5F5HA

X-ray structure of roquin roq domain in complex with ox40 hexa-loop rna motif
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
148
structure length
148
Chain Sequence
QLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Roquin-1
publication title Roquin recognizes a non-canonical hexaloop structure in the 3'-UTR of Ox40.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 48
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5f5hA00
4ULWA 4QI2A 4YWQA 3X1OA 4ZLDA 5F5FA 4QI0A 4ZLCA 5F5HA
chains in the Genus database with same CATH superfamily
4OD4A 1HE1A 5TJ5E 4P6IC 4U5HA 4JTCB 2DB4A 2Y69C 4L6RA 2RD9A 5E3CA 1SR2A 4CS9C 3EG9A 3NMKA 1ORYA 5BQGA 4IJJA 5DS6A 2Q00A 3C8GA 3FOOA 1HW1A 1ZW3A 2NUPB 2PP4A 5L0FA 5A69A 3G50A 3JT1A 1ZU4A 2LD6A 2XLOA 3I4UA 3TQOA 4CJOA 1WTYA 2QUPA 3AQBA 4QDLA 3PDMP 3K66A 2HS5A 2EPNA 2VH3A 4JRZA 1MMAA 5JP7A 4JCHA 4H54A 3LS0A 4NC3A 1ORJA 1OR3A 1OR2A 1WWPA 2L6FA 4Z9IA 1VLTA 4PJLA 2CNWD 3WODF 1I5NA 3Q6NA 5D92A 4U9DA 3RW0A 1Q0DA 3MFNA 4MTGA 3SZRA 2I15A 4BJ5A 2GFHA 3EGDA 1V55C 3LNRA 4YK5A 1VTMP 3CAXA 4AE4A 2QLAA 3V5ZA 1BR4A 3IPMO 1NLXA 4Q5SF 3AJMA 1ORSC 3DMDA 3M4CA 2X0CA 5E3AA 2Y39A 3K33A 5T3WA 4EBKA 3UGOA 1MMDA 1NZEA 3S84A 4PR9A 4O6NA 1NU7D 4C3BA 4KI2A 3LESA 1VLSA 3HNLA 1J8MF 3L8IA 5JVEA 5KYXA 3FAPB 2J9BA 4G0HA 1A7DA 3AGUA 4FWVA 1LE4A 1XZPA 4XPWA 1VK5A 1FR0A 5FZTA 3RQGA 3PHF2 4NCQA 2ZXPA 3IQCA 4GEHA 3CQZA 4YT5A 1F1MA 2M64A 4RDAA 4JTAB 2XLMA 3W2WA 3ZWIA 1JAFA 4XTKA 4DRHB 3EFOA 4OIOF 3GODA 3O55A 5BUOA 1AEPA 4K1OA 3ZSUA 3GWLA 5E33A 1EI7A 2C04A 1QKRA 2BE5F 1O3UA 2Q7RA 1E85A 4IB4A 1Q0GA 4GQHA 1RCPA 2Y3BA 4U5BE 5B3SC 3QW0A 4QI2A 1KNYA 2ZXWC 1JR8A 256BA 4DJ9A 3M15A 1AUEA 4E17A 3W8IA 1TR2A 1NFOA 3DM5A 1G4US 2NSGA 4N4WA 4DXWA 2YQYA 3V5XA 2EPKX 1V54C 3FMSA 3NKDA 1Z63A 1J8YF 5L0GA 1YZAA 1ZYRF 3B0UX 2OKUA 1H9GA 3X1OA 2R7UA 3RYLA 5AC4A 3S9OA 2XXAB 2QY9A 2VB6A 2KJGA 1TFKB 3B9QA 2VCBA 3W4YA 2CCYA 2BC5A 1A41A 3GEHA 3ITFA 1Q0KA 2HV7A 2IXOA 4PACA 2HZ8A 1LVKA 1VYIA 4MNDA 4DBQA 3C8GD 2KC3A 3LJBA 2J8WA 2CNWA 1ZW2A 3ZDLA 2HUJA 4BJ5C 4DRIB 4JE9A 4A4AA 3KYIA 3EGXB 4JJGA 2YL3A 2YZSA 5DS4A 5CI8A 1JMWA 3G4ZA 4DVYP 2WB7A 5KYWA 4IAQA 1OCOC 3LAYA 2XRHA 3C62A 4PK4A 2GDCA 4ZLDA 4E7SA 2V26A 4XWJA 4BJ1A 1FMVA 4O6MA 3DJNB 1NFNA 1T9KA 1G8XA 5COGA 2XM0A 5DVWA 4CS7A 2LQGA 4E18A 4OIRF 1VYKA 3CEXA 4BJ6A 5COMA 2B0JA 1GQAA 3C18A 3IQ5A 3H2UA 3DAFA 3AG1C 3LNMB 2IM8A 2WL8A 3NMJA 5D91A 3C7JA 2J0WA 1T5OA 4E0HA 2IXPA 3DE8A 4LDQA 4N6HA 1A7VA 4KNWA 5JT4A 1R4TA 4RBNA 3RIPA 2R7TA 3T6GB 4MVQA 3DXJF 5L0CA 1Q0FA 4JC7A 5B1AC 1PCXA 4N6CA 3V5YA 2LFFA 3Q7LA 3Q6MA 4YN0B 5KYUA 1ZU5A 3SXKA 3GORA 4JIOA 4XLPF 1G4WR 4FX5A 4CSAA 2WZLA 3W2VA 2KGOA 4XPXA 1K04A 1WGWA 1WATA 2C03A 1OCZC 3F47A 4K0DA 2QE9A 3KL4A 2J45A 3DWWA 3O10A 4KC9A 3SXYA 1LS1A 3DM9B 1SMYF 1V4AA 3EH2A 2L7AA 2OU6A 1PV3A 2YLIA 4XEFA 4Z9JA 3VYWA 3B0PA 4YWQA 1YA9A 2YVKA 4ONSA 4CIHA 3AG4C 3JRMO 2R7VA 1YZCA 3SEOA 3QZCA 3UR3C 4HEAJ 1KTMA 4AL0A 3ECSA 2YEVA 2GA0A 4PFOA 3GM2A 3TOMA 4JZAA 1I4YA 2E87A 5A6BD 1ST6A 1TKNA 2P61A 3FOPA 3VF0A 2A0UA 4EUKB 1H6GA 2R7OA 3M1CB 2G3VA 3R7CA 3HJCA 1LI5A 4C7OA 5L3VA 4G7HF 3EGDB 3ASNC 1IW7F 5GPGB 4BPMA 2ZPAA 1XZQA 5T1DB 4P9TA 4AE4B 4DBRA 2KSFA 2Y3HA 3HKKA 3E9VA 4Z9HA 1FTSA 1M6TA 1M56C 1RKEA 1TWGA 2EPMX 2ZD9A 3N2ZB 2EIKC 1D0XA 2HKVA 3WG7C 4BJ6C 1RJ9B 1E2XA 4MVRA 2PX3A 3ZC4A 1T6IA 3OWTA 3J06A 2EIJC 1YJGA 2L6GA 4CBEA 5KYXB 2HMQA 2RSEB 2PNOA 1JPJA 2IYLD 2W9YA 3NRHA 2QNLA 4CJGA 1U0BB 4JEAA 1Z5ZA 3H2VA 1TFOB 2Y3GA 3UGPA 2PBEA 2W45A 5L0DA 2R7SA 2H7VC 2ICWG 2XL4A 1D0ZA 1HMOA 3DZAA 1QLEC 2YRFA 2LSEA 1D0YA 1FFHA 2NUTB 4LDKA 4MTFA 3RH3A 2A68F 4IARA 1SYQA 4ULWA 4A2NB 1OCCC 2NUPA 4D4NA 2GWWA 4CSAC 5AC5A 4HFKB 4YT2A 2Q9CA 1LPEA 2NSFA 2YL1A 3A9CA 3EPVA 2CW0F 1FNTc 3TJ5A 2J9WA 2MHRA 5F5FA 1CGME 2R03A 1SF8A 3Q7GA 4I1MA 3U2MA 4X0RA 4NQFA 1JPNA 1O5HA 2XM4A 3JYYA 1NU9C 2ZXOA 2H7BA 3NKEA 3PMRA 4N06A 2GAQA 4AX2A 1YA7O 4F4BA 3F46A 3QVZA 2P1AA 3EHMA 2ETSA 3NYMA 2YHSA 2HFIA 3K1IA 2J9UA 4EBJA 2HSQA 2W4BA 4BEMJ 2A0BA 1M57C 3KKBA 3ZQYA 4EWCA 4JEBA 5CIVA 2EPLX 4YJWA 3UMIA 5IY5C 3UNGC 2JPUA 3O6XA 2OG2A 4MW8A 3EHNA 4W8KA 4Q4ZF 5DLJA 4FESA 2XLHA 3AGTA 2J7PA 1O87A 4JCZA 4JJFA 4U5CE 3K7DA 5A6BA 2AVKA 1GS9A 3U0CA 1EKYA 2OEVA 3HNKA 2OQMA 1NG1A 3RFYA 4U5GA 3M4BA 3U3BA 1ZHXA 2LCHA 3WAQA 3A11A 2LP4A 4YL1A 4DRJB 1YARO 1M2VA 3MYIA 3TULA 2DGJA 3K6BA 3L8JA 2KK1A 5BQIA 1MQVA 4G78A 3L34A 4YT8A 2QTVA 1K05A 2VCAA 5JRAA 1SZIA 1ZHTA 3ABKC 4MQ9F 3NG1A 2I8BA 1LS4A 3LUTB 4CDVA 1UFBA 3M79A 1VB5A 1WOLA 3GEIA 2EPOA 5E2QA 4CS8C 2ZXRA 3L0IA 4JVSA 2VCCA 5EHHA 1BDJB 4LLEA 3T6JA 2HSBA 4MVMA 2PFDA 2WZGA 1UG7A 2JX0A 1IZMA 1A0BA 1OCRC 2R7WA 2XL8A 1B68A 3ATPA 3DD7A 1BR1A 1OW6A 4CDYA 3U3FA 1D1BA 4CIPA 2R9RB 1LE2A 1T6QA 4UDVA 2XXAA 2KYHA 2BL2A 4PFPA 4NY3A 3H65A 5KYYB 4U5DE 2M4EA 1HW2A 2OEXA 3SXMA 5DQZA 1JOGA 2YKZA 2NPUA 2VC9A 4XEKA 2XS8A 2VASA 1YVIA 4IWBA 2L9JA 2P7VA 3K1IC 4LACB 2HV6A 5L0IA 4O6YA 3EZHA 3T9OA 4WGZA 2H7OA 4CX9A 5JUAA 2A6HF 3RF3A 3RVZA 4E7ZA 2A1DD 3ZTZA 2G3KA 2UUHA 2Q3TA 2F22A 4O7GA 1OW7A 1YAUO 4O79A 3FAJA 3NMIA 3FVYA 5COFA 5AGFA 2O9XA 3EG9B 2W4MA 4J7YA 1ZHWA 2R05A 3C8GB 4IAOA 2XLDA 3VM6A 3LLIA 3JCUQ 2UUIA 5A6AA 4MVOA 1CGOA 3RVYA 4XLNF 1FAPB 1APCA 5A6KA 1PD1A 4PJNA 4MVZA 1T01A 1Y4CA 3B71A 4YL3A 4DVZA 1OXKA 2XLWA 2KW3C 2J7PD 2XSEA 1GGQA 4NTBA 5JS5A 5K0IA 2AWCA 2J46A 1RKEB 3EH1A 1MNDA 3KMIA 1LM3B 2L81A 3MYFA 2OJQA 3B29A 1OKKA 1KU2A 2IBFA 3T4RA 3TK0A 5F5HA 3QTHA 3HLZA 4ZLCA 3SP1A 2IOQA 3GWNA 3DI5A 3ZG1A 3EJNA 4YT4A 2A6EF 1TQGA 1ZHZA 4ANJA 1MMGA 4HFFB 1S05A 2NG1A 3HTKC 4AK9A 2R7XA 4QI0A 4WGYA 2YLDA 1A7EA 1U89A 2J9VA 3LS1A 3U5SA 4MW3A 3AG3C 4OINF 2Z15A 2X51A 3C63A 4AL1A 3AOUA 3DAGA 3NYJA 4IRUA 5B1BC 1Z3IX 3QVYA 3GM1A 3QW1A 4CS8A 2XLVA 5BQHA 1LKXA 3G4XA 4MTOA 1N1CA 1H9TA 1HE9A 4MVSA 1DOVA 4D4XA 3U8PA 3GEEA 5A6JA 1E84A 5CI9A 2AU5A 3TJ6A 4FAPB 4GYTA 3EFOB 4C3EA 1E83A 4MVUA 3S0XA 1DOWA 3U9JA 2J0XA 3NDBB 3LEVA 3TOLA 3VRCA 1E86A 2DYRC 4ULVA 3POVA 3KPHA 3GANA 4I44A 2OJED 1RKCA 2XL6A 1WASA 1NSGB 2AWYA 1CGNA 3NYLA 4CDAA 3AG2C 1R5ID 3HNJA 4NTFA 2P0NA 1QQ3A 2P6VA 2Q4FA 4G7ZF 1C03A 1Z7Qc 2JD3A 2H8AA 1HY5A 2Q9BA 3OA1A 4U5EE 3MBGA 4WJ0A 1RJ9A 3RQEA 1CPRA 1OXBA 4KBLA 2R7RA 4C3DA 3JSZA 1LI7A 3ZIBA 3IQTA 2LIGA 1ZHYA 4PJJA 3UMHA 1VMAA 2MYSA 3V7OA 2V3CC 3SNHA 4JTDB 3GM3A 1C17M 4OD5A 1AVOB 1RMVA 1M2VB 3DKAA 3IEEA 3UMKA 2YWAA 1YDIA 4BEJA 4J32B 3DE9A 5L0JA 3QMKA 3ABMC 4EKWA 1C02A 1OQCA 3E70C 3ABLC 3O39A 4I3MA 4M63A 2NUTA 5KYNA 1GM5A 4EHPA 2TMVP 2YL0A 3ZQVA 5KYWB 4JW1A 1QSPA 2DI3A 4Q7CA 4U5FE 3N0TA 2FGYA 5HV9A 1PD0A 2PX0A 2YL7A 3MLGA 1QVXA 1OKKD 2XS1A 1S7ZA 3BRJA 1M2OA 3HNIA 5T3TA 4G7OF 2FAPB 3FXHA 3JZ0A 1BBHA 4RD9A 1OW8A 5JSLA 2YLGA 3JTLO 2R25A 1MNEA 4EBBA 4ER9A 1BR2A 4IGGA 4U9EA 2LK4A 3ZTMA 5HSWA 3DJUB 1YYXA 1CPQA 1YLMA 3EQLF 3LLKA 2G62A 2EILC 2R7QA 4K7BA 1FFTC 1V74B 4KNVA 4LLCA 4R32A 2HJ3A 2R02A 4LDRA 3W8HA 4EIYA 2WVQA 4B6IA 4H4KC 3I5PA 3PCVA 5L3QA 2WZFA 4E0IA 2AP3A 1EA8A 2WVNA 2EINC 2KQ9A 5KYUB 4CS9A 4BJTA 1RXQA 2DYSC 2IXNA 1Z23A 3U2LA 3LEOA 1L3PA 4JKVA 3SXZA 4W8PA 3L1MA 2D4UA 1YYJA 2HJMA 3ZVRA 2HMZA 4XEVA 3RQFA 2OOCA 5EGYA 1D1AA 5F28E 5DQTA 4OIQF 2WVOA 2EIMC 5EK0A 3JSEO 3S29A 2MWQA 2Q9AA 3SYNA 2CGEA 1QZXA 3KYJA 4WABA 3EGXA 4J30B 1K40A 1U6HA 3JRTA 3R2PA 4MS2A 3C8ZA 3VAYA 4OIPF 3U9MA 2A69F 1EQ1A 1HMDA 1ZZPA 3US6A 1Q0MA 1WN0A 2FFHA 4LERA 2IXMA 1Y6DA 1TWCA 3S28A 3TD7A 4XPYA 3B0VC 1Z6AA 2CYDA 3MX3A 3T6BA 1TWAA 2PF4E 3FDQA 1L7CA 1TWHA 3OEOA 4I1OB 1D1CA 4YL0A 5B3IA 2B0HA 3IHUA 3S90A 4JURI 4C7OB 4XQ1A 3N24A 3EZIA 4DOZA 3AQCA 4PJMA 1VOMA 2D5RB 5DS5A 3U8VA 5KYYA 2OCCC 3IQ6A 5L0HA 3ASOC 3S27A 4J7TA 3RKOF 1I4ZA 3CZ6A 4P9FA 4BG0A 1NBBA 3JYHA 1ZVZA 2XLEA 3CSKA 3WHNA 3I5QA 4HE8D 1H7IA 3BEHA 5JLIA 2L6HA 1QPUA 3K1HA 1W2WA 1G5ZA 1XWJA 2ASRA 1BZ4A 2LFDA 3FHDA 5FCLA 1T6UA 4NTAA 1MMNA 2Y3DA 1JRAA 2CDQA 2KNHA 3X2QC 1FMWA 3KH2A 1LIHA
chains in the Genus database with same CATH topology
4OD4A 4P6IC 4U5HA 2Y69C 5E3CA 4CS9C 3EG9A 4IJJA 5DS6A 2NUPB 2PP4A 3JT1A 1ZU4A 3I4UA 3AQBA 4QDLA 3K66A 2VH3A 1MMAA 4JCHA 3LS0A 4PJLA 2CNWD 3WODF 3Q6NA 5D92A 3SZRA 4BJ5A 2GFHA 3EGDA 1V55C 3LNRA 4AE4A 1BR4A 4Q5SF 3DMDA 3UGOA 5E3AA 2Y39A 3K33A 5T3WA 1MMDA 1NZEA 4KI2A 4C3BA 4O6NA 1NU7D 3LESA 1J8MF 5KYXA 4G0HA 4FWVA 1VK5A 3PHF2 2ZXPA 4GEHA 3CQZA 4YT5A 4RDAA 3W2WA 4XTKA 3EFOA 4OIOF 3GODA 5BUOA 3ZSUA 5E33A 2C04A 2BE5F 4U5BE 2Y3BA 5B3SC 4QI2A 2ZXWC 3W8IA 1TR2A 3DM5A 1V54C 1Z63A 3NKDA 1J8YF 1ZYRF 3B0UX 3X1OA 2R7UA 3RYLA 2XXAB 2QY9A 2VB6A 2KJGA 3B9QA 3ITFA 2HV7A 2IXOA 1LVKA 1VYIA 4MNDA 4DBQA 3LJBA 2CNWA 4BJ5C 3EGXB 4JJGA 2YZSA 5DS4A 5CI8A 4DVYP 2WB7A 5KYWA 1OCOC 3LAYA 2XRHA 4PK4A 4ZLDA 4E7SA 2V26A 4XWJA 4BJ1A 1FMVA 4O6MA 3DJNB 1G8XA 5DVWA 4CS7A 4OIRF 1VYKA 4BJ6A 2B0JA 3DAFA 3AG1C 2WL8A 5D91A 2J0WA 2IXPA 4KNWA 4RBNA 2R7TA 3RIPA 3DXJF 5B1AC 1PCXA 3Q7LA 5KYUA 3Q6MA 4YN0B 1ZU5A 4XLPF 4FX5A 4CSAA 2WZLA 3W2VA 2KGOA 1WGWA 2C03A 3F47A 4K0DA 1OCZC 3KL4A 2J45A 4KC9A 1LS1A 3DM9B 1SMYF 3EH2A 3VYWA 3B0PA 4YWQA 4CIHA 3AG4C 2R7VA 3SEOA 3QZCA 3UR3C 4HEAJ 3ECSA 2YEVA 4PFOA 4JZAA 2E87A 1ST6A 1TKNA 2R7OA 3M1CB 2G3VA 3HJCA 4C7OA 5L3VA 4G7HF 3EGDB 3ASNC 1IW7F 4DBRA 2ZPAA 5T1DB 4AE4B 2Y3HA 3E9VA 1FTSA 1M56C 1TWGA 3N2ZB 2EIKC 1D0XA 3WG7C 4BJ6C 1RJ9B 2PX3A 3ZC4A 3OWTA 2EIJC 4CBEA 5KYXB 2W9YA 1JPJA 2IYLD 3NRHA 1Z5ZA 3UGPA 2Y3GA 2W45A 2R7SA 2H7VC 3DZAA 2XL4A 1D0ZA 1QLEC 2LSEA 1FFHA 1D0YA 2NUTB 3RH3A 4A2NB 2A68F 4ULWA 1OCCC 2NUPA 4CSAC 4HFKB 4YT2A 2Q9CA 3EPVA 2CW0F 2J9WA 5F5FA 1SF8A 3Q7GA 4I1MA 4X0RA 3UNGC 1JPNA 1O5HA 3NKEA 1NU9C 2ZXOA 2H7BA 3PMRA 4N06A 4AX2A 4F4BA 3F46A 3EHMA 3NYMA 2YHSA 2J9UA 2W4BA 2KNHA 1M57C 3KKBA 4EWCA 4YJWA 3UMIA 5IY5C 3O6XA 2OG2A 4Q4ZF 3EHNA 4W8KA 5DLJA 4FESA 4U5CE 4JJFA 2J7PA 1O87A 3K7DA 1NG1A 3RFYA 4U5GA 1ZHXA 1M2VA 2DGJA 3K6BA 3L34A 4YT8A 2QTVA 1SZIA 1ZHTA 3ABKC 4MQ9F 3NG1A 2I8BA 4CS8C 5E2QA 2ZXRA 3L0IA 4JVSA 5EHHA 4LLEA 3T6JA 2PFDA 2WZGA 1IZMA 1OCRC 2R7WA 1BR1A 1D1BA 2XXAA 4PFPA 4NY3A 3H65A 5KYYB 4U5DE 2M4EA 5DQZA 2VASA 4IWBA 4LACB 2L9JA 2P7VA 3K1IC 2HV6A 4O6YA 3EZHA 2H7OA 2A6HF 4E7ZA 2A1DD 2G3KA 2Q3TA 4O7GA 4O79A 3FAJA 3FVYA 2O9XA 3EG9B 2W4MA 1ZHWA 4IAOA 3LLIA 3JCUQ 4XLNF 1PD1A 4PJNA 4DVZA 2KW3C 2J7PD 2XSEA 2J46A 3EH1A 1MNDA 3KMIA 2L81A 1OKKA 1KU2A 3T4RA 5F5HA 4ZLCA 3HLZA 3SP1A 2IOQA 3ZG1A 3EJNA 4YT4A 2A6EF 4ANJA 1ZHZA 1MMGA 4HFFB 4AK9A 2NG1A 3HTKC 2R7XA 4QI0A 3LS1A 2J9VA 3AG3C 4OINF 2Z15A 2X51A 4IRUA 3DAGA 3NYJA 5B1BC 1Z3IX 4CS8A 1LKXA 1N1CA 5CI9A 4GYTA 3EFOB 4C3EA 3S0XA 2J0XA 3NDBB 3LEVA 2DYRC 3POVA 3GANA 4I44A 3NYLA 3AG2C 2P6VA 4G7ZF 2JD3A 2Q9BA 3OA1A 4U5EE 4WJ0A 1RJ9A 4KBLA 2R7RA 4C3DA 3JSZA 3ZIBA 4PJJA 1ZHYA 3UMHA 1VMAA 2MYSA 3V7OA 2V3CC 3SNHA 4OD5A 1M2VB 3IEEA 3UMKA 4BEJA 4J32B 3QMKA 3ABMC 3E70C 3ABLC 3O39A 4I3MA 4M63A 2NUTA 5KYNA 5KYWB 4JW1A 4Q7CA 4U5FE 3N0TA 2FGYA 1PD0A 2PX0A 3MLGA 1OKKD 5T3TA 1S7ZA 1M2OA 4G7OF 4RD9A 4EBBA 1MNEA 1BR2A 5HSWA 3DJUB 3EQLF 3LLKA 2G62A 2EILC 2R7QA 4K7BA 1FFTC 4KNVA 4LLCA 3W8HA 2WVQA 4B6IA 4H4KC 3I5PA 5L3QA 2WZFA 2WVNA 5KYUB 2EINC 2KQ9A 4CS9A 4BJTA 2DYSC 2IXNA 1Z23A 3ZVRA 5EGYA 1D1AA 5DQTA 4OIQF 2WVOA 2EIMC 3S29A 2MWQA 2Q9AA 3SYNA 2CGEA 1QZXA 3EGXA 4J30B 3JRTA 3VAYA 4OIPF 2A69F 2FFHA 4LERA 2IXMA 1TWCA 3S28A 3TD7A 3B0VC 1Z6AA 3T6BA 3MX3A 1TWAA 2PF4E 3FDQA 1TWHA 4I1OB 3OEOA 1D1CA 4C7OB 4JURI 3N24A 3EZIA 4DOZA 3AQCA 4PJMA 1VOMA 2D5RB 5DS5A 5KYYA 2OCCC 3ASOC 3S27A 3RKOF 3CZ6A 4BG0A 3JYHA 3CSKA 3I5QA 4HE8D 3K1HA 1W2WA 3FHDA 5FCLA 1MMNA 2Y3DA 2CDQA 3DD7A 3X2QC 1FMWA 3KH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ULW A;  4QI2 A;  4YWQ A;  3X1O A;  4ZLD A;  5F5F A;  4QI0 A;  4ZLC A;  5F5H A; 
#chains in the Genus database with same CATH topology
 4OD4 A;  1HE1 A;  5TJ5 E;  4P6I C;  4U5H A;  4JTC B;  2DB4 A;  2Y69 C;  4L6R A;  2RD9 A;  5E3C A;  1SR2 A;  4CS9 C;  3EG9 A;  3NMK A;  1ORY A;  5BQG A;  4IJJ A;  5DS6 A;  2Q00 A;  3C8G A;  3FOO A;  1HW1 A;  1ZW3 A;  2NUP B;  2PP4 A;  5L0F A;  5A69 A;  3G50 A;  3JT1 A;  1ZU4 A;  2LD6 A;  2XLO A;  3I4U A;  3TQO A;  4CJO A;  1WTY A;  2QUP A;  3AQB A;  4QDL A;  3PDM P;  3K66 A;  2HS5 A;  2EPN A;  2VH3 A;  4JRZ A;  1MMA A;  5JP7 A;  4JCH A;  4H54 A;  3LS0 A;  4NC3 A;  1ORJ A;  1OR3 A;  1OR2 A;  1WWP A;  2L6F A;  4Z9I A;  1VLT A;  4PJL A;  2CNW D;  3WOD F;  1I5N A;  3Q6N A;  5D92 A;  4U9D A;  3RW0 A;  1Q0D A;  3MFN A;  4MTG A;  3SZR A;  2I15 A;  4BJ5 A;  2GFH A;  3EGD A;  1V55 C;  3LNR A;  4YK5 A;  1VTM P;  3CAX A;  4AE4 A;  2QLA A;  3V5Z A;  1BR4 A;  3IPM O;  1NLX A;  4Q5S F;  3AJM A;  1ORS C;  3DMD A;  3M4C A;  2X0C A;  5E3A A;  2Y39 A;  3K33 A;  5T3W A;  4EBK A;  3UGO A;  1MMD A;  1NZE A;  3S84 A;  4PR9 A;  4O6N A;  1NU7 D;  4C3B A;  4KI2 A;  3LES A;  1VLS A;  3HNL A;  1J8M F;  3L8I A;  5JVE A;  5KYX A;  3FAP B;  2J9B A;  4G0H A;  1A7D A;  3AGU A;  4FWV A;  1LE4 A;  1XZP A;  4XPW A;  1VK5 A;  1FR0 A;  5FZT A;  3RQG A;  3PHF 2;  4NCQ A;  2ZXP A;  3IQC A;  4GEH A;  3CQZ A;  4YT5 A;  1F1M A;  2M64 A;  4RDA A;  4JTA B;  2XLM A;  3W2W A;  3ZWI A;  1JAF A;  4XTK A;  4DRH B;  3EFO A;  4OIO F;  3GOD A;  3O55 A;  5BUO A;  1AEP A;  4K1O A;  3ZSU A;  3GWL A;  5E33 A;  1EI7 A;  2C04 A;  1QKR A;  2BE5 F;  1O3U A;  2Q7R A;  1E85 A;  4IB4 A;  1Q0G A;  4GQH A;  1RCP A;  2Y3B A;  4U5B E;  5B3S C;  3QW0 A;  4QI2 A;  1KNY A;  2ZXW C;  1JR8 A;  256B A;  4DJ9 A;  3M15 A;  1AUE A;  4E17 A;  3W8I A;  1TR2 A;  1NFO A;  3DM5 A;  1G4U S;  2NSG A;  4N4W A;  4DXW A;  2YQY A;  3V5X A;  2EPK X;  1V54 C;  3FMS A;  3NKD A;  1Z63 A;  1J8Y F;  5L0G A;  1YZA A;  1ZYR F;  3B0U X;  2OKU A;  1H9G A;  3X1O A;  2R7U A;  3RYL A;  5AC4 A;  3S9O A;  2XXA B;  2QY9 A;  2VB6 A;  2KJG A;  1TFK B;  3B9Q A;  2VCB A;  3W4Y A;  2CCY A;  2BC5 A;  1A41 A;  3GEH A;  3ITF A;  1Q0K A;  2HV7 A;  2IXO A;  4PAC A;  2HZ8 A;  1LVK A;  1VYI A;  4MND A;  4DBQ A;  3C8G D;  2KC3 A;  3LJB A;  2J8W A;  2CNW A;  1ZW2 A;  3ZDL A;  2HUJ A;  4BJ5 C;  4DRI B;  4JE9 A;  4A4A A;  3KYI A;  3EGX B;  4JJG A;  2YL3 A;  2YZS A;  5DS4 A;  5CI8 A;  1JMW A;  3G4Z A;  4DVY P;  2WB7 A;  5KYW A;  4IAQ A;  1OCO C;  3LAY A;  2XRH A;  3C62 A;  4PK4 A;  2GDC A;  4ZLD A;  4E7S A;  2V26 A;  4XWJ A;  4BJ1 A;  1FMV A;  4O6M A;  3DJN B;  1NFN A;  1T9K A;  1G8X A;  5COG A;  2XM0 A;  5DVW A;  4CS7 A;  2LQG A;  4E18 A;  4OIR F;  1VYK A;  3CEX A;  4BJ6 A;  5COM A;  2B0J A;  1GQA A;  3C18 A;  3IQ5 A;  3H2U A;  3DAF A;  3AG1 C;  3LNM B;  2IM8 A;  2WL8 A;  3NMJ A;  5D91 A;  3C7J A;  2J0W A;  1T5O A;  4E0H A;  2IXP A;  3DE8 A;  4LDQ A;  4N6H A;  1A7V A;  4KNW A;  5JT4 A;  1R4T A;  4RBN A;  3RIP A;  2R7T A;  3T6G B;  4MVQ A;  3DXJ F;  5L0C A;  1Q0F A;  4JC7 A;  5B1A C;  1PCX A;  4N6C A;  3V5Y A;  2LFF A;  3Q7L A;  3Q6M A;  4YN0 B;  5KYU A;  1ZU5 A;  3SXK A;  3GOR A;  4JIO A;  4XLP F;  1G4W R;  4FX5 A;  4CSA A;  2WZL A;  3W2V A;  2KGO A;  4XPX A;  1K04 A;  1WGW A;  1WAT A;  2C03 A;  1OCZ C;  3F47 A;  4K0D A;  2QE9 A;  3KL4 A;  2J45 A;  3DWW A;  3O10 A;  4KC9 A;  3SXY A;  1LS1 A;  3DM9 B;  1SMY F;  1V4A A;  3EH2 A;  2L7A A;  2OU6 A;  1PV3 A;  2YLI A;  4XEF A;  4Z9J A;  3VYW A;  3B0P A;  4YWQ A;  1YA9 A;  2YVK A;  4ONS A;  4CIH A;  3AG4 C;  3JRM O;  2R7V A;  1YZC A;  3SEO A;  3QZC A;  3UR3 C;  4HEA J;  1KTM A;  4AL0 A;  3ECS A;  2YEV A;  2GA0 A;  4PFO A;  3GM2 A;  3TOM A;  4JZA A;  1I4Y A;  2E87 A;  5A6B D;  1ST6 A;  1TKN A;  2P61 A;  3FOP A;  3VF0 A;  2A0U A;  4EUK B;  1H6G A;  2R7O A;  3M1C B;  2G3V A;  3R7C A;  3HJC A;  1LI5 A;  4C7O A;  5L3V A;  4G7H F;  3EGD B;  3ASN C;  1IW7 F;  5GPG B;  4BPM A;  2ZPA A;  1XZQ A;  5T1D B;  4P9T A;  4AE4 B;  4DBR A;  2KSF A;  2Y3H A;  3HKK A;  3E9V A;  4Z9H A;  1FTS A;  1M6T A;  1M56 C;  1RKE A;  1TWG A;  2EPM X;  2ZD9 A;  3N2Z B;  2EIK C;  1D0X A;  2HKV A;  3WG7 C;  4BJ6 C;  1RJ9 B;  1E2X A;  4MVR A;  2PX3 A;  3ZC4 A;  1T6I A;  3OWT A;  3J06 A;  2EIJ C;  1YJG A;  2L6G A;  4CBE A;  5KYX B;  2HMQ A;  2RSE B;  2PNO A;  1JPJ A;  2IYL D;  2W9Y A;  3NRH A;  2QNL A;  4CJG A;  1U0B B;  4JEA A;  1Z5Z A;  3H2V A;  1TFO B;  2Y3G A;  3UGP A;  2PBE A;  2W45 A;  5L0D A;  2R7S A;  2H7V C;  2ICW G;  2XL4 A;  1D0Z A;  1HMO A;  3DZA A;  1QLE C;  2YRF A;  2LSE A;  1D0Y A;  1FFH A;  2NUT B;  4LDK A;  4MTF A;  3RH3 A;  2A68 F;  4IAR A;  1SYQ A;  4ULW A;  4A2N B;  1OCC C;  2NUP A;  4D4N A;  2GWW A;  4CSA C;  5AC5 A;  4HFK B;  4YT2 A;  2Q9C A;  1LPE A;  2NSF A;  2YL1 A;  3A9C A;  3EPV A;  2CW0 F;  1FNT c;  3TJ5 A;  2J9W A;  2MHR A;  5F5F A;  1CGM E;  2R03 A;  1SF8 A;  3Q7G A;  4I1M A;  3U2M A;  4X0R A;  4NQF A;  1JPN A;  1O5H A;  2XM4 A;  3JYY A;  1NU9 C;  2ZXO A;  2H7B A;  3NKE A;  3PMR A;  4N06 A;  2GAQ A;  4AX2 A;  1YA7 O;  4F4B A;  3F46 A;  3QVZ A;  2P1A A;  3EHM A;  2ETS A;  3NYM A;  2YHS A;  2HFI A;  3K1I A;  2J9U A;  4EBJ A;  2HSQ A;  2W4B A;  4BEM J;  2A0B A;  1M57 C;  3KKB A;  3ZQY A;  4EWC A;  4JEB A;  5CIV A;  2EPL X;  4YJW A;  3UMI A;  5IY5 C;  3UNG C;  2JPU A;  3O6X A;  2OG2 A;  4MW8 A;  3EHN A;  4W8K A;  4Q4Z F;  5DLJ A;  4FES A;  2XLH A;  3AGT A;  2J7P A;  1O87 A;  4JCZ A;  4JJF A;  4U5C E;  3K7D A;  5A6B A;  2AVK A;  1GS9 A;  3U0C A;  1EKY A;  2OEV A;  3HNK A;  2OQM A;  1NG1 A;  3RFY A;  4U5G A;  3M4B A;  3U3B A;  1ZHX A;  2LCH A;  3WAQ A;  3A11 A;  2LP4 A;  4YL1 A;  4DRJ B;  1YAR O;  1M2V A;  3MYI A;  3TUL A;  2DGJ A;  3K6B A;  3L8J A;  2KK1 A;  5BQI A;  1MQV A;  4G78 A;  3L34 A;  4YT8 A;  2QTV A;  1K05 A;  2VCA A;  5JRA A;  1SZI A;  1ZHT A;  3ABK C;  4MQ9 F;  3NG1 A;  2I8B A;  1LS4 A;  3LUT B;  4CDV A;  1UFB A;  3M79 A;  1VB5 A;  1WOL A;  3GEI A;  2EPO A;  5E2Q A;  4CS8 C;  2ZXR A;  3L0I A;  4JVS A;  2VCC A;  5EHH A;  1BDJ B;  4LLE A;  3T6J A;  2HSB A;  4MVM A;  2PFD A;  2WZG A;  1UG7 A;  2JX0 A;  1IZM A;  1A0B A;  1OCR C;  2R7W A;  2XL8 A;  1B68 A;  3ATP A;  3DD7 A;  1BR1 A;  1OW6 A;  4CDY A;  3U3F A;  1D1B A;  4CIP A;  2R9R B;  1LE2 A;  1T6Q A;  4UDV A;  2XXA A;  2KYH A;  2BL2 A;  4PFP A;  4NY3 A;  3H65 A;  5KYY B;  4U5D E;  2M4E A;  1HW2 A;  2OEX A;  3SXM A;  5DQZ A;  1JOG A;  2YKZ A;  2NPU A;  2VC9 A;  4XEK A;  2XS8 A;  2VAS A;  1YVI A;  4IWB A;  2L9J A;  2P7V A;  3K1I C;  4LAC B;  2HV6 A;  5L0I A;  4O6Y A;  3EZH A;  3T9O A;  4WGZ A;  2H7O A;  4CX9 A;  5JUA A;  2A6H F;  3RF3 A;  3RVZ A;  4E7Z A;  2A1D D;  3ZTZ A;  2G3K A;  2UUH A;  2Q3T A;  2F22 A;  4O7G A;  1OW7 A;  1YAU O;  4O79 A;  3FAJ A;  3NMI A;  3FVY A;  5COF A;  5AGF A;  2O9X A;  3EG9 B;  2W4M A;  4J7Y A;  1ZHW A;  2R05 A;  3C8G B;  4IAO A;  2XLD A;  3VM6 A;  3LLI A;  3JCU Q;  2UUI A;  5A6A A;  4MVO A;  1CGO A;  3RVY A;  4XLN F;  1FAP B;  1APC A;  5A6K A;  1PD1 A;  4PJN A;  4MVZ A;  1T01 A;  1Y4C A;  3B71 A;  4YL3 A;  4DVZ A;  1OXK A;  2XLW A;  2KW3 C;  2J7P D;  2XSE A;  1GGQ A;  4NTB A;  5JS5 A;  5K0I A;  2AWC A;  2J46 A;  1RKE B;  3EH1 A;  1MND A;  3KMI A;  1LM3 B;  2L81 A;  3MYF A;  2OJQ A;  3B29 A;  1OKK A;  1KU2 A;  2IBF A;  3T4R A;  3TK0 A;  5F5H A;  3QTH A;  3HLZ A;  4ZLC A;  3SP1 A;  2IOQ A;  3GWN A;  3DI5 A;  3ZG1 A;  3EJN A;  4YT4 A;  2A6E F;  1TQG A;  1ZHZ A;  4ANJ A;  1MMG A;  4HFF B;  1S05 A;  2NG1 A;  3HTK C;  4AK9 A;  2R7X A;  4QI0 A;  4WGY A;  2YLD A;  1A7E A;  1U89 A;  2J9V A;  3LS1 A;  3U5S A;  4MW3 A;  3AG3 C;  4OIN F;  2Z15 A;  2X51 A;  3C63 A;  4AL1 A;  3AOU A;  3DAG A;  3NYJ A;  4IRU A;  5B1B C;  1Z3I X;  3QVY A;  3GM1 A;  3QW1 A;  4CS8 A;  2XLV A;  5BQH A;  1LKX A;  3G4X A;  4MTO A;  1N1C A;  1H9T A;  1HE9 A;  4MVS A;  1DOV A;  4D4X A;  3U8P A;  3GEE A;  5A6J A;  1E84 A;  5CI9 A;  2AU5 A;  3TJ6 A;  4FAP B;  4GYT A;  3EFO B;  4C3E A;  1E83 A;  4MVU A;  3S0X A;  1DOW A;  3U9J A;  2J0X A;  3NDB B;  3LEV A;  3TOL A;  3VRC A;  1E86 A;  2DYR C;  4ULV A;  3POV A;  3KPH A;  3GAN A;  4I44 A;  2OJE D;  1RKC A;  2XL6 A;  1WAS A;  1NSG B;  2AWY A;  1CGN A;  3NYL A;  4CDA A;  3AG2 C;  1R5I D;  3HNJ A;  4NTF A;  2P0N A;  1QQ3 A;  2P6V A;  2Q4F A;  4G7Z F;  1C03 A;  1Z7Q c;  2JD3 A;  2H8A A;  1HY5 A;  2Q9B A;  3OA1 A;  4U5E E;  3MBG A;  4WJ0 A;  1RJ9 A;  3RQE A;  1CPR A;  1OXB A;  4KBL A;  2R7R A;  4C3D A;  3JSZ A;  1LI7 A;  3ZIB A;  3IQT A;  2LIG A;  1ZHY A;  4PJJ A;  3UMH A;  1VMA A;  2MYS A;  3V7O A;  2V3C C;  3SNH A;  4JTD B;  3GM3 A;  1C17 M;  4OD5 A;  1AVO B;  1RMV A;  1M2V B;  3DKA A;  3IEE A;  3UMK A;  2YWA A;  1YDI A;  4BEJ A;  4J32 B;  3DE9 A;  5L0J A;  3QMK A;  3ABM C;  4EKW A;  1C02 A;  1OQC A;  3E70 C;  3ABL C;  3O39 A;  4I3M A;  4M63 A;  2NUT A;  5KYN A;  1GM5 A;  4EHP A;  2TMV P;  2YL0 A;  3ZQV A;  5KYW B;  4JW1 A;  1QSP A;  2DI3 A;  4Q7C A;  4U5F E;  3N0T A;  2FGY A;  5HV9 A;  1PD0 A;  2PX0 A;  2YL7 A;  3MLG A;  1QVX A;  1OKK D;  2XS1 A;  1S7Z A;  3BRJ A;  1M2O A;  3HNI A;  5T3T A;  4G7O F;  2FAP B;  3FXH A;  3JZ0 A;  1BBH A;  4RD9 A;  1OW8 A;  5JSL A;  2YLG A;  3JTL O;  2R25 A;  1MNE A;  4EBB A;  4ER9 A;  1BR2 A;  4IGG A;  4U9E A;  2LK4 A;  3ZTM A;  5HSW A;  3DJU B;  1YYX A;  1CPQ A;  1YLM A;  3EQL F;  3LLK A;  2G62 A;  2EIL C;  2R7Q A;  4K7B A;  1FFT C;  1V74 B;  4KNV A;  4LLC A;  4R32 A;  2HJ3 A;  2R02 A;  4LDR A;  3W8H A;  4EIY A;  2WVQ A;  4B6I A;  4H4K C;  3I5P A;  3PCV A;  5L3Q A;  2WZF A;  4E0I A;  2AP3 A;  1EA8 A;  2WVN A;  2EIN C;  2KQ9 A;  5KYU B;  4CS9 A;  4BJT A;  1RXQ A;  2DYS C;  2IXN A;  1Z23 A;  3U2L A;  3LEO A;  1L3P A;  4JKV A;  3SXZ A;  4W8P A;  3L1M A;  2D4U A;  1YYJ A;  2HJM A;  3ZVR A;  2HMZ A;  4XEV A;  3RQF A;  2OOC A;  5EGY A;  1D1A A;  5F28 E;  5DQT A;  4OIQ F;  2WVO A;  2EIM C;  5EK0 A;  3JSE O;  3S29 A;  2MWQ A;  2Q9A A;  3SYN A;  2CGE A;  1QZX A;  3KYJ A;  4WAB A;  3EGX A;  4J30 B;  1K40 A;  1U6H A;  3JRT A;  3R2P A;  4MS2 A;  3C8Z A;  3VAY A;  4OIP F;  3U9M A;  2A69 F;  1EQ1 A;  1HMD A;  1ZZP A;  3US6 A;  1Q0M A;  1WN0 A;  2FFH A;  4LER A;  2IXM A;  1Y6D A;  1TWC A;  3S28 A;  3TD7 A;  4XPY A;  3B0V C;  1Z6A A;  2CYD A;  3MX3 A;  3T6B A;  1TWA A;  2PF4 E;  3FDQ A;  1L7C A;  1TWH A;  3OEO A;  4I1O B;  1D1C A;  4YL0 A;  5B3I A;  2B0H A;  3IHU A;  3S90 A;  4JUR I;  4C7O B;  4XQ1 A;  3N24 A;  3EZI A;  4DOZ A;  3AQC A;  4PJM A;  1VOM A;  2D5R B;  5DS5 A;  3U8V A;  5KYY A;  2OCC C;  3IQ6 A;  5L0H A;  3ASO C;  3S27 A;  4J7T A;  3RKO F;  1I4Z A;  3CZ6 A;  4P9F A;  4BG0 A;  1NBB A;  3JYH A;  1ZVZ A;  2XLE A;  3CSK A;  3WHN A;  3I5Q A;  4HE8 D;  1H7I A;  3BEH A;  5JLI A;  2L6H A;  1QPU A;  3K1H A;  1W2W A;  1G5Z A;  1XWJ A;  2ASR A;  1BZ4 A;  2LFD A;  3FHD A;  5FCL A;  1T6U A;  4NTA A;  1MMN A;  2Y3D A;  1JRA A;  2CDQ A;  2KNH A;  3X2Q C;  1FMW A;  3KH2 A;  1LIH A; 
#chains in the Genus database with same CATH homology
 4OD4 A;  4P6I C;  4U5H A;  2Y69 C;  5E3C A;  4CS9 C;  3EG9 A;  4IJJ A;  5DS6 A;  2NUP B;  2PP4 A;  3JT1 A;  1ZU4 A;  3I4U A;  3AQB A;  4QDL A;  3K66 A;  2VH3 A;  1MMA A;  4JCH A;  3LS0 A;  4PJL A;  2CNW D;  3WOD F;  3Q6N A;  5D92 A;  3SZR A;  4BJ5 A;  2GFH A;  3EGD A;  1V55 C;  3LNR A;  4AE4 A;  1BR4 A;  4Q5S F;  3DMD A;  3UGO A;  5E3A A;  2Y39 A;  3K33 A;  5T3W A;  1MMD A;  1NZE A;  4KI2 A;  4C3B A;  4O6N A;  1NU7 D;  3LES A;  1J8M F;  5KYX A;  4G0H A;  4FWV A;  1VK5 A;  3PHF 2;  2ZXP A;  4GEH A;  3CQZ A;  4YT5 A;  4RDA A;  3W2W A;  4XTK A;  3EFO A;  4OIO F;  3GOD A;  5BUO A;  3ZSU A;  5E33 A;  2C04 A;  2BE5 F;  4U5B E;  2Y3B A;  5B3S C;  4QI2 A;  2ZXW C;  3W8I A;  1TR2 A;  3DM5 A;  1V54 C;  1Z63 A;  3NKD A;  1J8Y F;  1ZYR F;  3B0U X;  3X1O A;  2R7U A;  3RYL A;  2XXA B;  2QY9 A;  2VB6 A;  2KJG A;  3B9Q A;  3ITF A;  2HV7 A;  2IXO A;  1LVK A;  1VYI A;  4MND A;  4DBQ A;  3LJB A;  2CNW A;  4BJ5 C;  3EGX B;  4JJG A;  2YZS A;  5DS4 A;  5CI8 A;  4DVY P;  2WB7 A;  5KYW A;  1OCO C;  3LAY A;  2XRH A;  4PK4 A;  4ZLD A;  4E7S A;  2V26 A;  4XWJ A;  4BJ1 A;  1FMV A;  4O6M A;  3DJN B;  1G8X A;  5DVW A;  4CS7 A;  4OIR F;  1VYK A;  4BJ6 A;  2B0J A;  3DAF A;  3AG1 C;  2WL8 A;  5D91 A;  2J0W A;  2IXP A;  4KNW A;  4RBN A;  2R7T A;  3RIP A;  3DXJ F;  5B1A C;  1PCX A;  3Q7L A;  5KYU A;  3Q6M A;  4YN0 B;  1ZU5 A;  4XLP F;  4FX5 A;  4CSA A;  2WZL A;  3W2V A;  2KGO A;  1WGW A;  2C03 A;  3F47 A;  4K0D A;  1OCZ C;  3KL4 A;  2J45 A;  4KC9 A;  1LS1 A;  3DM9 B;  1SMY F;  3EH2 A;  3VYW A;  3B0P A;  4YWQ A;  4CIH A;  3AG4 C;  2R7V A;  3SEO A;  3QZC A;  3UR3 C;  4HEA J;  3ECS A;  2YEV A;  4PFO A;  4JZA A;  2E87 A;  1ST6 A;  1TKN A;  2R7O A;  3M1C B;  2G3V A;  3HJC A;  4C7O A;  5L3V A;  4G7H F;  3EGD B;  3ASN C;  1IW7 F;  4DBR A;  2ZPA A;  5T1D B;  4AE4 B;  2Y3H A;  3E9V A;  1FTS A;  1M56 C;  1TWG A;  3N2Z B;  2EIK C;  1D0X A;  3WG7 C;  4BJ6 C;  1RJ9 B;  2PX3 A;  3ZC4 A;  3OWT A;  2EIJ C;  4CBE A;  5KYX B;  2W9Y A;  1JPJ A;  2IYL D;  3NRH A;  1Z5Z A;  3UGP A;  2Y3G A;  2W45 A;  2R7S A;  2H7V C;  3DZA A;  2XL4 A;  1D0Z A;  1QLE C;  2LSE A;  1FFH A;  1D0Y A;  2NUT B;  3RH3 A;  4A2N B;  2A68 F;  4ULW A;  1OCC C;  2NUP A;  4CSA C;  4HFK B;  4YT2 A;  2Q9C A;  3EPV A;  2CW0 F;  2J9W A;  5F5F A;  1SF8 A;  3Q7G A;  4I1M A;  4X0R A;  3UNG C;  1JPN A;  1O5H A;  3NKE A;  1NU9 C;  2ZXO A;  2H7B A;  3PMR A;  4N06 A;  4AX2 A;  4F4B A;  3F46 A;  3EHM A;  3NYM A;  2YHS A;  2J9U A;  2W4B A;  2KNH A;  1M57 C;  3KKB A;  4EWC A;  4YJW A;  3UMI A;  5IY5 C;  3O6X A;  2OG2 A;  4Q4Z F;  3EHN A;  4W8K A;  5DLJ A;  4FES A;  4U5C E;  4JJF A;  2J7P A;  1O87 A;  3K7D A;  1NG1 A;  3RFY A;  4U5G A;  1ZHX A;  1M2V A;  2DGJ A;  3K6B A;  3L34 A;  4YT8 A;  2QTV A;  1SZI A;  1ZHT A;  3ABK C;  4MQ9 F;  3NG1 A;  2I8B A;  4CS8 C;  5E2Q A;  2ZXR A;  3L0I A;  4JVS A;  5EHH A;  4LLE A;  3T6J A;  2PFD A;  2WZG A;  1IZM A;  1OCR C;  2R7W A;  1BR1 A;  1D1B A;  2XXA A;  4PFP A;  4NY3 A;  3H65 A;  5KYY B;  4U5D E;  2M4E A;  5DQZ A;  2VAS A;  4IWB A;  4LAC B;  2L9J A;  2P7V A;  3K1I C;  2HV6 A;  4O6Y A;  3EZH A;  2H7O A;  2A6H F;  4E7Z A;  2A1D D;  2G3K A;  2Q3T A;  4O7G A;  4O79 A;  3FAJ A;  3FVY A;  2O9X A;  3EG9 B;  2W4M A;  1ZHW A;  4IAO A;  3LLI A;  3JCU Q;  4XLN F;  1PD1 A;  4PJN A;  4DVZ A;  2KW3 C;  2J7P D;  2XSE A;  2J46 A;  3EH1 A;  1MND A;  3KMI A;  2L81 A;  1OKK A;  1KU2 A;  3T4R A;  5F5H A;  4ZLC A;  3HLZ A;  3SP1 A;  2IOQ A;  3ZG1 A;  3EJN A;  4YT4 A;  2A6E F;  4ANJ A;  1ZHZ A;  1MMG A;  4HFF B;  4AK9 A;  2NG1 A;  3HTK C;  2R7X A;  4QI0 A;  3LS1 A;  2J9V A;  3AG3 C;  4OIN F;  2Z15 A;  2X51 A;  4IRU A;  3DAG A;  3NYJ A;  5B1B C;  1Z3I X;  4CS8 A;  1LKX A;  1N1C A;  5CI9 A;  4GYT A;  3EFO B;  4C3E A;  3S0X A;  2J0X A;  3NDB B;  3LEV A;  2DYR C;  3POV A;  3GAN A;  4I44 A;  3NYL A;  3AG2 C;  2P6V A;  4G7Z F;  2JD3 A;  2Q9B A;  3OA1 A;  4U5E E;  4WJ0 A;  1RJ9 A;  4KBL A;  2R7R A;  4C3D A;  3JSZ A;  3ZIB A;  4PJJ A;  1ZHY A;  3UMH A;  1VMA A;  2MYS A;  3V7O A;  2V3C C;  3SNH A;  4OD5 A;  1M2V B;  3IEE A;  3UMK A;  4BEJ A;  4J32 B;  3QMK A;  3ABM C;  3E70 C;  3ABL C;  3O39 A;  4I3M A;  4M63 A;  2NUT A;  5KYN A;  5KYW B;  4JW1 A;  4Q7C A;  4U5F E;  3N0T A;  2FGY A;  1PD0 A;  2PX0 A;  3MLG A;  1OKK D;  5T3T A;  1S7Z A;  1M2O A;  4G7O F;  4RD9 A;  4EBB A;  1MNE A;  1BR2 A;  5HSW A;  3DJU B;  3EQL F;  3LLK A;  2G62 A;  2EIL C;  2R7Q A;  4K7B A;  1FFT C;  4KNV A;  4LLC A;  3W8H A;  2WVQ A;  4B6I A;  4H4K C;  3I5P A;  5L3Q A;  2WZF A;  2WVN A;  5KYU B;  2EIN C;  2KQ9 A;  4CS9 A;  4BJT A;  2DYS C;  2IXN A;  1Z23 A;  3ZVR A;  5EGY A;  1D1A A;  5DQT A;  4OIQ F;  2WVO A;  2EIM C;  3S29 A;  2MWQ A;  2Q9A A;  3SYN A;  2CGE A;  1QZX A;  3EGX A;  4J30 B;  3JRT A;  3VAY A;  4OIP F;  2A69 F;  2FFH A;  4LER A;  2IXM A;  1TWC A;  3S28 A;  3TD7 A;  3B0V C;  1Z6A A;  3T6B A;  3MX3 A;  1TWA A;  2PF4 E;  3FDQ A;  1TWH A;  4I1O B;  3OEO A;  1D1C A;  4C7O B;  4JUR I;  3N24 A;  3EZI A;  4DOZ A;  3AQC A;  4PJM A;  1VOM A;  2D5R B;  5DS5 A;  5KYY A;  2OCC C;  3ASO C;  3S27 A;  3RKO F;  3CZ6 A;  4BG0 A;  3JYH A;  3CSK A;  3I5Q A;  4HE8 D;  3K1H A;  1W2W A;  3FHD A;  5FCL A;  1MMN A;  2Y3D A;  2CDQ A;  3DD7 A;  3X2Q C;  1FMW A;  3KH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...