2VH3A

Ranasmurfin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
112
structure length
110
Chain Sequence
b'AACSFPPSEIPGSKECLAEALQKHQGFKKKSYALICAYLNYKEDAENYERAAEDFDSAVKCTGCKEGVDLHEGNPELIEEGFEKFLASLKIDRKALGSLCTLFQKLAIPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RANASMURFIN
molecule tags Unknown function
publication title Unusual Chromophore and Cross-Links in Ranasmurfin: A Blue Protein from the Foam Nests of a Tropical Frog.
pubmed doi rcsb
total genus 36
structure length 110
sequence length 112
ec nomenclature
pdb deposition date 2007-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1410 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2vh3A00
2VH3A
chains in the Genus database with same CATH superfamily
1DOVA 3HNKA 2R05A 3L8JA 4AE4B 1WWPA 3SZRA 4C7OA 4DBRA 4YT4A 5HSWA 1BR1A 2A6EF 2AVKA 4P6IC 2EILC 3LS0A 4GYTA 2OKUA 4BPMA 3B0VC 3EGDA 3G4XA 4QI0A 4MTGA 4XLNF 3X1OA 1GGQA 1O5HA 5K0IA 3C63A 3V7OA 2VH3A 3CAXA 1M56C 1RXQA 2DB4A 3JZ0A 1QQ3A 2A69F 4LERA 3ABMC 1UG7A 2AU5A 1Q0KA 2C04A 4I1OB 1WATA 3M79A 2W45A 3S90A 2VCAA 4N6CA 1LE2A 2WVOA 3ZQVA 1JPJA 1LE4A 4DXWA 2YL0A 4K1OA 4JRZA 4PJLA 5JSLA 3N0TA 2AP3A 3ITFA 3LUTB 4I3MA 5F5HA 3OA1A 2IXMA 2YL3A 4YJWA 5L0FA 5KYWA 4PJMA 2NPUA 3AJMA 4LACB 2CYDA 4JIOA 3RQEA 3FHDA 3U3FA 3C8GA 2R02A 2XXAB 2XM0A 3DM5A 3NRHA 2H8AA 2A68F 4AE4A 2A0UA 1AVOB 1YA9A 2CCYA 3EH2A 4E7ZA 3B9QA 4KNVA 2XLHA 4DRHB 1OCZC 2L81A 3IQCA 3RFYA 4CBEA 4CDAA 2PFDA 1R4TA 2BL2A 2YZSA 1VLTA 2FGYA 4JW1A 4CIPA 1J8YF 1RKEB 2PP4A 2HMZA 3Q7LA 4LDRA 4Z9IA 2X51A 2JPUA 2IYLD 5FZTA 1D0XA 4PJJA 2IXOA 1YVIA 3I5PA 2YRFA 2NSFA 2PF4E 2XLEA 5F28E 5JLIA 5COMA 2GFHA 3MX3A 2Q9BA 4JZAA 3NKDA 2FAPB 4YT5A 3S29A 3C7JA 3NYLA 3JRTA 5E3CA 4O7GA 5KYNA 3EGXB 2J7PA 2LD6A 5B1BC 3EHNA 4WGYA 3HJCA 4CDYA 5L0JA 1MNDA 1D1AA 3FXHA 1E2XA 3RQFA 3EZHA 3TK0A 1M2OA 4E18A 2JX0A 4N06A 2Q9AA 3ECSA 4N6HA 3LNMB 4XEVA 5A6KA 4IJJA 2Q3TA 3JSEO 1QVXA 3C8ZA 5BQIA 4DOZA 4YN0B 2IBFA 1ZHTA 4G78A 3MYFA 5B3SC 3S84A 1D0YA 3ZG1A 3Q7GA 3QVZA 2KQ9A 4JTDB 4K7BA 2ZXOA 3K1IA 2YLIA 2TMVP 3AG2C 1FMVA 2OQMA 3KPHA 2RD9A 3KH2A 1TWCA 3GWNA 1VYKA 4LDKA 3HTKC 2Y3BA 3KL4A 1BR4A 3LAYA 2I15A 3QVYA 3WAQA 2LFFA 4MVOA 1SZIA 2LQGA 2Q9CA 3CZ6A 3VYWA 2HJ3A 2J0WA 1NFOA 4EBKA 3JYHA 1OCCC 3O10A 1ZVZA 2J9WA 2ICWG 2YKZA 4YT2A 4O6NA 4JE9A 2J8WA 1ZW3A 3WHNA 5EHHA 4DRIB 3S0XA 2NG1A 3EFOA 1V54C 1MNEA 1Z3IX 2XL6A 2HSBA 1XWJA 3EQLF 3Q6NA 4JJFA 3NG1A 2GWWA 4CX9A 5A69A 3RVYA 2EPNA 5JT4A 3ABLC 1U0BB 4CJOA 4ZLDA 4BEMJ 4Q4ZF 1LIHA 5L0HA 2EIMC 4CIHA 5IY5C 5GPGB 1T6QA 4W8KA 1BZ4A 5L0GA 2NUPB 3U8PA 4KBLA 3RIPA 4DVYP 1VLSA 1EKYA 1G4WR 3WODF 1W2WA 3CEXA 3PHF2 3W8HA 4E0IA 1IW7F 1O3UA 1D1BA 1HE9A 1ORSC 1CGOA 3SP1A 1FR0A 1QPUA 4MW8A 4OD5A 3U8VA 2G62A 5BQHA 2KGOA 3EZIA 3N24A 5E3AA 3U2LA 3C18A 4BJ5A 4JTCB 4OD4A 2W4BA 3HLZA 5L0DA 5B1AC 5B3IA 5KYYB 1JAFA 1HMOA 2J9VA 4NTFA 2E87A 3E70C 4MVSA 2X0CA 4EWCA 2WB7A 2R03A 5D91A 4K0DA 2JD3A 3H2UA 4BJ6A 2GAQA 4E7SA 4Q7CA 2Z15A 5COGA 2WZLA 3LS1A 3C62A 2XLWA 3O39A 4U9EA 2Y3HA 1DOWA 1WOLA 3CQZA 1MQVA 1K40A 3VAYA 4YL0A 3T4RA 3EJNA 4Z9JA 3VRCA 4JCHA 3KMIA 1VYIA 1GM5A 3B29A 1E83A 1RJ9A 4E0HA 3RKOF 2QNLA 4MVUA 1QSPA 4CS8A 2R9RB 1VB5A 4HFFB 2IXPA 3LLIA 3SNHA 4BG0A 3EH1A 3U0CA 4EUKB 2VC9A 3L8IA 1ZYRF 1RKEA 1TFKB 3ATPA 4GQHA 3RQGA 3AQBA 1JR8A 1NG1A 2P6VA 3RW0A 2R7OA 3EGXA 5DVWA 2PBEA 2EINC 2HV6A 3K6BA 3GANA 4J30B 2FFHA 2YHSA 1J8MF 1IZMA 4U5HA 3DAGA 1YYJA 1Z5ZA 1NZEA 1XZPA 2L9JA 4L6RA 3LEVA 5T1DB 4AX2A 4AK9A 4NC3A 3QW0A 3W8IA 1ORYA 1HW1A 1T6UA 5HV9A 1H9TA 3WG7C 4FWVA 3DJUB 4I1MA 2LCHA 5COFA 2KW3C 2WVQA 5JS5A 2OEXA 2RSEB 3EHMA 1OQCA 1PD0A 1ZHWA 4NQFA 4RD9A 2BC5A 3U9MA 1I5NA 2J9UA 1AUEA 4KC9A 1PV3A 1WGWA 2ZXWC 2HSQA 2XL8A 5CIVA 4P9TA 3M4CA 1SMYF 3NYJA 2CW0F 4AL1A 5KYUB 1S05A 2ASRA 2J9BA 1YLMA 3GODA 3O55A 1TKNA 4H4KC 4CDVA 1E86A 4OIOF 3GEHA 2NUPA 3A9CA 3DE9A 3NYMA 1YDIA 4J32B 1JPNA 2C03A 3AQCA 3I4UA 5KYWB 2H7BA 2L6FA 4XEKA 1E85A 2XLOA 2Y3DA 2ZD9A 4MVMA 1CPQA 1FNTc 3SXZA 4XQ1A 5F5FA 1MMAA 1HMDA 1AEPA 1C02A 2HFIA 3F47A 3FAPB 3OEOA 4YK5A 4C7OB 3ZVRA 2OJED 4PR9A 3AG4C 2J45A 4MS2A 1VTMP 5E2QA 2HMQA 3TJ6A 2H7OA 2YL1A 3SEOA 2I8BA 1C17M 2WZFA 3K1HA 1XZQA 4I44A 4U9DA 3DJNB 3ZWIA 4C3DA 4DRJB 3NDBB 5JUAA 1OW7A 2MYSA 3SXMA 3M15A 4BJ5C 4EHPA 3U5SA 3IQ6A 4IB4A 3M1CB 3K33A 4O6YA 1NFNA 1G5ZA 1SF8A 2XLMA 3JRMO 3A11A 1YZAA 3RF3A 3UGPA 3POVA 5DS5A 1YYXA 1A41A 1WASA 1K04A 2YLGA 1I4ZA 2W4MA 2KK1A 4QI2A 1CPRA 1D1CA 1KNYA 1NBBA 2V26A 3EG9A 3V5XA 1LI7A 4RDAA 2KSFA 3ZC4A 1L7CA 1Z63A 4BEJA 2P0NA 2KC3A 4PJNA 3LJBA 3T9OA 3KYIA 4FESA 1KU2A 3O6XA 4WABA 1TWAA 3UMIA 5BUOA 2OOCA 3V5YA 1KTMA 2AWYA 3GM1A 1EQ1A 1OR3A 5AGFA 1PD1A 1A7VA 4C3BA 1R5ID 3C8GB 3ABKC 1OCOC 3NMKA 1FTSA 1TR2A 4J7TA 3JT1A 3L1MA 2DYRC 3W4YA 4BJ1A 4D4XA 2DGJA 3U9JA 2OEVA 2UUHA 3TQOA 1I4YA 1YZCA 1GQAA 3AG3C 1LKXA 1Q0DA 4W8PA 4X0RA 3SXYA 4EBJA 2EIKC 2D5RB 3UGOA 3AOUA 5AC4A 5L3QA 2EPMX 1GS9A 1YARO 2XS8A 2J0XA 1FFHA 2A0BA 1Z23A 2B0JA 1QZXA 1FAPB 3HNIA 3Q6MA 4OINF 2XS1A 5L0IA 2R7VA 2CNWD 4IWBA 3LNRA 3UMHA 5BQGA 4B6IA 3KYJA 5JRAA 4PACA 3DKAA 4G7OF 3KKBA 1Q0FA 1RKCA 3MYIA 3UMKA 5DQTA 4Q5SF 3PMRA 1M2VB 3IEEA 5T3TA 3TULA 1RMVA 1HE1A 3EFOB 2KJGA 1OKKD 2YEVA 4IAOA 2EPKX 4WGZA 4JKVA 1Y4CA 2LSEA 2R7TA 4BJ6C 2Q4FA 1LS1A 3GM3A 5CI9A 3G4ZA 2Y3GA 4KNWA 2YL7A 4CS9C 4FAPB 1QLEC 3QTHA 2PX0A 4CJGA 3M4BA 2DI3A 1U6HA 3ZQYA 3HNJA 1M57C 3UNGC 2HKVA 1ZHYA 2Y69C 1F1MA 4HE8D 4Z9HA 1ZHXA 2MHRA 1APCA 2ZPAA 2XL4A 4PK4A 1M6TA 3PCVA 3ZTMA 4CS7A 2V3CC 4EKWA 1V74B 1N1CA 3BEHA 3NKEA 3ZIBA 5EGYA 1HY5A 4JVSA 3FOOA 4JTAB 4ONSA 1V4AA 3FOPA 2XRHA 4U5BE 2A1DD 3T6GB 5DS4A 1A0BA 1FFTC 2L7AA 5DS6A 1OW8A 3DAFA 1ZU4A 5EK0A 5A6JA 1V55C 2IOQA 3DZAA 2LIGA 2VCBA 3U2MA 3JCUQ 3N2ZB 3FAJA 5A6AA 3GWLA 2ETSA 2CGEA 1MMDA 1FMWA 2IXNA 2WL8A 2ZXRA 4NCQA 3MLGA 3TJ5A 2G3VA 1RCPA 2M4EA 1TFOB 4U5GA 2LP4A 4ULWA 3S28A 2W9YA 2G3KA 2VB6A 3SXKA 2R7QA 1C03A 4JEBA 4JEAA 3ZTZA 4DBQA 3AG1C 5A6BA 1HW2A 4YL3A 4U5DE 4YT8A 4LLCA 2EIJC 3B0PA 5L3VA 3B71A 2XSEA 3FDQA 1O87A 1OW6A 3FVYA 4XWJA 4F4BA 1BR2A 4G7HF 5KYXA 3NMIA 2XLVA 4XTKA 3T6BA 3AGTA 1TWHA 4ANJA 2XLDA 2WVNA 4YL1A 2HZ8A 1OXKA 4O79A 4QDLA 3S9OA 3S27A 5JVEA 3W2WA 2R7XA 3G50A 1JMWA 4JC7A 3MFNA 3JSZA 4M63A 5CI8A 3E9VA 4PFOA 1YA7O 2QUPA 2J7PD 2PNOA 4JURI 4IGGA 5A6BD 2NUTB 4U5CE 4ER9A 2HS5A 4HEAJ 5L0CA 4OIQF 1NU7D 2XM4A 2Q00A 3TD7A 1NSGB 4MVRA 3RYLA 4MVQA 1WTYA 1Z6AA 2LFDA 3H2VA 1D0ZA 4AL0A 3DE8A 1OCRC 3UR3C 4A4AA 4DVZA 2QY9A 5KYXB 1ZHZA 2OU6A 4MW3A 3LLKA 5TJ5E 2R7RA 5DQZA 2F22A 3JYYA 3GEEA 3DMDA 2EPLX 3IQ5A 3L34A 3W2VA 1ZZPA 1BBHA 3QW1A 1TQGA 2CNWA 3H65A 3MBGA 2ZXPA 5T3WA 4CS9A 2B0HA 3R7CA 1CGNA 2GA0A 1U89A 2BE5F 4MTOA 3HNLA 4EIYA 3OWTA 3JTLO 3X2QC 2XXAA 4FX5A 3ASNC 3DWWA 4XPXA 4IAQA 3J06A 1CGME 1YJGA 5DLJA 1LM3B 3L0IA 1Q0GA 3LEOA 2EPOA 4UDVA 1G8XA 4KI2A 3IPMO 4E17A 1H9GA 5D92A 1E84A 2OCCC 4C3EA 2O9XA 4XLPF 4IRUA 2YQYA 5KYUA 1SR2A 4PFPA 1T6IA 2R25A 1MMNA 3ASOC 1QKRA 4O6MA 1LPEA 3ZSUA 3QZCA 4U5FE 3US6A 3TOLA 1H7IA 3K1IC 2IM8A 1MMGA 256BA 1S7ZA 2OG2A 4XPYA 2WZGA 3AGUA 3LESA 5JP7A 2P7VA 4DJ9A 3EPVA 4GEHA 4J7YA 4G7ZF 1ZU5A 4MQ9F 4EBBA 3NMJA 3GORA 1LVKA 3DI5A 3K7DA 3VF0A 1UFBA 3T6JA 3DXJF 4NY3A 2NUTA 1OXBA 4YWQA 4OIPF 2DYSC 2QLAA 4H54A 1Q0MA 1TWGA 3PDMP 4XPWA 2VCCA 1Z7Qc 3ZDLA 1OKKA 4OIRF 3I5QA 1T5OA 2AWCA 3IQTA 3IHUA 1NU9C 4CS8C 2H7VC 2HJMA 2QE9A 1EA8A 1VK5A 2YLDA 4HFKB 4G0HA 1SYQA 2HUJA 1ZW2A 4LDQA 3RVZA 1T9KA 4BJTA 3EGDB 4D4NA 1VMAA 1WN0A 3EG9B 3U3BA 1M2VA 4NTBA 1L3PA 1VOMA 1YAUO 4MVZA 3DD7A 2P1AA 2Q7RA 5FCLA 4CSAA 2OJQA 4JCZA 2D4UA 2LK4A 1A7DA 3TOMA 1G4US 3B0UX 1NLXA 1RJ9B 2R7SA 4LLEA 3GM2A 3CSKA 5E33A 3C8GD 2VASA 1K05A 2KNHA 3V5ZA 2UUIA 4WJ0A 3BRJA 3K66A 1Y6DA 2R7WA 3F46A 4A2NB 2R7UA 4JJGA 1JRAA 4P9FA 2L6GA 3QMKA 2GDCA 4MTFA 1H6GA 1LI5A 2PX3A 4IARA 1PCXA 2YVKA 1JOGA 2KYHA 2J46A 4N4WA 1OR2A 3HKKA 1ST6A 3RH3A 1T01A 5KYYA 3FMSA 1ORJA 2CDQA 2NSGA 2YWAA 4NTAA 4U5EE 1BDJB 2A6HF 3SYNA 5AC5A 3GEIA 3DM9B 2HV7A 4ULVA 4R32A 3R2PA 1LS4A 2P61A 4CSAC 4RBNA 2M64A 2Y39A 4ZLCA 3VM6A 4XEFA 2QTVA 2MWQA 1B68A 4MNDA 1A7EA 2L6HA 1EI7A
chains in the Genus database with same CATH topology
4AE4B 4C7OA 3SZRA 4DBRA 4YT4A 5HSWA 1BR1A 2A6EF 4P6IC 2EILC 3LS0A 4GYTA 3B0VC 3EGDA 4XLNF 4QI0A 3X1OA 1O5HA 3V7OA 2VH3A 1M56C 2A69F 4LERA 3ABMC 2C04A 4I1OB 2W45A 2WVOA 1JPJA 4PJLA 3N0TA 3ITFA 4I3MA 5F5HA 3OA1A 2IXMA 4YJWA 5KYWA 4PJMA 4LACB 3FHDA 2XXAB 3DM5A 3NRHA 2A68F 4AE4A 3EH2A 4E7ZA 3B9QA 4KNVA 1OCZC 2L81A 3RFYA 4CBEA 2PFDA 2YZSA 2FGYA 4JW1A 1J8YF 2PP4A 3Q7LA 2X51A 2IYLD 1D0XA 4PJJA 2IXOA 3I5PA 2PF4E 2GFHA 3MX3A 2Q9BA 4JZAA 3NKDA 4YT5A 3S29A 3NYLA 3JRTA 5E3CA 4O7GA 5KYNA 3EGXB 2J7PA 5B1BC 3EHNA 3HJCA 1MNDA 1D1AA 3EZHA 1M2OA 4N06A 2Q9AA 3ECSA 4IJJA 2Q3TA 4DOZA 1ZHTA 5B3SC 1D0YA 3ZG1A 3Q7GA 2KQ9A 4K7BA 2ZXOA 3AG2C 1FMVA 3KH2A 1TWCA 1VYKA 3HTKC 2Y3BA 3KL4A 1BR4A 3LAYA 3VYWA 1SZIA 3CZ6A 2Q9CA 2J0WA 3JYHA 1OCCC 2J9WA 4YT2A 4O6NA 5EHHA 3S0XA 2NG1A 3EFOA 1V54C 1MNEA 1Z3IX 3EQLF 3Q6NA 4JJFA 3NG1A 3ABLC 4ZLDA 4Q4ZF 2EIMC 4CIHA 5IY5C 4W8KA 2NUPB 4DVYP 4KBLA 3RIPA 3WODF 1W2WA 3W8HA 1IW7F 1D1BA 3SP1A 4OD5A 2G62A 2KGOA 3EZIA 3N24A 5E3AA 4BJ5A 4OD4A 2W4BA 3HLZA 5B1AC 5KYYB 2J9VA 2E87A 3E70C 4EWCA 2WB7A 5D91A 4K0DA 2JD3A 4BJ6A 4E7SA 4Q7CA 2Z15A 2WZLA 3LS1A 3O39A 2Y3HA 3CQZA 3VAYA 3T4RA 3EJNA 4JCHA 3KMIA 1VYIA 1RJ9A 3RKOF 4CS8A 4HFFB 2IXPA 3LLIA 3SNHA 4BG0A 3EH1A 1ZYRF 3AQBA 1NG1A 2P6VA 2R7OA 3EGXA 5DVWA 2EINC 2HV6A 3K6BA 3GANA 4J30B 2FFHA 2YHSA 1J8MF 1IZMA 4U5HA 3DAGA 1Z5ZA 1NZEA 4AX2A 2L9JA 3LEVA 5T1DB 4AK9A 3W8IA 3WG7C 4FWVA 3DJUB 4I1MA 2KW3C 2WVQA 3EHMA 1PD0A 1ZHWA 4RD9A 2J9UA 4KC9A 1WGWA 2ZXWC 1SMYF 3NYJA 2CW0F 5KYUB 4H4KC 3GODA 1TKNA 4OIOF 2NUPA 3NYMA 4J32B 1JPNA 2C03A 3AQCA 3I4UA 5KYWB 2H7BA 2Y3DA 5F5FA 1MMAA 3F47A 3OEOA 4C7OB 3ZVRA 3AG4C 2J45A 5E2QA 2H7OA 3SEOA 4I44A 3K1HA 2I8BA 2WZFA 3DJNB 4C3DA 3NDBB 2MYSA 4BJ5C 3M1CB 3K33A 4O6YA 1SF8A 3UGPA 3POVA 5DS5A 2W4MA 4QI2A 1D1CA 3EG9A 2V26A 4RDAA 1Z63A 3ZC4A 4BEJA 4PJNA 3LJBA 3PHF2 4FESA 1KU2A 3O6XA 3UMIA 1TWAA 5BUOA 1PD1A 4C3BA 3ABKC 1OCOC 1FTSA 1TR2A 3JT1A 2DYRC 4BJ1A 2DGJA 3AG3C 1LKXA 4X0RA 2EIKC 2D5RB 3UGOA 5L3QA 2J0XA 1FFHA 4OINF 1Z23A 2B0JA 1QZXA 3Q6MA 2R7VA 2CNWD 4IWBA 3LNRA 3UMHA 4B6IA 4G7OF 4Q5SF 3KKBA 3UMKA 5DQTA 3PMRA 1M2VB 3IEEA 5T3TA 3EFOB 2KJGA 1OKKD 2YEVA 4IAOA 2LSEA 2R7TA 4BJ6C 1LS1A 5CI9A 2Y3GA 4KNWA 4CS9C 1QLEC 2PX0A 1M57C 3UNGC 1ZHYA 2Y69C 4HE8D 1ZHXA 2ZPAA 2XL4A 4PK4A 4CS7A 2V3CC 1N1CA 3NKEA 3ZIBA 5EGYA 4JVSA 4U5BE 2XRHA 2A1DD 5DS4A 1FFTC 5DS6A 3DAFA 1ZU4A 1V55C 2IOQA 3DZAA 3JCUQ 3N2ZB 3FAJA 2CGEA 1MMDA 1FMWA 2IXNA 2WL8A 2ZXRA 3MLGA 2G3VA 2M4EA 4U5GA 4ULWA 3S28A 2W9YA 2G3KA 2VB6A 2R7QA 4DBQA 3AG1C 4U5DE 4YT8A 4LLCA 2EIJC 3B0PA 5L3VA 2XSEA 3FDQA 1O87A 4XWJA 3FVYA 4F4BA 1BR2A 4G7HF 5KYXA 4XTKA 3T6BA 4ANJA 1TWHA 2WVNA 3S27A 4O79A 2R7XA 4QDLA 3W2WA 3JSZA 4M63A 5CI8A 3E9VA 4PFOA 2J7PD 4JURI 2NUTB 4U5CE 4OIQF 4HEAJ 1NU7D 3TD7A 3RYLA 1Z6AA 1D0ZA 1OCRC 3UR3C 4DVZA 2QY9A 5KYXB 1ZHZA 3LLKA 2R7RA 5DQZA 3DMDA 3L34A 3W2VA 2CNWA 3H65A 2ZXPA 5T3WA 4CS9A 2BE5F 3OWTA 3X2QC 2XXAA 4FX5A 3ASNC 5DLJA 3L0IA 1G8XA 4KI2A 5D92A 2OCCC 4C3EA 2O9XA 4XLPF 4IRUA 5KYUA 4PFPA 1MMNA 3ASOC 4O6MA 3ZSUA 3QZCA 4U5FE 3K1IC 4YN0B 1MMGA 1S7ZA 2OG2A 2WZGA 3LESA 2P7VA 3EPVA 4GEHA 4G7ZF 1ZU5A 4MQ9F 4EBBA 1LVKA 3K7DA 3T6JA 3DXJF 4NY3A 2NUTA 4YWQA 4OIPF 2DYSC 1TWGA 1OKKA 4OIRF 3I5QA 4CS8C 1NU9C 2H7VC 1VK5A 4HFKB 4BJTA 4G0HA 3EGDB 1VMAA 3EG9B 1M2VA 1VOMA 5FCLA 3DD7A 4CSAA 3B0UX 1RJ9B 2R7SA 4LLEA 5E33A 3CSKA 2VASA 2KNHA 4WJ0A 3K66A 2R7WA 3F46A 4A2NB 2R7UA 4JJGA 3QMKA 2PX3A 1PCXA 2J46A 1ST6A 3RH3A 5KYYA 2CDQA 4U5EE 3SYNA 2A6HF 3DM9B 2HV7A 4CSAC 4RBNA 2Y39A 4ZLCA 2QTVA 2MWQA 4MNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VH3 A; 
#chains in the Genus database with same CATH topology
 1DOV A;  3HNK A;  2R05 A;  3L8J A;  4AE4 B;  1WWP A;  3SZR A;  4C7O A;  4DBR A;  4YT4 A;  5HSW A;  1BR1 A;  2A6E F;  2AVK A;  4P6I C;  2EIL C;  3LS0 A;  4GYT A;  2OKU A;  4BPM A;  3B0V C;  3EGD A;  3G4X A;  4QI0 A;  4MTG A;  4XLN F;  3X1O A;  1GGQ A;  1O5H A;  5K0I A;  3C63 A;  3V7O A;  2VH3 A;  3CAX A;  1M56 C;  1RXQ A;  2DB4 A;  3JZ0 A;  1QQ3 A;  2A69 F;  4LER A;  3ABM C;  1UG7 A;  2AU5 A;  1Q0K A;  2C04 A;  4I1O B;  1WAT A;  3M79 A;  2W45 A;  3S90 A;  2VCA A;  4N6C A;  1LE2 A;  2WVO A;  3ZQV A;  1JPJ A;  1LE4 A;  4DXW A;  2YL0 A;  4K1O A;  4JRZ A;  4PJL A;  5JSL A;  3N0T A;  2AP3 A;  3ITF A;  3LUT B;  4I3M A;  5F5H A;  3OA1 A;  2IXM A;  2YL3 A;  4YJW A;  5L0F A;  5KYW A;  4PJM A;  2NPU A;  3AJM A;  4LAC B;  2CYD A;  4JIO A;  3RQE A;  3FHD A;  3U3F A;  3C8G A;  2R02 A;  2XXA B;  2XM0 A;  3DM5 A;  3NRH A;  2H8A A;  2A68 F;  4AE4 A;  2A0U A;  1AVO B;  1YA9 A;  2CCY A;  3EH2 A;  4E7Z A;  3B9Q A;  4KNV A;  2XLH A;  4DRH B;  1OCZ C;  2L81 A;  3IQC A;  3RFY A;  4CBE A;  4CDA A;  2PFD A;  1R4T A;  2BL2 A;  2YZS A;  1VLT A;  2FGY A;  4JW1 A;  4CIP A;  1J8Y F;  1RKE B;  2PP4 A;  2HMZ A;  3Q7L A;  4LDR A;  4Z9I A;  2X51 A;  2JPU A;  2IYL D;  5FZT A;  1D0X A;  4PJJ A;  2IXO A;  1YVI A;  3I5P A;  2YRF A;  2NSF A;  2PF4 E;  2XLE A;  5F28 E;  5JLI A;  5COM A;  2GFH A;  3MX3 A;  2Q9B A;  4JZA A;  3NKD A;  2FAP B;  4YT5 A;  3S29 A;  3C7J A;  3NYL A;  3JRT A;  5E3C A;  4O7G A;  5KYN A;  3EGX B;  2J7P A;  2LD6 A;  5B1B C;  3EHN A;  4WGY A;  3HJC A;  4CDY A;  5L0J A;  1MND A;  1D1A A;  3FXH A;  1E2X A;  3RQF A;  3EZH A;  3TK0 A;  1M2O A;  4E18 A;  2JX0 A;  4N06 A;  2Q9A A;  3ECS A;  4N6H A;  3LNM B;  4XEV A;  5A6K A;  4IJJ A;  2Q3T A;  3JSE O;  1QVX A;  3C8Z A;  5BQI A;  4DOZ A;  4YN0 B;  2IBF A;  1ZHT A;  4G78 A;  3MYF A;  5B3S C;  3S84 A;  1D0Y A;  3ZG1 A;  3Q7G A;  3QVZ A;  2KQ9 A;  4JTD B;  4K7B A;  2ZXO A;  3K1I A;  2YLI A;  2TMV P;  3AG2 C;  1FMV A;  2OQM A;  3KPH A;  2RD9 A;  3KH2 A;  1TWC A;  3GWN A;  1VYK A;  4LDK A;  3HTK C;  2Y3B A;  3KL4 A;  1BR4 A;  3LAY A;  2I15 A;  3QVY A;  3WAQ A;  2LFF A;  4MVO A;  1SZI A;  2LQG A;  2Q9C A;  3CZ6 A;  3VYW A;  2HJ3 A;  2J0W A;  1NFO A;  4EBK A;  3JYH A;  1OCC C;  3O10 A;  1ZVZ A;  2J9W A;  2ICW G;  2YKZ A;  4YT2 A;  4O6N A;  4JE9 A;  2J8W A;  1ZW3 A;  3WHN A;  5EHH A;  4DRI B;  3S0X A;  2NG1 A;  3EFO A;  1V54 C;  1MNE A;  1Z3I X;  2XL6 A;  2HSB A;  1XWJ A;  3EQL F;  3Q6N A;  4JJF A;  3NG1 A;  2GWW A;  4CX9 A;  5A69 A;  3RVY A;  2EPN A;  5JT4 A;  3ABL C;  1U0B B;  4CJO A;  4ZLD A;  4BEM J;  4Q4Z F;  1LIH A;  5L0H A;  2EIM C;  4CIH A;  5IY5 C;  5GPG B;  1T6Q A;  4W8K A;  1BZ4 A;  5L0G A;  2NUP B;  3U8P A;  4KBL A;  3RIP A;  4DVY P;  1VLS A;  1EKY A;  1G4W R;  3WOD F;  1W2W A;  3CEX A;  3PHF 2;  3W8H A;  4E0I A;  1IW7 F;  1O3U A;  1D1B A;  1HE9 A;  1ORS C;  1CGO A;  3SP1 A;  1FR0 A;  1QPU A;  4MW8 A;  4OD5 A;  3U8V A;  2G62 A;  5BQH A;  2KGO A;  3EZI A;  3N24 A;  5E3A A;  3U2L A;  3C18 A;  4BJ5 A;  4JTC B;  4OD4 A;  2W4B A;  3HLZ A;  5L0D A;  5B1A C;  5B3I A;  5KYY B;  1JAF A;  1HMO A;  2J9V A;  4NTF A;  2E87 A;  3E70 C;  4MVS A;  2X0C A;  4EWC A;  2WB7 A;  2R03 A;  5D91 A;  4K0D A;  2JD3 A;  3H2U A;  4BJ6 A;  2GAQ A;  4E7S A;  4Q7C A;  2Z15 A;  5COG A;  2WZL A;  3LS1 A;  3C62 A;  2XLW A;  3O39 A;  4U9E A;  2Y3H A;  1DOW A;  1WOL A;  3CQZ A;  1MQV A;  1K40 A;  3VAY A;  4YL0 A;  3T4R A;  3EJN A;  4Z9J A;  3VRC A;  4JCH A;  3KMI A;  1VYI A;  1GM5 A;  3B29 A;  1E83 A;  1RJ9 A;  4E0H A;  3RKO F;  2QNL A;  4MVU A;  1QSP A;  4CS8 A;  2R9R B;  1VB5 A;  4HFF B;  2IXP A;  3LLI A;  3SNH A;  4BG0 A;  3EH1 A;  3U0C A;  4EUK B;  2VC9 A;  3L8I A;  1ZYR F;  1RKE A;  1TFK B;  3ATP A;  4GQH A;  3RQG A;  3AQB A;  1JR8 A;  1NG1 A;  2P6V A;  3RW0 A;  2R7O A;  3EGX A;  5DVW A;  2PBE A;  2EIN C;  2HV6 A;  3K6B A;  3GAN A;  4J30 B;  2FFH A;  2YHS A;  1J8M F;  1IZM A;  4U5H A;  3DAG A;  1YYJ A;  1Z5Z A;  1NZE A;  1XZP A;  2L9J A;  4L6R A;  3LEV A;  5T1D B;  4AX2 A;  4AK9 A;  4NC3 A;  3QW0 A;  3W8I A;  1ORY A;  1HW1 A;  1T6U A;  5HV9 A;  1H9T A;  3WG7 C;  4FWV A;  3DJU B;  4I1M A;  2LCH A;  5COF A;  2KW3 C;  2WVQ A;  5JS5 A;  2OEX A;  2RSE B;  3EHM A;  1OQC A;  1PD0 A;  1ZHW A;  4NQF A;  4RD9 A;  2BC5 A;  3U9M A;  1I5N A;  2J9U A;  1AUE A;  4KC9 A;  1PV3 A;  1WGW A;  2ZXW C;  2HSQ A;  2XL8 A;  5CIV A;  4P9T A;  3M4C A;  1SMY F;  3NYJ A;  2CW0 F;  4AL1 A;  5KYU B;  1S05 A;  2ASR A;  2J9B A;  1YLM A;  3GOD A;  3O55 A;  1TKN A;  4H4K C;  4CDV A;  1E86 A;  4OIO F;  3GEH A;  2NUP A;  3A9C A;  3DE9 A;  3NYM A;  1YDI A;  4J32 B;  1JPN A;  2C03 A;  3AQC A;  3I4U A;  5KYW B;  2H7B A;  2L6F A;  4XEK A;  1E85 A;  2XLO A;  2Y3D A;  2ZD9 A;  4MVM A;  1CPQ A;  1FNT c;  3SXZ A;  4XQ1 A;  5F5F A;  1MMA A;  1HMD A;  1AEP A;  1C02 A;  2HFI A;  3F47 A;  3FAP B;  3OEO A;  4YK5 A;  4C7O B;  3ZVR A;  2OJE D;  4PR9 A;  3AG4 C;  2J45 A;  4MS2 A;  1VTM P;  5E2Q A;  2HMQ A;  3TJ6 A;  2H7O A;  2YL1 A;  3SEO A;  2I8B A;  1C17 M;  2WZF A;  3K1H A;  1XZQ A;  4I44 A;  4U9D A;  3DJN B;  3ZWI A;  4C3D A;  4DRJ B;  3NDB B;  5JUA A;  1OW7 A;  2MYS A;  3SXM A;  3M15 A;  4BJ5 C;  4EHP A;  3U5S A;  3IQ6 A;  4IB4 A;  3M1C B;  3K33 A;  4O6Y A;  1NFN A;  1G5Z A;  1SF8 A;  2XLM A;  3JRM O;  3A11 A;  1YZA A;  3RF3 A;  3UGP A;  3POV A;  5DS5 A;  1YYX A;  1A41 A;  1WAS A;  1K04 A;  2YLG A;  1I4Z A;  2W4M A;  2KK1 A;  4QI2 A;  1CPR A;  1D1C A;  1KNY A;  1NBB A;  2V26 A;  3EG9 A;  3V5X A;  1LI7 A;  4RDA A;  2KSF A;  3ZC4 A;  1L7C A;  1Z63 A;  4BEJ A;  2P0N A;  2KC3 A;  4PJN A;  3LJB A;  3T9O A;  3KYI A;  4FES A;  1KU2 A;  3O6X A;  4WAB A;  1TWA A;  3UMI A;  5BUO A;  2OOC A;  3V5Y A;  1KTM A;  2AWY A;  3GM1 A;  1EQ1 A;  1OR3 A;  5AGF A;  1PD1 A;  1A7V A;  4C3B A;  1R5I D;  3C8G B;  3ABK C;  1OCO C;  3NMK A;  1FTS A;  1TR2 A;  4J7T A;  3JT1 A;  3L1M A;  2DYR C;  3W4Y A;  4BJ1 A;  4D4X A;  2DGJ A;  3U9J A;  2OEV A;  2UUH A;  3TQO A;  1I4Y A;  1YZC A;  1GQA A;  3AG3 C;  1LKX A;  1Q0D A;  4W8P A;  4X0R A;  3SXY A;  4EBJ A;  2EIK C;  2D5R B;  3UGO A;  3AOU A;  5AC4 A;  5L3Q A;  2EPM X;  1GS9 A;  1YAR O;  2XS8 A;  2J0X A;  1FFH A;  2A0B A;  1Z23 A;  2B0J A;  1QZX A;  1FAP B;  3HNI A;  3Q6M A;  4OIN F;  2XS1 A;  5L0I A;  2R7V A;  2CNW D;  4IWB A;  3LNR A;  3UMH A;  5BQG A;  4B6I A;  3KYJ A;  5JRA A;  4PAC A;  3DKA A;  4G7O F;  3KKB A;  1Q0F A;  1RKC A;  3MYI A;  3UMK A;  5DQT A;  4Q5S F;  3PMR A;  1M2V B;  3IEE A;  5T3T A;  3TUL A;  1RMV A;  1HE1 A;  3EFO B;  2KJG A;  1OKK D;  2YEV A;  4IAO A;  2EPK X;  4WGZ A;  4JKV A;  1Y4C A;  2LSE A;  2R7T A;  4BJ6 C;  2Q4F A;  1LS1 A;  3GM3 A;  5CI9 A;  3G4Z A;  2Y3G A;  4KNW A;  2YL7 A;  4CS9 C;  4FAP B;  1QLE C;  3QTH A;  2PX0 A;  4CJG A;  3M4B A;  2DI3 A;  1U6H A;  3ZQY A;  3HNJ A;  1M57 C;  3UNG C;  2HKV A;  1ZHY A;  2Y69 C;  1F1M A;  4HE8 D;  4Z9H A;  1ZHX A;  2MHR A;  1APC A;  2ZPA A;  2XL4 A;  4PK4 A;  1M6T A;  3PCV A;  3ZTM A;  4CS7 A;  2V3C C;  4EKW A;  1V74 B;  1N1C A;  3BEH A;  3NKE A;  3ZIB A;  5EGY A;  1HY5 A;  4JVS A;  3FOO A;  4JTA B;  4ONS A;  1V4A A;  3FOP A;  2XRH A;  4U5B E;  2A1D D;  3T6G B;  5DS4 A;  1A0B A;  1FFT C;  2L7A A;  5DS6 A;  1OW8 A;  3DAF A;  1ZU4 A;  5EK0 A;  5A6J A;  1V55 C;  2IOQ A;  3DZA A;  2LIG A;  2VCB A;  3U2M A;  3JCU Q;  3N2Z B;  3FAJ A;  5A6A A;  3GWL A;  2ETS A;  2CGE A;  1MMD A;  1FMW A;  2IXN A;  2WL8 A;  2ZXR A;  4NCQ A;  3MLG A;  3TJ5 A;  2G3V A;  1RCP A;  2M4E A;  1TFO B;  4U5G A;  2LP4 A;  4ULW A;  3S28 A;  2W9Y A;  2G3K A;  2VB6 A;  3SXK A;  2R7Q A;  1C03 A;  4JEB A;  4JEA A;  3ZTZ A;  4DBQ A;  3AG1 C;  5A6B A;  1HW2 A;  4YL3 A;  4U5D E;  4YT8 A;  4LLC A;  2EIJ C;  3B0P A;  5L3V A;  3B71 A;  2XSE A;  3FDQ A;  1O87 A;  1OW6 A;  3FVY A;  4XWJ A;  4F4B A;  1BR2 A;  4G7H F;  5KYX A;  3NMI A;  2XLV A;  4XTK A;  3T6B A;  3AGT A;  1TWH A;  4ANJ A;  2XLD A;  2WVN A;  4YL1 A;  2HZ8 A;  1OXK A;  4O79 A;  4QDL A;  3S9O A;  3S27 A;  5JVE A;  3W2W A;  2R7X A;  3G50 A;  1JMW A;  4JC7 A;  3MFN A;  3JSZ A;  4M63 A;  5CI8 A;  3E9V A;  4PFO A;  1YA7 O;  2QUP A;  2J7P D;  2PNO A;  4JUR I;  4IGG A;  5A6B D;  2NUT B;  4U5C E;  4ER9 A;  2HS5 A;  4HEA J;  5L0C A;  4OIQ F;  1NU7 D;  2XM4 A;  2Q00 A;  3TD7 A;  1NSG B;  4MVR A;  3RYL A;  4MVQ A;  1WTY A;  1Z6A A;  2LFD A;  3H2V A;  1D0Z A;  4AL0 A;  3DE8 A;  1OCR C;  3UR3 C;  4A4A A;  4DVZ A;  2QY9 A;  5KYX B;  1ZHZ A;  2OU6 A;  4MW3 A;  3LLK A;  5TJ5 E;  2R7R A;  5DQZ A;  2F22 A;  3JYY A;  3GEE A;  3DMD A;  2EPL X;  3IQ5 A;  3L34 A;  3W2V A;  1ZZP A;  1BBH A;  3QW1 A;  1TQG A;  2CNW A;  3H65 A;  3MBG A;  2ZXP A;  5T3W A;  4CS9 A;  2B0H A;  3R7C A;  1CGN A;  2GA0 A;  1U89 A;  2BE5 F;  4MTO A;  3HNL A;  4EIY A;  3OWT A;  3JTL O;  3X2Q C;  2XXA A;  4FX5 A;  3ASN C;  3DWW A;  4XPX A;  4IAQ A;  3J06 A;  1CGM E;  1YJG A;  5DLJ A;  1LM3 B;  3L0I A;  1Q0G A;  3LEO A;  2EPO A;  4UDV A;  1G8X A;  4KI2 A;  3IPM O;  4E17 A;  1H9G A;  5D92 A;  1E84 A;  2OCC C;  4C3E A;  2O9X A;  4XLP F;  4IRU A;  2YQY A;  5KYU A;  1SR2 A;  4PFP A;  1T6I A;  2R25 A;  1MMN A;  3ASO C;  1QKR A;  4O6M A;  1LPE A;  3ZSU A;  3QZC A;  4U5F E;  3US6 A;  3TOL A;  1H7I A;  3K1I C;  2IM8 A;  1MMG A;  256B A;  1S7Z A;  2OG2 A;  4XPY A;  2WZG A;  3AGU A;  3LES A;  5JP7 A;  2P7V A;  4DJ9 A;  3EPV A;  4GEH A;  4J7Y A;  4G7Z F;  1ZU5 A;  4MQ9 F;  4EBB A;  3NMJ A;  3GOR A;  1LVK A;  3DI5 A;  3K7D A;  3VF0 A;  1UFB A;  3T6J A;  3DXJ F;  4NY3 A;  2NUT A;  1OXB A;  4YWQ A;  4OIP F;  2DYS C;  2QLA A;  4H54 A;  1Q0M A;  1TWG A;  3PDM P;  4XPW A;  2VCC A;  1Z7Q c;  3ZDL A;  1OKK A;  4OIR F;  3I5Q A;  1T5O A;  2AWC A;  3IQT A;  3IHU A;  1NU9 C;  4CS8 C;  2H7V C;  2HJM A;  2QE9 A;  1EA8 A;  1VK5 A;  2YLD A;  4HFK B;  4G0H A;  1SYQ A;  2HUJ A;  1ZW2 A;  4LDQ A;  3RVZ A;  1T9K A;  4BJT A;  3EGD B;  4D4N A;  1VMA A;  1WN0 A;  3EG9 B;  3U3B A;  1M2V A;  4NTB A;  1L3P A;  1VOM A;  1YAU O;  4MVZ A;  3DD7 A;  2P1A A;  2Q7R A;  5FCL A;  4CSA A;  2OJQ A;  4JCZ A;  2D4U A;  2LK4 A;  1A7D A;  3TOM A;  1G4U S;  3B0U X;  1NLX A;  1RJ9 B;  2R7S A;  4LLE A;  3GM2 A;  3CSK A;  5E33 A;  3C8G D;  2VAS A;  1K05 A;  2KNH A;  3V5Z A;  2UUI A;  4WJ0 A;  3BRJ A;  3K66 A;  1Y6D A;  2R7W A;  3F46 A;  4A2N B;  2R7U A;  4JJG A;  1JRA A;  4P9F A;  2L6G A;  3QMK A;  2GDC A;  4MTF A;  1H6G A;  1LI5 A;  2PX3 A;  4IAR A;  1PCX A;  2YVK A;  1JOG A;  2KYH A;  2J46 A;  4N4W A;  1OR2 A;  3HKK A;  1ST6 A;  3RH3 A;  1T01 A;  5KYY A;  3FMS A;  1ORJ A;  2CDQ A;  2NSG A;  2YWA A;  4NTA A;  4U5E E;  1BDJ B;  2A6H F;  3SYN A;  5AC5 A;  3GEI A;  3DM9 B;  2HV7 A;  4ULV A;  4R32 A;  3R2P A;  1LS4 A;  2P61 A;  4CSA C;  4RBN A;  2M64 A;  2Y39 A;  4ZLC A;  3VM6 A;  4XEF A;  2QTV A;  2MWQ A;  1B68 A;  4MND A;  1A7E A;  2L6H A;  1EI7 A; 
#chains in the Genus database with same CATH homology
 4AE4 B;  4C7O A;  3SZR A;  4DBR A;  4YT4 A;  5HSW A;  1BR1 A;  2A6E F;  4P6I C;  2EIL C;  3LS0 A;  4GYT A;  3B0V C;  3EGD A;  4XLN F;  4QI0 A;  3X1O A;  1O5H A;  3V7O A;  2VH3 A;  1M56 C;  2A69 F;  4LER A;  3ABM C;  2C04 A;  4I1O B;  2W45 A;  2WVO A;  1JPJ A;  4PJL A;  3N0T A;  3ITF A;  4I3M A;  5F5H A;  3OA1 A;  2IXM A;  4YJW A;  5KYW A;  4PJM A;  4LAC B;  3FHD A;  2XXA B;  3DM5 A;  3NRH A;  2A68 F;  4AE4 A;  3EH2 A;  4E7Z A;  3B9Q A;  4KNV A;  1OCZ C;  2L81 A;  3RFY A;  4CBE A;  2PFD A;  2YZS A;  2FGY A;  4JW1 A;  1J8Y F;  2PP4 A;  3Q7L A;  2X51 A;  2IYL D;  1D0X A;  4PJJ A;  2IXO A;  3I5P A;  2PF4 E;  2GFH A;  3MX3 A;  2Q9B A;  4JZA A;  3NKD A;  4YT5 A;  3S29 A;  3NYL A;  3JRT A;  5E3C A;  4O7G A;  5KYN A;  3EGX B;  2J7P A;  5B1B C;  3EHN A;  3HJC A;  1MND A;  1D1A A;  3EZH A;  1M2O A;  4N06 A;  2Q9A A;  3ECS A;  4IJJ A;  2Q3T A;  4DOZ A;  1ZHT A;  5B3S C;  1D0Y A;  3ZG1 A;  3Q7G A;  2KQ9 A;  4K7B A;  2ZXO A;  3AG2 C;  1FMV A;  3KH2 A;  1TWC A;  1VYK A;  3HTK C;  2Y3B A;  3KL4 A;  1BR4 A;  3LAY A;  3VYW A;  1SZI A;  3CZ6 A;  2Q9C A;  2J0W A;  3JYH A;  1OCC C;  2J9W A;  4YT2 A;  4O6N A;  5EHH A;  3S0X A;  2NG1 A;  3EFO A;  1V54 C;  1MNE A;  1Z3I X;  3EQL F;  3Q6N A;  4JJF A;  3NG1 A;  3ABL C;  4ZLD A;  4Q4Z F;  2EIM C;  4CIH A;  5IY5 C;  4W8K A;  2NUP B;  4DVY P;  4KBL A;  3RIP A;  3WOD F;  1W2W A;  3W8H A;  1IW7 F;  1D1B A;  3SP1 A;  4OD5 A;  2G62 A;  2KGO A;  3EZI A;  3N24 A;  5E3A A;  4BJ5 A;  4OD4 A;  2W4B A;  3HLZ A;  5B1A C;  5KYY B;  2J9V A;  2E87 A;  3E70 C;  4EWC A;  2WB7 A;  5D91 A;  4K0D A;  2JD3 A;  4BJ6 A;  4E7S A;  4Q7C A;  2Z15 A;  2WZL A;  3LS1 A;  3O39 A;  2Y3H A;  3CQZ A;  3VAY A;  3T4R A;  3EJN A;  4JCH A;  3KMI A;  1VYI A;  1RJ9 A;  3RKO F;  4CS8 A;  4HFF B;  2IXP A;  3LLI A;  3SNH A;  4BG0 A;  3EH1 A;  1ZYR F;  3AQB A;  1NG1 A;  2P6V A;  2R7O A;  3EGX A;  5DVW A;  2EIN C;  2HV6 A;  3K6B A;  3GAN A;  4J30 B;  2FFH A;  2YHS A;  1J8M F;  1IZM A;  4U5H A;  3DAG A;  1Z5Z A;  1NZE A;  4AX2 A;  2L9J A;  3LEV A;  5T1D B;  4AK9 A;  3W8I A;  3WG7 C;  4FWV A;  3DJU B;  4I1M A;  2KW3 C;  2WVQ A;  3EHM A;  1PD0 A;  1ZHW A;  4RD9 A;  2J9U A;  4KC9 A;  1WGW A;  2ZXW C;  1SMY F;  3NYJ A;  2CW0 F;  5KYU B;  4H4K C;  3GOD A;  1TKN A;  4OIO F;  2NUP A;  3NYM A;  4J32 B;  1JPN A;  2C03 A;  3AQC A;  3I4U A;  5KYW B;  2H7B A;  2Y3D A;  5F5F A;  1MMA A;  3F47 A;  3OEO A;  4C7O B;  3ZVR A;  3AG4 C;  2J45 A;  5E2Q A;  2H7O A;  3SEO A;  4I44 A;  3K1H A;  2I8B A;  2WZF A;  3DJN B;  4C3D A;  3NDB B;  2MYS A;  4BJ5 C;  3M1C B;  3K33 A;  4O6Y A;  1SF8 A;  3UGP A;  3POV A;  5DS5 A;  2W4M A;  4QI2 A;  1D1C A;  3EG9 A;  2V26 A;  4RDA A;  1Z63 A;  3ZC4 A;  4BEJ A;  4PJN A;  3LJB A;  3PHF 2;  4FES A;  1KU2 A;  3O6X A;  3UMI A;  1TWA A;  5BUO A;  1PD1 A;  4C3B A;  3ABK C;  1OCO C;  1FTS A;  1TR2 A;  3JT1 A;  2DYR C;  4BJ1 A;  2DGJ A;  3AG3 C;  1LKX A;  4X0R A;  2EIK C;  2D5R B;  3UGO A;  5L3Q A;  2J0X A;  1FFH A;  4OIN F;  1Z23 A;  2B0J A;  1QZX A;  3Q6M A;  2R7V A;  2CNW D;  4IWB A;  3LNR A;  3UMH A;  4B6I A;  4G7O F;  4Q5S F;  3KKB A;  3UMK A;  5DQT A;  3PMR A;  1M2V B;  3IEE A;  5T3T A;  3EFO B;  2KJG A;  1OKK D;  2YEV A;  4IAO A;  2LSE A;  2R7T A;  4BJ6 C;  1LS1 A;  5CI9 A;  2Y3G A;  4KNW A;  4CS9 C;  1QLE C;  2PX0 A;  1M57 C;  3UNG C;  1ZHY A;  2Y69 C;  4HE8 D;  1ZHX A;  2ZPA A;  2XL4 A;  4PK4 A;  4CS7 A;  2V3C C;  1N1C A;  3NKE A;  3ZIB A;  5EGY A;  4JVS A;  4U5B E;  2XRH A;  2A1D D;  5DS4 A;  1FFT C;  5DS6 A;  3DAF A;  1ZU4 A;  1V55 C;  2IOQ A;  3DZA A;  3JCU Q;  3N2Z B;  3FAJ A;  2CGE A;  1MMD A;  1FMW A;  2IXN A;  2WL8 A;  2ZXR A;  3MLG A;  2G3V A;  2M4E A;  4U5G A;  4ULW A;  3S28 A;  2W9Y A;  2G3K A;  2VB6 A;  2R7Q A;  4DBQ A;  3AG1 C;  4U5D E;  4YT8 A;  4LLC A;  2EIJ C;  3B0P A;  5L3V A;  2XSE A;  3FDQ A;  1O87 A;  4XWJ A;  3FVY A;  4F4B A;  1BR2 A;  4G7H F;  5KYX A;  4XTK A;  3T6B A;  4ANJ A;  1TWH A;  2WVN A;  3S27 A;  4O79 A;  2R7X A;  4QDL A;  3W2W A;  3JSZ A;  4M63 A;  5CI8 A;  3E9V A;  4PFO A;  2J7P D;  4JUR I;  2NUT B;  4U5C E;  4OIQ F;  4HEA J;  1NU7 D;  3TD7 A;  3RYL A;  1Z6A A;  1D0Z A;  1OCR C;  3UR3 C;  4DVZ A;  2QY9 A;  5KYX B;  1ZHZ A;  3LLK A;  2R7R A;  5DQZ A;  3DMD A;  3L34 A;  3W2V A;  2CNW A;  3H65 A;  2ZXP A;  5T3W A;  4CS9 A;  2BE5 F;  3OWT A;  3X2Q C;  2XXA A;  4FX5 A;  3ASN C;  5DLJ A;  3L0I A;  1G8X A;  4KI2 A;  5D92 A;  2OCC C;  4C3E A;  2O9X A;  4XLP F;  4IRU A;  5KYU A;  4PFP A;  1MMN A;  3ASO C;  4O6M A;  3ZSU A;  3QZC A;  4U5F E;  3K1I C;  4YN0 B;  1MMG A;  1S7Z A;  2OG2 A;  2WZG A;  3LES A;  2P7V A;  3EPV A;  4GEH A;  4G7Z F;  1ZU5 A;  4MQ9 F;  4EBB A;  1LVK A;  3K7D A;  3T6J A;  3DXJ F;  4NY3 A;  2NUT A;  4YWQ A;  4OIP F;  2DYS C;  1TWG A;  1OKK A;  4OIR F;  3I5Q A;  4CS8 C;  1NU9 C;  2H7V C;  1VK5 A;  4HFK B;  4BJT A;  4G0H A;  3EGD B;  1VMA A;  3EG9 B;  1M2V A;  1VOM A;  5FCL A;  3DD7 A;  4CSA A;  3B0U X;  1RJ9 B;  2R7S A;  4LLE A;  5E33 A;  3CSK A;  2VAS A;  2KNH A;  4WJ0 A;  3K66 A;  2R7W A;  3F46 A;  4A2N B;  2R7U A;  4JJG A;  3QMK A;  2PX3 A;  1PCX A;  2J46 A;  1ST6 A;  3RH3 A;  5KYY A;  2CDQ A;  4U5E E;  3SYN A;  2A6H F;  3DM9 B;  2HV7 A;  4CSA C;  4RBN A;  2Y39 A;  4ZLC A;  2QTV A;  2MWQ A;  4MND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...