2VH3A

Ranasmurfin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
112
structure length
110
Chain Sequence
AACSFPPSEIPGSKECLAEALQKHQGFKKKSYALICAYLNYKEDAENYERAAEDFDSAVKCTGCKEGVDLHEGNPELIEEGFEKFLASLKIDRKALGSLCTLFQKLAIPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual Chromophore and Cross-Links in Ranasmurfin: A Blue Protein from the Foam Nests of a Tropical Frog.
pubmed doi rcsb
molecule tags Unknown function
molecule keywords RANASMURFIN
total genus 36
structure length 110
sequence length 112
ec nomenclature
pdb deposition date 2007-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1410 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2vh3A00
2VH3A
chains in the Genus database with same CATH superfamily
5D91A 3HNKA 2ASRA 5AC5A 2M4EA 3TULA 3MLGA 3GEHA 3S90A 3GANA 3ASOC 2ZXOA 1T6IA 3O10A 3B0UX 1YDIA 3FAPB 5JS5A 4AL0A 2GFHA 2L7AA 1LI5A 2XLMA 4P9FA 5GPGB 5DQZA 4ZLCA 3NDBB 2Q00A 2XLVA 4J30B 1J8YF 1HMDA 1NBBA 4Z9IA 5BUOA 3ZQYA 4PACA 3CAXA 5F5FA 3RYLA 3TQOA 1TFKB 3NRHA 1WOLA 2NSFA 4HE8D 4JURI 3QVZA 4PFOA 2J7PA 1TQGA 1WASA 2P1AA 1AEPA 3KYIA 1D0YA 2QUPA 1M2VB 3K6BA 1LPEA 1IW7F 2ZPAA 1MMDA 3JSEO 5E3AA 4G7HF 3DM5A 4A2NB 4AK9A 5L0IA 2EIMC 2WB7A 3T6BA 3DWWA 2YLIA 5HSWA 4YL0A 3IQCA 4DOZA 3S28A 2HSBA 256BA 1I5NA 2L6FA 5L0DA 2H7BA 1Q0KA 3JRMO 3DJUB 1WGWA 3J06A 3U9MA 1VK5A 4JE9A 3DM9B 4E7ZA 1PD1A 5D92A 4CIHA 3I4UA 2R7TA 3IQ5A 4YWQA 2W9YA 1SMYF 2VH3A 4KC9A 1OCOC 3QW1A 4CS7A 3SNHA 3V7OA 2PX0A 1S05A 4GYTA 5KYNA 2ETSA 3QVYA 4IAQA 4JCHA 4HFKB 5CI9A 4YN0B 4LLEA 3UNGC 3TOLA 2H8AA 5COGA 5T3WA 3U3BA 3ZQVA 3Q6NA 2HV6A 3JCUQ 4NTBA 3SP1A 4YT8A 4EBJA 5DS4A 3EHNA 2QY9A 4JCZA 4LERA 4IGGA 3FOOA 3DD7A 1E85A 3U2MA 3M1CB 2C04A 1N1CA 3ITFA 3JYHA 4AE4B 5A6AA 1RKEA 3EFOB 2HFIA 1M2VA 1HW2A 1Q0DA 1C02A 2CGEA 2HUJA 4OIPF 2HSQA 4C7OB 4YJWA 3W8HA 2YVKA 1Z7Qc 2R7SA 4PJMA 3IQTA 3E9VA 3L1MA 3K33A 3R7CA 1CPQA 5KYYA 2HV7A 3Q6MA 3O39A 4XEFA 3NG1A 1QZXA 5B3SC 5L0JA 3AJMA 4MS2A 1UG7A 1YAUO 3ZTZA 4XLPF 2XM0A 3N0TA 3UGPA 4AX2A 3DZAA 4OIOF 5FCLA 1T01A 2ZXRA 4PJNA 5COFA 2DI3A 4DVYP 1VYIA 5JLIA 4N06A 4JJGA 1MNDA 1NU7D 2C03A 2IBFA 2PP4A 4B6IA 2Q9CA 3S9OA 2EPOA 2F22A 3EGDB 4NTFA 3EG9A 4NTAA 3GM3A 3IHUA 3F46A 1Q0GA 3ZTMA 2KW3C 3JT1A 1YARO 3VAYA 1O5HA 2YEVA 2EIJC 2AP3A 2L6GA 2WZGA 3VM6A 3LJBA 4K1OA 5A6BD 2R7QA 2KQ9A 3BEHA 3G4ZA 1Q0MA 4KI2A 3HNJA 1R4TA 2WL8A 3ZWIA 2EINC 3DAGA 1GS9A 2XM4A 3S27A 3ZG1A 4CS9C 5FZTA 5DLJA 4J7YA 2MWQA 2HJ3A 2Y39A 3KKBA 5COMA 3EZIA 2IXMA 4JIOA 1CGME 5F28E 1RKEB 4G7ZF 4YL3A 3ASNC 1H7IA 3UR3C 2A6EF 1V4AA 2CDQA 3PCVA 4MVQA 4QDLA 1Z6AA 3A11A 1A7VA 1L3PA 1NLXA 3AGTA 3M4CA 4EUKB 1I4ZA 1K40A 3ECSA 3TOMA 4NQFA 1ZYRF 1V54C 1L7CA 1OW6A 2ICWG 5BQGA 4DXWA 1FMVA 4I1MA 4M63A 4IB4A 2KC3A 2CNWA 2Q9AA 2VCAA 2HZ8A 2L6HA 4MVMA 4ER9A 2XLOA 3U8VA 4IWBA 1QQ3A 4JVSA 2G62A 2YWAA 1V55C 4XWJA 5DVWA 3VF0A 3VRCA 3KPHA 4E0HA 3GWNA 1ZVZA 4XEVA 3HLZA 2XRHA 1FR0A 2RD9A 1MMGA 2YZSA 2IOQA 5DQTA 2RSEB 3H2UA 2UUHA 4H54A 4MVOA 1NSGB 2Z15A 4U5BE 4Z9JA 5EK0A 1FMWA 3DKAA 4XTKA 1D0XA 5JVEA 3X1OA 1FAPB 5JUAA 4IARA 2IXNA 3ATPA 2OQMA 3PDMP 4FX5A 1EKYA 3EQLF 1EA8A 1B68A 2IXPA 2VC9A 3NMIA 4GEHA 4DBRA 2J45A 4DRHB 1JPNA 2KJGA 5HV9A 4JEBA 2W4MA 3SXKA 4JEAA 2XL8A 3LEVA 2R03A 4MW8A 4BJ5A 5KYXB 1T6UA 1I4YA 1ZU5A 3EFOA 3LUTB 1Q0FA 4FWVA 3K1IC 3GEEA 4ULWA 1J8MF 3TJ5A 1PCXA 3EJNA 4JJFA 2KNHA 1BBHA 4X0RA 4YT5A 2XS8A 3U5SA 5CIVA 1QKRA 1TWAA 1GM5A 2HMZA 2WVQA 3WAQA 3KL4A 1WATA 3B0PA 1OW8A 2L81A 1VOMA 4YK5A 3NYMA 4XPYA 4WJ0A 2XXAA 1ZU4A 3H65A 2J9WA 1CPRA 1EI7A 1JPJA 4OD4A 5KYUA 2J9BA 3U9JA 1G4WR 5A69A 1ORJA 3M4BA 3HNIA 2NUPB 3DAFA 3IQ6A 4CS8C 4G7OF 3C8GD 3LNMB 1YYJA 3U8PA 3W2WA 4CX9A 3OWTA 1BR4A 1TWHA 1LI7A 2DYSC 1VLTA 2A68F 2OKUA 3C8ZA 3RIPA 3RKOF 1ZHWA 2D5RB 2AWYA 3GODA 2Y3DA 5DS6A 3K1HA 4MVSA 3UMKA 2XLEA 4IAOA 5JSLA 3DJNB 3H2VA 3Q7GA 1ZZPA 2LP4A 4G0HA 1HE1A 5A6JA 2XS1A 3EPVA 1JAFA 1YVIA 4MTGA 4RDAA 3RH3A 1G5ZA 5F5HA 4XLNF 2J46A 1NG1A 4I1OB 3ZIBA 1EQ1A 3N2ZB 3US6A 1NU9C 3C62A 5L3VA 2G3VA 3ZSUA 5KYWA 2XL4A 4BEMJ 5KYXA 2LIGA 2LQGA 1YLMA 1DOVA 4MVUA 3FXHA 1ORSC 4IJJA 3T9OA 2OU6A 3E70C 1FFHA 2BC5A 2LSEA 3JTLO 3KMIA 5KYWB 4EBBA 1JRAA 5KYUB 2WVNA 4W8KA 3ABMC 1D1AA 3LLKA 2TMVP 4LLCA 1A7EA 1XZPA 1BZ4A 4XPWA 2PF4E 4JTCB 4A4AA 2P7VA 2JD3A 1G8XA 2B0JA 1RMVA 1VLSA 2B0HA 1D0ZA 4XEKA 4CS8A 5JT4A 4JTAB 3JYYA 3NMKA 4CSAC 4C3DA 4AE4A 3VYWA 4BPMA 1ST6A 2CCYA 3JSZA 3C18A 4N6HA 1Z23A 4U5EE 3OEOA 1LKXA 3HJCA 3WHNA 3AG2C 1UFBA 3GWLA 5IY5C 1YZAA 5KYYB 1TR2A 4MVZA 1RKCA 3GM2A 3L8JA 1SF8A 3WG7C 1QLEC 2NUPA 3RW0A 1M2OA 1Z5ZA 4YL1A 1GQAA 1RJ9B 1ZHYA 3C63A 3EH1A 1E83A 2Q7RA 1NFOA 3MBGA 2H7OA 3EH2A 1V74B 4ULVA 2Y3BA 5E2QA 1HY5A 1ZHZA 4O6NA 2W4BA 2EPNA 2R7OA 3O55A 1MNEA 2VASA 3G50A 3L34A 3LS0A 1RCPA 2WVOA 1SR2A 2NG1A 1ZHTA 3AQBA 4LACB 4ONSA 4XQ1A 3EHMA 3RVZA 1M56C 3PHF2 3FOPA 2GDCA 3POVA 1SYQA 2W45A 1A41A 3F47A 1AVOB 3AG4C 3NYLA 4ZLDA 2D4UA 3QZCA 3L8IA 5B1BC 2YLDA 1FTSA 2YLGA 4N6CA 2R7XA 3FHDA 2OCCC 4LDRA 1LIHA 3DI5A 3JZ0A 1PV3A 3OA1A 3NKEA 2LK4A 4BJTA 2R7VA 1G4US 5K0IA 3UMHA 5E33A 1OKKA 3NKDA 1MQVA 2IXOA 2J7PD 2P6VA 4OIRF 3FDQA 1Y6DA 4EKWA 4F4BA 2XSEA 3W2VA 4JZAA 4AL1A 1BR2A 1Y4CA 2J0XA 2X0CA 3CSKA 3DMDA 5JRAA 4XPXA 2OJED 4U9DA 3X2QC 1QVXA 1KTMA 2A6HF 5T1DB 4Q7CA 4QI0A 4EIYA 4Q5SF 2YL1A 1D1BA 3A9CA 2OJQA 3AQCA 3O6XA 4RD9A 3W8IA 2UUIA 1LVKA 5JP7A 3UGOA 1O87A 3FVYA 4H4KC 2L9JA 1LM3B 4U5FE 2YRFA 4G78A 4OD5A 1RJ9A 2NUTB 2XLHA 2VCBA 2KYHA 3V5YA 4BJ6A 1XWJA 1W2WA 1WWPA 4O79A 3V5XA 2ZD9A 1RXQA 2EIKC 3LESA 3MX3A 4D4XA 2V3CC 2VCCA 3M79A 5B3IA 4J32B 1U0BB 3T6JA 1OKKD 2R05A 4MQ9F 4BEJA 3ZDLA 3B29A 2QTVA 4LDQA 4MVRA 2AU5A 4JTDB 3RQFA 4C3BA 2Y3HA 3RQEA 5EGYA 2YL7A 4E0IA 1CGNA 5L0HA 1HW1A 3KH2A 4FAPB 2PX3A 1WTYA 4CIPA 4BJ6C 1TFOB 4C7OA 2QNLA 1FFTC 2R7UA 1MMAA 4E18A 2O9XA 2X51A 4EBKA 1LS1A 1BR1A 4P6IC 2FFHA 2WZLA 4PJLA 4DVZA 3RF3A 4D4NA 3GORA 1MMNA 1YJGA 3GM1A 4PR9A 5A6KA 2KSFA 4YT2A 3T6GB 4KNWA 4EHPA 2J9UA 5L0GA 2PFDA 2A0BA 1YA9A 1E2XA 2CNWD 4JC7A 1K04A 3PMRA 1E86A 1TKNA 2ZXPA 1D1CA 2MHRA 1H9GA 3I5PA 4MTOA 4CS9A 2BL2A 4QI2A 1VMAA 2NUTA 4CBEA 2GWWA 1C17M 1U6HA 2XL6A 5L3QA 4K7BA 4KNVA 4MW3A 4OIQF 4PJJA 3LEOA 1OR2A 4N4WA 4I3MA 5TJ5E 4R32A 4FESA 1OW7A 1K05A 4JKVA 1APCA 1JMWA 5E3CA 3EGDA 2G3KA 1NFNA 1VYKA 3CZ6A 1DOWA 3HTKC 4Z9HA 1ZW2A 4HFFB 4DJ9A 2GAQA 2J0WA 2CYDA 3M15A 3I5QA 4YT4A 3U0CA 1PD0A 3HNLA 4EWCA 2YQYA 1H9TA 4ANJA 2R9RB 1GGQA 4U5HA 1TWGA 2YKZA 2PNOA 2OOCA 4O6YA 3NMJA 2EILC 3K1IA 4U5CE 2VB6A 2J9VA 4NC3A 2Q3TA 1VTMP 2JX0A 1OR3A 2A69F 3BRJA 2XXAB 1WN0A 1FNTc 5DS5A 1LE4A 3RQGA 3MFNA 4CDAA 2HJMA 4PFPA 1M57C 3LAYA 3GEIA 4U5DE 2LCHA 3LS1A 4NY3A 4J7TA 5CI8A 2P0NA 4LDKA 4P9TA 3S84A 4I44A 5BQIA 2HS5A 3T4RA 2YHSA 2IYLD 4O7GA 3R2PA 4E7SA 3S29A 2NSGA 4CDYA 1M6TA 2OEXA 5AGFA 2QE9A 3SXMA 3WODF 2P61A 4DRIB 4CSAA 4WGYA 1OCRC 3ABKC 1ZHXA 1OXBA 3EGXA 4MTFA 1JOGA 3U2LA 1Z63A 2HMQA 2DB4A 5AC4A 4BG0A 1QPUA 1R5ID 2I8BA 2LD6A 4OINF 3FAJA 1S7ZA 3EGXB 4U5GA 1H6GA 1CGOA 2I15A 3LNRA 3AG3C 3C8GA 2Y3GA 1U89A 1YZCA 3G4XA 1E84A 1IZMA 4GQHA 2XLWA 2FGYA 2LFFA 3TK0A 2M64A 4K0DA 1NZEA 1SZIA 1T5OA 4U9EA 3DXJF 3U3FA 2V26A 1TWCA 3QW0A 2A0UA 2KK1A 1OQCA 1QSPA 1O3UA 1T9KA 2YL0A 3B9QA 2R25A 4WABA 4WGZA 3V5ZA 1T6QA 5T3TA 3UMIA 4O6MA 3K7DA 4CDVA 1XZQA 1ORYA 2XLDA 3Q7LA 4JW1A 2AWCA 2R02A 3ZVRA 2A1DD 3SYNA 2MYSA 2QLAA 5L0FA 3DE9A 3KYJA 5L0CA 4NCQA 3LLIA 3QTHA 3B0VC 2HKVA 1JR8A 1HMOA 2LFDA 1AUEA 3QMKA 4PK4A 3W4YA 3SEOA 4C3EA 3SXZA 4RBNA 3AOUA 2ZXWC 3IEEA 4L6RA 1ZW3A 3HKKA 3TJ6A 4DRJB 2R7RA 3N24A 2DYRC 3FMSA 5B1AC 3SXYA 3RFYA 1A0BA 3IPMO 3EZHA 4HEAJ 3AG1C 3MYFA 1OCCC 2WZFA 2KGOA 1LS4A 2EPKX 1A7DA 1KNYA 2Q4FA 2FAPB 2EPLX 3K66A 3AGUA 2DGJA 3ABLC 2NPUA 4CJGA 3JRTA 4MNDA 5BQHA 1OXKA 3B71A 2AVKA 3S0XA 2E87A 3NYJA 2IM8A 2JPUA 1Z3IX 1F1MA 2GA0A 2Y69C 4CJOA 4DBQA 1YYXA 2R7WA 1KU2A 1C03A 1VB5A 1YA7O 2CW0F 1HE9A 2OG2A 2J8WA 3DE8A 3CQZA 3ZC4A 4E17A 5A6BA 3MYIA 3C8GB 4KBLA 3C7JA 2YL3A 2OEVA 4W8PA 1BDJB 1OCZC 4BJ5C 3TD7A 2BE5F 3RVYA 4IRUA 4BJ1A 4Q4ZF 3SZRA 3CEXA 4UDVA 3EG9B 4JRZA 1LE2A 2Q9BA 5EHHA 2H7VC 2EPMX 2PBEA 3L0IA
chains in the Genus database with same CATH topology
5D91A 2M4EA 3MLGA 3GANA 3ASOC 2ZXOA 3B0UX 2GFHA 4ZLCA 5DQZA 3NDBB 4J30B 1J8YF 5BUOA 5F5FA 3RYLA 3NRHA 4HE8D 4JURI 4PFOA 2J7PA 3LJBA 4CS7A 1D0YA 3K6BA 1M2VB 1IW7F 2ZPAA 1MMDA 5E3AA 4G7HF 3DM5A 4A2NB 4AK9A 2EIMC 2WB7A 3T6BA 5HSWA 4DOZA 3S28A 2H7BA 3DJUB 1WGWA 1VK5A 3DM9B 4E7ZA 1PD1A 5D92A 4CIHA 3I4UA 2R7TA 4YWQA 2W9YA 1SMYF 2VH3A 4KC9A 1OCOC 3SNHA 3V7OA 2PX0A 4GYTA 5KYNA 4JCHA 5CI9A 4YN0B 4HFKB 4LLEA 3UNGC 5T3WA 3Q6NA 2HV6A 3JCUQ 3SP1A 4YT8A 5DS4A 3EHNA 2QY9A 4LERA 3DD7A 3M1CB 2C04A 1N1CA 3ITFA 3JYHA 4AE4B 3EFOB 1M2VA 2CGEA 4OIPF 4C7OB 4YJWA 3W8HA 2R7SA 4PJMA 3E9VA 3K33A 5KYYA 2HV7A 3Q6MA 3O39A 3NG1A 1QZXA 5B3SC 4XLPF 3N0TA 3UGPA 4AX2A 3DZAA 4OIOF 5FCLA 2ZXRA 4PJNA 4DVYP 1VYIA 4N06A 4JJGA 1MNDA 1NU7D 2C03A 2PP4A 4B6IA 2Q9CA 3EGDB 3EG9A 3F46A 2KW3C 3JT1A 3VAYA 1O5HA 2YEVA 2EIJC 2WZGA 2R7QA 2KQ9A 4KI2A 2WL8A 2EINC 3DAGA 3S27A 3ZG1A 4CS9C 5DLJA 2MWQA 2Y39A 3KKBA 3EZIA 2IXMA 4G7ZF 3ASNC 3UR3C 2A6EF 2CDQA 4QDLA 1Z6AA 3ECSA 1ZYRF 1V54C 1FMVA 4I1MA 4M63A 2Q9AA 2CNWA 4IWBA 4JVSA 2G62A 5DVWA 1V55C 4XWJA 3HLZA 2XRHA 1MMGA 2YZSA 2IOQA 5DQTA 2Z15A 4U5BE 1FMWA 4XTKA 1D0XA 3X1OA 2IXNA 4FX5A 3EQLF 4GEHA 2IXPA 4DBRA 2J45A 1JPNA 2KJGA 2W4MA 3LEVA 4BJ5A 5KYXB 1ZU5A 3EFOA 4FWVA 3K1IC 4ULWA 1J8MF 1PCXA 3EJNA 4JJFA 2KNHA 4X0RA 4YT5A 1TWAA 2WVQA 3KL4A 3B0PA 2L81A 1VOMA 3NYMA 2XXAA 4WJ0A 1ZU4A 3H65A 2J9WA 4OD4A 1JPJA 5KYUA 2NUPB 3DAFA 4CS8C 4G7OF 3W2WA 3OWTA 1BR4A 1TWHA 2DYSC 4BEJA 5KYUB 2A68F 3RIPA 3RKOF 1ZHWA 2D5RB 3GODA 5DS6A 2Y3DA 3K1HA 3UMKA 4IAOA 3DJNB 3Q7GA 4G0HA 3EPVA 4RDAA 3RH3A 5F5HA 4XLNF 2J46A 1NG1A 4I1OB 3ZIBA 3N2ZB 1NU9C 5L3VA 2G3VA 3ZSUA 5KYWA 2XL4A 5KYXA 4IJJA 4CSAA 3E70C 1FFHA 2LSEA 3KMIA 5KYWB 4EBBA 2WVNA 4W8KA 3ABMC 1D1AA 3LLKA 4LLCA 2PF4E 2P7VA 2JD3A 1G8XA 2B0JA 1D0ZA 4CS8A 4CSAC 4C3DA 4AE4A 3VYWA 1ST6A 3JSZA 1Z23A 4U5EE 3OEOA 1LKXA 3HJCA 3AG2C 5IY5C 5KYYB 1TR2A 1SF8A 3WG7C 1QLEC 2NUPA 1M2OA 1Z5ZA 1ZHYA 1RJ9B 3EH1A 2H7OA 3EH2A 2Y3BA 5E2QA 1ZHZA 4O6NA 2W4BA 2R7OA 1MNEA 2VASA 3LS0A 3L34A 2WVOA 2NG1A 4LACB 1ZHTA 3AQBA 3PHF2 3EHMA 1M56C 3POVA 2W45A 4ZLDA 3F47A 3AG4C 3NYLA 3QZCA 5B1BC 1FTSA 2R7XA 3FHDA 2OCCC 3OA1A 3NKEA 4BJTA 2R7VA 3UMHA 5E33A 1OKKA 3NKDA 2IXOA 2J7PD 2P6VA 4OIRF 4F4BA 2XSEA 3W2VA 4JZAA 1BR2A 2J0XA 3CSKA 3DMDA 3X2QC 2A6HF 5T1DB 4Q7CA 4QI0A 4Q5SF 1D1BA 3AQCA 3W8IA 3O6XA 4RD9A 3UGOA 1LVKA 1O87A 3FVYA 4H4KC 2L9JA 4U5FE 4OD5A 1RJ9A 2NUTB 4BJ6A 1W2WA 4O79A 3LESA 2EIKC 3MX3A 2V3CC 4J32B 3T6JA 1OKKD 4MQ9F 2QTVA 4C3BA 2Y3HA 5EGYA 3KH2A 4C7OA 2PX3A 4BJ6C 2R7UA 1FFTC 1MMAA 2O9XA 2X51A 1LS1A 1BR1A 4P6IC 2FFHA 2WZLA 4PJLA 4DVZA 1MMNA 4YT2A 4KNWA 2J9UA 2PFDA 2CNWD 3PMRA 1TKNA 2ZXPA 1D1CA 3I5PA 4CS9A 4QI2A 1VMAA 2NUTA 4CBEA 5L3QA 4K7BA 4KNVA 4OIQF 4PJJA 4I3MA 4FESA 5E3CA 3EGDA 2G3KA 1VYKA 3CZ6A 3HTKC 4HFFB 2J0WA 3I5QA 4YT4A 1PD0A 4EWCA 4ANJA 4U5HA 1TWGA 4O6YA 2EILC 4U5CE 2VB6A 2J9VA 2Q3TA 2A69F 2XXAB 5DS5A 4PFPA 1M57C 3LAYA 4U5DE 3LS1A 4NY3A 5CI8A 4I44A 3T4RA 2YHSA 2IYLD 4O7GA 4E7SA 3S29A 3WODF 1OCRC 3ABKC 1ZHXA 3EGXA 1Z63A 4BG0A 2I8BA 4OINF 3FAJA 1S7ZA 3EGXB 4U5GA 3LNRA 3AG3C 2Y3GA 1IZMA 2FGYA 4K0DA 1NZEA 1SZIA 3DXJF 2V26A 1TWCA 3B9QA 5T3TA 3UMIA 4O6MA 3K7DA 3Q7LA 4JW1A 3ZVRA 2A1DD 3SYNA 2MYSA 3LLIA 3B0VC 3QMKA 4PK4A 4C3EA 3SEOA 4RBNA 2ZXWC 3IEEA 2R7RA 3N24A 2DYRC 5B1AC 3RFYA 3EZHA 4HEAJ 3AG1C 1OCCC 2WZFA 2KGOA 3K66A 2DGJA 3ABLC 3JRTA 4MNDA 3S0XA 2E87A 3NYJA 1Z3IX 2Y69C 2R7WA 4DBQA 1KU2A 2CW0F 3ZC4A 2OG2A 3CQZA 4KBLA 1OCZC 4BJ5C 3TD7A 2BE5F 4IRUA 4BJ1A 4Q4ZF 3SZRA 3EG9B 2Q9BA 5EHHA 2H7VC 3FDQA 3L0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VH3 A; 
#chains in the Genus database with same CATH topology
 5D91 A;  3HNK A;  2ASR A;  5AC5 A;  2M4E A;  3TUL A;  3MLG A;  3GEH A;  3S90 A;  3GAN A;  3ASO C;  2ZXO A;  1T6I A;  3O10 A;  3B0U X;  1YDI A;  3FAP B;  5JS5 A;  4AL0 A;  2GFH A;  2L7A A;  1LI5 A;  2XLM A;  4P9F A;  5GPG B;  5DQZ A;  4ZLC A;  3NDB B;  2Q00 A;  2XLV A;  4J30 B;  1J8Y F;  1HMD A;  1NBB A;  4Z9I A;  5BUO A;  3ZQY A;  4PAC A;  3CAX A;  5F5F A;  3RYL A;  3TQO A;  1TFK B;  3NRH A;  1WOL A;  2NSF A;  4HE8 D;  4JUR I;  3QVZ A;  4PFO A;  2J7P A;  1TQG A;  1WAS A;  2P1A A;  1AEP A;  3KYI A;  1D0Y A;  2QUP A;  1M2V B;  3K6B A;  1LPE A;  1IW7 F;  2ZPA A;  1MMD A;  3JSE O;  5E3A A;  4G7H F;  3DM5 A;  4A2N B;  4AK9 A;  5L0I A;  2EIM C;  2WB7 A;  3T6B A;  3DWW A;  2YLI A;  5HSW A;  4YL0 A;  3IQC A;  4DOZ A;  3S28 A;  2HSB A;  256B A;  1I5N A;  2L6F A;  5L0D A;  2H7B A;  1Q0K A;  3JRM O;  3DJU B;  1WGW A;  3J06 A;  3U9M A;  1VK5 A;  4JE9 A;  3DM9 B;  4E7Z A;  1PD1 A;  5D92 A;  4CIH A;  3I4U A;  2R7T A;  3IQ5 A;  4YWQ A;  2W9Y A;  1SMY F;  2VH3 A;  4KC9 A;  1OCO C;  3QW1 A;  4CS7 A;  3SNH A;  3V7O A;  2PX0 A;  1S05 A;  4GYT A;  5KYN A;  2ETS A;  3QVY A;  4IAQ A;  4JCH A;  4HFK B;  5CI9 A;  4YN0 B;  4LLE A;  3UNG C;  3TOL A;  2H8A A;  5COG A;  5T3W A;  3U3B A;  3ZQV A;  3Q6N A;  2HV6 A;  3JCU Q;  4NTB A;  3SP1 A;  4YT8 A;  4EBJ A;  5DS4 A;  3EHN A;  2QY9 A;  4JCZ A;  4LER A;  4IGG A;  3FOO A;  3DD7 A;  1E85 A;  3U2M A;  3M1C B;  2C04 A;  1N1C A;  3ITF A;  3JYH A;  4AE4 B;  5A6A A;  1RKE A;  3EFO B;  2HFI A;  1M2V A;  1HW2 A;  1Q0D A;  1C02 A;  2CGE A;  2HUJ A;  4OIP F;  2HSQ A;  4C7O B;  4YJW A;  3W8H A;  2YVK A;  1Z7Q c;  2R7S A;  4PJM A;  3IQT A;  3E9V A;  3L1M A;  3K33 A;  3R7C A;  1CPQ A;  5KYY A;  2HV7 A;  3Q6M A;  3O39 A;  4XEF A;  3NG1 A;  1QZX A;  5B3S C;  5L0J A;  3AJM A;  4MS2 A;  1UG7 A;  1YAU O;  3ZTZ A;  4XLP F;  2XM0 A;  3N0T A;  3UGP A;  4AX2 A;  3DZA A;  4OIO F;  5FCL A;  1T01 A;  2ZXR A;  4PJN A;  5COF A;  2DI3 A;  4DVY P;  1VYI A;  5JLI A;  4N06 A;  4JJG A;  1MND A;  1NU7 D;  2C03 A;  2IBF A;  2PP4 A;  4B6I A;  2Q9C A;  3S9O A;  2EPO A;  2F22 A;  3EGD B;  4NTF A;  3EG9 A;  4NTA A;  3GM3 A;  3IHU A;  3F46 A;  1Q0G A;  3ZTM A;  2KW3 C;  3JT1 A;  1YAR O;  3VAY A;  1O5H A;  2YEV A;  2EIJ C;  2AP3 A;  2L6G A;  2WZG A;  3VM6 A;  3LJB A;  4K1O A;  5A6B D;  2R7Q A;  2KQ9 A;  3BEH A;  3G4Z A;  1Q0M A;  4KI2 A;  3HNJ A;  1R4T A;  2WL8 A;  3ZWI A;  2EIN C;  3DAG A;  1GS9 A;  2XM4 A;  3S27 A;  3ZG1 A;  4CS9 C;  5FZT A;  5DLJ A;  4J7Y A;  2MWQ A;  2HJ3 A;  2Y39 A;  3KKB A;  5COM A;  3EZI A;  2IXM A;  4JIO A;  1CGM E;  5F28 E;  1RKE B;  4G7Z F;  4YL3 A;  3ASN C;  1H7I A;  3UR3 C;  2A6E F;  1V4A A;  2CDQ A;  3PCV A;  4MVQ A;  4QDL A;  1Z6A A;  3A11 A;  1A7V A;  1L3P A;  1NLX A;  3AGT A;  3M4C A;  4EUK B;  1I4Z A;  1K40 A;  3ECS A;  3TOM A;  4NQF A;  1ZYR F;  1V54 C;  1L7C A;  1OW6 A;  2ICW G;  5BQG A;  4DXW A;  1FMV A;  4I1M A;  4M63 A;  4IB4 A;  2KC3 A;  2CNW A;  2Q9A A;  2VCA A;  2HZ8 A;  2L6H A;  4MVM A;  4ER9 A;  2XLO A;  3U8V A;  4IWB A;  1QQ3 A;  4JVS A;  2G62 A;  2YWA A;  1V55 C;  4XWJ A;  5DVW A;  3VF0 A;  3VRC A;  3KPH A;  4E0H A;  3GWN A;  1ZVZ A;  4XEV A;  3HLZ A;  2XRH A;  1FR0 A;  2RD9 A;  1MMG A;  2YZS A;  2IOQ A;  5DQT A;  2RSE B;  3H2U A;  2UUH A;  4H54 A;  4MVO A;  1NSG B;  2Z15 A;  4U5B E;  4Z9J A;  5EK0 A;  1FMW A;  3DKA A;  4XTK A;  1D0X A;  5JVE A;  3X1O A;  1FAP B;  5JUA A;  4IAR A;  2IXN A;  3ATP A;  2OQM A;  3PDM P;  4FX5 A;  1EKY A;  3EQL F;  1EA8 A;  1B68 A;  2IXP A;  2VC9 A;  3NMI A;  4GEH A;  4DBR A;  2J45 A;  4DRH B;  1JPN A;  2KJG A;  5HV9 A;  4JEB A;  2W4M A;  3SXK A;  4JEA A;  2XL8 A;  3LEV A;  2R03 A;  4MW8 A;  4BJ5 A;  5KYX B;  1T6U A;  1I4Y A;  1ZU5 A;  3EFO A;  3LUT B;  1Q0F A;  4FWV A;  3K1I C;  3GEE A;  4ULW A;  1J8M F;  3TJ5 A;  1PCX A;  3EJN A;  4JJF A;  2KNH A;  1BBH A;  4X0R A;  4YT5 A;  2XS8 A;  3U5S A;  5CIV A;  1QKR A;  1TWA A;  1GM5 A;  2HMZ A;  2WVQ A;  3WAQ A;  3KL4 A;  1WAT A;  3B0P A;  1OW8 A;  2L81 A;  1VOM A;  4YK5 A;  3NYM A;  4XPY A;  4WJ0 A;  2XXA A;  1ZU4 A;  3H65 A;  2J9W A;  1CPR A;  1EI7 A;  1JPJ A;  4OD4 A;  5KYU A;  2J9B A;  3U9J A;  1G4W R;  5A69 A;  1ORJ A;  3M4B A;  3HNI A;  2NUP B;  3DAF A;  3IQ6 A;  4CS8 C;  4G7O F;  3C8G D;  3LNM B;  1YYJ A;  3U8P A;  3W2W A;  4CX9 A;  3OWT A;  1BR4 A;  1TWH A;  1LI7 A;  2DYS C;  1VLT A;  2A68 F;  2OKU A;  3C8Z A;  3RIP A;  3RKO F;  1ZHW A;  2D5R B;  2AWY A;  3GOD A;  2Y3D A;  5DS6 A;  3K1H A;  4MVS A;  3UMK A;  2XLE A;  4IAO A;  5JSL A;  3DJN B;  3H2V A;  3Q7G A;  1ZZP A;  2LP4 A;  4G0H A;  1HE1 A;  5A6J A;  2XS1 A;  3EPV A;  1JAF A;  1YVI A;  4MTG A;  4RDA A;  3RH3 A;  1G5Z A;  5F5H A;  4XLN F;  2J46 A;  1NG1 A;  4I1O B;  3ZIB A;  1EQ1 A;  3N2Z B;  3US6 A;  1NU9 C;  3C62 A;  5L3V A;  2G3V A;  3ZSU A;  5KYW A;  2XL4 A;  4BEM J;  5KYX A;  2LIG A;  2LQG A;  1YLM A;  1DOV A;  4MVU A;  3FXH A;  1ORS C;  4IJJ A;  3T9O A;  2OU6 A;  3E70 C;  1FFH A;  2BC5 A;  2LSE A;  3JTL O;  3KMI A;  5KYW B;  4EBB A;  1JRA A;  5KYU B;  2WVN A;  4W8K A;  3ABM C;  1D1A A;  3LLK A;  2TMV P;  4LLC A;  1A7E A;  1XZP A;  1BZ4 A;  4XPW A;  2PF4 E;  4JTC B;  4A4A A;  2P7V A;  2JD3 A;  1G8X A;  2B0J A;  1RMV A;  1VLS A;  2B0H A;  1D0Z A;  4XEK A;  4CS8 A;  5JT4 A;  4JTA B;  3JYY A;  3NMK A;  4CSA C;  4C3D A;  4AE4 A;  3VYW A;  4BPM A;  1ST6 A;  2CCY A;  3JSZ A;  3C18 A;  4N6H A;  1Z23 A;  4U5E E;  3OEO A;  1LKX A;  3HJC A;  3WHN A;  3AG2 C;  1UFB A;  3GWL A;  5IY5 C;  1YZA A;  5KYY B;  1TR2 A;  4MVZ A;  1RKC A;  3GM2 A;  3L8J A;  1SF8 A;  3WG7 C;  1QLE C;  2NUP A;  3RW0 A;  1M2O A;  1Z5Z A;  4YL1 A;  1GQA A;  1RJ9 B;  1ZHY A;  3C63 A;  3EH1 A;  1E83 A;  2Q7R A;  1NFO A;  3MBG A;  2H7O A;  3EH2 A;  1V74 B;  4ULV A;  2Y3B A;  5E2Q A;  1HY5 A;  1ZHZ A;  4O6N A;  2W4B A;  2EPN A;  2R7O A;  3O55 A;  1MNE A;  2VAS A;  3G50 A;  3L34 A;  3LS0 A;  1RCP A;  2WVO A;  1SR2 A;  2NG1 A;  1ZHT A;  3AQB A;  4LAC B;  4ONS A;  4XQ1 A;  3EHM A;  3RVZ A;  1M56 C;  3PHF 2;  3FOP A;  2GDC A;  3POV A;  1SYQ A;  2W45 A;  1A41 A;  3F47 A;  1AVO B;  3AG4 C;  3NYL A;  4ZLD A;  2D4U A;  3QZC A;  3L8I A;  5B1B C;  2YLD A;  1FTS A;  2YLG A;  4N6C A;  2R7X A;  3FHD A;  2OCC C;  4LDR A;  1LIH A;  3DI5 A;  3JZ0 A;  1PV3 A;  3OA1 A;  3NKE A;  2LK4 A;  4BJT A;  2R7V A;  1G4U S;  5K0I A;  3UMH A;  5E33 A;  1OKK A;  3NKD A;  1MQV A;  2IXO A;  2J7P D;  2P6V A;  4OIR F;  3FDQ A;  1Y6D A;  4EKW A;  4F4B A;  2XSE A;  3W2V A;  4JZA A;  4AL1 A;  1BR2 A;  1Y4C A;  2J0X A;  2X0C A;  3CSK A;  3DMD A;  5JRA A;  4XPX A;  2OJE D;  4U9D A;  3X2Q C;  1QVX A;  1KTM A;  2A6H F;  5T1D B;  4Q7C A;  4QI0 A;  4EIY A;  4Q5S F;  2YL1 A;  1D1B A;  3A9C A;  2OJQ A;  3AQC A;  3O6X A;  4RD9 A;  3W8I A;  2UUI A;  1LVK A;  5JP7 A;  3UGO A;  1O87 A;  3FVY A;  4H4K C;  2L9J A;  1LM3 B;  4U5F E;  2YRF A;  4G78 A;  4OD5 A;  1RJ9 A;  2NUT B;  2XLH A;  2VCB A;  2KYH A;  3V5Y A;  4BJ6 A;  1XWJ A;  1W2W A;  1WWP A;  4O79 A;  3V5X A;  2ZD9 A;  1RXQ A;  2EIK C;  3LES A;  3MX3 A;  4D4X A;  2V3C C;  2VCC A;  3M79 A;  5B3I A;  4J32 B;  1U0B B;  3T6J A;  1OKK D;  2R05 A;  4MQ9 F;  4BEJ A;  3ZDL A;  3B29 A;  2QTV A;  4LDQ A;  4MVR A;  2AU5 A;  4JTD B;  3RQF A;  4C3B A;  2Y3H A;  3RQE A;  5EGY A;  2YL7 A;  4E0I A;  1CGN A;  5L0H A;  1HW1 A;  3KH2 A;  4FAP B;  2PX3 A;  1WTY A;  4CIP A;  4BJ6 C;  1TFO B;  4C7O A;  2QNL A;  1FFT C;  2R7U A;  1MMA A;  4E18 A;  2O9X A;  2X51 A;  4EBK A;  1LS1 A;  1BR1 A;  4P6I C;  2FFH A;  2WZL A;  4PJL A;  4DVZ A;  3RF3 A;  4D4N A;  3GOR A;  1MMN A;  1YJG A;  3GM1 A;  4PR9 A;  5A6K A;  2KSF A;  4YT2 A;  3T6G B;  4KNW A;  4EHP A;  2J9U A;  5L0G A;  2PFD A;  2A0B A;  1YA9 A;  1E2X A;  2CNW D;  4JC7 A;  1K04 A;  3PMR A;  1E86 A;  1TKN A;  2ZXP A;  1D1C A;  2MHR A;  1H9G A;  3I5P A;  4MTO A;  4CS9 A;  2BL2 A;  4QI2 A;  1VMA A;  2NUT A;  4CBE A;  2GWW A;  1C17 M;  1U6H A;  2XL6 A;  5L3Q A;  4K7B A;  4KNV A;  4MW3 A;  4OIQ F;  4PJJ A;  3LEO A;  1OR2 A;  4N4W A;  4I3M A;  5TJ5 E;  4R32 A;  4FES A;  1OW7 A;  1K05 A;  4JKV A;  1APC A;  1JMW A;  5E3C A;  3EGD A;  2G3K A;  1NFN A;  1VYK A;  3CZ6 A;  1DOW A;  3HTK C;  4Z9H A;  1ZW2 A;  4HFF B;  4DJ9 A;  2GAQ A;  2J0W A;  2CYD A;  3M15 A;  3I5Q A;  4YT4 A;  3U0C A;  1PD0 A;  3HNL A;  4EWC A;  2YQY A;  1H9T A;  4ANJ A;  2R9R B;  1GGQ A;  4U5H A;  1TWG A;  2YKZ A;  2PNO A;  2OOC A;  4O6Y A;  3NMJ A;  2EIL C;  3K1I A;  4U5C E;  2VB6 A;  2J9V A;  4NC3 A;  2Q3T A;  1VTM P;  2JX0 A;  1OR3 A;  2A69 F;  3BRJ A;  2XXA B;  1WN0 A;  1FNT c;  5DS5 A;  1LE4 A;  3RQG A;  3MFN A;  4CDA A;  2HJM A;  4PFP A;  1M57 C;  3LAY A;  3GEI A;  4U5D E;  2LCH A;  3LS1 A;  4NY3 A;  4J7T A;  5CI8 A;  2P0N A;  4LDK A;  4P9T A;  3S84 A;  4I44 A;  5BQI A;  2HS5 A;  3T4R A;  2YHS A;  2IYL D;  4O7G A;  3R2P A;  4E7S A;  3S29 A;  2NSG A;  4CDY A;  1M6T A;  2OEX A;  5AGF A;  2QE9 A;  3SXM A;  3WOD F;  2P61 A;  4DRI B;  4CSA A;  4WGY A;  1OCR C;  3ABK C;  1ZHX A;  1OXB A;  3EGX A;  4MTF A;  1JOG A;  3U2L A;  1Z63 A;  2HMQ A;  2DB4 A;  5AC4 A;  4BG0 A;  1QPU A;  1R5I D;  2I8B A;  2LD6 A;  4OIN F;  3FAJ A;  1S7Z A;  3EGX B;  4U5G A;  1H6G A;  1CGO A;  2I15 A;  3LNR A;  3AG3 C;  3C8G A;  2Y3G A;  1U89 A;  1YZC A;  3G4X A;  1E84 A;  1IZM A;  4GQH A;  2XLW A;  2FGY A;  2LFF A;  3TK0 A;  2M64 A;  4K0D A;  1NZE A;  1SZI A;  1T5O A;  4U9E A;  3DXJ F;  3U3F A;  2V26 A;  1TWC A;  3QW0 A;  2A0U A;  2KK1 A;  1OQC A;  1QSP A;  1O3U A;  1T9K A;  2YL0 A;  3B9Q A;  2R25 A;  4WAB A;  4WGZ A;  3V5Z A;  1T6Q A;  5T3T A;  3UMI A;  4O6M A;  3K7D A;  4CDV A;  1XZQ A;  1ORY A;  2XLD A;  3Q7L A;  4JW1 A;  2AWC A;  2R02 A;  3ZVR A;  2A1D D;  3SYN A;  2MYS A;  2QLA A;  5L0F A;  3DE9 A;  3KYJ A;  5L0C A;  4NCQ A;  3LLI A;  3QTH A;  3B0V C;  2HKV A;  1JR8 A;  1HMO A;  2LFD A;  1AUE A;  3QMK A;  4PK4 A;  3W4Y A;  3SEO A;  4C3E A;  3SXZ A;  4RBN A;  3AOU A;  2ZXW C;  3IEE A;  4L6R A;  1ZW3 A;  3HKK A;  3TJ6 A;  4DRJ B;  2R7R A;  3N24 A;  2DYR C;  3FMS A;  5B1A C;  3SXY A;  3RFY A;  1A0B A;  3IPM O;  3EZH A;  4HEA J;  3AG1 C;  3MYF A;  1OCC C;  2WZF A;  2KGO A;  1LS4 A;  2EPK X;  1A7D A;  1KNY A;  2Q4F A;  2FAP B;  2EPL X;  3K66 A;  3AGU A;  2DGJ A;  3ABL C;  2NPU A;  4CJG A;  3JRT A;  4MND A;  5BQH A;  1OXK A;  3B71 A;  2AVK A;  3S0X A;  2E87 A;  3NYJ A;  2IM8 A;  2JPU A;  1Z3I X;  1F1M A;  2GA0 A;  2Y69 C;  4CJO A;  4DBQ A;  1YYX A;  2R7W A;  1KU2 A;  1C03 A;  1VB5 A;  1YA7 O;  2CW0 F;  1HE9 A;  2OG2 A;  2J8W A;  3DE8 A;  3CQZ A;  3ZC4 A;  4E17 A;  5A6B A;  3MYI A;  3C8G B;  4KBL A;  3C7J A;  2YL3 A;  2OEV A;  4W8P A;  1BDJ B;  1OCZ C;  4BJ5 C;  3TD7 A;  2BE5 F;  3RVY A;  4IRU A;  4BJ1 A;  4Q4Z F;  3SZR A;  3CEX A;  4UDV A;  3EG9 B;  4JRZ A;  1LE2 A;  2Q9B A;  5EHH A;  2H7V C;  2EPM X;  2PBE A;  3L0I A; 
#chains in the Genus database with same CATH homology
 5D91 A;  2M4E A;  3MLG A;  3GAN A;  3ASO C;  2ZXO A;  3B0U X;  2GFH A;  4ZLC A;  5DQZ A;  3NDB B;  4J30 B;  1J8Y F;  5BUO A;  5F5F A;  3RYL A;  3NRH A;  4HE8 D;  4JUR I;  4PFO A;  2J7P A;  3LJB A;  4CS7 A;  1D0Y A;  3K6B A;  1M2V B;  1IW7 F;  2ZPA A;  1MMD A;  5E3A A;  4G7H F;  3DM5 A;  4A2N B;  4AK9 A;  2EIM C;  2WB7 A;  3T6B A;  5HSW A;  4DOZ A;  3S28 A;  2H7B A;  3DJU B;  1WGW A;  1VK5 A;  3DM9 B;  4E7Z A;  1PD1 A;  5D92 A;  4CIH A;  3I4U A;  2R7T A;  4YWQ A;  2W9Y A;  1SMY F;  2VH3 A;  4KC9 A;  1OCO C;  3SNH A;  3V7O A;  2PX0 A;  4GYT A;  5KYN A;  4JCH A;  5CI9 A;  4YN0 B;  4HFK B;  4LLE A;  3UNG C;  5T3W A;  3Q6N A;  2HV6 A;  3JCU Q;  3SP1 A;  4YT8 A;  5DS4 A;  3EHN A;  2QY9 A;  4LER A;  3DD7 A;  3M1C B;  2C04 A;  1N1C A;  3ITF A;  3JYH A;  4AE4 B;  3EFO B;  1M2V A;  2CGE A;  4OIP F;  4C7O B;  4YJW A;  3W8H A;  2R7S A;  4PJM A;  3E9V A;  3K33 A;  5KYY A;  2HV7 A;  3Q6M A;  3O39 A;  3NG1 A;  1QZX A;  5B3S C;  4XLP F;  3N0T A;  3UGP A;  4AX2 A;  3DZA A;  4OIO F;  5FCL A;  2ZXR A;  4PJN A;  4DVY P;  1VYI A;  4N06 A;  4JJG A;  1MND A;  1NU7 D;  2C03 A;  2PP4 A;  4B6I A;  2Q9C A;  3EGD B;  3EG9 A;  3F46 A;  2KW3 C;  3JT1 A;  3VAY A;  1O5H A;  2YEV A;  2EIJ C;  2WZG A;  2R7Q A;  2KQ9 A;  4KI2 A;  2WL8 A;  2EIN C;  3DAG A;  3S27 A;  3ZG1 A;  4CS9 C;  5DLJ A;  2MWQ A;  2Y39 A;  3KKB A;  3EZI A;  2IXM A;  4G7Z F;  3ASN C;  3UR3 C;  2A6E F;  2CDQ A;  4QDL A;  1Z6A A;  3ECS A;  1ZYR F;  1V54 C;  1FMV A;  4I1M A;  4M63 A;  2Q9A A;  2CNW A;  4IWB A;  4JVS A;  2G62 A;  5DVW A;  1V55 C;  4XWJ A;  3HLZ A;  2XRH A;  1MMG A;  2YZS A;  2IOQ A;  5DQT A;  2Z15 A;  4U5B E;  1FMW A;  4XTK A;  1D0X A;  3X1O A;  2IXN A;  4FX5 A;  3EQL F;  4GEH A;  2IXP A;  4DBR A;  2J45 A;  1JPN A;  2KJG A;  2W4M A;  3LEV A;  4BJ5 A;  5KYX B;  1ZU5 A;  3EFO A;  4FWV A;  3K1I C;  4ULW A;  1J8M F;  1PCX A;  3EJN A;  4JJF A;  2KNH A;  4X0R A;  4YT5 A;  1TWA A;  2WVQ A;  3KL4 A;  3B0P A;  2L81 A;  1VOM A;  3NYM A;  2XXA A;  4WJ0 A;  1ZU4 A;  3H65 A;  2J9W A;  4OD4 A;  1JPJ A;  5KYU A;  2NUP B;  3DAF A;  4CS8 C;  4G7O F;  3W2W A;  3OWT A;  1BR4 A;  1TWH A;  2DYS C;  4BEJ A;  5KYU B;  2A68 F;  3RIP A;  3RKO F;  1ZHW A;  2D5R B;  3GOD A;  5DS6 A;  2Y3D A;  3K1H A;  3UMK A;  4IAO A;  3DJN B;  3Q7G A;  4G0H A;  3EPV A;  4RDA A;  3RH3 A;  5F5H A;  4XLN F;  2J46 A;  1NG1 A;  4I1O B;  3ZIB A;  3N2Z B;  1NU9 C;  5L3V A;  2G3V A;  3ZSU A;  5KYW A;  2XL4 A;  5KYX A;  4IJJ A;  4CSA A;  3E70 C;  1FFH A;  2LSE A;  3KMI A;  5KYW B;  4EBB A;  2WVN A;  4W8K A;  3ABM C;  1D1A A;  3LLK A;  4LLC A;  2PF4 E;  2P7V A;  2JD3 A;  1G8X A;  2B0J A;  1D0Z A;  4CS8 A;  4CSA C;  4C3D A;  4AE4 A;  3VYW A;  1ST6 A;  3JSZ A;  1Z23 A;  4U5E E;  3OEO A;  1LKX A;  3HJC A;  3AG2 C;  5IY5 C;  5KYY B;  1TR2 A;  1SF8 A;  3WG7 C;  1QLE C;  2NUP A;  1M2O A;  1Z5Z A;  1ZHY A;  1RJ9 B;  3EH1 A;  2H7O A;  3EH2 A;  2Y3B A;  5E2Q A;  1ZHZ A;  4O6N A;  2W4B A;  2R7O A;  1MNE A;  2VAS A;  3LS0 A;  3L34 A;  2WVO A;  2NG1 A;  4LAC B;  1ZHT A;  3AQB A;  3PHF 2;  3EHM A;  1M56 C;  3POV A;  2W45 A;  4ZLD A;  3F47 A;  3AG4 C;  3NYL A;  3QZC A;  5B1B C;  1FTS A;  2R7X A;  3FHD A;  2OCC C;  3OA1 A;  3NKE A;  4BJT A;  2R7V A;  3UMH A;  5E33 A;  1OKK A;  3NKD A;  2IXO A;  2J7P D;  2P6V A;  4OIR F;  4F4B A;  2XSE A;  3W2V A;  4JZA A;  1BR2 A;  2J0X A;  3CSK A;  3DMD A;  3X2Q C;  2A6H F;  5T1D B;  4Q7C A;  4QI0 A;  4Q5S F;  1D1B A;  3AQC A;  3W8I A;  3O6X A;  4RD9 A;  3UGO A;  1LVK A;  1O87 A;  3FVY A;  4H4K C;  2L9J A;  4U5F E;  4OD5 A;  1RJ9 A;  2NUT B;  4BJ6 A;  1W2W A;  4O79 A;  3LES A;  2EIK C;  3MX3 A;  2V3C C;  4J32 B;  3T6J A;  1OKK D;  4MQ9 F;  2QTV A;  4C3B A;  2Y3H A;  5EGY A;  3KH2 A;  4C7O A;  2PX3 A;  4BJ6 C;  2R7U A;  1FFT C;  1MMA A;  2O9X A;  2X51 A;  1LS1 A;  1BR1 A;  4P6I C;  2FFH A;  2WZL A;  4PJL A;  4DVZ A;  1MMN A;  4YT2 A;  4KNW A;  2J9U A;  2PFD A;  2CNW D;  3PMR A;  1TKN A;  2ZXP A;  1D1C A;  3I5P A;  4CS9 A;  4QI2 A;  1VMA A;  2NUT A;  4CBE A;  5L3Q A;  4K7B A;  4KNV A;  4OIQ F;  4PJJ A;  4I3M A;  4FES A;  5E3C A;  3EGD A;  2G3K A;  1VYK A;  3CZ6 A;  3HTK C;  4HFF B;  2J0W A;  3I5Q A;  4YT4 A;  1PD0 A;  4EWC A;  4ANJ A;  4U5H A;  1TWG A;  4O6Y A;  2EIL C;  4U5C E;  2VB6 A;  2J9V A;  2Q3T A;  2A69 F;  2XXA B;  5DS5 A;  4PFP A;  1M57 C;  3LAY A;  4U5D E;  3LS1 A;  4NY3 A;  5CI8 A;  4I44 A;  3T4R A;  2YHS A;  2IYL D;  4O7G A;  4E7S A;  3S29 A;  3WOD F;  1OCR C;  3ABK C;  1ZHX A;  3EGX A;  1Z63 A;  4BG0 A;  2I8B A;  4OIN F;  3FAJ A;  1S7Z A;  3EGX B;  4U5G A;  3LNR A;  3AG3 C;  2Y3G A;  1IZM A;  2FGY A;  4K0D A;  1NZE A;  1SZI A;  3DXJ F;  2V26 A;  1TWC A;  3B9Q A;  5T3T A;  3UMI A;  4O6M A;  3K7D A;  3Q7L A;  4JW1 A;  3ZVR A;  2A1D D;  3SYN A;  2MYS A;  3LLI A;  3B0V C;  3QMK A;  4PK4 A;  4C3E A;  3SEO A;  4RBN A;  2ZXW C;  3IEE A;  2R7R A;  3N24 A;  2DYR C;  5B1A C;  3RFY A;  3EZH A;  4HEA J;  3AG1 C;  1OCC C;  2WZF A;  2KGO A;  3K66 A;  2DGJ A;  3ABL C;  3JRT A;  4MND A;  3S0X A;  2E87 A;  3NYJ A;  1Z3I X;  2Y69 C;  2R7W A;  4DBQ A;  1KU2 A;  2CW0 F;  3ZC4 A;  2OG2 A;  3CQZ A;  4KBL A;  1OCZ C;  4BJ5 C;  3TD7 A;  2BE5 F;  4IRU A;  4BJ1 A;  4Q4Z F;  3SZR A;  3EG9 B;  2Q9B A;  5EHH A;  2H7V C;  3FDQ A;  3L0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...