5F5HA

X-ray structure of roquin roq domain in complex with ox40 hexa-loop rna motif
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
148
structure length
148
Chain Sequence
b'QLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Roquin-1
publication title Roquin recognizes a non-canonical hexaloop structure in the 3'-UTR of Ox40.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 48
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5f5hA00
5F5HA 4QI0A 4ZLCA 3X1OA 5F5FA 4QI2A 4ULWA 4ZLDA 4YWQA
chains in the Genus database with same CATH superfamily
2CYDA 2EPMX 5EGYA 2W9YA 4JRZA 1A7VA 1R5ID 2A1DD 1RJ9A 1YA9A 2QUPA 3GODA 2YHSA 1LS4A 4D4XA 4CSAC 2Y3DA 3ZDLA 4AL1A 3EZHA 3CZ6A 4MTFA 4AE4B 3Q7GA 3S0XA 4YL0A 1YZCA 1PD1A 1HMOA 1H9GA 4R32A 1SR2A 1ZHZA 2XLVA 3SXYA 3JT1A 3FAJA 3JRMO 3U9MA 2I8BA 3V5ZA 3W2WA 3G4XA 3V5XA 2YQYA 3NMKA 3B71A 1FFTC 5CI8A 4D4NA 1ZHYA 5KYXB 5JRAA 2DYSC 3NYMA 4BJ6C 3LLIA 3WG7C 4DRIB 3OWTA 1EI7A 3ZQVA 1ZVZA 3N0TA 1D1BA 2PF4E 3TJ6A 2HJ3A 3BRJA 1OCRC 4BPMA 3QZCA 3UNGC 1CPRA 3MLGA 2VCCA 3MBGA 3E9VA 5JVEA 3U2LA 1APCA 1Z63A 4PFPA 4AK9A 1H9TA 4HFKB 3NMIA 2XL4A 3SXMA 3QMKA 4PJMA 1JPNA 4EWCA 4N6CA 1TKNA 2XL6A 1Z7Qc 3F46A 4JJFA 1C17M 1OCCC 4EHPA 3EPVA 4CDAA 1QQ3A 3OEOA 4K0DA 2OG2A 3VM6A 1HW1A 3G4ZA 3SXZA 1HMDA 4CS8A 3Q6NA 5JUAA 1BBHA 1E83A 2CCYA 2EPLX 4O6YA 3J06A 3FOPA 1M6TA 1PCXA 2O9XA 3GM2A 4ANJA 4MVUA 4LDRA 2J46A 3EJNA 4NTFA 5BQGA 4C3DA 4YWQA 2R7XA 2R7RA 3NDBB 1L3PA 1LI7A 2D4UA 3DMDA 3H2VA 3V7OA 3U8VA 5DQTA 2ZXWC 1T9KA 2WZLA 3DZAA 4HE8D 4KC9A 5L0IA 3AJMA 3IPMO 2YZSA 3RFYA 4OD4A 3FDQA 3IQCA 1TWHA 2NSGA 4MVMA 4FX5A 4YL1A 5L0JA 4WJ0A 4YL3A 2XLWA 1D0ZA 4PFOA 2KGOA 3S29A 1RKCA 3Q7LA 1YARO 4MVZA 2XS8A 2HV6A 3X1OA 1VYKA 2R7QA 2CDQA 3LLKA 2CW0F 1C02A 2L81A 1UG7A 2ICWG 2WVOA 3WODF 4LLEA 4K1OA 5HSWA 5COMA 3C8GA 1LPEA 4J7YA 4MVSA 5T3WA 4A4AA 4CS8C 1YA7O 2HS5A 1QPUA 4M63A 1CGME 3TQOA 1BDJB 2UUIA 3U9JA 2GDCA 3X2QC 2HMZA 2KK1A 3O39A 2WL8A 4A2NB 3EG9A 4U5CE 5A6AA 3DD7A 3DI5A 3ASOC 1NZEA 2OEVA 2YEVA 3NYJA 3ZVRA 4I44A 1MMGA 4IWBA 1A0BA 2V26A 2ZXRA 3GEIA 1QVXA 2R7WA 1EKYA 1VOMA 3NG1A 2MHRA 4JVSA 1OW8A 1PV3A 2IBFA 5JLIA 1ZZPA 1O87A 4O6NA 4U5HA 4C3BA 1E84A 1XZPA 2DGJA 4J32B 3RW0A 1SF8A 4F4BA 1TFOB 2NUPB 2H7OA 2G3KA 4HEAJ 5F28E 4O79A 4XEFA 2VB6A 1KNYA 3S90A 3KL4A 3DM5A 4MTOA 1B68A 3JSEO 4PJLA 2P0NA 4QI2A 3NKEA 4MTGA 4RD9A 3EGXB 4XLPF 2Y69C 1ZHWA 4NQFA 3SP1A 2AWYA 1JOGA 4MVQA 3I5QA 3VAYA 3CQZA 2ZXOA 1V55C 1ORSC 1TQGA 1NLXA 3W8HA 1E85A 3B0PA 4XPWA 4XEVA 5KYUB 3NRHA 5FZTA 5COGA 3Q6MA 1VTMP 5L0HA 4AE4A 3GM3A 3HJCA 1A7EA 4YT5A 1WTYA 3EZIA 2H8AA 1IW7F 2BC5A 1OW7A 1FAPB 3LAYA 1FNTc 4P9TA 1ZU5A 3W8IA 1TR2A 1K40A 4JEBA 3RVZA 3S27A 4PJJA 1OXBA 1V4AA 5JSLA 1I5NA 4MNDA 4NCQA 4QDLA 3H65A 1U6HA 5A6JA 2EPNA 3TOLA 5KYXA 2R05A 2KC3A 1JR8A 2G3VA 5DVWA 3SEOA 4CX9A 1AVOB 1G4WR 5KYYB 2NUTB 2IXOA 2QTVA 3GWNA 4E0IA 1OW6A 3A9CA 3QW0A 4J30B 3ASNC 3KMIA 2L7AA 1YJGA 3GANA 3LNRA 4GYTA 5A6KA 4X0RA 1VB5A 2R7TA 2WZFA 4G78A 4G0HA 3C62A 3ZIBA 4DJ9A 1Q0GA 1U89A 2IXMA 3DWWA 4OIRF 1BR4A 2AP3A 2VASA 3GEHA 4DVZA 3ZTMA 3M4CA 4U5GA 3SYNA 2J9VA 2Y3BA 3AOUA 3L8JA 1S05A 4MVRA 3ZC4A 2J7PA 4B6IA 2XLDA 4EBBA 5L0CA 2J0XA 3CEXA 3C8GD 3IQ6A 1FMWA 1XZQA 1MMAA 2HFIA 2I15A 2VH3A 4JTDB 1G5ZA 4NC3A 4BG0A 5JS5A 3U0CA 2E87A 5K0IA 2VCBA 3EH1A 3TK0A 3HNKA 3E70C 5TJ5E 5D91A 3TULA 1QLEC 2XLOA 4XPYA 4N4WA 4AX2A 1TWGA 3MFNA 2IM8A 1JAFA 1OCZC 2OJQA 1T6UA 3DE9A 4U5DE 3FAPB 5T3TA 4E7SA 4HFFB 3RQEA 1LIHA 1PD0A 3VRCA 1Q0DA 4O7GA 3SNHA 3KPHA 3T6JA 2Q9CA 1BZ4A 2YLIA 4RBNA 3RQGA 2EPKX 2L6FA 4CS9A 3NYLA 4NY3A 2LD6A 2Y3GA 3ZQYA 1QZXA 3RH3A 1ZYRF 1Q0KA 3AG1C 3US6A 3AG2C 2YL3A 2FAPB 4IARA 4EIYA 3S84A 2FFHA 2J8WA 2LCHA 3HNJA 2GWWA 3VF0A 3ZWIA 3T4RA 3C63A 2A6EF 3L0IA 1OR3A 2BL2A 1MNDA 3B0VC 5DLJA 1KTMA 4QI0A 1LS1A 2Y39A 3UMIA 1RCPA 1NG1A 3L1MA 2W45A 3IEEA 3IQ5A 3M1CB 1ZHXA 4OIPF 1A41A 1AEPA 2QLAA 3FHDA 4E7ZA 5DS5A 3MX3A 1MMDA 4MVOA 2XLMA 4LDKA 1E2XA 2LSEA 3L34A 1AUEA 1Y6DA 2IOQA 4L6RA 2J45A 3HLZA 2DB4A 1HY5A 2XL8A 2MWQA 2YLGA 4ULWA 2J9UA 1VK5A 1MMNA 4MW3A 4PR9A 4CS9C 4LDQA 1VMAA 3K66A 3CAXA 2NUPA 3RF3A 1OCOC 1H7IA 3KKBA 4JJGA 2LFDA 4OINF 4CDYA 1M2VA 2JD3A 4EBJA 1LM3B 2QE9A 2OQMA 2P61A 4OIQF 4CIPA 3EGXA 5AGFA 2A69F 3ATPA 3IQTA 2CGEA 3M15A 4MW8A 4DBQA 1DOVA 4BEJA 2C03A 4FAPB 2EIMC 1WATA 2L9JA 3N24A 4LACB 2X0CA 4BEMJ 3POVA 3S28A 3RYLA 5DS6A 3N2ZB 3JZ0A 5KYUA 1D1CA 2R25A 4KI2A 3LEVA 5B1BC 5L3VA 1M57C 3AG4C 2J7PD 1SYQA 4FESA 1VYIA 3QW1A 3T6BA 4N06A 5A69A 2X51A 1OKKA 4WGZA 4WGYA 1Z3IX 3JRTA 2R02A 2CNWA 2YRFA 3AQCA 3QVYA 4JEAA 4JURI 4GEHA 4U9EA 4XQ1A 4XTKA 3HNLA 1YZAA 2OEXA 1WASA 4E17A 4JW1A 5F5HA 5BQIA 4G7HF 2R7UA 1M2OA 4I1MA 1M2VB 1MNEA 3ABLC 1LKXA 2JPUA 3C18A 3ZSUA 2QY9A 1Q0MA 2EILC 2KW3C 2PP4A 1QSPA 3DJNB 5KYYA 5F5FA 2WVQA 4IGGA 2NUTA 5T1DB 2HUJA 4U5BE 2TMVP 1LVKA 2F22A 2KNHA 2QNLA 1TWAA 3C8ZA 3O55A 1D1AA 2KJGA 3U2MA 2EIJC 3B29A 5L0GA 2R7OA 1OR2A 5JP7A 4EBKA 2XXAB 1TFKB 4E0HA 1VLSA 5L3QA 2R7VA 2W4BA 4P9FA 3QVZA 2J9WA 1EA8A 2L6GA 3PMRA 1N1CA 4RDAA 5E2QA 4I1OB 2P7VA 1Z5ZA 4CJGA 4EUKB 2H7VC 3PCVA 4WABA 2XM0A 3CSKA 1FFHA 3TOMA 4CIHA 4CJOA 4YT4A 3W2VA 3AGUA 3I4UA 1XWJA 3KH2A 2XLEA 2M4EA 1QKRA 2R03A 2YVKA 4MS2A 3VYWA 2A68F 5D92A 2FGYA 5KYWB 2R7SA 3ZTZA 4BJ5A 1OXKA 1U0BB 3R7CA 3HKKA 1S7ZA 2LQGA 2YWAA 4GQHA 4OD5A 3RKOF 3T9OA 5DS4A 4G7ZF 1KU2A 4ONSA 3GWLA 1YAUO 1D0XA 1YLMA 2VC9A 1K04A 1J8YF 4XLNF 1JRAA 3JCUQ 1ZW3A 4KBLA 1SZIA 3H2UA 3LS1A 2JX0A 4DOZA 5IY5C 3QTHA 3EQLF 4N6HA 1C03A 3HTKC 4DXWA 4Q4ZF 1NU7D 3JTLO 2P6VA 2YL0A 2YL1A 1CPQA 2J9BA 2OJED 4FWVA 4IAOA 4JZAA 3U5SA 5B1AC 5EHHA 2OOCA 4ZLDA 3ECSA 1Y4CA 1G4US 5A6BA 1OQCA 2AVKA 3B9QA 2PBEA 4JIOA 5CIVA 2WVNA 1WWPA 2XSEA 3DXJF 4BJ1A 4YK5A 4PK4A 2MYSA 3L8IA 2Z15A 3DAGA 4Q5SF 3M79A 3EFOB 2AU5A 4BJ5C 1ZHTA 1RKEB 5CI9A 1OKKD 2R9RB 4Z9JA 1J8MF 3U3FA 5B3SC 2HKVA 2CNWD 2OU6A 2Q9BA 3ZG1A 5B3IA 3EHNA 4U9DA 3RVYA 3FOOA 4CBEA 1JPJA 3LS0A 3NKDA 4W8PA 3K1IA 3K6BA 2GFHA 2G62A 1T01A 3EH2A 2A0UA 4XWJA 4IAQA 5AC5A 3K33A 1JMWA 4Z9HA 1BR1A 3S9OA 3FMSA 4KNWA 1WN0A 1VLTA 1RJ9B 2HV7A 2Q9AA 4J7TA 4C3EA 1T6IA 2C04A 2NG1A 2HZ8A 2PX3A 3AG3C 5EK0A 2AWCA 2BE5F 2LP4A 2V3CC 2B0JA 1HW2A 3ABMC 2HMQA 4JTAB 4Z9IA 1HE9A 3RQFA 1CGNA 3GEEA 3RIPA 2Q3TA 4BJTA 4DRJB 2H7BA 1ST6A 1SMYF 2PFDA 3K1HA 3SZRA 3B0UX 1K05A 3DAFA 4JCHA 2HSBA 4H54A 1WGWA 3V5YA 3UGOA 4NTAA 4C7OA 3EGDA 3LNMB 2W4MA 4ULVA 1CGOA 2Q4FA 3UMHA 1O3UA 3EHMA 2YLDA 1GQAA 3WHNA 2XRHA 1NSGB 2B0HA 3K1IC 4IJJA 3LEOA 4P6IC 3O10A 4U5FE 5FCLA 3T6GB 2IYLD 2M64A 1DOWA 3JYYA 4KNVA 3U3BA 4Q7CA 2J0WA 3LJBA 4DVYP 2ZD9A 2YKZA 3ABKC 4OIOF 3ITFA 5KYNA 4UDVA 4AL0A 3OA1A 1T6QA 3I5PA 3FVYA 3MYFA 2RSEB 3TD7A 3W4YA 4JKVA 4EKWA 1Z6AA 2EINC 4E18A 2EPOA 2L6HA 4MQ9F 2PNOA 2XLHA 2LIGA 2VCAA 4C7OB 3EGDB 4YT2A 2XXAA 2XM4A 5GPGB 3SXKA 4JCZA 1H6GA 3A11A 1E86A 1FTSA 2LFFA 4CDVA 4XPXA 1T5OA 4JC7A 4YN0B 2EIKC 1RXQA 2LK4A 1V74B 3AGTA 3DM9B 1ZW2A 2ASRA 1F1MA 1LE4A 2A6HF 2UUHA 3IHUA 1G8XA 3DE8A 3FXHA 3K7DA 1LI5A 4IB4A 2IXPA 3R2PA 1V54C 2D5RB 3GORA 1HE1A 5AC4A 3PHF2 5A6BD 1Q0FA 3HNIA 4JTCB 4NTBA 1ORJA 1L7CA 2OKUA 3KYJA 2KQ9A 4PACA 3UMKA 1RMVA 5KYWA 1GGQA 2DI3A 4W8KA 1FR0A 2OCCC 1YDIA 2GA0A 1LE2A 1GM5A 1A7DA 2ZXPA 1ORYA 1IZMA 1I4ZA 256BA 2WB7A 3DJUB 4H4KC 5E33A 5E3CA 3C7JA 3NMJA 1ZU4A 1M56C 2KSFA 3LUTB 4PJNA 2NSFA 2Y3HA 3C8GB 3DKAA 3LESA 2GAQA 4K7BA 2A0BA 2ETSA 4I3MA 4CSAA 2WZGA 3GM1A 4DBRA 5JT4A 2IXNA 1MQVA 3PDMP 2YL7A 4XEKA 1FMVA 2HJMA 5L0FA 4O6MA 3G50A 1NU9C 1O5HA 1TWCA 2Q7RA 5HV9A 4ZLCA 3EG9B 2ZPAA 3KYIA 4U5EE 1D0YA 3O6XA 5E3AA 1EQ1A 2Q00A 3M4BA 4YJWA 4JE9A 1WOLA 2XS1A 4LLCA 4ER9A 4CS7A 3UR3C 1YVIA 1NBBA 4DRHB 2P1AA 2KYHA 3JYHA 3U8PA 3WAQA 5L0DA 1R4TA 1YYXA 1NFNA 2RD9A 1W2WA 3EFOA 3JSZA 4BJ6A 5BUOA 1RKEA 5DQZA 4YT8A 1NFOA 2NPUA 1Z23A 5COFA 1BR2A 1I4YA 2PX0A 2HSQA 3MYIA 4IRUA 3UGPA 3F47A 2DYRC 1YYJA 4LERA 5BQHA 1GS9A 4G7OF 1UFBA 3BEHA 3TJ5A 3AQBA
chains in the Genus database with same CATH topology
5EGYA 2W9YA 2A1DD 1RJ9A 3GODA 2YHSA 2Y3DA 3EZHA 3CZ6A 4AE4B 3S0XA 3Q7GA 1PD1A 1ZHZA 3JT1A 3FAJA 2I8BA 3W2WA 1FFTC 5CI8A 1ZHYA 5KYXB 2DYSC 3NYMA 4BJ6C 3LLIA 3WG7C 3OWTA 3N0TA 1D1BA 2PF4E 1OCRC 3QZCA 3UNGC 3MLGA 3E9VA 1Z63A 4PFPA 4AK9A 4HFKB 2XL4A 3QMKA 4PJMA 1JPNA 4EWCA 1TKNA 3F46A 4JJFA 1OCCC 3EPVA 3OEOA 4K0DA 2OG2A 4CS8A 3Q6NA 4O6YA 2O9XA 1PCXA 4ANJA 4C3DA 2J46A 3EJNA 4YWQA 2R7XA 2R7RA 3NDBB 3DMDA 3V7OA 5DQTA 2ZXWC 4HE8D 2WZLA 3DZAA 4KC9A 2YZSA 3RFYA 4OD4A 3FDQA 1TWHA 4FX5A 4WJ0A 3S29A 4PFOA 1D0ZA 2KGOA 3Q7LA 2HV6A 3X1OA 1VYKA 2R7QA 2CDQA 3LLKA 2CW0F 2L81A 2WVOA 3WODF 4LLEA 5HSWA 5T3WA 4CS8C 4M63A 3X2QC 3O39A 4A2NB 2WL8A 3EG9A 4U5CE 3DD7A 3NYJA 3ASOC 1NZEA 3ZVRA 2YEVA 4I44A 1MMGA 4IWBA 2R7WA 2V26A 2ZXRA 1VOMA 3NG1A 1O87A 4O6NA 4U5HA 4C3BA 4J32B 2DGJA 1SF8A 4F4BA 2NUPB 2H7OA 2G3KA 4HEAJ 4O79A 2VB6A 3KL4A 3DM5A 4PJLA 4QI2A 3NKEA 4RD9A 3EGXB 4XLPF 2Y69C 1ZHWA 3SP1A 3VAYA 3I5QA 3CQZA 2ZXOA 1V55C 3W8HA 3B0PA 5KYUB 3NRHA 3Q6MA 4AE4A 3HJCA 4YT5A 3EZIA 1IW7F 3LAYA 1ZU5A 3W8IA 1TR2A 3S27A 4PJJA 4MNDA 4QDLA 3H65A 5KYXA 2G3VA 3SEOA 5KYYB 2NUTB 2IXOA 2QTVA 4J30B 3ASNC 3KMIA 3GANA 3LNRA 4GYTA 2R7TA 4X0RA 2WZFA 4G0HA 3ZIBA 2IXMA 4OIRF 1BR4A 2VASA 4DVZA 4U5GA 3SYNA 2J9VA 2Y3BA 3ZC4A 4B6IA 2J7PA 4EBBA 2J0XA 1FMWA 1MMAA 4BG0A 2VH3A 2E87A 3EH1A 3E70C 5D91A 1QLEC 4AX2A 1TWGA 1OCZC 4U5DE 5T3TA 4E7SA 4HFFB 1PD0A 4O7GA 3SNHA 3T6JA 2Q9CA 4RBNA 4CS9A 3NYLA 4NY3A 2Y3GA 1QZXA 3RH3A 1ZYRF 3AG1C 3AG2C 2FFHA 3T4RA 2A6EF 3L0IA 3B0VC 1MNDA 5DLJA 4QI0A 1LS1A 2Y39A 3UMIA 1NG1A 2W45A 3IEEA 3M1CB 1ZHXA 4OIPF 3FHDA 5DS5A 4E7ZA 3MX3A 1MMDA 2LSEA 3L34A 2IOQA 2J45A 3HLZA 4ULWA 2MWQA 2J9UA 1VK5A 1MMNA 4CS9C 1VMAA 3K66A 2NUPA 1OCOC 3KKBA 4JJGA 4OINF 2JD3A 1M2VA 4OIQF 3EGXA 2A69F 2CGEA 4DBQA 4BEJA 2C03A 2EIMC 4LACB 2L9JA 3N24A 3POVA 3S28A 3RYLA 5DS6A 3N2ZB 5KYUA 4KI2A 1D1CA 3LEVA 5B1BC 5L3VA 1M57C 3AG4C 2J7PD 4FESA 1VYIA 3T6BA 4N06A 2X51A 1OKKA 1Z3IX 3JRTA 2CNWA 3AQCA 4JURI 4XTKA 5DVWA 4G7OF 4GEHA 4G7HF 4JW1A 5F5HA 2R7UA 1M2OA 4I1MA 1M2VB 1MNEA 3ABLC 1LKXA 3ZSUA 2QY9A 2EILC 2KW3C 2PP4A 3DJNB 5KYYA 5F5FA 2WVQA 2NUTA 5T1DB 4U5BE 1LVKA 2KNHA 1TWAA 1D1AA 2KJGA 2EIJC 2R7OA 2XXAB 5L3QA 2R7VA 2W4BA 2J9WA 3PMRA 1N1CA 4RDAA 5E2QA 4I1OB 2P7VA 1Z5ZA 2H7VC 3CSKA 1FFHA 4CIHA 4YT4A 3W2VA 3I4UA 3KH2A 2M4EA 3VYWA 2A68F 5D92A 2FGYA 5KYWB 2R7SA 4BJ5A 1S7ZA 4OD5A 3RKOF 5DS4A 4G7ZF 1KU2A 1D0XA 1J8YF 4XLNF 3JCUQ 4KBLA 1SZIA 3LS1A 4DOZA 5IY5C 3EQLF 3HTKC 4Q4ZF 1NU7D 2P6VA 4FWVA 4IAOA 4JZAA 5B1AC 5EHHA 4ZLDA 3ECSA 3B9QA 2WVNA 2XSEA 3DXJF 4BJ1A 4PK4A 2MYSA 2Z15A 3DAGA 3EFOB 4BJ5C 1ZHTA 5CI9A 5B3SC 1OKKD 1J8MF 2CNWD 2Q9BA 3ZG1A 3EHNA 4CBEA 3NKDA 1JPJA 3LS0A 3K6BA 2GFHA 2G62A 3EH2A 4XWJA 3K33A 1BR1A 4KNWA 2HV7A 1RJ9B 2Q9AA 4C3EA 2C04A 2NG1A 3AG3C 2PX3A 2BE5F 2V3CC 2B0JA 3ABMC 3RIPA 2Q3TA 4BJTA 2H7BA 1ST6A 1SMYF 2PFDA 3K1HA 3SZRA 3B0UX 3DAFA 4JCHA 1WGWA 3UGOA 4C7OA 3EGDA 2W4MA 3UMHA 3EHMA 2XRHA 3K1IC 4P6IC 4IJJA 4U5FE 5FCLA 2IYLD 4KNVA 4DVYP 4Q7CA 2J0WA 3LJBA 3ABKC 4OIOF 3ITFA 5KYNA 3OA1A 3I5PA 3FVYA 3TD7A 1Z6AA 2EINC 4MQ9F 4C7OB 3EGDB 4YT2A 2XXAA 1FTSA 4YN0B 2EIKC 3DM9B 4JVSA 2A6HF 1G8XA 3K7DA 2IXPA 1V54C 2D5RB 3PHF2 3UMKA 2KQ9A 5KYWA 4W8KA 2OCCC 2ZXPA 1IZMA 2WB7A 3DJUB 5E33A 4H4KC 5E3CA 1ZU4A 1M56C 4PJNA 2Y3HA 4K7BA 3LESA 4I3MA 4CSAA 2WZGA 4DBRA 2IXNA 1FMVA 4O6MA 1NU9C 1TWCA 1O5HA 4ZLCA 3EG9B 2ZPAA 4U5EE 1D0YA 3O6XA 5E3AA 4YJWA 4LLCA 4CS7A 3UR3C 3JYHA 1W2WA 3EFOA 3JSZA 4BJ6A 5BUOA 5DQZA 4YT8A 1Z23A 1BR2A 2PX0A 4IRUA 3UGPA 3F47A 2DYRC 4LERA 4CSAC 4Q5SF 3AQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F5H A;  4QI0 A;  4ZLC A;  3X1O A;  5F5F A;  4QI2 A;  4ULW A;  4ZLD A;  4YWQ A; 
#chains in the Genus database with same CATH topology
 2CYD A;  2EPM X;  5EGY A;  2W9Y A;  4JRZ A;  1A7V A;  1R5I D;  2A1D D;  1RJ9 A;  1YA9 A;  2QUP A;  3GOD A;  2YHS A;  1LS4 A;  4D4X A;  4CSA C;  2Y3D A;  3ZDL A;  4AL1 A;  3EZH A;  3CZ6 A;  4MTF A;  4AE4 B;  3Q7G A;  3S0X A;  4YL0 A;  1YZC A;  1PD1 A;  1HMO A;  1H9G A;  4R32 A;  1SR2 A;  1ZHZ A;  2XLV A;  3SXY A;  3JT1 A;  3FAJ A;  3JRM O;  3U9M A;  2I8B A;  3V5Z A;  3W2W A;  3G4X A;  3V5X A;  2YQY A;  3NMK A;  3B71 A;  1FFT C;  5CI8 A;  4D4N A;  1ZHY A;  5KYX B;  5JRA A;  2DYS C;  3NYM A;  4BJ6 C;  3LLI A;  3WG7 C;  4DRI B;  3OWT A;  1EI7 A;  3ZQV A;  1ZVZ A;  3N0T A;  1D1B A;  2PF4 E;  3TJ6 A;  2HJ3 A;  3BRJ A;  1OCR C;  4BPM A;  3QZC A;  3UNG C;  1CPR A;  3MLG A;  2VCC A;  3MBG A;  3E9V A;  5JVE A;  3U2L A;  1APC A;  1Z63 A;  4PFP A;  4AK9 A;  1H9T A;  4HFK B;  3NMI A;  2XL4 A;  3SXM A;  3QMK A;  4PJM A;  1JPN A;  4EWC A;  4N6C A;  1TKN A;  2XL6 A;  1Z7Q c;  3F46 A;  4JJF A;  1C17 M;  1OCC C;  4EHP A;  3EPV A;  4CDA A;  1QQ3 A;  3OEO A;  4K0D A;  2OG2 A;  3VM6 A;  1HW1 A;  3G4Z A;  3SXZ A;  1HMD A;  4CS8 A;  3Q6N A;  5JUA A;  1BBH A;  1E83 A;  2CCY A;  2EPL X;  4O6Y A;  3J06 A;  3FOP A;  1M6T A;  1PCX A;  2O9X A;  3GM2 A;  4ANJ A;  4MVU A;  4LDR A;  2J46 A;  3EJN A;  4NTF A;  5BQG A;  4C3D A;  4YWQ A;  2R7X A;  2R7R A;  3NDB B;  1L3P A;  1LI7 A;  2D4U A;  3DMD A;  3H2V A;  3V7O A;  3U8V A;  5DQT A;  2ZXW C;  1T9K A;  2WZL A;  3DZA A;  4HE8 D;  4KC9 A;  5L0I A;  3AJM A;  3IPM O;  2YZS A;  3RFY A;  4OD4 A;  3FDQ A;  3IQC A;  1TWH A;  2NSG A;  4MVM A;  4FX5 A;  4YL1 A;  5L0J A;  4WJ0 A;  4YL3 A;  2XLW A;  1D0Z A;  4PFO A;  2KGO A;  3S29 A;  1RKC A;  3Q7L A;  1YAR O;  4MVZ A;  2XS8 A;  2HV6 A;  3X1O A;  1VYK A;  2R7Q A;  2CDQ A;  3LLK A;  2CW0 F;  1C02 A;  2L81 A;  1UG7 A;  2ICW G;  2WVO A;  3WOD F;  4LLE A;  4K1O A;  5HSW A;  5COM A;  3C8G A;  1LPE A;  4J7Y A;  4MVS A;  5T3W A;  4A4A A;  4CS8 C;  1YA7 O;  2HS5 A;  1QPU A;  4M63 A;  1CGM E;  3TQO A;  1BDJ B;  2UUI A;  3U9J A;  2GDC A;  3X2Q C;  2HMZ A;  2KK1 A;  3O39 A;  2WL8 A;  4A2N B;  3EG9 A;  4U5C E;  5A6A A;  3DD7 A;  3DI5 A;  3ASO C;  1NZE A;  2OEV A;  2YEV A;  3NYJ A;  3ZVR A;  4I44 A;  1MMG A;  4IWB A;  1A0B A;  2V26 A;  2ZXR A;  3GEI A;  1QVX A;  2R7W A;  1EKY A;  1VOM A;  3NG1 A;  2MHR A;  4JVS A;  1OW8 A;  1PV3 A;  2IBF A;  5JLI A;  1ZZP A;  1O87 A;  4O6N A;  4U5H A;  4C3B A;  1E84 A;  1XZP A;  2DGJ A;  4J32 B;  3RW0 A;  1SF8 A;  4F4B A;  1TFO B;  2NUP B;  2H7O A;  2G3K A;  4HEA J;  5F28 E;  4O79 A;  4XEF A;  2VB6 A;  1KNY A;  3S90 A;  3KL4 A;  3DM5 A;  4MTO A;  1B68 A;  3JSE O;  4PJL A;  2P0N A;  4QI2 A;  3NKE A;  4MTG A;  4RD9 A;  3EGX B;  4XLP F;  2Y69 C;  1ZHW A;  4NQF A;  3SP1 A;  2AWY A;  1JOG A;  4MVQ A;  3I5Q A;  3VAY A;  3CQZ A;  2ZXO A;  1V55 C;  1ORS C;  1TQG A;  1NLX A;  3W8H A;  1E85 A;  3B0P A;  4XPW A;  4XEV A;  5KYU B;  3NRH A;  5FZT A;  5COG A;  3Q6M A;  1VTM P;  5L0H A;  4AE4 A;  3GM3 A;  3HJC A;  1A7E A;  4YT5 A;  1WTY A;  3EZI A;  2H8A A;  1IW7 F;  2BC5 A;  1OW7 A;  1FAP B;  3LAY A;  1FNT c;  4P9T A;  1ZU5 A;  3W8I A;  1TR2 A;  1K40 A;  4JEB A;  3RVZ A;  3S27 A;  4PJJ A;  1OXB A;  1V4A A;  5JSL A;  1I5N A;  4MND A;  4NCQ A;  4QDL A;  3H65 A;  1U6H A;  5A6J A;  2EPN A;  3TOL A;  5KYX A;  2R05 A;  2KC3 A;  1JR8 A;  2G3V A;  5DVW A;  3SEO A;  4CX9 A;  1AVO B;  1G4W R;  5KYY B;  2NUT B;  2IXO A;  2QTV A;  3GWN A;  4E0I A;  1OW6 A;  3A9C A;  3QW0 A;  4J30 B;  3ASN C;  3KMI A;  2L7A A;  1YJG A;  3GAN A;  3LNR A;  4GYT A;  5A6K A;  4X0R A;  1VB5 A;  2R7T A;  2WZF A;  4G78 A;  4G0H A;  3C62 A;  3ZIB A;  4DJ9 A;  1Q0G A;  1U89 A;  2IXM A;  3DWW A;  4OIR F;  1BR4 A;  2AP3 A;  2VAS A;  3GEH A;  4DVZ A;  3ZTM A;  3M4C A;  4U5G A;  3SYN A;  2J9V A;  2Y3B A;  3AOU A;  3L8J A;  1S05 A;  4MVR A;  3ZC4 A;  2J7P A;  4B6I A;  2XLD A;  4EBB A;  5L0C A;  2J0X A;  3CEX A;  3C8G D;  3IQ6 A;  1FMW A;  1XZQ A;  1MMA A;  2HFI A;  2I15 A;  2VH3 A;  4JTD B;  1G5Z A;  4NC3 A;  4BG0 A;  5JS5 A;  3U0C A;  2E87 A;  5K0I A;  2VCB A;  3EH1 A;  3TK0 A;  3HNK A;  3E70 C;  5TJ5 E;  5D91 A;  3TUL A;  1QLE C;  2XLO A;  4XPY A;  4N4W A;  4AX2 A;  1TWG A;  3MFN A;  2IM8 A;  1JAF A;  1OCZ C;  2OJQ A;  1T6U A;  3DE9 A;  4U5D E;  3FAP B;  5T3T A;  4E7S A;  4HFF B;  3RQE A;  1LIH A;  1PD0 A;  3VRC A;  1Q0D A;  4O7G A;  3SNH A;  3KPH A;  3T6J A;  2Q9C A;  1BZ4 A;  2YLI A;  4RBN A;  3RQG A;  2EPK X;  2L6F A;  4CS9 A;  3NYL A;  4NY3 A;  2LD6 A;  2Y3G A;  3ZQY A;  1QZX A;  3RH3 A;  1ZYR F;  1Q0K A;  3AG1 C;  3US6 A;  3AG2 C;  2YL3 A;  2FAP B;  4IAR A;  4EIY A;  3S84 A;  2FFH A;  2J8W A;  2LCH A;  3HNJ A;  2GWW A;  3VF0 A;  3ZWI A;  3T4R A;  3C63 A;  2A6E F;  3L0I A;  1OR3 A;  2BL2 A;  1MND A;  3B0V C;  5DLJ A;  1KTM A;  4QI0 A;  1LS1 A;  2Y39 A;  3UMI A;  1RCP A;  1NG1 A;  3L1M A;  2W45 A;  3IEE A;  3IQ5 A;  3M1C B;  1ZHX A;  4OIP F;  1A41 A;  1AEP A;  2QLA A;  3FHD A;  4E7Z A;  5DS5 A;  3MX3 A;  1MMD A;  4MVO A;  2XLM A;  4LDK A;  1E2X A;  2LSE A;  3L34 A;  1AUE A;  1Y6D A;  2IOQ A;  4L6R A;  2J45 A;  3HLZ A;  2DB4 A;  1HY5 A;  2XL8 A;  2MWQ A;  2YLG A;  4ULW A;  2J9U A;  1VK5 A;  1MMN A;  4MW3 A;  4PR9 A;  4CS9 C;  4LDQ A;  1VMA A;  3K66 A;  3CAX A;  2NUP A;  3RF3 A;  1OCO C;  1H7I A;  3KKB A;  4JJG A;  2LFD A;  4OIN F;  4CDY A;  1M2V A;  2JD3 A;  4EBJ A;  1LM3 B;  2QE9 A;  2OQM A;  2P61 A;  4OIQ F;  4CIP A;  3EGX A;  5AGF A;  2A69 F;  3ATP A;  3IQT A;  2CGE A;  3M15 A;  4MW8 A;  4DBQ A;  1DOV A;  4BEJ A;  2C03 A;  4FAP B;  2EIM C;  1WAT A;  2L9J A;  3N24 A;  4LAC B;  2X0C A;  4BEM J;  3POV A;  3S28 A;  3RYL A;  5DS6 A;  3N2Z B;  3JZ0 A;  5KYU A;  1D1C A;  2R25 A;  4KI2 A;  3LEV A;  5B1B C;  5L3V A;  1M57 C;  3AG4 C;  2J7P D;  1SYQ A;  4FES A;  1VYI A;  3QW1 A;  3T6B A;  4N06 A;  5A69 A;  2X51 A;  1OKK A;  4WGZ A;  4WGY A;  1Z3I X;  3JRT A;  2R02 A;  2CNW A;  2YRF A;  3AQC A;  3QVY A;  4JEA A;  4JUR I;  4GEH A;  4U9E A;  4XQ1 A;  4XTK A;  3HNL A;  1YZA A;  2OEX A;  1WAS A;  4E17 A;  4JW1 A;  5F5H A;  5BQI A;  4G7H F;  2R7U A;  1M2O A;  4I1M A;  1M2V B;  1MNE A;  3ABL C;  1LKX A;  2JPU A;  3C18 A;  3ZSU A;  2QY9 A;  1Q0M A;  2EIL C;  2KW3 C;  2PP4 A;  1QSP A;  3DJN B;  5KYY A;  5F5F A;  2WVQ A;  4IGG A;  2NUT A;  5T1D B;  2HUJ A;  4U5B E;  2TMV P;  1LVK A;  2F22 A;  2KNH A;  2QNL A;  1TWA A;  3C8Z A;  3O55 A;  1D1A A;  2KJG A;  3U2M A;  2EIJ C;  3B29 A;  5L0G A;  2R7O A;  1OR2 A;  5JP7 A;  4EBK A;  2XXA B;  1TFK B;  4E0H A;  1VLS A;  5L3Q A;  2R7V A;  2W4B A;  4P9F A;  3QVZ A;  2J9W A;  1EA8 A;  2L6G A;  3PMR A;  1N1C A;  4RDA A;  5E2Q A;  4I1O B;  2P7V A;  1Z5Z A;  4CJG A;  4EUK B;  2H7V C;  3PCV A;  4WAB A;  2XM0 A;  3CSK A;  1FFH A;  3TOM A;  4CIH A;  4CJO A;  4YT4 A;  3W2V A;  3AGU A;  3I4U A;  1XWJ A;  3KH2 A;  2XLE A;  2M4E A;  1QKR A;  2R03 A;  2YVK A;  4MS2 A;  3VYW A;  2A68 F;  5D92 A;  2FGY A;  5KYW B;  2R7S A;  3ZTZ A;  4BJ5 A;  1OXK A;  1U0B B;  3R7C A;  3HKK A;  1S7Z A;  2LQG A;  2YWA A;  4GQH A;  4OD5 A;  3RKO F;  3T9O A;  5DS4 A;  4G7Z F;  1KU2 A;  4ONS A;  3GWL A;  1YAU O;  1D0X A;  1YLM A;  2VC9 A;  1K04 A;  1J8Y F;  4XLN F;  1JRA A;  3JCU Q;  1ZW3 A;  4KBL A;  1SZI A;  3H2U A;  3LS1 A;  2JX0 A;  4DOZ A;  5IY5 C;  3QTH A;  3EQL F;  4N6H A;  1C03 A;  3HTK C;  4DXW A;  4Q4Z F;  1NU7 D;  3JTL O;  2P6V A;  2YL0 A;  2YL1 A;  1CPQ A;  2J9B A;  2OJE D;  4FWV A;  4IAO A;  4JZA A;  3U5S A;  5B1A C;  5EHH A;  2OOC A;  4ZLD A;  3ECS A;  1Y4C A;  1G4U S;  5A6B A;  1OQC A;  2AVK A;  3B9Q A;  2PBE A;  4JIO A;  5CIV A;  2WVN A;  1WWP A;  2XSE A;  3DXJ F;  4BJ1 A;  4YK5 A;  4PK4 A;  2MYS A;  3L8I A;  2Z15 A;  3DAG A;  4Q5S F;  3M79 A;  3EFO B;  2AU5 A;  4BJ5 C;  1ZHT A;  1RKE B;  5CI9 A;  1OKK D;  2R9R B;  4Z9J A;  1J8M F;  3U3F A;  5B3S C;  2HKV A;  2CNW D;  2OU6 A;  2Q9B A;  3ZG1 A;  5B3I A;  3EHN A;  4U9D A;  3RVY A;  3FOO A;  4CBE A;  1JPJ A;  3LS0 A;  3NKD A;  4W8P A;  3K1I A;  3K6B A;  2GFH A;  2G62 A;  1T01 A;  3EH2 A;  2A0U A;  4XWJ A;  4IAQ A;  5AC5 A;  3K33 A;  1JMW A;  4Z9H A;  1BR1 A;  3S9O A;  3FMS A;  4KNW A;  1WN0 A;  1VLT A;  1RJ9 B;  2HV7 A;  2Q9A A;  4J7T A;  4C3E A;  1T6I A;  2C04 A;  2NG1 A;  2HZ8 A;  2PX3 A;  3AG3 C;  5EK0 A;  2AWC A;  2BE5 F;  2LP4 A;  2V3C C;  2B0J A;  1HW2 A;  3ABM C;  2HMQ A;  4JTA B;  4Z9I A;  1HE9 A;  3RQF A;  1CGN A;  3GEE A;  3RIP A;  2Q3T A;  4BJT A;  4DRJ B;  2H7B A;  1ST6 A;  1SMY F;  2PFD A;  3K1H A;  3SZR A;  3B0U X;  1K05 A;  3DAF A;  4JCH A;  2HSB A;  4H54 A;  1WGW A;  3V5Y A;  3UGO A;  4NTA A;  4C7O A;  3EGD A;  3LNM B;  2W4M A;  4ULV A;  1CGO A;  2Q4F A;  3UMH A;  1O3U A;  3EHM A;  2YLD A;  1GQA A;  3WHN A;  2XRH A;  1NSG B;  2B0H A;  3K1I C;  4IJJ A;  3LEO A;  4P6I C;  3O10 A;  4U5F E;  5FCL A;  3T6G B;  2IYL D;  2M64 A;  1DOW A;  3JYY A;  4KNV A;  3U3B A;  4Q7C A;  2J0W A;  3LJB A;  4DVY P;  2ZD9 A;  2YKZ A;  3ABK C;  4OIO F;  3ITF A;  5KYN A;  4UDV A;  4AL0 A;  3OA1 A;  1T6Q A;  3I5P A;  3FVY A;  3MYF A;  2RSE B;  3TD7 A;  3W4Y A;  4JKV A;  4EKW A;  1Z6A A;  2EIN C;  4E18 A;  2EPO A;  2L6H A;  4MQ9 F;  2PNO A;  2XLH A;  2LIG A;  2VCA A;  4C7O B;  3EGD B;  4YT2 A;  2XXA A;  2XM4 A;  5GPG B;  3SXK A;  4JCZ A;  1H6G A;  3A11 A;  1E86 A;  1FTS A;  2LFF A;  4CDV A;  4XPX A;  1T5O A;  4JC7 A;  4YN0 B;  2EIK C;  1RXQ A;  2LK4 A;  1V74 B;  3AGT A;  3DM9 B;  1ZW2 A;  2ASR A;  1F1M A;  1LE4 A;  2A6H F;  2UUH A;  3IHU A;  1G8X A;  3DE8 A;  3FXH A;  3K7D A;  1LI5 A;  4IB4 A;  2IXP A;  3R2P A;  1V54 C;  2D5R B;  3GOR A;  1HE1 A;  5AC4 A;  3PHF 2;  5A6B D;  1Q0F A;  3HNI A;  4JTC B;  4NTB A;  1ORJ A;  1L7C A;  2OKU A;  3KYJ A;  2KQ9 A;  4PAC A;  3UMK A;  1RMV A;  5KYW A;  1GGQ A;  2DI3 A;  4W8K A;  1FR0 A;  2OCC C;  1YDI A;  2GA0 A;  1LE2 A;  1GM5 A;  1A7D A;  2ZXP A;  1ORY A;  1IZM A;  1I4Z A;  256B A;  2WB7 A;  3DJU B;  4H4K C;  5E33 A;  5E3C A;  3C7J A;  3NMJ A;  1ZU4 A;  1M56 C;  2KSF A;  3LUT B;  4PJN A;  2NSF A;  2Y3H A;  3C8G B;  3DKA A;  3LES A;  2GAQ A;  4K7B A;  2A0B A;  2ETS A;  4I3M A;  4CSA A;  2WZG A;  3GM1 A;  4DBR A;  5JT4 A;  2IXN A;  1MQV A;  3PDM P;  2YL7 A;  4XEK A;  1FMV A;  2HJM A;  5L0F A;  4O6M A;  3G50 A;  1NU9 C;  1O5H A;  1TWC A;  2Q7R A;  5HV9 A;  4ZLC A;  3EG9 B;  2ZPA A;  3KYI A;  4U5E E;  1D0Y A;  3O6X A;  5E3A A;  1EQ1 A;  2Q00 A;  3M4B A;  4YJW A;  4JE9 A;  1WOL A;  2XS1 A;  4LLC A;  4ER9 A;  4CS7 A;  3UR3 C;  1YVI A;  1NBB A;  4DRH B;  2P1A A;  2KYH A;  3JYH A;  3U8P A;  3WAQ A;  5L0D A;  1R4T A;  1YYX A;  1NFN A;  2RD9 A;  1W2W A;  3EFO A;  3JSZ A;  4BJ6 A;  5BUO A;  1RKE A;  5DQZ A;  4YT8 A;  1NFO A;  2NPU A;  1Z23 A;  5COF A;  1BR2 A;  1I4Y A;  2PX0 A;  2HSQ A;  3MYI A;  4IRU A;  3UGP A;  3F47 A;  2DYR C;  1YYJ A;  4LER A;  5BQH A;  1GS9 A;  4G7O F;  1UFB A;  3BEH A;  3TJ5 A;  3AQB A; 
#chains in the Genus database with same CATH homology
 5EGY A;  2W9Y A;  2A1D D;  1RJ9 A;  3GOD A;  2YHS A;  2Y3D A;  3EZH A;  3CZ6 A;  4AE4 B;  3S0X A;  3Q7G A;  1PD1 A;  1ZHZ A;  3JT1 A;  3FAJ A;  2I8B A;  3W2W A;  1FFT C;  5CI8 A;  1ZHY A;  5KYX B;  2DYS C;  3NYM A;  4BJ6 C;  3LLI A;  3WG7 C;  3OWT A;  3N0T A;  1D1B A;  2PF4 E;  1OCR C;  3QZC A;  3UNG C;  3MLG A;  3E9V A;  1Z63 A;  4PFP A;  4AK9 A;  4HFK B;  2XL4 A;  3QMK A;  4PJM A;  1JPN A;  4EWC A;  1TKN A;  3F46 A;  4JJF A;  1OCC C;  3EPV A;  3OEO A;  4K0D A;  2OG2 A;  4CS8 A;  3Q6N A;  4O6Y A;  2O9X A;  1PCX A;  4ANJ A;  4C3D A;  2J46 A;  3EJN A;  4YWQ A;  2R7X A;  2R7R A;  3NDB B;  3DMD A;  3V7O A;  5DQT A;  2ZXW C;  4HE8 D;  2WZL A;  3DZA A;  4KC9 A;  2YZS A;  3RFY A;  4OD4 A;  3FDQ A;  1TWH A;  4FX5 A;  4WJ0 A;  3S29 A;  4PFO A;  1D0Z A;  2KGO A;  3Q7L A;  2HV6 A;  3X1O A;  1VYK A;  2R7Q A;  2CDQ A;  3LLK A;  2CW0 F;  2L81 A;  2WVO A;  3WOD F;  4LLE A;  5HSW A;  5T3W A;  4CS8 C;  4M63 A;  3X2Q C;  3O39 A;  4A2N B;  2WL8 A;  3EG9 A;  4U5C E;  3DD7 A;  3NYJ A;  3ASO C;  1NZE A;  3ZVR A;  2YEV A;  4I44 A;  1MMG A;  4IWB A;  2R7W A;  2V26 A;  2ZXR A;  1VOM A;  3NG1 A;  1O87 A;  4O6N A;  4U5H A;  4C3B A;  4J32 B;  2DGJ A;  1SF8 A;  4F4B A;  2NUP B;  2H7O A;  2G3K A;  4HEA J;  4O79 A;  2VB6 A;  3KL4 A;  3DM5 A;  4PJL A;  4QI2 A;  3NKE A;  4RD9 A;  3EGX B;  4XLP F;  2Y69 C;  1ZHW A;  3SP1 A;  3VAY A;  3I5Q A;  3CQZ A;  2ZXO A;  1V55 C;  3W8H A;  3B0P A;  5KYU B;  3NRH A;  3Q6M A;  4AE4 A;  3HJC A;  4YT5 A;  3EZI A;  1IW7 F;  3LAY A;  1ZU5 A;  3W8I A;  1TR2 A;  3S27 A;  4PJJ A;  4MND A;  4QDL A;  3H65 A;  5KYX A;  2G3V A;  3SEO A;  5KYY B;  2NUT B;  2IXO A;  2QTV A;  4J30 B;  3ASN C;  3KMI A;  3GAN A;  3LNR A;  4GYT A;  2R7T A;  4X0R A;  2WZF A;  4G0H A;  3ZIB A;  2IXM A;  4OIR F;  1BR4 A;  2VAS A;  4DVZ A;  4U5G A;  3SYN A;  2J9V A;  2Y3B A;  3ZC4 A;  4B6I A;  2J7P A;  4EBB A;  2J0X A;  1FMW A;  1MMA A;  4BG0 A;  2VH3 A;  2E87 A;  3EH1 A;  3E70 C;  5D91 A;  1QLE C;  4AX2 A;  1TWG A;  1OCZ C;  4U5D E;  5T3T A;  4E7S A;  4HFF B;  1PD0 A;  4O7G A;  3SNH A;  3T6J A;  2Q9C A;  4RBN A;  4CS9 A;  3NYL A;  4NY3 A;  2Y3G A;  1QZX A;  3RH3 A;  1ZYR F;  3AG1 C;  3AG2 C;  2FFH A;  3T4R A;  2A6E F;  3L0I A;  3B0V C;  1MND A;  5DLJ A;  4QI0 A;  1LS1 A;  2Y39 A;  3UMI A;  1NG1 A;  2W45 A;  3IEE A;  3M1C B;  1ZHX A;  4OIP F;  3FHD A;  5DS5 A;  4E7Z A;  3MX3 A;  1MMD A;  2LSE A;  3L34 A;  2IOQ A;  2J45 A;  3HLZ A;  4ULW A;  2MWQ A;  2J9U A;  1VK5 A;  1MMN A;  4CS9 C;  1VMA A;  3K66 A;  2NUP A;  1OCO C;  3KKB A;  4JJG A;  4OIN F;  2JD3 A;  1M2V A;  4OIQ F;  3EGX A;  2A69 F;  2CGE A;  4DBQ A;  4BEJ A;  2C03 A;  2EIM C;  4LAC B;  2L9J A;  3N24 A;  3POV A;  3S28 A;  3RYL A;  5DS6 A;  3N2Z B;  5KYU A;  4KI2 A;  1D1C A;  3LEV A;  5B1B C;  5L3V A;  1M57 C;  3AG4 C;  2J7P D;  4FES A;  1VYI A;  3T6B A;  4N06 A;  2X51 A;  1OKK A;  1Z3I X;  3JRT A;  2CNW A;  3AQC A;  4JUR I;  4XTK A;  5DVW A;  4G7O F;  4GEH A;  4G7H F;  4JW1 A;  5F5H A;  2R7U A;  1M2O A;  4I1M A;  1M2V B;  1MNE A;  3ABL C;  1LKX A;  3ZSU A;  2QY9 A;  2EIL C;  2KW3 C;  2PP4 A;  3DJN B;  5KYY A;  5F5F A;  2WVQ A;  2NUT A;  5T1D B;  4U5B E;  1LVK A;  2KNH A;  1TWA A;  1D1A A;  2KJG A;  2EIJ C;  2R7O A;  2XXA B;  5L3Q A;  2R7V A;  2W4B A;  2J9W A;  3PMR A;  1N1C A;  4RDA A;  5E2Q A;  4I1O B;  2P7V A;  1Z5Z A;  2H7V C;  3CSK A;  1FFH A;  4CIH A;  4YT4 A;  3W2V A;  3I4U A;  3KH2 A;  2M4E A;  3VYW A;  2A68 F;  5D92 A;  2FGY A;  5KYW B;  2R7S A;  4BJ5 A;  1S7Z A;  4OD5 A;  3RKO F;  5DS4 A;  4G7Z F;  1KU2 A;  1D0X A;  1J8Y F;  4XLN F;  3JCU Q;  4KBL A;  1SZI A;  3LS1 A;  4DOZ A;  5IY5 C;  3EQL F;  3HTK C;  4Q4Z F;  1NU7 D;  2P6V A;  4FWV A;  4IAO A;  4JZA A;  5B1A C;  5EHH A;  4ZLD A;  3ECS A;  3B9Q A;  2WVN A;  2XSE A;  3DXJ F;  4BJ1 A;  4PK4 A;  2MYS A;  2Z15 A;  3DAG A;  3EFO B;  4BJ5 C;  1ZHT A;  5CI9 A;  5B3S C;  1OKK D;  1J8M F;  2CNW D;  2Q9B A;  3ZG1 A;  3EHN A;  4CBE A;  3NKD A;  1JPJ A;  3LS0 A;  3K6B A;  2GFH A;  2G62 A;  3EH2 A;  4XWJ A;  3K33 A;  1BR1 A;  4KNW A;  2HV7 A;  1RJ9 B;  2Q9A A;  4C3E A;  2C04 A;  2NG1 A;  3AG3 C;  2PX3 A;  2BE5 F;  2V3C C;  2B0J A;  3ABM C;  3RIP A;  2Q3T A;  4BJT A;  2H7B A;  1ST6 A;  1SMY F;  2PFD A;  3K1H A;  3SZR A;  3B0U X;  3DAF A;  4JCH A;  1WGW A;  3UGO A;  4C7O A;  3EGD A;  2W4M A;  3UMH A;  3EHM A;  2XRH A;  3K1I C;  4P6I C;  4IJJ A;  4U5F E;  5FCL A;  2IYL D;  4KNV A;  4DVY P;  4Q7C A;  2J0W A;  3LJB A;  3ABK C;  4OIO F;  3ITF A;  5KYN A;  3OA1 A;  3I5P A;  3FVY A;  3TD7 A;  1Z6A A;  2EIN C;  4MQ9 F;  4C7O B;  3EGD B;  4YT2 A;  2XXA A;  1FTS A;  4YN0 B;  2EIK C;  3DM9 B;  4JVS A;  2A6H F;  1G8X A;  3K7D A;  2IXP A;  1V54 C;  2D5R B;  3PHF 2;  3UMK A;  2KQ9 A;  5KYW A;  4W8K A;  2OCC C;  2ZXP A;  1IZM A;  2WB7 A;  3DJU B;  5E33 A;  4H4K C;  5E3C A;  1ZU4 A;  1M56 C;  4PJN A;  2Y3H A;  4K7B A;  3LES A;  4I3M A;  4CSA A;  2WZG A;  4DBR A;  2IXN A;  1FMV A;  4O6M A;  1NU9 C;  1TWC A;  1O5H A;  4ZLC A;  3EG9 B;  2ZPA A;  4U5E E;  1D0Y A;  3O6X A;  5E3A A;  4YJW A;  4LLC A;  4CS7 A;  3UR3 C;  3JYH A;  1W2W A;  3EFO A;  3JSZ A;  4BJ6 A;  5BUO A;  5DQZ A;  4YT8 A;  1Z23 A;  1BR2 A;  2PX0 A;  4IRU A;  3UGP A;  3F47 A;  2DYR C;  4LER A;  4CSA C;  4Q5S F;  3AQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...