2VH3A

Ranasmurfin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
112
structure length
110
Chain Sequence
AACSFPPSEIPGSKECLAEALQKHQGFKKKSYALICAYLNYKEDAENYERAAEDFDSAVKCTGCKEGVDLHEGNPELIEEGFEKFLASLKIDRKALGSLCTLFQKLAIPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual Chromophore and Cross-Links in Ranasmurfin: A Blue Protein from the Foam Nests of a Tropical Frog.
pubmed doi rcsb
molecule tags Unknown function
molecule keywords RANASMURFIN
total genus 36
structure length 110
sequence length 112
ec nomenclature
pdb deposition date 2007-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1410 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2vh3A00
2VH3A
chains in the Genus database with same CATH superfamily
1QVXA 1VB5A 2J9UA 3S27A 4E7ZA 4ZLCA 1HE9A 5A6KA 2J0WA 4DRIB 5JS5A 2FFHA 1PD0A 2IBFA 3LLKA 1YJGA 3EFOB 3ZDLA 1TFOB 4E0HA 2J9WA 3JCUQ 3EG9B 1WOLA 2HMZA 5AC4A 1E84A 1NFOA 2LD6A 4PACA 1CGME 4PJLA 3RYLA 4XPWA 1M2OA 4YWQA 1CPRA 3LS1A 2YHSA 1FAPB 3ASOC 3I5PA 2CNWA 4YJWA 5L0FA 4IJJA 1WASA 2VH3A 2R7UA 1OCOC 3OA1A 3ZC4A 1D0YA 2QE9A 4JW1A 3S28A 3HJCA 3M1CB 1MNEA 1Z63A 3GM1A 3QW0A 1D0XA 2J0XA 4MVQA 5E3CA 1Z5ZA 1WN0A 5E2QA 2NSGA 1LM3B 1HMOA 1ZHYA 4P9FA 4PJMA 3BRJA 2G62A 4BJ1A 2NUTA 1QZXA 2R7QA 2XL8A 1C02A 3ABKC 3HTKC 2KYHA 4P6IC 3RF3A 2RSEB 4DVZA 4MVUA 2VCBA 3SYNA 1Q0MA 4BJ5C 4EKWA 2Y3DA 2RD9A 3H2VA 5COMA 4LERA 1GGQA 5KYXB 1G8XA 2HFIA 2UUHA 2L7AA 1W2WA 2XM4A 1APCA 1LE4A 2ZXPA 3F46A 3GODA 4I44A 3ZSUA 4W8KA 1LVKA 2AWCA 2X0CA 2A0UA 3DAFA 2R7VA 5CI9A 4JEBA 2XLDA 2QNLA 3JT1A 2GAQA 2NSFA 4J7TA 3SEOA 2XLVA 3G4XA 4AE4B 5F28E 2Q00A 1SF8A 2A0BA 4DVYP 1DOWA 1EQ1A 2I15A 4ULVA 1YDIA 1H7IA 2ICWG 1BR1A 3L1MA 1O87A 2WVNA 3HNLA 4OIRF 3BEHA 1T6UA 2J9VA 3TK0A 3U3BA 1HW2A 3EGDB 2W45A 1J8YF 5D91A 5T1DB 2Y69C 3HLZA 3MBGA 3SXKA 3H65A 3C8GA 1M56C 2C03A 2L9JA 1YLMA 4JVSA 5F5HA 1GQAA 2R05A 2P7VA 1IZMA 1ORSC 4PJNA 4NY3A 5L3VA 5KYNA 1QPUA 1S7ZA 4C3EA 5TJ5E 1RKEA 4U9DA 3EFOA 3O55A 4U5EE 1M2VB 1OKKA 2PP4A 2I8BA 2DGJA 2D4UA 4C3DA 3TJ5A 2CYDA 2Q7RA 4F4BA 1YAUO 3LNMB 5DS6A 3K1HA 3KPHA 4ULWA 2IOQA 2XXAB 5HV9A 1B68A 3SXZA 4XPXA 2XLHA 4RD9A 3X1OA 5A6BD 4MTOA 4IARA 4WJ0A 4ER9A 1WATA 4YL3A 1U89A 4U5GA 3L34A 3KMIA 2LP4A 2XS8A 4KC9A 2WVQA 2NUPB 2Y3HA 1JR8A 2R25A 3PMRA 3ZQVA 4EWCA 4LDKA 1I4YA 2NG1A 3DM5A 5EK0A 3ZWIA 4DRHB 3IQTA 2YEVA 3PDMP 1PD1A 4E7SA 4G7OF 2KNHA 4MVRA 4Z9HA 3S0XA 3T6JA 1S05A 3FXHA 3CZ6A 3WODF 3F47A 3LEVA 4O6MA 5L0GA 3IEEA 3US6A 2CW0F 2QY9A 1FFTC 1TR2A 4JTDB 3FDQA 3TQOA 4D4XA 2IXMA 2E87A 4JZAA 3NKEA 4JCZA 1ZHTA 3U9MA 4CS9A 1KTMA 4JJGA 3QW1A 1D0ZA 3C8GD 1OW8A 3QZCA 4ONSA 3NRHA 4OIPF 4OD5A 3NMKA 4HFKB 4PR9A 5KYWA 4H54A 1FMWA 3G50A 4WGYA 2W4BA 5KYYA 1MMDA 5COFA 2DI3A 2EPLX 1AUEA 2OEVA 1T5OA 3EHMA 4E17A 4I1OB 2EIMC 3RKOF 2HZ8A 1SZIA 3V5YA 4CIHA 5KYXA 2JPUA 1WWPA 2R7RA 1FTSA 3T9OA 3KL4A 1L3PA 4O6NA 1KNYA 4I3MA 5L0CA 1ZW2A 3DD7A 2ZPAA 1G4WR 1LPEA 1GM5A 2XSEA 1LIHA 2O9XA 4CS8A 5A69A 3C18A 1YYJA 3GEEA 5L0IA 4XWJA 3V7OA 3QTHA 1TKNA 4OIOF 4A2NB 3WAQA 3EJNA 1UFBA 2PNOA 4JCHA 2V3CC 3FOPA 3GM3A 3N2ZB 4WGZA 4D4NA 4CJOA 5JT4A 3EGXB 1YZCA 1RCPA 4DJ9A 1TWGA 3FHDA 3Q7LA 3R7CA 5BQIA 5AGFA 5K0IA 4U5CE 1V55C 3RIPA 4PK4A 2OJED 2PX3A 2BC5A 4YK5A 5L0JA 2P61A 1CPQA 3SXYA 4IAQA 3JRTA 1AVOB 2WB7A 1Q0DA 3IHUA 2ETSA 1OR3A 1V74B 2LK4A 2NUTB 1HE1A 3FVYA 2DYSC 4JIOA 2GWWA 2A6HF 4MS2A 4BJ5A 1AEPA 2KGOA 1LS1A 2HMQA 2QTVA 2R7TA 4O7GA 3L8JA 4CSAC 3EHNA 1G4US 5T3WA 4GYTA 4NTBA 1HW1A 5KYUB 1RJ9B 2J46A 4W8PA 4J7YA 4G7ZF 2CGEA 3B0VC 1T6QA 2OQMA 3RQGA 1VTMP 2CDQA 4LDRA 5L0DA 1BR4A 2OEXA 3K6BA 3DAGA 3GORA 1Z23A 4K0DA 4XEVA 4CIPA 3AJMA 1KU2A 1Y6DA 4CX9A 2VCCA 2KK1A 4IRUA 5DS4A 2FGYA 4MVOA 4FAPB 1OW7A 4A4AA 5A6BA 1VLSA 3B0UX 5D92A 4CJGA 5FZTA 3TOLA 2GDCA 3W2VA 1M6TA 4LLEA 3RVYA 4E18A 4IGGA 3MLGA 3SNHA 1JRAA 4LACB 3UMIA 1D1CA 2JD3A 4UDVA 3QVZA 1HMDA 5JP7A 5B3SC 2DYRC 2XLOA 1ZU5A 2M4EA 2G3KA 4JKVA 3U2MA 3HNIA 1NBBA 4BEJA 4XEKA 3N0TA 3O10A 2OKUA 2YL0A 3EH2A 3K7DA 3A9CA 2XL4A 1ORJA 1YA9A 2EILC 4DRJB 3DI5A 4G78A 2IXOA 3FAPB 2CNWD 3H2UA 3L0IA 3R2PA 3O6XA 3C8GB 5KYYB 1A7VA 1NG1A 3NYMA 3TD7A 4CS9C 2YRFA 3S84A 2R7XA 3C8ZA 3DJUB 2ZXOA 3SXMA 1SYQA 3IPMO 3ZTMA 2PBEA 1TQGA 3MFNA 3OWTA 3B0PA 1HY5A 4GQHA 4J30B 4NCQA 4XPYA 1XWJA 3T4RA 4KI2A 1XZPA 3LJBA 2M64A 3V5ZA 4CS8C 1OCCC 2XXAA 3M15A 3EQLF 1C03A 2YVKA 1ZZPA 3E9VA 1VLTA 3K66A 4XEFA 2R7WA 3U2LA 2V26A 3NYLA 2UUIA 2XLWA 2EIKC 3EPVA 1DOVA 4N06A 4BJTA 5F5FA 3AG2C 3I5QA 4U9EA 2XLMA 2YL1A 5GPGB 4NC3A 5BUOA 3DWWA 5E33A 2KQ9A 4YT4A 3U0CA 2J45A 3A11A 3ABLC 3AG4C 2IXPA 1ZU4A 4XTKA 4YN0B 2L81A 4MNDA 1OW6A 4R32A 4IWBA 2PX0A 2R03A 3GWNA 5HSWA 2DB4A 3RQFA 4LDQA 5AC5A 1ZHXA 2EPKX 1JMWA 3FOOA 3GEHA 1JAFA 3DMDA 1H9GA 3KH2A 4J32B 4WABA 4PJJA 2EIJC 3JYHA 2AU5A 3VAYA 2B0JA 3JYYA 1OQCA 3U8PA 2WZGA 2GFHA 3DJNB 5EHHA 4FESA 3TULA 2VCAA 4HE8D 2IXNA 4P9TA 3N24A 2XLEA 3GEIA 4C3BA 1TWAA 4RDAA 1ORYA 3U5SA 4M63A 3UNGC 1FMVA 2NUPA 2HV6A 5KYUA 1WGWA 1BZ4A 1TFKB 2MHRA 3DE9A 3PCVA 2QUPA 1OR2A 2MYSA 2AP3A 2WVOA 3TJ6A 4Q4ZF 2TMVP 2JX0A 3GM2A 2QLAA 3RFYA 1QLEC 4KNWA 3FAJA 3AGTA 1VMAA 1RMVA 4C7OA 3L8IA 3TOMA 1V4AA 1CGOA 5CI8A 1L7CA 4EBKA 1Z7Qc 4XQ1A 1I5NA 2J7PA 1K05A 1YARO 1UG7A 2R7SA 1SR2A 1A7EA 1ZHWA 2XS1A 3CSKA 3AG3C 1K40A 1VK5A 2KJGA 3EH1A 4Q5SF 4JEAA 1OCRC 1T01A 2J9BA 4U5DE 3U8VA 2Q4FA 1K04A 3W8IA 1MMNA 2VC9A 4K1OA 4EUKB 2EPNA 3EZIA 1LI7A 2YWAA 4JTAB 5A6JA 1PCXA 3V5XA 1MMAA 1RKEB 3I4UA 4N6CA 2H7BA 1ZYRF 3JSZA 4AL1A 3C62A 5CIVA 3O39A 1LI5A 3KYIA 3B71A 2LSEA 2Y3BA 3M4BA 2A1DD 4U5FE 2J7PD 2HJ3A 1J8MF 1D1AA 1F1MA 2VB6A 2X51A 5DQTA 1Q0GA 4BEMJ 3Q6NA 3AG1C 2CCYA 1R5ID 2ASRA 3AQBA 3AQCA 1U6HA 1E2XA 3DZAA 2KW3C 3UGPA 3W2WA 2J8WA 4YL1A 4BG0A 3G4ZA 4OINF 1H9TA 2A68F 3NYJA 2L6FA 3ABMC 2LIGA 4JRZA 5BQHA 1NFNA 2W4MA 4NQFA 3WG7C 3M79A 2B0HA 4MVZA 1GS9A 2EPMX 3JRMO 1G5ZA 3QVYA 2IM8A 1E83A 3ASNC 1FR0A 1H6GA 4IAOA 2C04A 3AOUA 3POVA 2P0NA 1MQVA 2L6HA 1E85A 5JVEA 2FAPB 2W9YA 3VRCA 3RW0A 4DXWA 4JJFA 1OKKD 1JPJA 3NKDA 4DOZA 2G3VA 2XL6A 4QDLA 3X2QC 2XM0A 3EZHA 3ZVRA 3K1IA 3JSEO 1QSPA 3DE8A 1NZEA 4N4WA 4MTFA 2HV7A 3B29A 3HNKA 3RQEA 2EPOA 3LEOA 4MW3A 5JSLA 1JOGA 3LESA 5B3IA 2XRHA 1BDJB 4MTGA 2R7OA 5L0HA 2PFDA 3AGUA 4Z9IA 4PFOA 3RH3A 1WTYA 1QQ3A 2HSBA 3VM6A 4Q7CA 5DQZA 3M4CA 3ATPA 1R4TA 3NMIA 1ZW3A 4HFFB 3JZ0A 3ITFA 4EBBA 1V54C 3ZTZA 5A6AA 4X0RA 5DS5A 4YT8A 4K7BA 4Z9JA 2YLIA 4CDVA 1EI7A 1QKRA 3K1IC 3WHNA 2Q9CA 4AX2A 4L6RA 1A41A 4E0IA 4H4KC 3GWLA 1TWCA 4JE9A 1YZAA 1Z6AA 2KSFA 4G7HF 1Y4CA 4JURI 2PF4E 256BA 4MVSA 5B1AC 4ZLDA 1PV3A 3RVZA 1ZHZA 2OJQA 4G0HA 4MQ9F 4MVMA 2H8AA 2D5RB 1BR2A 2BL2A 5DLJA 4RBNA 4FWVA 2KC3A 4DBQA 2P6VA 5E3AA 4CBEA 4HEAJ 1N1CA 1EA8A 4O6YA 1LS4A 3CQZA 4AE4A 1SMYF 1OCZC 3IQ6A 4ANJA 4B6IA 4QI2A 1O5HA 4KBLA 2HKVA 1Q0FA 1CGNA 1BBHA 3K33A 3S90A 1JPNA 1FFHA 2H7OA 2OG2A 5T3TA 4C7OB 2OU6A 3C7JA 1VYKA 5JUAA 5EGYA 4FX5A 2Z15A 3FMSA 1NLXA 4JTCB 3Q6MA 3EGXA 4NTFA 1Z3IX 3LUTB 1M57C 2LFDA 4O79A 1Q0KA 5COGA 1LE2A 2LQGA 1NSGB 1RKCA 2GA0A 1D1BA 3IQCA 3ZQYA 4EIYA 3UMKA 1VOMA 2AVKA 2YKZA 1ZVZA 1MMGA 3SP1A 3W8HA 3KYJA 1A0BA 1O3UA 1VYIA 3UR3C 4OIQF 3EG9A 3DXJF 4CS7A 2VASA 1OXKA 1A7DA 2YZSA 4N6HA 1YYXA 4QI0A 1FNTc 4PFPA 1RJ9A 3CEXA 2NPUA 3MYFA 3SZRA 1LKXA 4U5HA 3LAYA 2YL7A 3Q7GA 4CSAA 4BPMA 3U9JA 3U3FA 3NDBB 2P1AA 3HNJA 2LCHA 5B1BC 2YQYA 4EBJA 3DKAA 3IQ5A 4OD4A 4AL0A 3UGOA 1T6IA 4JC7A 3HKKA 2Y3GA 1TWHA 3C63A 2YLDA 5L3QA 5DVWA 3OEOA 3MX3A 4XLPF 3NMJA 1C17M 2A69F 2HSQA 2MWQA 1U0BB 2ZXRA 5KYWB 2HUJA 2WL8A 3S9OA 3UMHA 3S29A 3MYIA 1XZQA 1YA7O 2HJMA 3LNRA 2H7VC 2Y39A 4BJ6C 4KNVA 4YT5A 3T6GB 3LLIA 1OXBA 5IY5C 4DBRA 2OOCA 1NU9C 3JTLO 4IB4A 1ST6A 2Q9AA 2ZD9A 3KKBA 4BJ6A 1MNDA 3B9QA 3CAXA 1M2VA 4LLCA 5BQGA 3VYWA 2IYLD 4MW8A 5JRAA 2WZLA 4EHPA 3GANA 2R02A 1EKYA 4AK9A 3PHF2 2EINC 2Q9BA 1NU7D 2F22A 2BE5F 3E70C 3VF0A 2HS5A 2LFFA 3ZG1A 3J06A 1YVIA 4XLNF 1RXQA 4CDAA 2ZXWC 1E86A 3T6BA 3W4YA 5FCLA 4CDYA 3QMKA 4U5BE 3ZIBA 4GEHA 2A6EF 3ECSA 3NG1A 4NTAA 3DM9B 2YLGA 3LS0A 4YT2A 2AWYA 2Q3TA 1I4ZA 2L6GA 2R9RB 2OCCC 1IW7F 3EGDA 4I1MA 4YL0A 2WZFA 2YL3A 1T9KA 5JLIA
chains in the Genus database with same CATH topology
2J9UA 3S27A 4ZLCA 4E7ZA 2J0WA 2FFHA 1PD0A 3LLKA 3EFOB 2J9WA 3JCUQ 3EG9B 4PJLA 3RYLA 4YWQA 1M2OA 3LS1A 2YHSA 3ASOC 3I5PA 2CNWA 4YJWA 4IJJA 2VH3A 2R7UA 1OCOC 3OA1A 3ZC4A 1D0YA 4JW1A 3S28A 3HJCA 3M1CB 1MNEA 1Z63A 5E3CA 1D0XA 2J0XA 1Z5ZA 5E2QA 1ZHYA 4PJMA 2G62A 4BJ1A 2NUTA 1QZXA 2R7QA 4P6IC 3ABKC 3HTKC 4DVZA 3SYNA 4BJ5C 2Y3DA 4LERA 5KYXB 1G8XA 1W2WA 3ZSUA 2ZXPA 3F46A 3GODA 4I44A 4W8KA 1LVKA 3DAFA 2R7VA 5CI9A 3JT1A 3SEOA 4AE4B 1SF8A 4DVYP 1BR1A 1O87A 2WVNA 4OIRF 2J9VA 3EGDB 2W45A 1J8YF 5D91A 5T1DB 2Y69C 3HLZA 3H65A 1M56C 2C03A 2L9JA 4JVSA 5F5HA 4PJNA 2P7VA 1IZMA 5L3VA 4NY3A 5KYNA 1S7ZA 4C3EA 3EFOA 4U5EE 1M2VB 1OKKA 2PP4A 2I8BA 2DGJA 4C3DA 4F4BA 5DS6A 3K1HA 4ULWA 2XXAB 2IOQA 4RD9A 3X1OA 4WJ0A 4U5GA 3L34A 3KMIA 4KC9A 2WVQA 2NUPB 2Y3HA 3PMRA 4EWCA 2NG1A 3DM5A 2YEVA 1PD1A 4E7SA 4G7OF 2KNHA 3S0XA 3T6JA 3WODF 3CZ6A 3F47A 3LEVA 4O6MA 3IEEA 2CW0F 2QY9A 1FFTC 1TR2A 3FDQA 2IXMA 2E87A 4JZAA 3NKEA 1ZHTA 4CS9A 4JJGA 1D0ZA 3QZCA 3NRHA 4OIPF 4OD5A 4HFKB 5KYWA 1FMWA 2W4BA 5KYYA 1MMDA 3EHMA 4I1OB 2EIMC 3RKOF 1SZIA 4CIHA 5KYXA 2R7RA 1FTSA 3KL4A 4O6NA 4I3MA 3DD7A 2ZPAA 2XSEA 2O9XA 4CS8A 4XWJA 3V7OA 1TKNA 4OIOF 4A2NB 2V3CC 3EJNA 4JCHA 3N2ZB 3EGXB 1TWGA 3FHDA 3Q7LA 4U5CE 1V55C 3RIPA 4PK4A 2PX3A 3JRTA 2WB7A 2NUTB 3FVYA 2DYSC 2A6HF 4BJ5A 2KGOA 1LS1A 2R7TA 2QTVA 4O7GA 4CSAC 3EHNA 5T3WA 4GYTA 5KYUB 1RJ9B 2J46A 4G7ZF 3B0VC 2CGEA 2CDQA 1BR4A 3K6BA 3DAGA 1Z23A 4K0DA 1KU2A 4IRUA 5DS4A 2FGYA 3B0UX 5D92A 3W2VA 4LLEA 3MLGA 3SNHA 4LACB 3UMIA 1D1CA 2JD3A 5B3SC 2DYRC 1ZU5A 2M4EA 2G3KA 4BEJA 3N0TA 3EH2A 3K7DA 2XL4A 2EILC 2IXOA 3L0IA 2CNWD 5KYYB 3O6XA 1NG1A 3NYMA 3TD7A 4CS9C 2R7XA 3DJUB 2ZXOA 4Q5SF 3OWTA 4J30B 3B0PA 3T4RA 4KI2A 3LJBA 4CS8C 1OCCC 2XXAA 3EQLF 3E9VA 3K66A 2R7WA 2V26A 3NYLA 4N06A 5F5FA 2EIKC 3EPVA 4BJTA 3AG2C 3I5QA 5BUOA 5E33A 2KQ9A 4YT4A 2J45A 3ABLC 3AG4C 2IXPA 1ZU4A 4XTKA 4YN0B 2L81A 4MNDA 4IWBA 2PX0A 5HSWA 1ZHXA 4J32B 3DMDA 3KH2A 4PJJA 2EIJC 3JYHA 3VAYA 2B0JA 2WZGA 2GFHA 3DJNB 5EHHA 4FESA 4HE8D 2IXNA 3N24A 4C3BA 1TWAA 4RDAA 3UNGC 4M63A 1FMVA 2NUPA 2HV6A 5KYUA 1WGWA 2WVOA 2MYSA 4Q4ZF 3RFYA 1QLEC 4KNWA 3FAJA 1VMAA 4C7OA 5CI8A 2J7PA 1ZHWA 3CSKA 3AG3C 1VK5A 2KJGA 3EH1A 1OCRC 4U5DE 3W8IA 1MMNA 3EZIA 1PCXA 1MMAA 3I4UA 2H7BA 1ZYRF 3JSZA 3O39A 2Y3BA 2LSEA 2A1DD 4U5FE 2J7PD 1J8MF 1D1AA 2VB6A 2X51A 5DQTA 3Q6NA 3AG1C 3AQBA 3DZAA 3W8HA 3UGPA 3AQCA 2KW3C 3W2WA 4BG0A 4OINF 2A68F 3NYJA 3ABMC 2W4MA 3WG7C 3ASNC 4IAOA 2C04A 3POVA 2W9YA 4JJFA 1OKKD 1JPJA 3NKDA 4DOZA 2G3VA 3X2QC 4QDLA 3ZVRA 3EZHA 1NZEA 2HV7A 3LESA 2XRHA 2R7OA 2PFDA 4PFOA 3RH3A 4Q7CA 5DQZA 4HFFB 3ITFA 4EBBA 1V54C 5DS5A 4X0RA 4YT8A 4K7BA 3K1IC 2Q9CA 4AX2A 4H4KC 1TWCA 1Z6AA 4G7HF 4ZLDA 4JURI 2PF4E 5B1AC 1ZHZA 4G0HA 4MQ9F 2D5RB 1BR2A 5DLJA 4RBNA 4FWVA 4DBQA 2P6VA 5E3AA 4CBEA 4HEAJ 1N1CA 4O6YA 3CQZA 4AE4A 1SMYF 1OCZC 4ANJA 4B6IA 4QI2A 1O5HA 4KBLA 3K33A 1JPNA 1FFHA 2H7OA 2OG2A 5T3TA 4C7OB 1VYKA 5EGYA 4FX5A 2Z15A 3Q6MA 3EGXA 1Z3IX 1M57C 4O79A 1D1BA 3UMKA 1VOMA 1MMGA 3SP1A 3UR3C 1VYIA 4OIQF 3EG9A 3DXJF 4CS7A 2VASA 2YZSA 4QI0A 4PFPA 1RJ9A 3SZRA 1LKXA 4U5HA 3LAYA 3Q7GA 4CSAA 3NDBB 5B1BC 4OD4A 3UGOA 2Y3GA 1TWHA 5L3QA 5DVWA 3OEOA 3MX3A 4XLPF 2A69F 2MWQA 2ZXRA 5KYWB 2WL8A 3UMHA 3S29A 3LNRA 4BJ6C 2H7VC 2Y39A 4KNVA 4YT5A 3LLIA 5IY5C 4DBRA 1NU9C 1ST6A 2Q9AA 3KKBA 4BJ6A 1MNDA 3B9QA 1M2VA 4LLCA 3VYWA 2R7SA 2IYLD 2WZLA 3GANA 4AK9A 3PHF2 2EINC 2Q9BA 1NU7D 2BE5F 3E70C 3ZG1A 4XLNF 2ZXWC 3T6BA 5FCLA 3QMKA 4U5BE 3ZIBA 4GEHA 2A6EF 3ECSA 3NG1A 3DM9B 3LS0A 4YT2A 2Q3TA 2OCCC 1IW7F 3EGDA 4I1MA 2WZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VH3 A; 
#chains in the Genus database with same CATH topology
 1QVX A;  1VB5 A;  2J9U A;  3S27 A;  4E7Z A;  4ZLC A;  1HE9 A;  5A6K A;  2J0W A;  4DRI B;  5JS5 A;  2FFH A;  1PD0 A;  2IBF A;  3LLK A;  1YJG A;  3EFO B;  3ZDL A;  1TFO B;  4E0H A;  2J9W A;  3JCU Q;  3EG9 B;  1WOL A;  2HMZ A;  5AC4 A;  1E84 A;  1NFO A;  2LD6 A;  4PAC A;  1CGM E;  4PJL A;  3RYL A;  4XPW A;  1M2O A;  4YWQ A;  1CPR A;  3LS1 A;  2YHS A;  1FAP B;  3ASO C;  3I5P A;  2CNW A;  4YJW A;  5L0F A;  4IJJ A;  1WAS A;  2VH3 A;  2R7U A;  1OCO C;  3OA1 A;  3ZC4 A;  1D0Y A;  2QE9 A;  4JW1 A;  3S28 A;  3HJC A;  3M1C B;  1MNE A;  1Z63 A;  3GM1 A;  3QW0 A;  1D0X A;  2J0X A;  4MVQ A;  5E3C A;  1Z5Z A;  1WN0 A;  5E2Q A;  2NSG A;  1LM3 B;  1HMO A;  1ZHY A;  4P9F A;  4PJM A;  3BRJ A;  2G62 A;  4BJ1 A;  2NUT A;  1QZX A;  2R7Q A;  2XL8 A;  1C02 A;  3ABK C;  3HTK C;  2KYH A;  4P6I C;  3RF3 A;  2RSE B;  4DVZ A;  4MVU A;  2VCB A;  3SYN A;  1Q0M A;  4BJ5 C;  4EKW A;  2Y3D A;  2RD9 A;  3H2V A;  5COM A;  4LER A;  1GGQ A;  5KYX B;  1G8X A;  2HFI A;  2UUH A;  2L7A A;  1W2W A;  2XM4 A;  1APC A;  1LE4 A;  2ZXP A;  3F46 A;  3GOD A;  4I44 A;  3ZSU A;  4W8K A;  1LVK A;  2AWC A;  2X0C A;  2A0U A;  3DAF A;  2R7V A;  5CI9 A;  4JEB A;  2XLD A;  2QNL A;  3JT1 A;  2GAQ A;  2NSF A;  4J7T A;  3SEO A;  2XLV A;  3G4X A;  4AE4 B;  5F28 E;  2Q00 A;  1SF8 A;  2A0B A;  4DVY P;  1DOW A;  1EQ1 A;  2I15 A;  4ULV A;  1YDI A;  1H7I A;  2ICW G;  1BR1 A;  3L1M A;  1O87 A;  2WVN A;  3HNL A;  4OIR F;  3BEH A;  1T6U A;  2J9V A;  3TK0 A;  3U3B A;  1HW2 A;  3EGD B;  2W45 A;  1J8Y F;  5D91 A;  5T1D B;  2Y69 C;  3HLZ A;  3MBG A;  3SXK A;  3H65 A;  3C8G A;  1M56 C;  2C03 A;  2L9J A;  1YLM A;  4JVS A;  5F5H A;  1GQA A;  2R05 A;  2P7V A;  1IZM A;  1ORS C;  4PJN A;  4NY3 A;  5L3V A;  5KYN A;  1QPU A;  1S7Z A;  4C3E A;  5TJ5 E;  1RKE A;  4U9D A;  3EFO A;  3O55 A;  4U5E E;  1M2V B;  1OKK A;  2PP4 A;  2I8B A;  2DGJ A;  2D4U A;  4C3D A;  3TJ5 A;  2CYD A;  2Q7R A;  4F4B A;  1YAU O;  3LNM B;  5DS6 A;  3K1H A;  3KPH A;  4ULW A;  2IOQ A;  2XXA B;  5HV9 A;  1B68 A;  3SXZ A;  4XPX A;  2XLH A;  4RD9 A;  3X1O A;  5A6B D;  4MTO A;  4IAR A;  4WJ0 A;  4ER9 A;  1WAT A;  4YL3 A;  1U89 A;  4U5G A;  3L34 A;  3KMI A;  2LP4 A;  2XS8 A;  4KC9 A;  2WVQ A;  2NUP B;  2Y3H A;  1JR8 A;  2R25 A;  3PMR A;  3ZQV A;  4EWC A;  4LDK A;  1I4Y A;  2NG1 A;  3DM5 A;  5EK0 A;  3ZWI A;  4DRH B;  3IQT A;  2YEV A;  3PDM P;  1PD1 A;  4E7S A;  4G7O F;  2KNH A;  4MVR A;  4Z9H A;  3S0X A;  3T6J A;  1S05 A;  3FXH A;  3CZ6 A;  3WOD F;  3F47 A;  3LEV A;  4O6M A;  5L0G A;  3IEE A;  3US6 A;  2CW0 F;  2QY9 A;  1FFT C;  1TR2 A;  4JTD B;  3FDQ A;  3TQO A;  4D4X A;  2IXM A;  2E87 A;  4JZA A;  3NKE A;  4JCZ A;  1ZHT A;  3U9M A;  4CS9 A;  1KTM A;  4JJG A;  3QW1 A;  1D0Z A;  3C8G D;  1OW8 A;  3QZC A;  4ONS A;  3NRH A;  4OIP F;  4OD5 A;  3NMK A;  4HFK B;  4PR9 A;  5KYW A;  4H54 A;  1FMW A;  3G50 A;  4WGY A;  2W4B A;  5KYY A;  1MMD A;  5COF A;  2DI3 A;  2EPL X;  1AUE A;  2OEV A;  1T5O A;  3EHM A;  4E17 A;  4I1O B;  2EIM C;  3RKO F;  2HZ8 A;  1SZI A;  3V5Y A;  4CIH A;  5KYX A;  2JPU A;  1WWP A;  2R7R A;  1FTS A;  3T9O A;  3KL4 A;  1L3P A;  4O6N A;  1KNY A;  4I3M A;  5L0C A;  1ZW2 A;  3DD7 A;  2ZPA A;  1G4W R;  1LPE A;  1GM5 A;  2XSE A;  1LIH A;  2O9X A;  4CS8 A;  5A69 A;  3C18 A;  1YYJ A;  3GEE A;  5L0I A;  4XWJ A;  3V7O A;  3QTH A;  1TKN A;  4OIO F;  4A2N B;  3WAQ A;  3EJN A;  1UFB A;  2PNO A;  4JCH A;  2V3C C;  3FOP A;  3GM3 A;  3N2Z B;  4WGZ A;  4D4N A;  4CJO A;  5JT4 A;  3EGX B;  1YZC A;  1RCP A;  4DJ9 A;  1TWG A;  3FHD A;  3Q7L A;  3R7C A;  5BQI A;  5AGF A;  5K0I A;  4U5C E;  1V55 C;  3RIP A;  4PK4 A;  2OJE D;  2PX3 A;  2BC5 A;  4YK5 A;  5L0J A;  2P61 A;  1CPQ A;  3SXY A;  4IAQ A;  3JRT A;  1AVO B;  2WB7 A;  1Q0D A;  3IHU A;  2ETS A;  1OR3 A;  1V74 B;  2LK4 A;  2NUT B;  1HE1 A;  3FVY A;  2DYS C;  4JIO A;  2GWW A;  2A6H F;  4MS2 A;  4BJ5 A;  1AEP A;  2KGO A;  1LS1 A;  2HMQ A;  2QTV A;  2R7T A;  4O7G A;  3L8J A;  4CSA C;  3EHN A;  1G4U S;  5T3W A;  4GYT A;  4NTB A;  1HW1 A;  5KYU B;  1RJ9 B;  2J46 A;  4W8P A;  4J7Y A;  4G7Z F;  2CGE A;  3B0V C;  1T6Q A;  2OQM A;  3RQG A;  1VTM P;  2CDQ A;  4LDR A;  5L0D A;  1BR4 A;  2OEX A;  3K6B A;  3DAG A;  3GOR A;  1Z23 A;  4K0D A;  4XEV A;  4CIP A;  3AJM A;  1KU2 A;  1Y6D A;  4CX9 A;  2VCC A;  2KK1 A;  4IRU A;  5DS4 A;  2FGY A;  4MVO A;  4FAP B;  1OW7 A;  4A4A A;  5A6B A;  1VLS A;  3B0U X;  5D92 A;  4CJG A;  5FZT A;  3TOL A;  2GDC A;  3W2V A;  1M6T A;  4LLE A;  3RVY A;  4E18 A;  4IGG A;  3MLG A;  3SNH A;  1JRA A;  4LAC B;  3UMI A;  1D1C A;  2JD3 A;  4UDV A;  3QVZ A;  1HMD A;  5JP7 A;  5B3S C;  2DYR C;  2XLO A;  1ZU5 A;  2M4E A;  2G3K A;  4JKV A;  3U2M A;  3HNI A;  1NBB A;  4BEJ A;  4XEK A;  3N0T A;  3O10 A;  2OKU A;  2YL0 A;  3EH2 A;  3K7D A;  3A9C A;  2XL4 A;  1ORJ A;  1YA9 A;  2EIL C;  4DRJ B;  3DI5 A;  4G78 A;  2IXO A;  3FAP B;  2CNW D;  3H2U A;  3L0I A;  3R2P A;  3O6X A;  3C8G B;  5KYY B;  1A7V A;  1NG1 A;  3NYM A;  3TD7 A;  4CS9 C;  2YRF A;  3S84 A;  2R7X A;  3C8Z A;  3DJU B;  2ZXO A;  3SXM A;  1SYQ A;  3IPM O;  3ZTM A;  2PBE A;  1TQG A;  3MFN A;  3OWT A;  3B0P A;  1HY5 A;  4GQH A;  4J30 B;  4NCQ A;  4XPY A;  1XWJ A;  3T4R A;  4KI2 A;  1XZP A;  3LJB A;  2M64 A;  3V5Z A;  4CS8 C;  1OCC C;  2XXA A;  3M15 A;  3EQL F;  1C03 A;  2YVK A;  1ZZP A;  3E9V A;  1VLT A;  3K66 A;  4XEF A;  2R7W A;  3U2L A;  2V26 A;  3NYL A;  2UUI A;  2XLW A;  2EIK C;  3EPV A;  1DOV A;  4N06 A;  4BJT A;  5F5F A;  3AG2 C;  3I5Q A;  4U9E A;  2XLM A;  2YL1 A;  5GPG B;  4NC3 A;  5BUO A;  3DWW A;  5E33 A;  2KQ9 A;  4YT4 A;  3U0C A;  2J45 A;  3A11 A;  3ABL C;  3AG4 C;  2IXP A;  1ZU4 A;  4XTK A;  4YN0 B;  2L81 A;  4MND A;  1OW6 A;  4R32 A;  4IWB A;  2PX0 A;  2R03 A;  3GWN A;  5HSW A;  2DB4 A;  3RQF A;  4LDQ A;  5AC5 A;  1ZHX A;  2EPK X;  1JMW A;  3FOO A;  3GEH A;  1JAF A;  3DMD A;  1H9G A;  3KH2 A;  4J32 B;  4WAB A;  4PJJ A;  2EIJ C;  3JYH A;  2AU5 A;  3VAY A;  2B0J A;  3JYY A;  1OQC A;  3U8P A;  2WZG A;  2GFH A;  3DJN B;  5EHH A;  4FES A;  3TUL A;  2VCA A;  4HE8 D;  2IXN A;  4P9T A;  3N24 A;  2XLE A;  3GEI A;  4C3B A;  1TWA A;  4RDA A;  1ORY A;  3U5S A;  4M63 A;  3UNG C;  1FMV A;  2NUP A;  2HV6 A;  5KYU A;  1WGW A;  1BZ4 A;  1TFK B;  2MHR A;  3DE9 A;  3PCV A;  2QUP A;  1OR2 A;  2MYS A;  2AP3 A;  2WVO A;  3TJ6 A;  4Q4Z F;  2TMV P;  2JX0 A;  3GM2 A;  2QLA A;  3RFY A;  1QLE C;  4KNW A;  3FAJ A;  3AGT A;  1VMA A;  1RMV A;  4C7O A;  3L8I A;  3TOM A;  1V4A A;  1CGO A;  5CI8 A;  1L7C A;  4EBK A;  1Z7Q c;  4XQ1 A;  1I5N A;  2J7P A;  1K05 A;  1YAR O;  1UG7 A;  2R7S A;  1SR2 A;  1A7E A;  1ZHW A;  2XS1 A;  3CSK A;  3AG3 C;  1K40 A;  1VK5 A;  2KJG A;  3EH1 A;  4Q5S F;  4JEA A;  1OCR C;  1T01 A;  2J9B A;  4U5D E;  3U8V A;  2Q4F A;  1K04 A;  3W8I A;  1MMN A;  2VC9 A;  4K1O A;  4EUK B;  2EPN A;  3EZI A;  1LI7 A;  2YWA A;  4JTA B;  5A6J A;  1PCX A;  3V5X A;  1MMA A;  1RKE B;  3I4U A;  4N6C A;  2H7B A;  1ZYR F;  3JSZ A;  4AL1 A;  3C62 A;  5CIV A;  3O39 A;  1LI5 A;  3KYI A;  3B71 A;  2LSE A;  2Y3B A;  3M4B A;  2A1D D;  4U5F E;  2J7P D;  2HJ3 A;  1J8M F;  1D1A A;  1F1M A;  2VB6 A;  2X51 A;  5DQT A;  1Q0G A;  4BEM J;  3Q6N A;  3AG1 C;  2CCY A;  1R5I D;  2ASR A;  3AQB A;  3AQC A;  1U6H A;  1E2X A;  3DZA A;  2KW3 C;  3UGP A;  3W2W A;  2J8W A;  4YL1 A;  4BG0 A;  3G4Z A;  4OIN F;  1H9T A;  2A68 F;  3NYJ A;  2L6F A;  3ABM C;  2LIG A;  4JRZ A;  5BQH A;  1NFN A;  2W4M A;  4NQF A;  3WG7 C;  3M79 A;  2B0H A;  4MVZ A;  1GS9 A;  2EPM X;  3JRM O;  1G5Z A;  3QVY A;  2IM8 A;  1E83 A;  3ASN C;  1FR0 A;  1H6G A;  4IAO A;  2C04 A;  3AOU A;  3POV A;  2P0N A;  1MQV A;  2L6H A;  1E85 A;  5JVE A;  2FAP B;  2W9Y A;  3VRC A;  3RW0 A;  4DXW A;  4JJF A;  1OKK D;  1JPJ A;  3NKD A;  4DOZ A;  2G3V A;  2XL6 A;  4QDL A;  3X2Q C;  2XM0 A;  3EZH A;  3ZVR A;  3K1I A;  3JSE O;  1QSP A;  3DE8 A;  1NZE A;  4N4W A;  4MTF A;  2HV7 A;  3B29 A;  3HNK A;  3RQE A;  2EPO A;  3LEO A;  4MW3 A;  5JSL A;  1JOG A;  3LES A;  5B3I A;  2XRH A;  1BDJ B;  4MTG A;  2R7O A;  5L0H A;  2PFD A;  3AGU A;  4Z9I A;  4PFO A;  3RH3 A;  1WTY A;  1QQ3 A;  2HSB A;  3VM6 A;  4Q7C A;  5DQZ A;  3M4C A;  3ATP A;  1R4T A;  3NMI A;  1ZW3 A;  4HFF B;  3JZ0 A;  3ITF A;  4EBB A;  1V54 C;  3ZTZ A;  5A6A A;  4X0R A;  5DS5 A;  4YT8 A;  4K7B A;  4Z9J A;  2YLI A;  4CDV A;  1EI7 A;  1QKR A;  3K1I C;  3WHN A;  2Q9C A;  4AX2 A;  4L6R A;  1A41 A;  4E0I A;  4H4K C;  3GWL A;  1TWC A;  4JE9 A;  1YZA A;  1Z6A A;  2KSF A;  4G7H F;  1Y4C A;  4JUR I;  2PF4 E;  256B A;  4MVS A;  5B1A C;  4ZLD A;  1PV3 A;  3RVZ A;  1ZHZ A;  2OJQ A;  4G0H A;  4MQ9 F;  4MVM A;  2H8A A;  2D5R B;  1BR2 A;  2BL2 A;  5DLJ A;  4RBN A;  4FWV A;  2KC3 A;  4DBQ A;  2P6V A;  5E3A A;  4CBE A;  4HEA J;  1N1C A;  1EA8 A;  4O6Y A;  1LS4 A;  3CQZ A;  4AE4 A;  1SMY F;  1OCZ C;  3IQ6 A;  4ANJ A;  4B6I A;  4QI2 A;  1O5H A;  4KBL A;  2HKV A;  1Q0F A;  1CGN A;  1BBH A;  3K33 A;  3S90 A;  1JPN A;  1FFH A;  2H7O A;  2OG2 A;  5T3T A;  4C7O B;  2OU6 A;  3C7J A;  1VYK A;  5JUA A;  5EGY A;  4FX5 A;  2Z15 A;  3FMS A;  1NLX A;  4JTC B;  3Q6M A;  3EGX A;  4NTF A;  1Z3I X;  3LUT B;  1M57 C;  2LFD A;  4O79 A;  1Q0K A;  5COG A;  1LE2 A;  2LQG A;  1NSG B;  1RKC A;  2GA0 A;  1D1B A;  3IQC A;  3ZQY A;  4EIY A;  3UMK A;  1VOM A;  2AVK A;  2YKZ A;  1ZVZ A;  1MMG A;  3SP1 A;  3W8H A;  3KYJ A;  1A0B A;  1O3U A;  1VYI A;  3UR3 C;  4OIQ F;  3EG9 A;  3DXJ F;  4CS7 A;  2VAS A;  1OXK A;  1A7D A;  2YZS A;  4N6H A;  1YYX A;  4QI0 A;  1FNT c;  4PFP A;  1RJ9 A;  3CEX A;  2NPU A;  3MYF A;  3SZR A;  1LKX A;  4U5H A;  3LAY A;  2YL7 A;  3Q7G A;  4CSA A;  4BPM A;  3U9J A;  3U3F A;  3NDB B;  2P1A A;  3HNJ A;  2LCH A;  5B1B C;  2YQY A;  4EBJ A;  3DKA A;  3IQ5 A;  4OD4 A;  4AL0 A;  3UGO A;  1T6I A;  4JC7 A;  3HKK A;  2Y3G A;  1TWH A;  3C63 A;  2YLD A;  5L3Q A;  5DVW A;  3OEO A;  3MX3 A;  4XLP F;  3NMJ A;  1C17 M;  2A69 F;  2HSQ A;  2MWQ A;  1U0B B;  2ZXR A;  5KYW B;  2HUJ A;  2WL8 A;  3S9O A;  3UMH A;  3S29 A;  3MYI A;  1XZQ A;  1YA7 O;  2HJM A;  3LNR A;  2H7V C;  2Y39 A;  4BJ6 C;  4KNV A;  4YT5 A;  3T6G B;  3LLI A;  1OXB A;  5IY5 C;  4DBR A;  2OOC A;  1NU9 C;  3JTL O;  4IB4 A;  1ST6 A;  2Q9A A;  2ZD9 A;  3KKB A;  4BJ6 A;  1MND A;  3B9Q A;  3CAX A;  1M2V A;  4LLC A;  5BQG A;  3VYW A;  2IYL D;  4MW8 A;  5JRA A;  2WZL A;  4EHP A;  3GAN A;  2R02 A;  1EKY A;  4AK9 A;  3PHF 2;  2EIN C;  2Q9B A;  1NU7 D;  2F22 A;  2BE5 F;  3E70 C;  3VF0 A;  2HS5 A;  2LFF A;  3ZG1 A;  3J06 A;  1YVI A;  4XLN F;  1RXQ A;  4CDA A;  2ZXW C;  1E86 A;  3T6B A;  3W4Y A;  5FCL A;  4CDY A;  3QMK A;  4U5B E;  3ZIB A;  4GEH A;  2A6E F;  3ECS A;  3NG1 A;  4NTA A;  3DM9 B;  2YLG A;  3LS0 A;  4YT2 A;  2AWY A;  2Q3T A;  1I4Z A;  2L6G A;  2R9R B;  2OCC C;  1IW7 F;  3EGD A;  4I1M A;  4YL0 A;  2WZF A;  2YL3 A;  1T9K A;  5JLI A; 
#chains in the Genus database with same CATH homology
 2J9U A;  3S27 A;  4ZLC A;  4E7Z A;  2J0W A;  2FFH A;  1PD0 A;  3LLK A;  3EFO B;  2J9W A;  3JCU Q;  3EG9 B;  4PJL A;  3RYL A;  4YWQ A;  1M2O A;  3LS1 A;  2YHS A;  3ASO C;  3I5P A;  2CNW A;  4YJW A;  4IJJ A;  2VH3 A;  2R7U A;  1OCO C;  3OA1 A;  3ZC4 A;  1D0Y A;  4JW1 A;  3S28 A;  3HJC A;  3M1C B;  1MNE A;  1Z63 A;  5E3C A;  1D0X A;  2J0X A;  1Z5Z A;  5E2Q A;  1ZHY A;  4PJM A;  2G62 A;  4BJ1 A;  2NUT A;  1QZX A;  2R7Q A;  4P6I C;  3ABK C;  3HTK C;  4DVZ A;  3SYN A;  4BJ5 C;  2Y3D A;  4LER A;  5KYX B;  1G8X A;  1W2W A;  3ZSU A;  2ZXP A;  3F46 A;  3GOD A;  4I44 A;  4W8K A;  1LVK A;  3DAF A;  2R7V A;  5CI9 A;  3JT1 A;  3SEO A;  4AE4 B;  1SF8 A;  4DVY P;  1BR1 A;  1O87 A;  2WVN A;  4OIR F;  2J9V A;  3EGD B;  2W45 A;  1J8Y F;  5D91 A;  5T1D B;  2Y69 C;  3HLZ A;  3H65 A;  1M56 C;  2C03 A;  2L9J A;  4JVS A;  5F5H A;  4PJN A;  2P7V A;  1IZM A;  5L3V A;  4NY3 A;  5KYN A;  1S7Z A;  4C3E A;  3EFO A;  4U5E E;  1M2V B;  1OKK A;  2PP4 A;  2I8B A;  2DGJ A;  4C3D A;  4F4B A;  5DS6 A;  3K1H A;  4ULW A;  2XXA B;  2IOQ A;  4RD9 A;  3X1O A;  4WJ0 A;  4U5G A;  3L34 A;  3KMI A;  4KC9 A;  2WVQ A;  2NUP B;  2Y3H A;  3PMR A;  4EWC A;  2NG1 A;  3DM5 A;  2YEV A;  1PD1 A;  4E7S A;  4G7O F;  2KNH A;  3S0X A;  3T6J A;  3WOD F;  3CZ6 A;  3F47 A;  3LEV A;  4O6M A;  3IEE A;  2CW0 F;  2QY9 A;  1FFT C;  1TR2 A;  3FDQ A;  2IXM A;  2E87 A;  4JZA A;  3NKE A;  1ZHT A;  4CS9 A;  4JJG A;  1D0Z A;  3QZC A;  3NRH A;  4OIP F;  4OD5 A;  4HFK B;  5KYW A;  1FMW A;  2W4B A;  5KYY A;  1MMD A;  3EHM A;  4I1O B;  2EIM C;  3RKO F;  1SZI A;  4CIH A;  5KYX A;  2R7R A;  1FTS A;  3KL4 A;  4O6N A;  4I3M A;  3DD7 A;  2ZPA A;  2XSE A;  2O9X A;  4CS8 A;  4XWJ A;  3V7O A;  1TKN A;  4OIO F;  4A2N B;  2V3C C;  3EJN A;  4JCH A;  3N2Z B;  3EGX B;  1TWG A;  3FHD A;  3Q7L A;  4U5C E;  1V55 C;  3RIP A;  4PK4 A;  2PX3 A;  3JRT A;  2WB7 A;  2NUT B;  3FVY A;  2DYS C;  2A6H F;  4BJ5 A;  2KGO A;  1LS1 A;  2R7T A;  2QTV A;  4O7G A;  4CSA C;  3EHN A;  5T3W A;  4GYT A;  5KYU B;  1RJ9 B;  2J46 A;  4G7Z F;  3B0V C;  2CGE A;  2CDQ A;  1BR4 A;  3K6B A;  3DAG A;  1Z23 A;  4K0D A;  1KU2 A;  4IRU A;  5DS4 A;  2FGY A;  3B0U X;  5D92 A;  3W2V A;  4LLE A;  3MLG A;  3SNH A;  4LAC B;  3UMI A;  1D1C A;  2JD3 A;  5B3S C;  2DYR C;  1ZU5 A;  2M4E A;  2G3K A;  4BEJ A;  3N0T A;  3EH2 A;  3K7D A;  2XL4 A;  2EIL C;  2IXO A;  3L0I A;  2CNW D;  5KYY B;  3O6X A;  1NG1 A;  3NYM A;  3TD7 A;  4CS9 C;  2R7X A;  3DJU B;  2ZXO A;  4Q5S F;  3OWT A;  4J30 B;  3B0P A;  3T4R A;  4KI2 A;  3LJB A;  4CS8 C;  1OCC C;  2XXA A;  3EQL F;  3E9V A;  3K66 A;  2R7W A;  2V26 A;  3NYL A;  4N06 A;  5F5F A;  2EIK C;  3EPV A;  4BJT A;  3AG2 C;  3I5Q A;  5BUO A;  5E33 A;  2KQ9 A;  4YT4 A;  2J45 A;  3ABL C;  3AG4 C;  2IXP A;  1ZU4 A;  4XTK A;  4YN0 B;  2L81 A;  4MND A;  4IWB A;  2PX0 A;  5HSW A;  1ZHX A;  4J32 B;  3DMD A;  3KH2 A;  4PJJ A;  2EIJ C;  3JYH A;  3VAY A;  2B0J A;  2WZG A;  2GFH A;  3DJN B;  5EHH A;  4FES A;  4HE8 D;  2IXN A;  3N24 A;  4C3B A;  1TWA A;  4RDA A;  3UNG C;  4M63 A;  1FMV A;  2NUP A;  2HV6 A;  5KYU A;  1WGW A;  2WVO A;  2MYS A;  4Q4Z F;  3RFY A;  1QLE C;  4KNW A;  3FAJ A;  1VMA A;  4C7O A;  5CI8 A;  2J7P A;  1ZHW A;  3CSK A;  3AG3 C;  1VK5 A;  2KJG A;  3EH1 A;  1OCR C;  4U5D E;  3W8I A;  1MMN A;  3EZI A;  1PCX A;  1MMA A;  3I4U A;  2H7B A;  1ZYR F;  3JSZ A;  3O39 A;  2Y3B A;  2LSE A;  2A1D D;  4U5F E;  2J7P D;  1J8M F;  1D1A A;  2VB6 A;  2X51 A;  5DQT A;  3Q6N A;  3AG1 C;  3AQB A;  3DZA A;  3W8H A;  3UGP A;  3AQC A;  2KW3 C;  3W2W A;  4BG0 A;  4OIN F;  2A68 F;  3NYJ A;  3ABM C;  2W4M A;  3WG7 C;  3ASN C;  4IAO A;  2C04 A;  3POV A;  2W9Y A;  4JJF A;  1OKK D;  1JPJ A;  3NKD A;  4DOZ A;  2G3V A;  3X2Q C;  4QDL A;  3ZVR A;  3EZH A;  1NZE A;  2HV7 A;  3LES A;  2XRH A;  2R7O A;  2PFD A;  4PFO A;  3RH3 A;  4Q7C A;  5DQZ A;  4HFF B;  3ITF A;  4EBB A;  1V54 C;  5DS5 A;  4X0R A;  4YT8 A;  4K7B A;  3K1I C;  2Q9C A;  4AX2 A;  4H4K C;  1TWC A;  1Z6A A;  4G7H F;  4ZLD A;  4JUR I;  2PF4 E;  5B1A C;  1ZHZ A;  4G0H A;  4MQ9 F;  2D5R B;  1BR2 A;  5DLJ A;  4RBN A;  4FWV A;  4DBQ A;  2P6V A;  5E3A A;  4CBE A;  4HEA J;  1N1C A;  4O6Y A;  3CQZ A;  4AE4 A;  1SMY F;  1OCZ C;  4ANJ A;  4B6I A;  4QI2 A;  1O5H A;  4KBL A;  3K33 A;  1JPN A;  1FFH A;  2H7O A;  2OG2 A;  5T3T A;  4C7O B;  1VYK A;  5EGY A;  4FX5 A;  2Z15 A;  3Q6M A;  3EGX A;  1Z3I X;  1M57 C;  4O79 A;  1D1B A;  3UMK A;  1VOM A;  1MMG A;  3SP1 A;  3UR3 C;  1VYI A;  4OIQ F;  3EG9 A;  3DXJ F;  4CS7 A;  2VAS A;  2YZS A;  4QI0 A;  4PFP A;  1RJ9 A;  3SZR A;  1LKX A;  4U5H A;  3LAY A;  3Q7G A;  4CSA A;  3NDB B;  5B1B C;  4OD4 A;  3UGO A;  2Y3G A;  1TWH A;  5L3Q A;  5DVW A;  3OEO A;  3MX3 A;  4XLP F;  2A69 F;  2MWQ A;  2ZXR A;  5KYW B;  2WL8 A;  3UMH A;  3S29 A;  3LNR A;  4BJ6 C;  2H7V C;  2Y39 A;  4KNV A;  4YT5 A;  3LLI A;  5IY5 C;  4DBR A;  1NU9 C;  1ST6 A;  2Q9A A;  3KKB A;  4BJ6 A;  1MND A;  3B9Q A;  1M2V A;  4LLC A;  3VYW A;  2R7S A;  2IYL D;  2WZL A;  3GAN A;  4AK9 A;  3PHF 2;  2EIN C;  2Q9B A;  1NU7 D;  2BE5 F;  3E70 C;  3ZG1 A;  4XLN F;  2ZXW C;  3T6B A;  5FCL A;  3QMK A;  4U5B E;  3ZIB A;  4GEH A;  2A6E F;  3ECS A;  3NG1 A;  3DM9 B;  3LS0 A;  4YT2 A;  2Q3T A;  2OCC C;  1IW7 F;  3EGD A;  4I1M A;  2WZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...