2VH3A

Ranasmurfin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
112
structure length
110
Chain Sequence
AACSFPPSEIPGSKECLAEALQKHQGFKKKSYALICAYLNYKEDAENYERAAEDFDSAVKCTGCKEGVDLHEGNPELIEEGFEKFLASLKIDRKALGSLCTLFQKLAIPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords RANASMURFIN
publication title Unusual Chromophore and Cross-Links in Ranasmurfin: A Blue Protein from the Foam Nests of a Tropical Frog.
pubmed doi rcsb
total genus 36
structure length 110
sequence length 112
ec nomenclature
pdb deposition date 2007-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1410 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2vh3A00
2VH3A
chains in the Genus database with same CATH superfamily
4CS8C 1QSPA 1V55C 1NFOA 4IB4A 2KSFA 3JYYA 4GQHA 5B3IA 1QQ3A 1D0XA 1OW7A 3DE8A 2ZD9A 3GEIA 4U9DA 4AX2A 2WB7A 4XWJA 3H2UA 3SXMA 4U5FE 1VTMP 2DI3A 4P6IC 3ZG1A 1G4WR 4HFKB 1XZPA 3N0TA 3WG7C 4J7TA 1SZIA 1S05A 1NLXA 1Z6AA 3FDQA 4J7YA 2HV6A 5A6JA 4JJFA 4G7ZF 2L81A 3NMIA 3T6JA 4A2NB 1D1BA 1ZW3A 3NMKA 3LEVA 1RKCA 1FTSA 1RKEB 2QE9A 3L34A 4JTAB 3LS1A 2OG2A 3TQOA 3V5YA 3Q7LA 4IGGA 3VYWA 3F46A 3DWWA 1EA8A 1ORJA 2A69F 2KK1A 3MLGA 3O6XA 4JURI 4BEMJ 3KPHA 3W2WA 4O7GA 2PFDA 3KMIA 5BUOA 4P9FA 2CNWD 1Q0KA 2WZGA 3NRHA 5T1DB 3U9MA 4LACB 1HE9A 1OCOC 1TKNA 1KNYA 4JCHA 4NTAA 3X2QC 3EHNA 4H54A 1SMYF 2PP4A 1ZZPA 1C02A 1J8YF 1L3PA 2Q9CA 3ASOC 4OIRF 3UMHA 2R03A 1T9KA 3U2MA 2YL3A 1Z7Qc 2W4BA 4XPXA 4OD4A 4EKWA 3AJMA 5DS5A 5L0JA 2XLHA 3G4ZA 2ZPAA 3BEHA 3S0XA 2D4UA 3ASNC 4K7BA 4MQ9F 2H7VC 4CDYA 3RFYA 4MVOA 2GFHA 4JJGA 2YL0A 2C04A 3K1IC 3C8GA 4JEBA 2CGEA 2J9WA 3EZIA 4K0DA 4M63A 3FAJA 3GM3A 1PCXA 2QUPA 2EILC 2XLVA 5L0CA 4CS9C 1LI5A 4MTOA 4XPYA 1XZQA 3QW0A 3LEOA 4LDRA 4MNDA 2H8AA 3GEEA 5A6AA 4Q4ZF 4PR9A 4BJ6A 2CYDA 3J06A 5L0GA 4G78A 1APCA 1LKXA 1NU7D 2PX0A 1RXQA 2WVQA 3IQTA 4J32B 3T4RA 3C62A 1Y4CA 2NSGA 3IHUA 4BJ5C 2PF4E 2W4MA 1KU2A 4Z9IA 1BR1A 3ABLC 3K66A 2QLAA 4XTKA 4J30B 3SXYA 3C63A 1JOGA 1NZEA 1F1MA 3TK0A 2LFFA 3EG9B 2M4EA 3MYIA 4JEAA 2YQYA 3DAFA 3V7OA 4KC9A 3DZAA 4EUKB 4B6IA 4CS7A 3M1CB 2ZXPA 2P61A 2QTVA 5AGFA 2AP3A 3Q6NA 3RVZA 3UMKA 3PMRA 1O87A 1RKEA 5KYNA 3EGXB 2EPNA 2LD6A 2XS8A 4PFPA 4CSAC 4YL1A 1HW2A 1QLEC 1Z5ZA 1NU9C 1SF8A 3LLKA 3B29A 5FZTA 1SYQA 1TFOB 2A1DD 4E7ZA 1G5ZA 1QVXA 4U5DE 2F22A 3IQCA 3PDMP 2NUPA 2FAPB 4NTFA 3EHMA 3MX3A 4MVSA 4ULVA 3W8HA 3B71A 4DRJB 2A0BA 1VYIA 4L6RA 2GA0A 2PX3A 3SYNA 4NY3A 4PFOA 5GPGB 4N6CA 1YARO 3JSEO 2W45A 3TD7A 3JSZA 4LLEA 2WL8A 4XLPF 2HUJA 2KNHA 3QMKA 2C03A 1FMVA 1ZU4A 3NG1A 3UMIA 5IY5C 4YJWA 1ZYRF 1EI7A 3SZRA 2RSEB 1H9TA 1FFHA 2CCYA 1Q0GA 4PJLA 2XM4A 4LDQA 1OKKA 4JCZA 4JKVA 1AVOB 3O39A 3DAGA 4Z9HA 1OW6A 2VASA 1TWAA 2OQMA 3HNKA 4NTBA 3EH2A 1CPRA 5COMA 2R7SA 3HNJA 2EPMX 3L8IA 1Q0MA 4JW1A 3E70C 3POVA 1JPNA 4GEHA 5COFA 4A4AA 2IXPA 1WOLA 1MQVA 4I1MA 3L1MA 1D0YA 1TFKB 1ZHZA 2YL1A 1O5HA 3IEEA 4ULWA 1BDJB 3VRCA 4KNWA 5JVEA 2DYSC 4DBRA 2Q9BA 2LK4A 4JE9A 2XS1A 5E33A 4BJ6C 4MS2A 4CDAA 1YZCA 3BRJA 3EG9A 1H6GA 1VK5A 4YT2A 1M56C 1D0ZA 4XEFA 3FXHA 1A41A 4OINF 1M6TA 2R7XA 2V26A 2XLDA 3GM2A 4JVSA 2GAQA 1LE4A 3EGXA 2YLGA 5JP7A 3VAYA 5TJ5E 1ST6A 4O79A 3NDBB 4QDLA 2R25A 3JYHA 4WGYA 3H65A 2EPLX 5KYYB 3B9QA 3LNRA 2LFDA 3L8JA 5EHHA 2HZ8A 3AQCA 2Q4FA 3V5ZA 2YEVA 5L0DA 2XLOA 5L0IA 2R7VA 4CDVA 1BZ4A 2EIKC 1VLTA 2O9XA 3CZ6A 3QVZA 4LDKA 3IQ6A 3QZCA 4IARA 3RKOF 5A6BD 2GDCA 2VB6A 3AG3C 2NUTB 4PACA 2P7VA 1ORSC 2CNWA 2KQ9A 5FCLA 1NBBA 1NFNA 5E3AA 2FGYA 2J9BA 2L7AA 2OEXA 2XLMA 5A69A 3M79A 1TR2A 1V4AA 4FAPB 2I8BA 2KC3A 1TWCA 2BL2A 3ZWIA 1M2VB 1V54C 3B0PA 4NCQA 3S27A 2HJMA 2PBEA 1WTYA 1G8XA 4XEVA 1JR8A 2L6HA 1UFBA 3H2VA 3RYLA 3ZTZA 4ANJA 4LLCA 1CGOA 3F47A 4YT8A 4N06A 4QI2A 2NUPB 4KNVA 2IYLD 3M4CA 4IJJA 2R05A 3RVYA 1JPJA 1T5OA 3DE9A 1CPQA 4I44A 2DYRC 5DQZA 5JRAA 1VB5A 3V5XA 1YJGA 2XRHA 1FR0A 3DKAA 5KYXA 5HSWA 2XSEA 2DB4A 3MBGA 1K04A 3HNIA 2TMVP 2CW0F 1FMWA 5JLIA 2Q9AA 1LVKA 4ZLDA 1EKYA 3GANA 4O6YA 4OIOF 2J0XA 2AWCA 2I15A 2L6GA 2B0HA 4H4KC 4OIQF 2JD3A 2YWAA 1MMNA 2QY9A 4E18A 1VLSA 2AVKA 3ZIBA 4P9TA 2UUHA 1O3UA 3FAPB 3IQ5A 3KYJA 4N6HA 256BA 2UUIA 5COGA 2IXNA 1N1CA 1DOWA 1YYXA 2HSQA 3E9VA 4AE4A 2J9UA 4OIPF 2YHSA 3T9OA 2IXOA 3DJUB 4D4NA 1FAPB 3K1HA 4U5BE 3JRTA 1H9GA 3R7CA 3ZSUA 3KYIA 1E85A 5KYYA 3PHF2 4CBEA 1AUEA 1YLMA 3AG4C 3UNGC 2YL7A 1ORYA 2M64A 3EPVA 3US6A 4CIPA 4JIOA 4BG0A 4NC3A 4DJ9A 1JAFA 3RQGA 3PCVA 3LUTB 5F5HA 4DOZA 2J45A 1IZMA 3TULA 1KTMA 2NUTA 3U3BA 2X51A 4CIHA 3WHNA 1TWGA 3LJBA 2XLEA 3HNLA 4EWCA 1M57C 3I4UA 4W8PA 5BQHA 5DVWA 5F5FA 4MVQA 2HMZA 1ZHXA 1M2VA 3C8GD 3C7JA 2LQGA 2VC9A 4CS8A 3CAXA 5EK0A 5L0FA 2EIJC 2MHRA 4LERA 2MYSA 4WGZA 3N24A 2OEVA 4PJJA 3ZQVA 3LESA 4YN0B 4C3DA 1CGME 1E83A 1HE1A 5A6KA 4Z9JA 3UR3C 1CGNA 3K6BA 2WVOA 2NG1A 1YZAA 1Z3IX 2XL4A 4XEKA 3MFNA 3SXKA 5CI9A 4O6NA 4E7SA 2BC5A 1HMOA 4EHPA 3ZQYA 5B1AC 4HFFB 1BR4A 3NKEA 4U5GA 4XQ1A 2XL6A 2KGOA 3KKBA 3S9OA 4ZLCA 3X1OA 1UG7A 2HSBA 2YLIA 3ATPA 4G7HF 2R9RB 5DLJA 2A0UA 4O6MA 3DXJF 4I3MA 3JT1A 5DS6A 3EFOA 1OCRC 1PV3A 2LP4A 3QW1A 3HKKA 2NSFA 2OOCA 5CI8A 2R7OA 1HMDA 3UGOA 3NYMA 2HS5A 5JSLA 3RIPA 3U8PA 1OCZC 1R4TA 5E3CA 5JUAA 2J8WA 2EIMC 3DD7A 3DM9B 3G4XA 3ZVRA 5DQTA 4RD9A 4EBJA 1EQ1A 5KYXB 1GQAA 1SR2A 3ZC4A 4MVRA 3O10A 3DI5A 2HJ3A 3WAQA 5B1BC 3AGUA 4IRUA 3AOUA 4W8KA 4XLNF 1ZVZA 1WASA 4RBNA 5JT4A 4X0RA 1LPEA 3K7DA 2V3CC 4PJMA 2OU6A 1JRAA 3CEXA 3Q7GA 3EH1A 1T6IA 4JRZA 2Y3GA 4WJ0A 4JTCB 4CJOA 3K1IA 5T3TA 1WATA 2WZLA 1OR2A 2J7PD 2KJGA 2W9YA 2R02A 3U5SA 5B3SC 2LIGA 2RD9A 3R2PA 3VF0A 4MTFA 3L0IA 4YK5A 2YVKA 3JRMO 3OA1A 3TOMA 2YZSA 3LNMB 1PD0A 3FVYA 5L3QA 1RMVA 1TQGA 2MWQA 1YVIA 3CSKA 4GYTA 5BQIA 3W2VA 4U5HA 2EPKX 3DMDA 3ZDLA 1OKKD 1ZU5A 2XLWA 1OR3A 2R7RA 2G3KA 1IW7F 1U0BB 4BJ5A 2L9JA 4BEJA 1Q0DA 3JZ0A 3EZHA 4E0IA 5AC5A 3EJNA 3AG1C 1A7VA 3FOPA 3IPMO 4HE8D 3VM6A 4OD5A 4FWVA 4XPWA 4YWQA 1E86A 1QZXA 5JS5A 2XXAA 2J9VA 2A6HF 3GORA 1LIHA 1WGWA 4JZAA 4DVZA 3RH3A 1I5NA 4KI2A 4C7OB 1XWJA 4MW8A 4PK4A 3RF3A 3U9JA 4CSAA 2KW3C 3C18A 4ER9A 3GEHA 4U5EE 3Q6MA 2G3VA 1LI7A 3U0CA 2P1AA 2VH3A 4MTGA 3S90A 2EINC 2Y39A 2ZXOA 4BPMA 1HW1A 1OXBA 3HJCA 1MNEA 1I4ZA 1PD1A 1W2WA 4JC7A 2HMQA 4DBQA 2ASRA 4MVZA 2LCHA 2HFIA 4PJNA 4YL0A 3OEOA 4WABA 2ZXWC 3JCUQ 1VOMA 3RW0A 1GM5A 2IBFA 2R7UA 5L3VA 3TOLA 1OQCA 1ZHTA 2ETSA 3A11A 3EFOB 4DRHB 2CDQA 2OCCC 2Y69C 1TWHA 4IWBA 1NG1A 3LLIA 3RQFA 2H7BA 4Q5SF 1GS9A 1Q0FA 1LM3B 4QI0A 3TJ5A 3I5PA 3RQEA 3FHDA 4KBLA 3NYLA 5KYWB 1Z63A 5EGYA 4RDAA 5L0HA 3QVYA 1RCPA 2ZXRA 5D91A 4JTDB 3W4YA 4C3EA 4DVYP 1M2OA 3W8IA 1H7IA 3I5QA 3SXZA 1K05A 4I1OB 1S7ZA 2OKUA 5E2QA 1C03A 4AE4B 2Y3DA 2AWYA 3DM5A 3TJ6A 4NQFA 4AL1A 4IAOA 3M4BA 3ABKC 5HV9A 2WVNA 2VCAA 3O55A 3G50A 2PNOA 4BJTA 1OCCC 4AL0A 1B68A 1Z23A 5T3WA 4MW3A 1RJ9B 4MVUA 5CIVA 1E84A 4DXWA 2A6EF 4G7OF 5D92A 1T6UA 4U5CE 3ECSA 3GM1A 1MMGA 2Y3HA 3U8VA 4Q7CA 4YT5A 1AEPA 2A68F 3EGDB 4MVMA 1VYKA 1L7CA 1QKRA 4C7OA 1MMDA 3KH2A 2IXMA 3DJNB 4EBBA 1J8MF 3AGTA 1WWPA 1FFTC 1YYJA 1HY5A 4IAQA 5KYUB 2HV7A 2NPUA 4C3BA 1YDIA 3ABMC 5DS4A 2LSEA 2Q00A 3GWLA 4AK9A 1QPUA 2IM8A 1T6QA 1LE2A 1OW8A 2VCBA 3GODA 2X0CA 2R7WA 2XXAB 2EPOA 2QNLA 3UGPA 4FESA 1JMWA 4DRIB 4CX9A 3C8ZA 5AC4A 1MMAA 3OWTA 2KYHA 2BE5F 3HTKC 3QTHA 3T6BA 2FFHA 2YKZA 2JPUA 4R32A 1T01A 4E0HA 3U3FA 2OJED 2WZFA 3N2ZB 1OXKA 3S84A 1A7EA 2Q3TA 3JTLO 2HKVA 1BR2A 5KYWA 2Y3BA 4U9EA 3SEOA 3U2LA 3LS0A 3ZTMA 5K0IA 3KL4A 3NMJA 3S28A 3HLZA 2Q7RA 3S29A 1G4US 2J46A 3GWNA 2J7PA 3NYJA 1U6HA 1V74B 3NKDA 3MYFA 2R7TA 1ZHWA 2E87A 3B0VC 4FX5A 4ONSA 4BJ1A 2J0WA 4EBKA 1DOVA 1A0BA 1GGQA 3ITFA 1ZW2A 4N4WA 3SP1A 3AQBA 1Y6DA 1VMAA 1YA9A 1D1CA 1I4YA 1YA7O 4D4XA 4EIYA 2DGJA 2D5RB 2VCCA 1U89A 5A6BA 1RJ9A 4HEAJ 1FNTc 2Z15A 5BQGA 4CS9A 4F4BA 5F28E 1C17M 1MNDA 1LS1A 2OJQA 2R7QA 3EQLF 3SNHA 2ICWG 1NSGB 3FMSA 3M15A 2YRFA 2YLDA 4CJGA 4YT4A 2AU5A 3A9CA 2JX0A 4UDVA 3EGDA 1YAUO 1BBHA 2B0JA 1D1AA 2P0NA 3C8GB 3K33A 1E2XA 1K40A 1ZHYA 1LS4A 2GWWA 1R5ID 2G62A 2IOQA 2L6FA 3AG2C 2P6VA 3FOOA 4G0HA 2XM0A 2H7OA 3WODF 4E17A 4YL3A 3CQZA 5KYUA 3LAYA 4K1OA 1A7DA 3B0UX 2XL8A 1WN0A 3T6GB
chains in the Genus database with same CATH topology
4CS8C 1V55C 4AX2A 1D0XA 2WB7A 4XWJA 4U5FE 4P6IC 3ZG1A 4HFKB 3N0TA 3WG7C 1SZIA 1Z6AA 3FDQA 2HV6A 4JJFA 4G7ZF 2L81A 3T6JA 4A2NB 1D1BA 3LEVA 1FTSA 3L34A 3LS1A 2OG2A 3Q7LA 3VYWA 3F46A 2A69F 3MLGA 3O6XA 4JURI 3W2WA 4O7GA 2PFDA 3KMIA 5BUOA 2CNWD 3NRHA 2WZGA 5T1DB 4LACB 1OCOC 1TKNA 4JCHA 3X2QC 3EHNA 1SMYF 2PP4A 2Q9CA 1J8YF 4OIRF 3ASOC 3UMHA 2W4BA 4OD4A 5DS5A 3S0XA 2ZPAA 3ASNC 4K7BA 4MQ9F 2H7VC 3RFYA 2GFHA 4JJGA 2C04A 3K1IC 2CGEA 2J9WA 3EZIA 4K0DA 4M63A 3FAJA 1PCXA 2EILC 4CS9C 4MNDA 4Q4ZF 4BJ6A 1LKXA 1NU7D 2PX0A 2WVQA 4J32B 3T4RA 4BJ5C 2PF4E 2W4MA 1KU2A 1BR1A 3ABLC 3K66A 4XTKA 4J30B 1NZEA 3EG9B 2M4EA 3V7OA 4KC9A 3DZAA 4B6IA 4CS7A 3M1CB 2ZXPA 2QTVA 3Q6NA 3PMRA 1O87A 5KYNA 3EGXB 4PFPA 4CSAC 1QLEC 1NU9C 1SF8A 1Z5ZA 3LLKA 2A1DD 4E7ZA 4U5DE 2NUPA 3EHMA 3MX3A 3W8HA 1VYIA 2PX3A 3SYNA 4NY3A 4PFOA 2W45A 3TD7A 3JSZA 4LLEA 2WL8A 4XLPF 2KNHA 3QMKA 2C03A 1FMVA 1ZU4A 3NG1A 3UMIA 5IY5C 4YJWA 1ZYRF 3SZRA 1FFHA 4PJLA 1OKKA 3O39A 3DAGA 2VASA 1TWAA 3EH2A 2R7SA 3POVA 4JW1A 3E70C 1JPNA 4GEHA 2IXPA 4I1MA 1D0YA 1ZHZA 4ULWA 1O5HA 3IEEA 4KNWA 2DYSC 4DBRA 2Q9BA 5E33A 4BJ6C 3EG9A 1VK5A 4YT2A 1M56C 1D0ZA 2R7XA 4OINF 2V26A 4AE4B 4JVSA 3EGXA 3VAYA 1ST6A 4O79A 3NDBB 4QDLA 3JYHA 3H65A 5KYYB 3B9QA 5EHHA 3AQCA 2YEVA 2R7VA 2EIKC 2O9XA 3CZ6A 3RKOF 3QZCA 2VB6A 3AG3C 2NUTB 2P7VA 2CNWA 2KQ9A 5E3AA 2FGYA 1TR2A 2I8BA 1TWCA 1V54C 1M2VB 3B0PA 3S27A 1G8XA 4ANJA 3RYLA 4LLCA 3F47A 4YT8A 4N06A 4QI2A 2NUPB 4KNVA 2IYLD 4IJJA 1JPJA 4I44A 2DYRC 5DQZA 2XRHA 5KYXA 5HSWA 2XSEA 2CW0F 1FMWA 2Q9AA 1LVKA 4ZLDA 3GANA 4O6YA 4OIOF 2J0XA 4H4KC 4OIQF 2JD3A 1MMNA 2QY9A 3ZIBA 2IXNA 1N1CA 4OIPF 3E9VA 4AE4A 2J9UA 2YHSA 2IXOA 3DJUB 3K1HA 4U5BE 3JRTA 3ZSUA 5KYYA 3PHF2 4CBEA 3AG4C 3UNGC 3EPVA 4BG0A 5F5HA 4DOZA 2J45A 1IZMA 2NUTA 2X51A 4CIHA 1TWGA 3LJBA 4EWCA 1M57C 3I4UA 5F5FA 5DVWA 1ZHXA 1M2VA 4CS8A 2EIJC 4LERA 2MYSA 3N24A 4PJJA 3LESA 4YN0B 4C3DA 3UR3C 3K6BA 2WVOA 2NG1A 1Z3IX 2XL4A 4E7SA 5CI9A 4O6NA 5B1AC 4HFFB 1BR4A 3NKEA 4U5GA 4ZLCA 3KKBA 2KGOA 3X1OA 4G7HF 5DLJA 4O6MA 3DXJF 4I3MA 3JT1A 5DS6A 3EFOA 1OCRC 5CI8A 2R7OA 3UGOA 3NYMA 3RIPA 1OCZC 5E3CA 2EIMC 3DD7A 3DM9B 3ZVRA 5DQTA 4RD9A 5KYXB 3ZC4A 5B1BC 4IRUA 4W8KA 4XLNF 4RBNA 4X0RA 2V3CC 3K7DA 4PJMA 3Q7GA 3EH1A 4WJ0A 2Y3GA 5T3TA 2WZLA 2J7PD 2KJGA 2W9YA 5B3SC 3L0IA 3OA1A 2YZSA 1PD0A 3FVYA 5L3QA 2MWQA 3CSKA 4GYTA 3W2VA 4U5HA 3DMDA 1OKKD 1ZU5A 2R7RA 2G3KA 1IW7F 4BJ5A 2L9JA 4BEJA 3EZHA 3EJNA 3AG1C 4HE8D 4OD5A 4FWVA 4YWQA 1QZXA 2XXAA 2J9VA 2A6HF 1WGWA 4JZAA 4DVZA 3RH3A 4KI2A 4C7OB 4PK4A 4CSAA 2KW3C 4U5EE 3Q6MA 2G3VA 2VH3A 2EINC 2Y39A 2ZXOA 3HJCA 1MNEA 1PD1A 1W2WA 4DBQA 4PJNA 3OEOA 2ZXWC 3JCUQ 1VOMA 2R7UA 5L3VA 1ZHTA 3EFOB 2CDQA 2OCCC 2Y69C 1TWHA 4IWBA 1NG1A 3LLIA 4Q5SF 2H7BA 4QI0A 3I5PA 3FHDA 4KBLA 3NYLA 5KYWB 1Z63A 5EGYA 4RDAA 4C3EA 2ZXRA 5D91A 4DVYP 1M2OA 3W8IA 3I5QA 4I1OB 1S7ZA 5E2QA 2Y3DA 3DM5A 4IAOA 3ABKC 2WVNA 4BJTA 1OCCC 1Z23A 5T3WA 1RJ9B 2A6EF 4G7OF 5D92A 4U5CE 3ECSA 1MMGA 2Y3HA 4Q7CA 4YT5A 2A68F 3EGDB 1VYKA 4C7OA 1MMDA 3KH2A 2IXMA 3DJNB 4EBBA 1J8MF 1FFTC 5KYUB 2HV7A 4C3BA 3ABMC 2LSEA 4AK9A 3GODA 2XXAB 2R7WA 3UGPA 4FESA 1MMAA 3OWTA 2BE5F 3HTKC 3T6BA 2FFHA 2WZFA 3N2ZB 2Q3TA 1BR2A 5KYWA 2Y3BA 3SEOA 3LS0A 3KL4A 3S28A 3HLZA 3S29A 2J46A 2J7PA 3NYJA 3NKDA 2R7TA 1ZHWA 2E87A 3B0VC 4FX5A 4BJ1A 2J0WA 3ITFA 3SP1A 3AQBA 1VMAA 1D1CA 2DGJA 2D5RB 1RJ9A 4HEAJ 2Z15A 4F4BA 4CS9A 1MNDA 1LS1A 2R7QA 3EQLF 3SNHA 4YT4A 3K33A 3EGDA 1D1AA 2B0JA 3LNRA 3UMKA 5DS4A 1ZHYA 5FCLA 2G62A 2IOQA 4G0HA 3AG2C 2P6VA 2H7OA 3WODF 3CQZA 5KYUA 3LAYA 3B0UX 3DAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VH3 A; 
#chains in the Genus database with same CATH topology
 4CS8 C;  1QSP A;  1V55 C;  1NFO A;  4IB4 A;  2KSF A;  3JYY A;  4GQH A;  5B3I A;  1QQ3 A;  1D0X A;  1OW7 A;  3DE8 A;  2ZD9 A;  3GEI A;  4U9D A;  4AX2 A;  2WB7 A;  4XWJ A;  3H2U A;  3SXM A;  4U5F E;  1VTM P;  2DI3 A;  4P6I C;  3ZG1 A;  1G4W R;  4HFK B;  1XZP A;  3N0T A;  3WG7 C;  4J7T A;  1SZI A;  1S05 A;  1NLX A;  1Z6A A;  3FDQ A;  4J7Y A;  2HV6 A;  5A6J A;  4JJF A;  4G7Z F;  2L81 A;  3NMI A;  3T6J A;  4A2N B;  1D1B A;  1ZW3 A;  3NMK A;  3LEV A;  1RKC A;  1FTS A;  1RKE B;  2QE9 A;  3L34 A;  4JTA B;  3LS1 A;  2OG2 A;  3TQO A;  3V5Y A;  3Q7L A;  4IGG A;  3VYW A;  3F46 A;  3DWW A;  1EA8 A;  1ORJ A;  2A69 F;  2KK1 A;  3MLG A;  3O6X A;  4JUR I;  4BEM J;  3KPH A;  3W2W A;  4O7G A;  2PFD A;  3KMI A;  5BUO A;  4P9F A;  2CNW D;  1Q0K A;  2WZG A;  3NRH A;  5T1D B;  3U9M A;  4LAC B;  1HE9 A;  1OCO C;  1TKN A;  1KNY A;  4JCH A;  4NTA A;  3X2Q C;  3EHN A;  4H54 A;  1SMY F;  2PP4 A;  1ZZP A;  1C02 A;  1J8Y F;  1L3P A;  2Q9C A;  3ASO C;  4OIR F;  3UMH A;  2R03 A;  1T9K A;  3U2M A;  2YL3 A;  1Z7Q c;  2W4B A;  4XPX A;  4OD4 A;  4EKW A;  3AJM A;  5DS5 A;  5L0J A;  2XLH A;  3G4Z A;  2ZPA A;  3BEH A;  3S0X A;  2D4U A;  3ASN C;  4K7B A;  4MQ9 F;  2H7V C;  4CDY A;  3RFY A;  4MVO A;  2GFH A;  4JJG A;  2YL0 A;  2C04 A;  3K1I C;  3C8G A;  4JEB A;  2CGE A;  2J9W A;  3EZI A;  4K0D A;  4M63 A;  3FAJ A;  3GM3 A;  1PCX A;  2QUP A;  2EIL C;  2XLV A;  5L0C A;  4CS9 C;  1LI5 A;  4MTO A;  4XPY A;  1XZQ A;  3QW0 A;  3LEO A;  4LDR A;  4MND A;  2H8A A;  3GEE A;  5A6A A;  4Q4Z F;  4PR9 A;  4BJ6 A;  2CYD A;  3J06 A;  5L0G A;  4G78 A;  1APC A;  1LKX A;  1NU7 D;  2PX0 A;  1RXQ A;  2WVQ A;  3IQT A;  4J32 B;  3T4R A;  3C62 A;  1Y4C A;  2NSG A;  3IHU A;  4BJ5 C;  2PF4 E;  2W4M A;  1KU2 A;  4Z9I A;  1BR1 A;  3ABL C;  3K66 A;  2QLA A;  4XTK A;  4J30 B;  3SXY A;  3C63 A;  1JOG A;  1NZE A;  1F1M A;  3TK0 A;  2LFF A;  3EG9 B;  2M4E A;  3MYI A;  4JEA A;  2YQY A;  3DAF A;  3V7O A;  4KC9 A;  3DZA A;  4EUK B;  4B6I A;  4CS7 A;  3M1C B;  2ZXP A;  2P61 A;  2QTV A;  5AGF A;  2AP3 A;  3Q6N A;  3RVZ A;  3UMK A;  3PMR A;  1O87 A;  1RKE A;  5KYN A;  3EGX B;  2EPN A;  2LD6 A;  2XS8 A;  4PFP A;  4CSA C;  4YL1 A;  1HW2 A;  1QLE C;  1Z5Z A;  1NU9 C;  1SF8 A;  3LLK A;  3B29 A;  5FZT A;  1SYQ A;  1TFO B;  2A1D D;  4E7Z A;  1G5Z A;  1QVX A;  4U5D E;  2F22 A;  3IQC A;  3PDM P;  2NUP A;  2FAP B;  4NTF A;  3EHM A;  3MX3 A;  4MVS A;  4ULV A;  3W8H A;  3B71 A;  4DRJ B;  2A0B A;  1VYI A;  4L6R A;  2GA0 A;  2PX3 A;  3SYN A;  4NY3 A;  4PFO A;  5GPG B;  4N6C A;  1YAR O;  3JSE O;  2W45 A;  3TD7 A;  3JSZ A;  4LLE A;  2WL8 A;  4XLP F;  2HUJ A;  2KNH A;  3QMK A;  2C03 A;  1FMV A;  1ZU4 A;  3NG1 A;  3UMI A;  5IY5 C;  4YJW A;  1ZYR F;  1EI7 A;  3SZR A;  2RSE B;  1H9T A;  1FFH A;  2CCY A;  1Q0G A;  4PJL A;  2XM4 A;  4LDQ A;  1OKK A;  4JCZ A;  4JKV A;  1AVO B;  3O39 A;  3DAG A;  4Z9H A;  1OW6 A;  2VAS A;  1TWA A;  2OQM A;  3HNK A;  4NTB A;  3EH2 A;  1CPR A;  5COM A;  2R7S A;  3HNJ A;  2EPM X;  3L8I A;  1Q0M A;  4JW1 A;  3E70 C;  3POV A;  1JPN A;  4GEH A;  5COF A;  4A4A A;  2IXP A;  1WOL A;  1MQV A;  4I1M A;  3L1M A;  1D0Y A;  1TFK B;  1ZHZ A;  2YL1 A;  1O5H A;  3IEE A;  4ULW A;  1BDJ B;  3VRC A;  4KNW A;  5JVE A;  2DYS C;  4DBR A;  2Q9B A;  2LK4 A;  4JE9 A;  2XS1 A;  5E33 A;  4BJ6 C;  4MS2 A;  4CDA A;  1YZC A;  3BRJ A;  3EG9 A;  1H6G A;  1VK5 A;  4YT2 A;  1M56 C;  1D0Z A;  4XEF A;  3FXH A;  1A41 A;  4OIN F;  1M6T A;  2R7X A;  2V26 A;  2XLD A;  3GM2 A;  4JVS A;  2GAQ A;  1LE4 A;  3EGX A;  2YLG A;  5JP7 A;  3VAY A;  5TJ5 E;  1ST6 A;  4O79 A;  3NDB B;  4QDL A;  2R25 A;  3JYH A;  4WGY A;  3H65 A;  2EPL X;  5KYY B;  3B9Q A;  3LNR A;  2LFD A;  3L8J A;  5EHH A;  2HZ8 A;  3AQC A;  2Q4F A;  3V5Z A;  2YEV A;  5L0D A;  2XLO A;  5L0I A;  2R7V A;  4CDV A;  1BZ4 A;  2EIK C;  1VLT A;  2O9X A;  3CZ6 A;  3QVZ A;  4LDK A;  3IQ6 A;  3QZC A;  4IAR A;  3RKO F;  5A6B D;  2GDC A;  2VB6 A;  3AG3 C;  2NUT B;  4PAC A;  2P7V A;  1ORS C;  2CNW A;  2KQ9 A;  5FCL A;  1NBB A;  1NFN A;  5E3A A;  2FGY A;  2J9B A;  2L7A A;  2OEX A;  2XLM A;  5A69 A;  3M79 A;  1TR2 A;  1V4A A;  4FAP B;  2I8B A;  2KC3 A;  1TWC A;  2BL2 A;  3ZWI A;  1M2V B;  1V54 C;  3B0P A;  4NCQ A;  3S27 A;  2HJM A;  2PBE A;  1WTY A;  1G8X A;  4XEV A;  1JR8 A;  2L6H A;  1UFB A;  3H2V A;  3RYL A;  3ZTZ A;  4ANJ A;  4LLC A;  1CGO A;  3F47 A;  4YT8 A;  4N06 A;  4QI2 A;  2NUP B;  4KNV A;  2IYL D;  3M4C A;  4IJJ A;  2R05 A;  3RVY A;  1JPJ A;  1T5O A;  3DE9 A;  1CPQ A;  4I44 A;  2DYR C;  5DQZ A;  5JRA A;  1VB5 A;  3V5X A;  1YJG A;  2XRH A;  1FR0 A;  3DKA A;  5KYX A;  5HSW A;  2XSE A;  2DB4 A;  3MBG A;  1K04 A;  3HNI A;  2TMV P;  2CW0 F;  1FMW A;  5JLI A;  2Q9A A;  1LVK A;  4ZLD A;  1EKY A;  3GAN A;  4O6Y A;  4OIO F;  2J0X A;  2AWC A;  2I15 A;  2L6G A;  2B0H A;  4H4K C;  4OIQ F;  2JD3 A;  2YWA A;  1MMN A;  2QY9 A;  4E18 A;  1VLS A;  2AVK A;  3ZIB A;  4P9T A;  2UUH A;  1O3U A;  3FAP B;  3IQ5 A;  3KYJ A;  4N6H A;  256B A;  2UUI A;  5COG A;  2IXN A;  1N1C A;  1DOW A;  1YYX A;  2HSQ A;  3E9V A;  4AE4 A;  2J9U A;  4OIP F;  2YHS A;  3T9O A;  2IXO A;  3DJU B;  4D4N A;  1FAP B;  3K1H A;  4U5B E;  3JRT A;  1H9G A;  3R7C A;  3ZSU A;  3KYI A;  1E85 A;  5KYY A;  3PHF 2;  4CBE A;  1AUE A;  1YLM A;  3AG4 C;  3UNG C;  2YL7 A;  1ORY A;  2M64 A;  3EPV A;  3US6 A;  4CIP A;  4JIO A;  4BG0 A;  4NC3 A;  4DJ9 A;  1JAF A;  3RQG A;  3PCV A;  3LUT B;  5F5H A;  4DOZ A;  2J45 A;  1IZM A;  3TUL A;  1KTM A;  2NUT A;  3U3B A;  2X51 A;  4CIH A;  3WHN A;  1TWG A;  3LJB A;  2XLE A;  3HNL A;  4EWC A;  1M57 C;  3I4U A;  4W8P A;  5BQH A;  5DVW A;  5F5F A;  4MVQ A;  2HMZ A;  1ZHX A;  1M2V A;  3C8G D;  3C7J A;  2LQG A;  2VC9 A;  4CS8 A;  3CAX A;  5EK0 A;  5L0F A;  2EIJ C;  2MHR A;  4LER A;  2MYS A;  4WGZ A;  3N24 A;  2OEV A;  4PJJ A;  3ZQV A;  3LES A;  4YN0 B;  4C3D A;  1CGM E;  1E83 A;  1HE1 A;  5A6K A;  4Z9J A;  3UR3 C;  1CGN A;  3K6B A;  2WVO A;  2NG1 A;  1YZA A;  1Z3I X;  2XL4 A;  4XEK A;  3MFN A;  3SXK A;  5CI9 A;  4O6N A;  4E7S A;  2BC5 A;  1HMO A;  4EHP A;  3ZQY A;  5B1A C;  4HFF B;  1BR4 A;  3NKE A;  4U5G A;  4XQ1 A;  2XL6 A;  2KGO A;  3KKB A;  3S9O A;  4ZLC A;  3X1O A;  1UG7 A;  2HSB A;  2YLI A;  3ATP A;  4G7H F;  2R9R B;  5DLJ A;  2A0U A;  4O6M A;  3DXJ F;  4I3M A;  3JT1 A;  5DS6 A;  3EFO A;  1OCR C;  1PV3 A;  2LP4 A;  3QW1 A;  3HKK A;  2NSF A;  2OOC A;  5CI8 A;  2R7O A;  1HMD A;  3UGO A;  3NYM A;  2HS5 A;  5JSL A;  3RIP A;  3U8P A;  1OCZ C;  1R4T A;  5E3C A;  5JUA A;  2J8W A;  2EIM C;  3DD7 A;  3DM9 B;  3G4X A;  3ZVR A;  5DQT A;  4RD9 A;  4EBJ A;  1EQ1 A;  5KYX B;  1GQA A;  1SR2 A;  3ZC4 A;  4MVR A;  3O10 A;  3DI5 A;  2HJ3 A;  3WAQ A;  5B1B C;  3AGU A;  4IRU A;  3AOU A;  4W8K A;  4XLN F;  1ZVZ A;  1WAS A;  4RBN A;  5JT4 A;  4X0R A;  1LPE A;  3K7D A;  2V3C C;  4PJM A;  2OU6 A;  1JRA A;  3CEX A;  3Q7G A;  3EH1 A;  1T6I A;  4JRZ A;  2Y3G A;  4WJ0 A;  4JTC B;  4CJO A;  3K1I A;  5T3T A;  1WAT A;  2WZL A;  1OR2 A;  2J7P D;  2KJG A;  2W9Y A;  2R02 A;  3U5S A;  5B3S C;  2LIG A;  2RD9 A;  3R2P A;  3VF0 A;  4MTF A;  3L0I A;  4YK5 A;  2YVK A;  3JRM O;  3OA1 A;  3TOM A;  2YZS A;  3LNM B;  1PD0 A;  3FVY A;  5L3Q A;  1RMV A;  1TQG A;  2MWQ A;  1YVI A;  3CSK A;  4GYT A;  5BQI A;  3W2V A;  4U5H A;  2EPK X;  3DMD A;  3ZDL A;  1OKK D;  1ZU5 A;  2XLW A;  1OR3 A;  2R7R A;  2G3K A;  1IW7 F;  1U0B B;  4BJ5 A;  2L9J A;  4BEJ A;  1Q0D A;  3JZ0 A;  3EZH A;  4E0I A;  5AC5 A;  3EJN A;  3AG1 C;  1A7V A;  3FOP A;  3IPM O;  4HE8 D;  3VM6 A;  4OD5 A;  4FWV A;  4XPW A;  4YWQ A;  1E86 A;  1QZX A;  5JS5 A;  2XXA A;  2J9V A;  2A6H F;  3GOR A;  1LIH A;  1WGW A;  4JZA A;  4DVZ A;  3RH3 A;  1I5N A;  4KI2 A;  4C7O B;  1XWJ A;  4MW8 A;  4PK4 A;  3RF3 A;  3U9J A;  4CSA A;  2KW3 C;  3C18 A;  4ER9 A;  3GEH A;  4U5E E;  3Q6M A;  2G3V A;  1LI7 A;  3U0C A;  2P1A A;  2VH3 A;  4MTG A;  3S90 A;  2EIN C;  2Y39 A;  2ZXO A;  4BPM A;  1HW1 A;  1OXB A;  3HJC A;  1MNE A;  1I4Z A;  1PD1 A;  1W2W A;  4JC7 A;  2HMQ A;  4DBQ A;  2ASR A;  4MVZ A;  2LCH A;  2HFI A;  4PJN A;  4YL0 A;  3OEO A;  4WAB A;  2ZXW C;  3JCU Q;  1VOM A;  3RW0 A;  1GM5 A;  2IBF A;  2R7U A;  5L3V A;  3TOL A;  1OQC A;  1ZHT A;  2ETS A;  3A11 A;  3EFO B;  4DRH B;  2CDQ A;  2OCC C;  2Y69 C;  1TWH A;  4IWB A;  1NG1 A;  3LLI A;  3RQF A;  2H7B A;  4Q5S F;  1GS9 A;  1Q0F A;  1LM3 B;  4QI0 A;  3TJ5 A;  3I5P A;  3RQE A;  3FHD A;  4KBL A;  3NYL A;  5KYW B;  1Z63 A;  5EGY A;  4RDA A;  5L0H A;  3QVY A;  1RCP A;  2ZXR A;  5D91 A;  4JTD B;  3W4Y A;  4C3E A;  4DVY P;  1M2O A;  3W8I A;  1H7I A;  3I5Q A;  3SXZ A;  1K05 A;  4I1O B;  1S7Z A;  2OKU A;  5E2Q A;  1C03 A;  4AE4 B;  2Y3D A;  2AWY A;  3DM5 A;  3TJ6 A;  4NQF A;  4AL1 A;  4IAO A;  3M4B A;  3ABK C;  5HV9 A;  2WVN A;  2VCA A;  3O55 A;  3G50 A;  2PNO A;  4BJT A;  1OCC C;  4AL0 A;  1B68 A;  1Z23 A;  5T3W A;  4MW3 A;  1RJ9 B;  4MVU A;  5CIV A;  1E84 A;  4DXW A;  2A6E F;  4G7O F;  5D92 A;  1T6U A;  4U5C E;  3ECS A;  3GM1 A;  1MMG A;  2Y3H A;  3U8V A;  4Q7C A;  4YT5 A;  1AEP A;  2A68 F;  3EGD B;  4MVM A;  1VYK A;  1L7C A;  1QKR A;  4C7O A;  1MMD A;  3KH2 A;  2IXM A;  3DJN B;  4EBB A;  1J8M F;  3AGT A;  1WWP A;  1FFT C;  1YYJ A;  1HY5 A;  4IAQ A;  5KYU B;  2HV7 A;  2NPU A;  4C3B A;  1YDI A;  3ABM C;  5DS4 A;  2LSE A;  2Q00 A;  3GWL A;  4AK9 A;  1QPU A;  2IM8 A;  1T6Q A;  1LE2 A;  1OW8 A;  2VCB A;  3GOD A;  2X0C A;  2R7W A;  2XXA B;  2EPO A;  2QNL A;  3UGP A;  4FES A;  1JMW A;  4DRI B;  4CX9 A;  3C8Z A;  5AC4 A;  1MMA A;  3OWT A;  2KYH A;  2BE5 F;  3HTK C;  3QTH A;  3T6B A;  2FFH A;  2YKZ A;  2JPU A;  4R32 A;  1T01 A;  4E0H A;  3U3F A;  2OJE D;  2WZF A;  3N2Z B;  1OXK A;  3S84 A;  1A7E A;  2Q3T A;  3JTL O;  2HKV A;  1BR2 A;  5KYW A;  2Y3B A;  4U9E A;  3SEO A;  3U2L A;  3LS0 A;  3ZTM A;  5K0I A;  3KL4 A;  3NMJ A;  3S28 A;  3HLZ A;  2Q7R A;  3S29 A;  1G4U S;  2J46 A;  3GWN A;  2J7P A;  3NYJ A;  1U6H A;  1V74 B;  3NKD A;  3MYF A;  2R7T A;  1ZHW A;  2E87 A;  3B0V C;  4FX5 A;  4ONS A;  4BJ1 A;  2J0W A;  4EBK A;  1DOV A;  1A0B A;  1GGQ A;  3ITF A;  1ZW2 A;  4N4W A;  3SP1 A;  3AQB A;  1Y6D A;  1VMA A;  1YA9 A;  1D1C A;  1I4Y A;  1YA7 O;  4D4X A;  4EIY A;  2DGJ A;  2D5R B;  2VCC A;  1U89 A;  5A6B A;  1RJ9 A;  4HEA J;  1FNT c;  2Z15 A;  5BQG A;  4CS9 A;  4F4B A;  5F28 E;  1C17 M;  1MND A;  1LS1 A;  2OJQ A;  2R7Q A;  3EQL F;  3SNH A;  2ICW G;  1NSG B;  3FMS A;  3M15 A;  2YRF A;  2YLD A;  4CJG A;  4YT4 A;  2AU5 A;  3A9C A;  2JX0 A;  4UDV A;  3EGD A;  1YAU O;  1BBH A;  2B0J A;  1D1A A;  2P0N A;  3C8G B;  3K33 A;  1E2X A;  1K40 A;  1ZHY A;  1LS4 A;  2GWW A;  1R5I D;  2G62 A;  2IOQ A;  2L6F A;  3AG2 C;  2P6V A;  3FOO A;  4G0H A;  2XM0 A;  2H7O A;  3WOD F;  4E17 A;  4YL3 A;  3CQZ A;  5KYU A;  3LAY A;  4K1O A;  1A7D A;  3B0U X;  2XL8 A;  1WN0 A;  3T6G B; 
#chains in the Genus database with same CATH homology
 4CS8 C;  1V55 C;  4AX2 A;  1D0X A;  2WB7 A;  4XWJ A;  4U5F E;  4P6I C;  3ZG1 A;  4HFK B;  3N0T A;  3WG7 C;  1SZI A;  1Z6A A;  3FDQ A;  2HV6 A;  4JJF A;  4G7Z F;  2L81 A;  3T6J A;  4A2N B;  1D1B A;  3LEV A;  1FTS A;  3L34 A;  3LS1 A;  2OG2 A;  3Q7L A;  3VYW A;  3F46 A;  2A69 F;  3MLG A;  3O6X A;  4JUR I;  3W2W A;  4O7G A;  2PFD A;  3KMI A;  5BUO A;  2CNW D;  3NRH A;  2WZG A;  5T1D B;  4LAC B;  1OCO C;  1TKN A;  4JCH A;  3X2Q C;  3EHN A;  1SMY F;  2PP4 A;  2Q9C A;  1J8Y F;  4OIR F;  3ASO C;  3UMH A;  2W4B A;  4OD4 A;  5DS5 A;  3S0X A;  2ZPA A;  3ASN C;  4K7B A;  4MQ9 F;  2H7V C;  3RFY A;  2GFH A;  4JJG A;  2C04 A;  3K1I C;  2CGE A;  2J9W A;  3EZI A;  4K0D A;  4M63 A;  3FAJ A;  1PCX A;  2EIL C;  4CS9 C;  4MND A;  4Q4Z F;  4BJ6 A;  1LKX A;  1NU7 D;  2PX0 A;  2WVQ A;  4J32 B;  3T4R A;  4BJ5 C;  2PF4 E;  2W4M A;  1KU2 A;  1BR1 A;  3ABL C;  3K66 A;  4XTK A;  4J30 B;  1NZE A;  3EG9 B;  2M4E A;  3V7O A;  4KC9 A;  3DZA A;  4B6I A;  4CS7 A;  3M1C B;  2ZXP A;  2QTV A;  3Q6N A;  3PMR A;  1O87 A;  5KYN A;  3EGX B;  4PFP A;  4CSA C;  1QLE C;  1NU9 C;  1SF8 A;  1Z5Z A;  3LLK A;  2A1D D;  4E7Z A;  4U5D E;  2NUP A;  3EHM A;  3MX3 A;  3W8H A;  1VYI A;  2PX3 A;  3SYN A;  4NY3 A;  4PFO A;  2W45 A;  3TD7 A;  3JSZ A;  4LLE A;  2WL8 A;  4XLP F;  2KNH A;  3QMK A;  2C03 A;  1FMV A;  1ZU4 A;  3NG1 A;  3UMI A;  5IY5 C;  4YJW A;  1ZYR F;  3SZR A;  1FFH A;  4PJL A;  1OKK A;  3O39 A;  3DAG A;  2VAS A;  1TWA A;  3EH2 A;  2R7S A;  3POV A;  4JW1 A;  3E70 C;  1JPN A;  4GEH A;  2IXP A;  4I1M A;  1D0Y A;  1ZHZ A;  4ULW A;  1O5H A;  3IEE A;  4KNW A;  2DYS C;  4DBR A;  2Q9B A;  5E33 A;  4BJ6 C;  3EG9 A;  1VK5 A;  4YT2 A;  1M56 C;  1D0Z A;  2R7X A;  4OIN F;  2V26 A;  4AE4 B;  4JVS A;  3EGX A;  3VAY A;  1ST6 A;  4O79 A;  3NDB B;  4QDL A;  3JYH A;  3H65 A;  5KYY B;  3B9Q A;  5EHH A;  3AQC A;  2YEV A;  2R7V A;  2EIK C;  2O9X A;  3CZ6 A;  3RKO F;  3QZC A;  2VB6 A;  3AG3 C;  2NUT B;  2P7V A;  2CNW A;  2KQ9 A;  5E3A A;  2FGY A;  1TR2 A;  2I8B A;  1TWC A;  1V54 C;  1M2V B;  3B0P A;  3S27 A;  1G8X A;  4ANJ A;  3RYL A;  4LLC A;  3F47 A;  4YT8 A;  4N06 A;  4QI2 A;  2NUP B;  4KNV A;  2IYL D;  4IJJ A;  1JPJ A;  4I44 A;  2DYR C;  5DQZ A;  2XRH A;  5KYX A;  5HSW A;  2XSE A;  2CW0 F;  1FMW A;  2Q9A A;  1LVK A;  4ZLD A;  3GAN A;  4O6Y A;  4OIO F;  2J0X A;  4H4K C;  4OIQ F;  2JD3 A;  1MMN A;  2QY9 A;  3ZIB A;  2IXN A;  1N1C A;  4OIP F;  3E9V A;  4AE4 A;  2J9U A;  2YHS A;  2IXO A;  3DJU B;  3K1H A;  4U5B E;  3JRT A;  3ZSU A;  5KYY A;  3PHF 2;  4CBE A;  3AG4 C;  3UNG C;  3EPV A;  4BG0 A;  5F5H A;  4DOZ A;  2J45 A;  1IZM A;  2NUT A;  2X51 A;  4CIH A;  1TWG A;  3LJB A;  4EWC A;  1M57 C;  3I4U A;  5F5F A;  5DVW A;  1ZHX A;  1M2V A;  4CS8 A;  2EIJ C;  4LER A;  2MYS A;  3N24 A;  4PJJ A;  3LES A;  4YN0 B;  4C3D A;  3UR3 C;  3K6B A;  2WVO A;  2NG1 A;  1Z3I X;  2XL4 A;  4E7S A;  5CI9 A;  4O6N A;  5B1A C;  4HFF B;  1BR4 A;  3NKE A;  4U5G A;  4ZLC A;  3KKB A;  2KGO A;  3X1O A;  4G7H F;  5DLJ A;  4O6M A;  3DXJ F;  4I3M A;  3JT1 A;  5DS6 A;  3EFO A;  1OCR C;  5CI8 A;  2R7O A;  3UGO A;  3NYM A;  3RIP A;  1OCZ C;  5E3C A;  2EIM C;  3DD7 A;  3DM9 B;  3ZVR A;  5DQT A;  4RD9 A;  5KYX B;  3ZC4 A;  5B1B C;  4IRU A;  4W8K A;  4XLN F;  4RBN A;  4X0R A;  2V3C C;  3K7D A;  4PJM A;  3Q7G A;  3EH1 A;  4WJ0 A;  2Y3G A;  5T3T A;  2WZL A;  2J7P D;  2KJG A;  2W9Y A;  5B3S C;  3L0I A;  3OA1 A;  2YZS A;  1PD0 A;  3FVY A;  5L3Q A;  2MWQ A;  3CSK A;  4GYT A;  3W2V A;  4U5H A;  3DMD A;  1OKK D;  1ZU5 A;  2R7R A;  2G3K A;  1IW7 F;  4BJ5 A;  2L9J A;  4BEJ A;  3EZH A;  3EJN A;  3AG1 C;  4HE8 D;  4OD5 A;  4FWV A;  4YWQ A;  1QZX A;  2XXA A;  2J9V A;  2A6H F;  1WGW A;  4JZA A;  4DVZ A;  3RH3 A;  4KI2 A;  4C7O B;  4PK4 A;  4CSA A;  2KW3 C;  4U5E E;  3Q6M A;  2G3V A;  2VH3 A;  2EIN C;  2Y39 A;  2ZXO A;  3HJC A;  1MNE A;  1PD1 A;  1W2W A;  4DBQ A;  4PJN A;  3OEO A;  2ZXW C;  3JCU Q;  1VOM A;  2R7U A;  5L3V A;  1ZHT A;  3EFO B;  2CDQ A;  2OCC C;  2Y69 C;  1TWH A;  4IWB A;  1NG1 A;  3LLI A;  4Q5S F;  2H7B A;  4QI0 A;  3I5P A;  3FHD A;  4KBL A;  3NYL A;  5KYW B;  1Z63 A;  5EGY A;  4RDA A;  4C3E A;  2ZXR A;  5D91 A;  4DVY P;  1M2O A;  3W8I A;  3I5Q A;  4I1O B;  1S7Z A;  5E2Q A;  2Y3D A;  3DM5 A;  4IAO A;  3ABK C;  2WVN A;  4BJT A;  1OCC C;  1Z23 A;  5T3W A;  1RJ9 B;  2A6E F;  4G7O F;  5D92 A;  4U5C E;  3ECS A;  1MMG A;  2Y3H A;  4Q7C A;  4YT5 A;  2A68 F;  3EGD B;  1VYK A;  4C7O A;  1MMD A;  3KH2 A;  2IXM A;  3DJN B;  4EBB A;  1J8M F;  1FFT C;  5KYU B;  2HV7 A;  4C3B A;  3ABM C;  2LSE A;  4AK9 A;  3GOD A;  2XXA B;  2R7W A;  3UGP A;  4FES A;  1MMA A;  3OWT A;  2BE5 F;  3HTK C;  3T6B A;  2FFH A;  2WZF A;  3N2Z B;  2Q3T A;  1BR2 A;  5KYW A;  2Y3B A;  3SEO A;  3LS0 A;  3KL4 A;  3S28 A;  3HLZ A;  3S29 A;  2J46 A;  2J7P A;  3NYJ A;  3NKD A;  2R7T A;  1ZHW A;  2E87 A;  3B0V C;  4FX5 A;  4BJ1 A;  2J0W A;  3ITF A;  3SP1 A;  3AQB A;  1VMA A;  1D1C A;  2DGJ A;  2D5R B;  1RJ9 A;  4HEA J;  2Z15 A;  4F4B A;  4CS9 A;  1MND A;  1LS1 A;  2R7Q A;  3EQL F;  3SNH A;  4YT4 A;  3K33 A;  3EGD A;  1D1A A;  2B0J A;  3LNR A;  3UMK A;  5DS4 A;  1ZHY A;  5FCL A;  2G62 A;  2IOQ A;  4G0H A;  3AG2 C;  2P6V A;  2H7O A;  3WOD F;  3CQZ A;  5KYU A;  3LAY A;  3B0U X;  3DAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...