y3GA 4W8KA 2WB7A 4PJMA 1OCRC 3LAYA 3RKOF 3FDQA 5FCLA 4OIOF 1ZHWA 3UMIA 2EILC 4Q4ZF 1PD1A 3NYLA 3T6BA 3LLKA 5DVWA 4P6IC 3QMKA 4U5EE 3PHF2 4B6IA 3LS1A 2P7VA 3DMDA 3S0XA 1TR2A 2G62A 3ZC4A 3AG1C 3IEEA 1D0YA 2J0WA 2E87A 2J7PD 2JD3A 1O87A 3Q7LA 3B0VC 2NUTB 1OCZC 2PFDA 3K7DA 3WODF 2NUTA 2J0XA 4IAOA 2YZSA 3KH2A 1VYIA 1IW7F 2WZGA 2KJGA 3L34A 3K1IC 2PX0A 3X2QC 4C3EA 3FVYA 2W4BA 4KNWA 5EHHA 2XXAA 3ABLC 4LLEA 1PD0A 1TWCA 3SZRA 2WZFA 2G3KA 3ASNC 4U5BE 3LNRA 2H7OA 4O7GA 4I3MA 1Z6AA 1ZU5A 3F46A 1G8XA 5E33A 3X1OA 3MLGA 3T4RA 4C3DA 5L3VA 4WJ0A 3V7OA 2XRHA 1ST6A 1QZXA 2FGYA 4CSAC 1NG1A 1MNEA 3EG9A 3EZHA 2A6HF 4XLNF 5KYXA 3JCUQ 5DS4A 4HFFB 4YT4A 3NKDA 2NG1A 3VYWA 5DQTA 5T3WA 4HFKB 2IXPA 2O9XA 1FMVA 4K0DA 2V3CC 5T1DB 4CS8C 2CNWD 3B0UX 2J9VA 3AG3C 2ZXRA 5B1BC 1QLEC 3W8IA 4FX5A 4DOZA 2XSEA 3ZSUA 1MMNA 5KYYA 3SYNA 3EGXB 4HEAJ 4O6MA 3K33A 3EGXA 4LLCA 2L9JA 5IY5C 1FTSA 2KGOA 2R7OA 5B3SC 3EZIA 1D1CA 2G3VA 3EFOB 2Q9CA 5KYUB 4AX2A 2V26A 4AK9A 1BR1A 2Y39A 2Y69C 5KYWB 4G7ZF 2NUPA 2WVNA 4ZLCA 3ITFA 1IZMA 4YT8A 1VYKA 3ECSA 4XLPF 4C3BA 1O5HA 4G7OF 2Q9AA 5F5FA 2DYSC 2EIMC 3O6XA 3OEOA 3JT1A 4YWQA 2QTVA 4LERA 3EH2A 1KU2A 3ZG1A 2Y3BA 3UGPA 4OD4A 4KI2A 3H65A 1M2OA 3DD7A 1OKKA 2WVQA 3W8HA 1V54C 5DS6A 1ZYRF 3M1CB 4JJFA 2L81A 1VMAA 3MX3A 2H7VC 4C7OA 2W45A 2D5RB 2VB6A 2Q3TA 3CZ6A 4JVSA 2EIKC 3RYLA 3FAJA 3UNGC 3ABMC 2R7QA 3EH1A 4EBBA 3FHDA 3Q7GA 2EINC 5DS5A 3VAYA 2XXAB 1J8YF 3ASOC 2BE5F 2J46A 1MMDA 2WVOA 4U5FE 3JRTA 2CGEA 4E7ZA 3EJNA 3PMRA 4JW1A 3JYHA 4H4KC 4IRUA 2A69F 3DM5A 1NU7D 3NKEA 3EHNA 3UR3C 3QZCA 5EGYA 2WZLA 1ZU4A 1VOMA 3W2WA 3SNHA 3NYJA 1NZEA 4IWBA 2DGJA 1D0XA 2LSEA 2ZPAA 3OA1A 4MQ9F 3EG9B 3GANA 5KYXB 2MYSA 3E9VA 4J30B 4NY3A 3N24A 2IXOA 4JZAA 3SEOA 1LKXA 1FMWA 4OINF 1SZIA 2A68F 4YJWA 3T6JA 2R7VA 3B0PA 2P6VA 5KYNA 3K66A 1SF8A 3DM9B 1SMYF 2R7XA 1LVKA 4RBNA 3UMHA 3Q6NA 4RDAA 3LESA 3K6BA 1NU9C 1BR4A 4LACB 3S27A 1OCOC 4IJJA 5KYYB 3LEVA 2VASA 5E2QA 4U5CE 2Q9BA 1OCCC 1WGWA 3ZIBA 1M57C 4HE8D 3B9QA 2J7PA 4M63A 3O39A 4JURI 5T3TA 4DBRA 3POVA 3S29A 1V55C 4KBLA 1M2VA 2WL8A 4GYTA 2QY9A 2A6EF 5L3QA 1RJ9B 2NUPB 4FWVA 4BJTA 3TD7A 4QI0A 3AQCA 2KNHA 3CQZA 1J8MF 1RJ9A 2X51A 4GEHA 5BUOA 2FFHA 4O6YA 4BJ6C 4BJ5C 4ULWA 1TWAA 4KC9A 3DAGA 1ZHTA 3EQLF 1LS1A 2IYLD 3DJUB 4PJLA 2KQ9A 4YT2A 1Z23A 5E3AA 2Y3DA 1BR2A 4OIRF 5E3CA 4CIHA 2IXNA 3AQBA 2ZXPA 4PJJA 4YT5A 3GODA 4A2NB 4BJ6A 3LS0A 4BJ5A 1TWHA 2C03A 1ZHYA 2Z15A 3I5QA 3N0TA 4C7OB 4U5HA 4JCHA 3ABKC 4I1MA 4ANJA 1Z63A 1TKNA 1PCXA 2HV7A 4G0HA 3KMIA 4I1OB 4PJNA 2YHSA 3UMKA 1W2WA 2ZXWC 4PK4A 2CNWA 2Y3HA 4CS9C 5CI8A 4Q7CA 4DBQA 3HLZA 2R7UA 3DXJF 3RIPA 4EWCA 2IOQA 3S28A 2KW3C 3L0IA 4FESA 1VK5A 2CW0F 3KL4A 4I44A 3RFYA 3NDBB 3E70C 3I4UA 4MNDA 4AE4B 2J45A 3UGOA 3DZAA 3W2VA 2PF4E 4QI2A 3AG2C 4AE4A 4KNVA 4N06A 3DJNB 3LJBA 4CS9A 2A1DD 2VH3A 2MWQA 1N1CA 3N2ZB 1Z5ZA 3EGDB 4K7BA 5HSWA 3EGDA 3AG4C 1TWGA 2PP4A 3DAFA 4PFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6N A;  1SF8 A;  2CGE A;  3HJC A;  2IOQ A;  3Q6M A; 
#chains in the Genus database with same CATH topology
 4BEJ A;  1AUE A;  3KKB A;  5JP7 A;  3V5X A;  4CJO A;  1GGQ A;  2R7W A;  5B1A C;  2NSF A;  1HW2 A;  2LD6 A;  4ZLD A;  5F5H A;  3I5P A;  1KTM A;  5D92 A;  1MMG A;  5JSL A;  5AC5 A;  1NSG B;  5AGF A;  2W9Y A;  3GWL A;  2BC5 A;  4OIQ F;  3U3F A;  4JJG A;  1FFT C;  4YN0 B;  2OG2 A;  2EIJ C;  3EPV A;  3GWN A;  2GDC A;  4J7T A;  4X0R A;  4BG0 A;  4JTC B;  1ZHX A;  2J9W A;  2ZXO A;  4DVY P;  3L1M A;  1WN0 A;  2R7R A;  1MQV A;  1OKK D;  2W4M A;  1T9K A;  2J8W A;  5D91 A;  1VB5 A;  4Q5S F;  4RD9 A;  3FMS A;  3GEH A;  2ZD9 A;  3WG7 C;  3ZVR A;  3JZ0 A;  4BJ1 A;  1XWJ A;  3R2P A;  1HY5 A;  2YKZ A;  4QDL A;  4F4B A;  2DYR C;  1S7Z A;  1UG7 A;  1Z3I X;  5A6B A;  2OCC C;  4PFO A;  2GFH A;  4CDA A;  3V5Y A;  4IB4 A;  1GM5 A;  2IXM A;  1T6I A;  2VCC A;  3LLI A;  3TJ5 A;  1M2V B;  2OJQ A;  3A11 A;  4JC7 A;  4DXW A;  1TQG A;  2CDQ A;  3HJC A;  2P1A A;  3C63 A;  3AOU A;  2R05 A;  5DLJ A;  4U9D A;  1RKE A;  3ZWI A;  1R5I D;  4WGZ A;  2HZ8 A;  2YRF A;  2PX3 A;  2ASR A;  2XL4 A;  4CSA A;  2HV6 A;  4J32 B;  1A0B A;  4O6N A;  4OD5 A;  4DVZ A;  4O79 A;  3Q6M A;  2YVK A;  5JVE A;  3NYM A;  5BQI A;  2EPL X;  3QVY A;  3CSK A;  2H7B A;  3HNI A;  3NRH A;  4U5G A;  2AU5 A;  3M15 A;  1Q0D A;  1JPJ A;  3HTK C;  3JSZ A;  4XWJ A;  1D1A A;  1E83 A;  4XTK A;  5CI9 A;  5DQZ A;  1TFO B;  2X0C A;  2R25 A;  3RVZ A;  2B0J A;  2VCB A;  4XPW A;  2R7T A;  3F47 A;  3SP1 A;  4MVQ A;  1T6Q A;  1MMA A;  2XLW A;  1HW1 A;  2C04 A;  1LE4 A;  1JR8 A;  2OU6 A;  2J9U A;  3DKA A;  1ORS C;  1YDI A;  3K1H A;  3MYF A;  4OIP F;  2YEV A;  4YL1 A;  3S90 A;  1OW7 A;  4G7H F;  1C02 A;  1NLX A;  3FAP B;  1M56 C;  5L0I A;  3OWT A;  1JPN A;  1FFH A;  1ZW3 A;  2I8B A;  1BZ4 A;  4JEA A;  4U5D E;  3EFO A;  3M4B A;  1ZHZ A;  3RH3 A;  3ZDL A;  1KNY A;  2FAP B;  4G78 A;  5KYU A;  4CS7 A;  3J06 A;  4DRJ B;  4L6R A;  1VLT A;  2LP4 A;  1BDJ B;  1D1B A;  3QTH A;  2BL2 A;  4JE9 A;  4E17 A;  5K0I A;  5KYW A;  2R7S A;  1D0Z A;  3MBG A;  4E7S A;  1YYX A;  1MND A;  1CGN A;  2M4E A;  5A6K A;  4CBE A;  3EHM A;  2LFD A;  3RVY A;  1M6T A;  3GOR A;  2XLO A;  1F1M A;  2Y3G A;  2YLD A;  3QW0 A;  4IGG A;  4W8K A;  2WB7 A;  4PJM A;  5L0D A;  1OCR C;  3LAY A;  3RKO F;  3FDQ A;  5FCL A;  4PR9 A;  4OIO F;  1ZHW A;  4P9F A;  3UMI A;  1A7V A;  2EIL C;  1HE9 A;  3DE8 A;  2IM8 A;  4Q4Z F;  4XPX A;  1PD1 A;  1OXB A;  3NYL A;  1T6U A;  3LLK A;  2KYH A;  3T6B A;  1XZQ A;  3C8G A;  3RW0 A;  5DVW A;  4P6I C;  3S9O A;  3QMK A;  4U5E E;  2R9R B;  3PHF 2;  2R02 A;  1C17 M;  4B6I A;  3LS1 A;  1ZVZ A;  2XM4 A;  2HMQ A;  2OOC A;  1WAS A;  1ZZP A;  4E0H A;  2P7V A;  3A9C A;  1OR2 A;  3DMD A;  3KYI A;  3S0X A;  2ICW G;  1TR2 A;  5FZT A;  2G62 A;  5GPG B;  3ZC4 A;  1K40 A;  3AG1 C;  4AL1 A;  3IEE A;  1D0Y A;  3RF3 A;  3ZQV A;  2J0W A;  2YLI A;  2E87 A;  2H8A A;  2J7P D;  1O87 A;  2JD3 A;  3Q7L A;  5COG A;  4JIO A;  2GA0 A;  1G4W R;  2NUT B;  3B0V C;  1FR0 A;  1OCZ C;  1YA9 A;  2PFD A;  3K7D A;  4J7Y A;  3WAQ A;  2KK1 A;  3WOD F;  2NUT A;  2J0X A;  4IAO A;  2YZS A;  3KH2 A;  1VYI A;  1IW7 F;  2WZG A;  2VCA A;  3LEO A;  2XLD A;  4ER9 A;  2KJG A;  3L34 A;  3K1I C;  2PX0 A;  4K1O A;  3ZTM A;  3X2Q C;  4C3E A;  4EHP A;  3BEH A;  3FVY A;  1VTM P;  3HKK A;  2W4B A;  4KNW A;  2HSQ A;  3U5S A;  1EKY A;  4UDV A;  5EHH A;  2XXA A;  2RSE B;  3ABL C;  4LLE A;  1PD0 A;  1R4T A;  3JYY A;  2YLG A;  1TWC A;  2R03 A;  3TOL A;  3SZR A;  2WZF A;  2UUH A;  4EUK B;  2G3K A;  2HS5 A;  3ASN C;  4DJ9 A;  4U5B E;  3LNR A;  2H7O A;  4O7G A;  1U0B B;  2CYD A;  4I3M A;  1Z6A A;  1ZU5 A;  1WWP A;  3F46 A;  1Q0F A;  1VLS A;  4NTF A;  2B0H A;  3M4C A;  1G8X A;  5E33 A;  4P9T A;  2YL3 A;  3X1O A;  3FXH A;  4D4X A;  3K1I A;  3MLG A;  5F28 E;  3T4R A;  2HJ3 A;  4C3D A;  5L3V A;  4MTF A;  4WJ0 A;  3RQG A;  3V7O A;  5L0J A;  1HMO A;  2YL0 A;  2XRH A;  1HMD A;  1SYQ A;  1ST6 A;  4XEV A;  1QZX A;  2FGY A;  4CSA C;  1NG1 A;  1MNE A;  2J9B A;  3EG9 A;  1LI7 A;  3EZH A;  1AVO B;  2A6H F;  3HNJ A;  1V4A A;  4XLN F;  3VM6 A;  5KYX A;  4NCQ A;  4Z9J A;  3JCU Q;  5DS4 A;  1RMV A;  1CGO A;  4HFF B;  4YT4 A;  3NKD A;  2NG1 A;  3VYW A;  5DQT A;  5T3W A;  2A0U A;  4HFK B;  2IXP A;  2O9X A;  1YZA A;  3LNM B;  4MVR A;  1FMV A;  1K04 A;  4K0D A;  1RXQ A;  3IQC A;  2V3C C;  3C8G D;  1RKE B;  3L8J A;  5T1D B;  4CS8 C;  2CNW D;  3B0U X;  1L7C A;  2J9V A;  2ZXR A;  3AG3 C;  5B1B C;  1QLE C;  3W8I A;  4FX5 A;  1H9T A;  3B29 A;  1DOV A;  5TJ5 E;  4DOZ A;  3SXM A;  2XSE A;  3BRJ A;  3US6 A;  3ZSU A;  2DB4 A;  1MMN A;  5KYY A;  3SYN A;  5L0G A;  3EGX B;  4HEA J;  3GM2 A;  4O6M A;  3K33 A;  5COF A;  5A6A A;  3S84 A;  3EGX A;  3U2L A;  4LLC A;  2L9J A;  2YWA A;  5IY5 C;  1YAU O;  4EIY A;  2PNO A;  2EPN A;  1FTS A;  1H7I A;  2KGO A;  1NFN A;  2R7O A;  5B3S C;  2OJE D;  2PBE A;  3EZI A;  1D1C A;  2YL7 A;  2G3V A;  1YJG A;  3EFO B;  1H9G A;  4CIP A;  2YL1 A;  2Q9C A;  5KYU B;  1RKC A;  3MFN A;  4AX2 A;  2V26 A;  1FNT c;  2XLM A;  4AK9 A;  1BR1 A;  1LPE A;  2Y39 A;  2Y69 C;  3ZTZ A;  1JOG A;  2NUP A;  3C18 A;  2P0N A;  5KYW B;  4G7Z F;  2KC3 A;  2WVN A;  3CEX A;  4ZLC A;  3ITF A;  1IZM A;  3SXZ A;  4YT8 A;  3SXY A;  1VYK A;  3ECS A;  4XLP F;  4C3B A;  4CDV A;  1AEP A;  4EKW A;  4Z9I A;  2XLH A;  1O5H A;  3C8Z A;  4G7O F;  2Q9A A;  5F5F A;  2DYS C;  2YQY A;  4BEM J;  3IHU A;  2EIM C;  3O6X A;  1Q0M A;  3IPM O;  3JT1 A;  3OEO A;  5COM A;  4YWQ A;  2QTV A;  3C8G B;  4JCZ A;  4LER A;  3TQO A;  1U6H A;  1L3P A;  2EPK X;  3EH2 A;  3U3B A;  1KU2 A;  1LI5 A;  3ZG1 A;  2Y3B A;  3HNL A;  3UGP A;  4OD4 A;  4KI2 A;  4YK5 A;  3CAX A;  3C62 A;  3ATP A;  1M2O A;  3DD7 A;  3H65 A;  2GWW A;  1Q0G A;  1OKK A;  3KYJ A;  2WVQ A;  3W8H A;  1EA8 A;  1V54 C;  4MVZ A;  2A0B A;  2JPU A;  1FAP B;  4N6H A;  1ZYR F;  4BPM A;  5DS6 A;  3TJ6 A;  1YAR O;  3M1C B;  3VRC A;  2LCH A;  4JJF A;  4E18 A;  1I5N A;  2IBF A;  2L81 A;  1VMA A;  2UUI A;  5BQH A;  3MX3 A;  2H7V C;  5JLI A;  4C7O A;  2W45 A;  2Q7R A;  1YVI A;  3SXK A;  2L6F A;  3FOP A;  1LE2 A;  2D5R B;  3IQ5 A;  4N4W A;  2VB6 A;  3WHN A;  4CJG A;  4FAP B;  5A6B D;  4NC3 A;  5JUA A;  2Q3T A;  3CZ6 A;  3V5Z A;  4JTA B;  2EPO A;  2EIK C;  4JVS A;  4CDY A;  3RYL A;  3FAJ A;  3UNG C;  3ABM C;  2R7Q A;  4XEK A;  3EH1 A;  4JTD B;  2TMV P;  2QLA A;  2XL6 A;  1HE1 A;  2RD9 A;  4EBB A;  2EPM X;  2AWY A;  2LFF A;  3FHD A;  1S05 A;  2EIN C;  3Q7G A;  5DS5 A;  4GQH A;  3IQ6 A;  4WGY A;  1NFO A;  3VAY A;  5JT4 A;  2XXA B;  2DI3 A;  4E0I A;  1J8Y F;  2BE5 F;  3ASO C;  2J46 A;  1MMD A;  2WVO A;  1CGM E;  3TOM A;  4U5F E;  2NPU A;  3JRT A;  2CGE A;  4E7Z A;  3EJN A;  3G50 A;  1T01 A;  3NMI A;  5AC4 A;  3PMR A;  2M64 A;  4JW1 A;  3JYH A;  2HKV A;  3H2V A;  4LDR A;  2NSG A;  4H4K C;  4IAQ A;  4IRU A;  3R7C A;  2A69 F;  4MVU A;  3DM5 A;  2JX0 A;  1NU7 D;  3NKE A;  2XLE A;  3AJM A;  4W8P A;  3QVZ A;  1O3U A;  4IAR A;  1GQA A;  3W4Y A;  2D4U A;  3EHN A;  1YLM A;  3QZC A;  3UR3 C;  5EGY A;  1BBH A;  256B A;  1APC A;  1Y6D A;  1ZU4 A;  1TFK B;  2HUJ A;  1XZP A;  2HFI A;  2WZL A;  1OW6 A;  1VOM A;  4H54 A;  4YL3 A;  3W2W A;  2VC9 A;  3NYJ A;  1NZE A;  1I4Z A;  4IWB A;  3SNH A;  2DGJ A;  3T6G B;  1D0X A;  2GAQ A;  1YA7 O;  2LSE A;  5CIV A;  2ZPA A;  3OA1 A;  3RQF A;  4MQ9 F;  3EG9 B;  1V74 B;  2AWC A;  3GAN A;  5KYX B;  4XPY A;  2MYS A;  3E9V A;  4J30 B;  4NY3 A;  3N24 A;  1Y4C A;  1EI7 A;  2IXO A;  4JZA A;  3SEO A;  2LK4 A;  1LKX A;  1FMW A;  5EK0 A;  3AGU A;  3L8I A;  4OIN F;  1SZI A;  2A68 F;  3TUL A;  4LDQ A;  4YJW A;  3T6J A;  3GEE A;  2R7V A;  2F22 A;  3B0P A;  2P6V A;  2XLV A;  5KYN A;  3K66 A;  5L0H A;  1SF8 A;  3DM9 B;  1SMY F;  3GM3 A;  4AL0 A;  2R7X A;  1LVK A;  2KSF A;  4RBN A;  1I4Y A;  3UMH A;  3Q6N A;  1QSP A;  1UFB A;  3LES A;  4RDA A;  3JRM O;  3K6B A;  1NU9 C;  1BR4 A;  4LAC B;  1GS9 A;  1A7E A;  2QNL A;  3S27 A;  1OCO C;  1ORY A;  2OEX A;  4IJJ A;  1G4U S;  5KYY B;  1E85 A;  3LEV A;  4MTG A;  2VAS A;  5E2Q A;  4U5C E;  2OEV A;  1QVX A;  2Q9B A;  4DRH B;  1WGW A;  1OCC C;  3ZIB A;  1M57 C;  2CCY A;  4HE8 D;  1OQC A;  3B9Q A;  2J7P A;  4M63 A;  4NQF A;  3O39 A;  5JRA A;  4MW8 A;  4JUR I;  5T3T A;  3T9O A;  4DBR A;  3U9J A;  3POV A;  3S29 A;  1V55 C;  3U2M A;  4CS8 A;  4KBL A;  2L6G A;  1M2V A;  1WTY A;  2WL8 A;  3NG1 A;  4GYT A;  1B68 A;  2QY9 A;  2A6E F;  5L3Q A;  3GM1 A;  1QKR A;  1RJ9 B;  2NUP B;  2QUP A;  3PCV A;  4FWV A;  2XM0 A;  4BJT A;  3TD7 A;  1WAT A;  1CPQ A;  3O55 A;  4QI0 A;  3AQC A;  2KNH A;  3G4Z A;  1J8M F;  3CQZ A;  1E84 A;  1RJ9 A;  2X51 A;  4GEH A;  1JMW A;  5BUO A;  2FFH A;  4XQ1 A;  3DWW A;  1QQ3 A;  4O6Y A;  3HNK A;  2ETS A;  4XEF A;  1A41 A;  2XS8 A;  4R32 A;  4BJ6 C;  5JS5 A;  4BJ5 C;  4ULW A;  1TWA A;  4ULV A;  4KC9 A;  3ZQY A;  5A69 A;  1OR3 A;  1SR2 A;  1K05 A;  2XS1 A;  3PDM P;  4NTB A;  4PAC A;  3DAG A;  1ZHT A;  3EQL F;  1LS1 A;  1C03 A;  4CX9 A;  2IYL D;  3AGT A;  3DJU B;  4PJL A;  3U8P A;  1OW8 A;  2KQ9 A;  3IQT A;  4WAB A;  4YT2 A;  2AP3 A;  1Z23 A;  5B3I A;  2Q00 A;  5E3A A;  2Y3D A;  3FOO A;  3DI5 A;  1BR2 A;  1G5Z A;  1LIH A;  5E3C A;  2I15 A;  1YZC A;  4OIR F;  3TK0 A;  4CIH A;  2IXN A;  2QE9 A;  4MTO A;  3AQB A;  3U8V A;  2ZXP A;  1EQ1 A;  4PJJ A;  3C7J A;  1YYJ A;  3MYI A;  4YT5 A;  3GOD A;  4MS2 A;  3NMK A;  4A2N B;  4BJ6 A;  2HMZ A;  3LS0 A;  4BJ5 A;  2Q4F A;  2OKU A;  1TWH A;  2C03 A;  1H6G A;  1A7D A;  1ORJ A;  1ZHY A;  2P61 A;  2Z15 A;  1JAF A;  3I5Q A;  1ZW2 A;  3N0T A;  4EBK A;  4C7O B;  1OXK A;  2OQM A;  4JCH A;  4U5H A;  3ABK C;  4I1M A;  4YL0 A;  4ANJ A;  1Z63 A;  1TKN A;  1PCX A;  3G4X A;  1Z7Q c;  1DOW A;  3B71 A;  3LUT B;  5L0F A;  3U0C A;  2HV7 A;  4G0H A;  3KMI A;  1NBB A;  4I1O B;  4PJN A;  2L6H A;  2YHS A;  3RQE A;  3UMK A;  1E2X A;  1W2W A;  2ZXW C;  4PK4 A;  3DE9 A;  2CNW A;  2Y3H A;  1U89 A;  4JKV A;  4LDK A;  4MVS A;  4CS9 C;  4MVO A;  4JEB A;  4U9E A;  4Z9H A;  5HV9 A;  5CI8 A;  4Q7C A;  4DRI B;  4DBQ A;  2HSB A;  3HLZ A;  3DXJ F;  2LIG A;  2R7U A;  1CPR A;  4ONS A;  1PV3 A;  2XL8 A;  4JRZ A;  3RIP A;  4EWC A;  1LS4 A;  1LM3 B;  2IOQ A;  5L0C A;  1QPU A;  3S28 A;  1T5O A;  2KW3 C;  3L0I A;  4FES A;  1VK5 A;  2CW0 F;  3KL4 A;  4I44 A;  3RFY A;  1WOL A;  4A4A A;  3NDB B;  3E70 C;  3I4U A;  3JSE O;  2MHR A;  4MND A;  4MVM A;  3U9M A;  4AE4 B;  2J45 A;  3O10 A;  1E86 A;  3UGO A;  3DZA A;  3W2V A;  2PF4 E;  4QI2 A;  3H2U A;  3NMJ A;  2LQG A;  3AG2 C;  3GEI A;  4AE4 A;  4KNV A;  4N06 A;  3DJN B;  4NTA A;  3LJB A;  4CS9 A;  3VF0 A;  2A1D D;  2VH3 A;  2MWQ A;  1N1C A;  3M79 A;  2L7A A;  3N2Z B;  1Z5Z A;  1RCP A;  3EGD B;  4K7B A;  3JTL O;  3QW1 A;  4D4N A;  5A6J A;  5HSW A;  4N6C A;  3EGD A;  2HJM A;  1JRA A;  1Q0K A;  3AG4 C;  2AVK A;  3KPH A;  4MW3 A;  5BQG A;  1TWG A;  2PP4 A;  4EBJ A;  3DAF A;  4PFP A; 
#chains in the Genus database with same CATH homology
 4BEJ A;  3KKB A;  2R7W A;  5B1A C;  4ZLD A;  5F5H A;  3I5P A;  5D92 A;  1MMG A;  2W9Y A;  4OIQ F;  1FFT C;  4YN0 B;  2OG2 A;  2EIJ C;  3EPV A;  4X0R A;  4BG0 A;  1ZHX A;  2J9W A;  2ZXO A;  4DVY P;  2R7R A;  1OKK D;  2W4M A;  4Q5S F;  5D91 A;  4RD9 A;  3WG7 C;  3ZVR A;  4BJ1 A;  4QDL A;  4F4B A;  2DYR C;  1S7Z A;  1Z3I X;  2OCC C;  4PFO A;  2GFH A;  2IXM A;  3LLI A;  1M2V B;  2CDQ A;  3HJC A;  5DLJ A;  2PX3 A;  2XL4 A;  4CSA A;  2HV6 A;  4J32 B;  4O6N A;  4OD5 A;  4DVZ A;  4O79 A;  3Q6M A;  3NYM A;  3CSK A;  2H7B A;  3NRH A;  4U5G A;  1JPJ A;  3HTK C;  3JSZ A;  4XWJ A;  1D1A A;  4XTK A;  5CI9 A;  5DQZ A;  2B0J A;  2R7T A;  3F47 A;  3SP1 A;  1MMA A;  4JJG A;  2C04 A;  3NG1 A;  4CS8 A;  4OIP F;  2J9U A;  3K1H A;  2YEV A;  4G7H F;  1M56 C;  3OWT A;  1JPN A;  1FFH A;  2I8B A;  4U5D E;  3RH3 A;  3EFO A;  1ZHZ A;  5KYU A;  4CS7 A;  2R7S A;  1D1B A;  5KYW A;  1D0Z A;  4E7S A;  1MND A;  2M4E A;  4CBE A;  3EHM A;  2Y3G A;  4W8K A;  2WB7 A;  4PJM A;  1OCR C;  3LAY A;  3RKO F;  3FDQ A;  5FCL A;  4OIO F;  1ZHW A;  3UMI A;  2EIL C;  4Q4Z F;  1PD1 A;  3NYL A;  3T6B A;  3LLK A;  5DVW A;  4P6I C;  3QMK A;  4U5E E;  3PHF 2;  4B6I A;  3LS1 A;  2P7V A;  3DMD A;  3S0X A;  1TR2 A;  2G62 A;  3ZC4 A;  3AG1 C;  3IEE A;  1D0Y A;  2J0W A;  2E87 A;  2J7P D;  2JD3 A;  1O87 A;  3Q7L A;  3B0V C;  2NUT B;  1OCZ C;  2PFD A;  3K7D A;  3WOD F;  2NUT A;  2J0X A;  4IAO A;  2YZS A;  3KH2 A;  1VYI A;  1IW7 F;  2WZG A;  2KJG A;  3L34 A;  3K1I C;  2PX0 A;  3X2Q C;  4C3E A;  3FVY A;  2W4B A;  4KNW A;  5EHH A;  2XXA A;  3ABL C;  4LLE A;  1PD0 A;  1TWC A;  3SZR A;  2WZF A;  2G3K A;  3ASN C;  4U5B E;  3LNR A;  2H7O A;  4O7G A;  4I3M A;  1Z6A A;  1ZU5 A;  3F46 A;  1G8X A;  5E33 A;  3X1O A;  3MLG A;  3T4R A;  4C3D A;  5L3V A;  4WJ0 A;  3V7O A;  2XRH A;  1ST6 A;  1QZX A;  2FGY A;  4CSA C;  1NG1 A;  1MNE A;  3EG9 A;  3EZH A;  2A6H F;  4XLN F;  5KYX A;  3JCU Q;  5DS4 A;  4HFF B;  4YT4 A;  3NKD A;  2NG1 A;  3VYW A;  5DQT A;  5T3W A;  4HFK B;  2IXP A;  2O9X A;  1FMV A;  4K0D A;  2V3C C;  5T1D B;  4CS8 C;  2CNW D;  3B0U X;  2J9V A;  3AG3 C;  2ZXR A;  5B1B C;  1QLE C;  3W8I A;  4FX5 A;  4DOZ A;  2XSE A;  3ZSU A;  1MMN A;  5KYY A;  3SYN A;  3EGX B;  4HEA J;  4O6M A;  3K33 A;  3EGX A;  4LLC A;  2L9J A;  5IY5 C;  1FTS A;  2KGO A;  2R7O A;  5B3S C;  3EZI A;  1D1C A;  2G3V A;  3EFO B;  2Q9C A;  5KYU B;  4AX2 A;  2V26 A;  4AK9 A;  1BR1 A;  2Y39 A;  2Y69 C;  5KYW B;  4G7Z F;  2NUP A;  2WVN A;  4ZLC A;  3ITF A;  1IZM A;  4YT8 A;  1VYK A;  3ECS A;  4XLP F;  4C3B A;  1O5H A;  4G7O F;  2Q9A A;  5F5F A;  2DYS C;  2EIM C;  3O6X A;  3OEO A;  3JT1 A;  4YWQ A;  2QTV A;  4LER A;  3EH2 A;  1KU2 A;  3ZG1 A;  2Y3B A;  3UGP A;  4OD4 A;  4KI2 A;  3H65 A;  1M2O A;  3DD7 A;  1OKK A;  2WVQ A;  3W8H A;  1V54 C;  5DS6 A;  1ZYR F;  3M1C B;  4JJF A;  2L81 A;  1VMA A;  3MX3 A;  2H7V C;  4C7O A;  2W45 A;  2D5R B;  2VB6 A;  2Q3T A;  3CZ6 A;  4JVS A;  2EIK C;  3RYL A;  3FAJ A;  3UNG C;  3ABM C;  2R7Q A;  3EH1 A;  4EBB A;  3FHD A;  3Q7G A;  2EIN C;  5DS5 A;  3VAY A;  2XXA B;  1J8Y F;  3ASO C;  2BE5 F;  2J46 A;  1MMD A;  2WVO A;  4U5F E;  3JRT A;  2CGE A;  4E7Z A;  3EJN A;  3PMR A;  4JW1 A;  3JYH A;  4H4K C;  4IRU A;  2A69 F;  3DM5 A;  1NU7 D;  3NKE A;  3EHN A;  3UR3 C;  3QZC A;  5EGY A;  2WZL A;  1ZU4 A;  1VOM A;  3W2W A;  3SNH A;  3NYJ A;  1NZE A;  4IWB A;  2DGJ A;  1D0X A;  2LSE A;  2ZPA A;  3OA1 A;  4MQ9 F;  3EG9 B;  3GAN A;  5KYX B;  2MYS A;  3E9V A;  4J30 B;  4NY3 A;  3N24 A;  2IXO A;  4JZA A;  3SEO A;  1LKX A;  1FMW A;  4OIN F;  1SZI A;  2A68 F;  4YJW A;  3T6J A;  2R7V A;  3B0P A;  2P6V A;  5KYN A;  3K66 A;  1SF8 A;  3DM9 B;  1SMY F;  2R7X A;  1LVK A;  4RBN A;  3UMH A;  3Q6N A;  4RDA A;  3LES A;  3K6B A;  1NU9 C;  1BR4 A;  4LAC B;  3S27 A;  1OCO C;  4IJJ A;  5KYY B;  3LEV A;  2VAS A;  5E2Q A;  4U5C E;  2Q9B A;  1OCC C;  1WGW A;  3ZIB A;  1M57 C;  4HE8 D;  3B9Q A;  2J7P A;  4M63 A;  3O39 A;  4JUR I;  5T3T A;  4DBR A;  3POV A;  3S29 A;  1V55 C;  4KBL A;  1M2V A;  2WL8 A;  4GYT A;  2QY9 A;  2A6E F;  5L3Q A;  1RJ9 B;  2NUP B;  4FWV A;  4BJT A;  3TD7 A;  4QI0 A;  3AQC A;  2KNH A;  3CQZ A;  1J8M F;  1RJ9 A;  2X51 A;  4GEH A;  5BUO A;  2FFH A;  4O6Y A;  4BJ6 C;  4BJ5 C;  4ULW A;  1TWA A;  4KC9 A;  3DAG A;  1ZHT A;  3EQL F;  1LS1 A;  2IYL D;  3DJU B;  4PJL A;  2KQ9 A;  4YT2 A;  1Z23 A;  5E3A A;  2Y3D A;  1BR2 A;  4OIR F;  5E3C A;  4CIH A;  2IXN A;  3AQB A;  2ZXP A;  4PJJ A;  4YT5 A;  3GOD A;  4A2N B;  4BJ6 A;  3LS0 A;  4BJ5 A;  1TWH A;  2C03 A;  1ZHY A;  2Z15 A;  3I5Q A;  3N0T A;  4C7O B;  4U5H A;  4JCH A;  3ABK C;  4I1M A;  4ANJ A;  1Z63 A;  1TKN A;  1PCX A;  2HV7 A;  4G0H A;  3KMI A;  4I1O B;  4PJN A;  2YHS A;  3UMK A;  1W2W A;  2ZXW C;  4PK4 A;  2CNW A;  2Y3H A;  4CS9 C;  5CI8 A;  4Q7C A;  4DBQ A;  3HLZ A;  2R7U A;  3DXJ F;  3RIP A;  4EWC A;  2IOQ A;  3S28 A;  2KW3 C;  3L0I A;  4FES A;  1VK5 A;  2CW0 F;  3KL4 A;  4I44 A;  3RFY A;  3NDB B;  3E70 C;  3I4U A;  4MND A;  4AE4 B;  2J45 A;  3UGO A;  3DZA A;  3W2V A;  2PF4 E;  4QI2 A;  3AG2 C;  4AE4 A;  4KNV A;  4N06 A;  3DJN B;  3LJB A;  4CS9 A;  2A1D D;  2VH3 A;  2MWQ A;  1N1C A;  3N2Z B;  1Z5Z A;  3EGD B;  4K7B A;  5HSW A;  3EGD A;  3AG4 C;  1TWG A;  2PP4 A;  3DAF A;  4PFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...