5F5HA

X-ray structure of roquin roq domain in complex with ox40 hexa-loop rna motif
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
148
structure length
148
Chain Sequence
QLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Roquin-1
publication title Roquin recognizes a non-canonical hexaloop structure in the 3'-UTR of Ox40.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 48
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5f5hA00
4ULWA 5F5HA 4ZLCA 4QI0A 4ZLDA 4QI2A 5F5FA 3X1OA 4YWQA
chains in the Genus database with same CATH superfamily
3CAXA 1IW7F 1UFBA 4O7GA 5IY5C 2GAQA 3EGXA 4JIOA 1GM5A 1M6TA 1ST6A 1TWGA 1TWCA 2J9WA 2L6GA 1OQCA 3EHMA 3EZIA 1TWHA 2LCHA 3LEVA 3NYLA 1E83A 2PP4A 3DZAA 3VRCA 4KC9A 2BE5F 2GA0A 1I4YA 4YJWA 3VF0A 3H65A 3TJ6A 2KSFA 2CCYA 1YA9A 1VYIA 1U6HA 1ZW3A 2P61A 3HNJA 1V74B 4KNVA 2LP4A 4G7HF 1FMVA 1M2VB 1NFNA 2C03A 1AUEA 4G0HA 4C7OB 1Q0GA 2YVKA 4IAOA 2XS8A 3WHNA 3O10A 5T3WA 3SXMA 1SF8A 4O79A 1NG1A 3QW0A 3I4UA 5L0DA 3ASNC 1G8XA 2J9UA 4JCHA 4FWVA 2H8AA 2I15A 1YVIA 2XM0A 4I3MA 4IGGA 4PR9A 2XL8A 1HE1A 5JLIA 1OW7A 2WVNA 4BPMA 2W45A 4JZAA 2RSEB 2NSFA 3C8GB 4BJ1A 4D4XA 5A6AA 1L7CA 4MTOA 4XPYA 2NSGA 3QVZA 2XM4A 4XTKA 1APCA 3EG9B 1N1CA 4OINF 1HY5A 2KK1A 4YL1A 3R2PA 1RKEB 5JP7A 4N06A 1M2OA 3DKAA 1FFHA 1H9GA 4LACB 4FX5A 4BJ6A 4BJ6C 3PDMP 2A1DD 1O87A 4WGYA 5KYUA 2Y39A 4ZLCA 4CX9A 2QNLA 3GM2A 2XXAA 1VYKA 1K04A 2B0JA 3KYJA 2X51A 2P7VA 2HZ8A 3M4CA 4WABA 2ZPAA 4XEKA 3LS1A 2WVQA 4JC7A 1A41A 4U9EA 1XZPA 2ICWG 1K05A 3A11A 4LDKA 2ZXWC 3BEHA 4X0RA 5KYYB 2F22A 1LI5A 3FDQA 4JJGA 2A0UA 4WJ0A 1RKCA 2J45A 4Z9HA 1A7EA 2CGEA 3LNRA 4N6CA 1O5HA 3RIPA 3VYWA 4EBKA 1BR1A 1J8MF 1YZCA 2WZGA 1H6GA 2PBEA 4Z9IA 2FAPB 3VAYA 2O9XA 1JRAA 2LD6A 2XRHA 4JTAB 2KC3A 2LFFA 4FESA 3V5XA 3CSKA 4GEHA 3T9OA 4DOZA 4DVZA 1XWJA 2R7SA 2XLVA 4XLNF 2EIJC 1JPNA 2HMQA 2DYSC 5L3VA 1S7ZA 3WAQA 1G4WR 5DS4A 3M15A 3ZQYA 5T1DB 1Z63A 1FTSA 1KTMA 4LLCA 3Q6MA 4MVMA 2LIGA 2XL6A 3ABKC 3SP1A 3FOOA 1A7DA 3K1IA 3K1IC 2WZFA 3ZQVA 3TK0A 1F1MA 2KYHA 5JRAA 4U5HA 3MLGA 2HJ3A 1SMYF 1LM3B 1YLMA 2HFIA 4XWJA 2DYRC 3NYMA 3QMKA 1EQ1A 2MWQA 3KPHA 3AG1C 4NTAA 3WODF 4C3DA 4XEVA 1ZU4A 1C02A 4YT2A 4NTBA 1E85A 5BUOA 3T6JA 2KNHA 4JJFA 5A6JA 1NLXA 4XEFA 5EHHA 2CYDA 3M1CB 1ZU5A 3KYIA 2YL3A 2J9BA 2HV6A 1RCPA 2WB7A 3ECSA 4I1OB 3AG4C 1OKKD 3IPMO 3M4BA 2H7VC 5B1AC 1DOWA 3FMSA 3GEIA 4QDLA 5JT4A 4LDRA 5B1BC 3RKOF 1MNDA 3DJUB 3KMIA 2YLDA 3GM1A 1T9KA 4DVYP 3HNKA 1OKKA 3CZ6A 1TR2A 4H54A 1A0BA 4MVSA 4NTFA 1OCCC 1C03A 3EZHA 4JEBA 1W2WA 2Q00A 4J30B 2A68F 3QVYA 5AGFA 5D92A 3F46A 2HSQA 5COGA 5L0GA 4N6HA 1OXKA 1D0XA 3FHDA 3AGTA 3GWNA 1PCXA 3B9QA 2IYLD 1RJ9B 3S90A 3CQZA 5HV9A 1T5OA 3OA1A 1QSPA 4OIOF 4EUKB 3LJBA 2MYSA 2XLDA 3LLKA 3GM3A 1BDJB 3RF3A 1YARO 1U89A 2P6VA 4AE4B 3SXYA 4JTCB 2A6HF 1ZHXA 3X2QC 2XLHA 3O55A 4ONSA 5JUAA 1I5NA 2BC5A 2VCAA 4ULWA 2NUPA 4E7SA 5A6BD 3NMJA 1JAFA 1LS4A 1VLTA 1NFOA 4E0HA 1NU9C 2P0NA 2YL0A 2Z15A 3BRJA 4YWQA 2R7TA 1MMNA 5F5HA 4E7ZA 2IXMA 5B3IA 2PNOA 2ZXPA 5A6BA 3J06A 2XS1A 3RH3A 2KQ9A 2QUPA 2HJMA 3U8VA 5T3TA 2EPOA 2OEXA 2QTVA 3ABLC 3TOLA 4MS2A 1OCRC 3DXJF 2XSEA 2A0BA 2A6EF 2CNWD 2GWWA 4O6MA 1B68A 3E70C 3EH1A 2AVKA 4BJ5C 4BJ5A 1I4ZA 2HS5A 3IQ5A 3QW1A 2KGOA 1XZQA 1MMDA 4G78A 3DE9A 5E3AA 4IAQA 5FZTA 2CNWA 3U2LA 4DXWA 1EA8A 2WZLA 4EBJA 4Q5SF 4PK4A 3OEOA 2QLAA 1MMAA 3U3BA 4W8PA 1K40A 2Q3TA 1WTYA 3ZTMA 3GORA 4CDYA 5E3CA 4U5EE 3NYJA 3ABMC 1JR8A 3S27A 4ER9A 3U2MA 1NU7D 2DI3A 4HEAJ 4KBLA 2YQYA 5KYXB 4Q7CA 3B0VC 3JRTA 4MTGA 3EFOB 3M79A 2XL4A 4E17A 3HNIA 5A6KA 3ZVRA 3MBGA 2R7WA 2H7BA 3NRHA 2M64A 4OD4A 1Q0DA 1ORJA 2NUTA 2AU5A 4JCZA 1BBHA 1KU2A 4MW3A 1YJGA 2X0CA 4EWCA 4UDVA 2KW3C 3NDBB 1YZAA 3V7OA 4XLPF 5DS6A 3FXHA 4QI2A 2WVOA 1D1AA 1LE2A 3L34A 1UG7A 3IHUA 2Q9BA 3JRMO 3S9OA 3W2WA 3ZSUA 5DQTA 1H7IA 2Y3GA 4DBQA 1HMOA 1OCOC 3V5YA 2OQMA 4EBBA 3B0UX 2IBFA 2R03A 2EPNA 3FVYA 1QPUA 2JX0A 2RD9A 3DAFA 2PX0A 4GQHA 4JURI 1TKNA 3V5ZA 5JVEA 3W8HA 2OOCA 2IOQA 4K1OA 3JTLO 1V4AA 4IB4A 5CI9A 5EK0A 5E33A 5AC4A 2ASRA 3DWWA 1E2XA 5K0IA 4DRJB 3K33A 3UMKA 4JE9A 1FMWA 1LVKA 4EIYA 5KYWB 4N4WA 1QLEC 5D91A 4G7ZF 1JOGA 3US6A 3LEOA 3U9JA 2R7VA 1EI7A 5L0IA 4J7TA 4B6IA 1E86A 2XLEA 2IM8A 2UUHA 2HKVA 2L81A 4JTDB 2YZSA 2OJQA 5CI8A 3SYNA 4JW1A 4MVUA 3QZCA 3U3FA 2VCBA 1LPEA 3H2VA 3IQCA 2L9JA 2GDCA 2YWAA 3N0TA 2EIKC 3N2ZB 4IARA 5TJ5E 2V3CC 1ZVZA 3JYHA 2R25A 3L8JA 3KH2A 1HE9A 2ZXRA 1E84A 3GEHA 4I1MA 3W4YA 1Y4CA 3LAYA 4CDAA 2IXPA 3UMHA 3HTKC 3F47A 4U5FE 4EKWA 3G4ZA 3B29A 3HJCA 2EPKX 1A7VA 1MQVA 3EGXB 3X1OA 3RQGA 3UR3C 3T4RA 1YDIA 3C63A 4NC3A 2CDQA 1M2VA 2OCCC 4PJJA 4PFOA 3PMRA 4C7OA 2L6FA 1LE4A 4HFKB 1G4US 1T6IA 4PACA 3ZDLA 2Q7RA 4PJNA 1ZYRF 1C17M 4CSAA 2JPUA 4CSAC 1MMGA 2YL7A 1TWAA 3L1MA 3ASOC 3NKDA 2Y3HA 4OIPF 1VLSA 4JKVA 1MNEA 1WWPA 3EH2A 1BZ4A 4MVOA 4BG0A 1VTMP 4CJGA 4OIQF 1D0YA 4A2NB 3C18A 2YEVA 4BEMJ 3FAJA 3I5QA 3U8PA 5DLJA 3EG9A 2W4MA 3EQLF 1JPJA 4MQ9F 4IJJA 3Q7LA 4RDAA 1RKEA 3W8IA 1WASA 2FFHA 4D4NA 4Z9JA 1PD1A 2YLIA 1ZHWA 5L0HA 3IEEA 2R7RA 2ZXOA 1D1CA 2TMVP 4DRHB 2J0XA 2QE9A 3ATPA 4DRIB 3K6BA 4XQ1A 5KYUB 4RBNA 4AK9A 5L3QA 4ZLDA 2L6HA 4PJMA 4M63A 2XXAB 3O6XA 2YRFA 3ITFA 1FNTc 3LESA 1QQ3A 4OD5A 5FCLA 5KYYA 3NMKA 3RQFA 2HMZA 2NPUA 4BJTA 1CGOA 3EGDA 1VMAA 2UUIA 3IQ6A 2AWCA 4P6IC 5A69A 3EHNA 3GANA 4PFPA 5JS5A 2G3KA 4HFFB 3U9MA 3NKEA 3RFYA 4BEJA 3S29A 5BQIA 1RMVA 3FOPA 1WATA 5BQGA 3NMIA 2LSEA 4CS7A 2EIMC 256BA 4CS8C 4CS8A 1WOLA 1YYXA 4A4AA 3JZ0A 3WG7C 3Q6NA 3AG3C 3DAGA 4NY3A 3L0IA 1CGNA 2G3VA 4YT8A 2J7PD 2B0HA 4Q4ZF 2YLGA 3B0PA 3QTHA 2IXNA 2YL1A 3G50A 1CPQA 1PV3A 4MNDA 1ZZPA 2Y69C 4LLEA 3T6GB 4GYTA 2JD3A 1D0ZA 4O6YA 4DBRA 1VOMA 3MX3A 4PJLA 1R5ID 1ZHYA 3GEEA 1NSGB 1CGME 2J7PA 1FFTC 1AEPA 4CDVA 1HW1A 2OG2A 1M57C 1QZXA 4YK5A 3AGUA 1GGQA 2J9VA 2R7QA 3UNGC 2Q4FA 1SZIA 3SEOA 2AP3A 1Y6DA 3PCVA 2Q9CA 3AQBA 3DJNB 2VH3A 4L6RA 4U5CE 1L3PA 3G4XA 5EGYA 5DS5A 2EILC 4CS9C 1D1BA 4CS9A 1HW2A 2J0WA 3NG1A 1QVXA 2LQGA 2L7AA 4H4KC 4G7OF 4YT4A 2YKZA 2R7XA 1Q0KA 2H7OA 4J7YA 4KNWA 4C3EA 4LERA 3UMIA 2C04A 3RVZA 2BL2A 1G5ZA 3MFNA 4RD9A 3Q7GA 2A69F 3ZG1A 4XPWA 3B71A 1ZHTA 1R4TA 4QI0A 2VC9A 3GODA 1ORSC 4YL3A 1YYJA 3RW0A 1LS1A 2R05A 1ZHZA 3RQEA 3S28A 3H2UA 4IRUA 1OR2A 2P1AA 3AJMA 5L0JA 2XLOA 1RJ9A 1O3UA 2YHSA 4AL1A 1NBBA 3S84A 1YA7O 1BR4A 2V26A 2G62A 1PD0A 1JMWA 4MTFA 3AOUA 3KKBA 3KL4A 3S0XA 4ULVA 4AE4A 1SYQA 1KNYA 1V55C 1J8YF 4CIHA 2PX3A 3ZC4A 1VB5A 4U5GA 2AWYA 4DJ9A 2IXOA 5E2QA 1FAPB 4MVQA 1WGWA 2R7OA 4MVZA 4C3BA 3C7JA 2VASA 3SZRA 5DQZA 4K0DA 1LIHA 2NUPB 2OJED 3TOMA 3SNHA 1HMDA 2R02A 2ZD9A 1OCZC 3EGDB 2OU6A 3RVYA 3K1HA 3HLZA 4J32B 3TJ5A 1LKXA 1TQGA 2J46A 3N24A 4MVRA 1WN0A 2I8BA 5JSLA 3C62A 1IZMA 1Z7Qc 5AC5A 1S05A 1VK5A 2E87A 1GS9A 3TULA 2R7UA 2OEVA 1YAUO 2HSBA 3DMDA 3TD7A 2LK4A 3EPVA 3ZWIA 3HKKA 5B3SC 3PHF2 4CBEA 4R32A 2R9RB 4LDQA 1OXBA 1LI7A 2M4EA 2D5RB 4ANJA 3LUTB 4NQFA 3C8GD 3LNMB 1EKYA 2LFDA 3DE8A 4NCQA 1T6UA 1H9TA 3CEXA 4U5DE 2D4UA 1AVOB 2NG1A 3L8IA 2PFDA 3LS0A 3JYYA 2KJGA 2J8WA 3ZTZA 2EPLX 4W8KA 3T6BA 3C8ZA 1QKRA 3DI5A 3C8GA 3JSZA 4EHPA 4AX2A 2DGJA 3E9VA 1OR3A 5KYXA 3JT1A 2GFHA 3VM6A 3JSEO 3EFOA 2Y3BA 1GQAA 1U0BB 1Q0FA 4P9TA 3A9CA 2EPMX 1ORYA 4AL0A 1TFKB 4JEAA 3DM5A 4YT5A 2XLWA 3K66A 4FAPB 3U0CA 4OIRF 3K7DA 2Y3DA 2PF4E 3TQOA 3GWLA 4YL0A 4E0IA 2HUJA 3AQCA 5BQHA 3U5SA 5CIVA 3I5PA 3UGPA 1ZW2A 2NUTB 4U5BE 3EJNA 1OW8A 3RYLA 2ETSA 5HSWA 1Z23A 2MHRA 3AG2C 2W9YA 4MW8A 1DOVA 4U9DA 1BR2A 1Q0MA 1T01A 5KYNA 2FGYA 1TFOB 2XLMA 4CJOA 2CW0F 1Z5ZA 2Q9AA 2VB6A 1SR2A 4I44A 4WGZA 4F4BA 3MYFA 2QY9A 3MYIA 5COMA 2W4BA 3W2VA 5KYWA 5F5FA 2WL8A 4HE8D 3R7CA 1V54C 4O6NA 4P9FA 5L0FA 1Z6AA 3DD7A 1T6QA 3DM9B 4XPXA 5COFA 3UGOA 1FR0A 3FAPB 3LLIA 2HV7A 2VCCA 3JCUQ 2EINC 4IWBA 3SXZA 5F28E 1RXQA 5L0CA 4JVSA 2OKUA 4CIPA 4KI2A 3HNLA 1Z3IX 4JRZA 1CPRA 1OW6A 5GPGB 3IQTA 4E18A 4YN0B 5DVWA 3SXKA 1M56C 2DB4A 3O39A 3OWTA 1NZEA 3ZIBA 3POVA 4K7BA
chains in the Genus database with same CATH topology
1IW7F 4O7GA 5IY5C 3EGXA 1ST6A 1TWGA 1TWCA 2J9WA 3EHMA 3NYLA 3LEVA 3EZIA 4AX2A 1TWHA 2PP4A 3DZAA 4KC9A 2BE5F 4YJWA 3H65A 1VYIA 4KNVA 4G7HF 1FMVA 1M2VB 2C03A 4G0HA 4C7OB 4IAOA 5T3WA 1SF8A 4O79A 1NG1A 3I4UA 3ASNC 1G8XA 2J9UA 4JCHA 4FWVA 4I3MA 2WVNA 2W45A 4JZAA 4BJ1A 4XTKA 3EG9B 1N1CA 4OINF 4N06A 1M2OA 4LACB 1FFHA 4FX5A 4BJ6A 4BJ6C 2A1DD 1O87A 5KYUA 2Y39A 4ZLCA 2XXAA 1VYKA 2B0JA 2X51A 2P7VA 2ZPAA 3LS1A 2WVQA 4X0RA 2ZXWC 5KYYB 3FDQA 4JJGA 4WJ0A 2J45A 2CGEA 3LNRA 3RIPA 1O5HA 3VYWA 1BR1A 1J8MF 2WZGA 3VAYA 2O9XA 2XRHA 4FESA 4DOZA 3CSKA 4GEHA 4DVZA 2R7SA 4XLNF 2EIJC 1JPNA 2DYSC 5L3VA 1S7ZA 5DS4A 1Z63A 5T1DB 1FTSA 4LLCA 3Q6MA 3ABKC 3SP1A 4EWCA 3K1IC 2WZFA 4U5HA 3MLGA 1SMYF 4XWJA 2DYRC 3NYMA 3QMKA 2MWQA 3AG1C 3WODF 4C3DA 4YT2A 1ZU4A 5BUOA 3T6JA 2KNHA 4JJFA 5EHHA 3M1CB 1ZU5A 2HV6A 3ECSA 2WB7A 4I1OB 3AG4C 1OKKD 5B1AC 2H7VC 4QDLA 5B1BC 3RKOF 1MNDA 3DJUB 3KMIA 4DVYP 1OKKA 3CZ6A 1TR2A 1OCCC 3EZHA 1W2WA 4J30B 2A68F 5D92A 3F46A 1D0XA 3FHDA 1PCXA 3B9QA 2IYLD 1RJ9B 3CQZA 3OA1A 4OIOF 3LJBA 2MYSA 3LLKA 2P6VA 4AE4B 2A6HF 1ZHXA 3X2QC 4ULWA 2NUPA 4E7SA 1NU9C 2Z15A 4YWQA 2R7TA 1MMNA 5F5HA 4E7ZA 2IXMA 2ZXPA 3RH3A 2KQ9A 5T3TA 2QTVA 3ABLC 1OCRC 3DXJF 2XSEA 2A6EF 2CNWD 4O6MA 3E70C 3EH1A 4BJ5C 4BJ5A 2KGOA 1MMDA 5E3AA 2CNWA 2WZLA 4Q5SF 4PK4A 3OEOA 1MMAA 2Q3TA 5E3CA 4U5EE 3NYJA 3ABMC 3S27A 1NU7D 4HEAJ 4KBLA 5KYXB 4Q7CA 3B0VC 3JRTA 3EFOB 2XL4A 3ZVRA 2R7WA 2H7BA 3NRHA 4OD4A 2NUTA 1KU2A 3NDBB 2KW3C 3V7OA 4XLPF 5DS6A 4QI2A 2WVOA 1D1AA 3L34A 2Q9BA 3W2WA 3ZSUA 5DQTA 2Y3GA 4DBQA 1OCOC 4EBBA 3B0UX 3FVYA 3DAFA 2PX0A 4JURI 1TKNA 3W8HA 2IOQA 5CI9A 5E33A 3K33A 3UMKA 1FMWA 1LVKA 5KYWB 5D91A 1QLEC 4G7ZF 2R7VA 4B6IA 2L81A 2YZSA 5CI8A 3SYNA 4JW1A 3QZCA 2L9JA 3N0TA 2V3CC 2EIKC 3N2ZB 3JYHA 3KH2A 2ZXRA 4I1MA 3LAYA 2IXPA 3UMHA 3HTKC 3F47A 4U5FE 3HJCA 3EGXB 3X1OA 3UR3C 3T4RA 2CDQA 1M2VA 2OCCC 4PJJA 4PFOA 3PMRA 4C7OA 4HFKB 4PJNA 1ZYRF 4CSAA 4CSAC 1MMGA 1TWAA 3ASOC 3NKDA 2Y3HA 4OIPF 1MNEA 3EH2A 4BG0A 4OIQF 1D0YA 4A2NB 2YEVA 3FAJA 3I5QA 5DLJA 3EG9A 2W4MA 3EQLF 1JPJA 4MQ9F 4IJJA 3Q7LA 4RDAA 3W8IA 2FFHA 1PD1A 1ZHWA 3IEEA 2R7RA 2ZXOA 1D1CA 2J0XA 3K6BA 5KYUB 4RBNA 4AK9A 5L3QA 4ZLDA 4PJMA 4M63A 2XXAB 3O6XA 3ITFA 3LESA 4OD5A 5FCLA 5KYYA 4BJTA 3EGDA 1VMAA 4P6IC 3EHNA 3GANA 4PFPA 2G3KA 4HFFB 3NKEA 3RFYA 4BEJA 3S29A 2LSEA 4CS7A 2EIMC 4CS8C 4CS8A 3WG7C 3Q6NA 3AG3C 3DAGA 4NY3A 3L0IA 2G3VA 4YT8A 2J7PD 4Q4ZF 3B0PA 2IXNA 4MNDA 2Y69C 4LLEA 4GYTA 2JD3A 1D0ZA 4O6YA 4DBRA 1VOMA 3MX3A 4PJLA 1ZHYA 2J7PA 1FFTC 2OG2A 1M57C 1QZXA 2J9VA 2R7QA 3UNGC 1SZIA 3SEOA 2Q9CA 3AQBA 3DJNB 2VH3A 5EGYA 4U5CE 5DS5A 2EILC 4CS9C 1D1BA 4CS9A 2J0WA 3NG1A 4H4KC 4G7OF 2R7XA 2H7OA 4KNWA 4C3EA 4LERA 3UMIA 2C04A 4RD9A 3Q7GA 2A69F 3ZG1A 4QI0A 1ZHTA 3GODA 1LS1A 1ZHZA 3S28A 4IRUA 1RJ9A 2YHSA 2V26A 1BR4A 2G62A 1PD0A 3KKBA 3KL4A 3S0XA 4AE4A 1V55C 4CIHA 1J8YF 2PX3A 3ZC4A 4U5GA 2IXOA 5E2QA 1WGWA 2R7OA 4C3BA 2VASA 3SZRA 5DQZA 4K0DA 2NUPB 3SNHA 1OCZC 3EGDB 3K1HA 3HLZA 4J32B 4YT4A 1LKXA 2J46A 3N24A 2I8BA 1IZMA 1VK5A 2E87A 2R7UA 3TD7A 3DMDA 3EPVA 5B3SC 3PHF2 4CBEA 2M4EA 2D5RB 4ANJA 4U5DE 2NG1A 2PFDA 3LS0A 2KJGA 3T6BA 4W8KA 3JSZA 2DGJA 3E9VA 5KYXA 3JT1A 2GFHA 3EFOA 2Y3BA 4YT5A 3DM5A 3K66A 4OIRF 3K7DA 2Y3DA 2PF4E 3AQCA 3I5PA 3UGPA 2NUTB 4U5BE 3EJNA 3RYLA 5HSWA 1Z23A 3AG2C 2W9YA 1BR2A 5KYNA 2FGYA 2CW0F 1Z5ZA 2Q9AA 2VB6A 4I44A 4F4BA 2QY9A 2W4BA 3W2VA 5KYWA 5F5FA 2WL8A 4HE8D 1V54C 4O6NA 1Z6AA 3DD7A 3DM9B 3UGOA 3LLIA 2HV7A 3JCUQ 4IWBA 2EINC 4JVSA 4KI2A 1Z3IX 4YN0B 5DVWA 1M56C 3O39A 3OWTA 3POVA 1NZEA 3ZIBA 4K7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ULW A;  5F5H A;  4ZLC A;  4QI0 A;  4ZLD A;  4QI2 A;  5F5F A;  3X1O A;  4YWQ A; 
#chains in the Genus database with same CATH topology
 3CAX A;  1IW7 F;  1UFB A;  4O7G A;  5IY5 C;  2GAQ A;  3EGX A;  4JIO A;  1GM5 A;  1M6T A;  1ST6 A;  1TWG A;  1TWC A;  2J9W A;  2L6G A;  1OQC A;  3EHM A;  3EZI A;  1TWH A;  2LCH A;  3LEV A;  3NYL A;  1E83 A;  2PP4 A;  3DZA A;  3VRC A;  4KC9 A;  2BE5 F;  2GA0 A;  1I4Y A;  4YJW A;  3VF0 A;  3H65 A;  3TJ6 A;  2KSF A;  2CCY A;  1YA9 A;  1VYI A;  1U6H A;  1ZW3 A;  2P61 A;  3HNJ A;  1V74 B;  4KNV A;  2LP4 A;  4G7H F;  1FMV A;  1M2V B;  1NFN A;  2C03 A;  1AUE A;  4G0H A;  4C7O B;  1Q0G A;  2YVK A;  4IAO A;  2XS8 A;  3WHN A;  3O10 A;  5T3W A;  3SXM A;  1SF8 A;  4O79 A;  1NG1 A;  3QW0 A;  3I4U A;  5L0D A;  3ASN C;  1G8X A;  2J9U A;  4JCH A;  4FWV A;  2H8A A;  2I15 A;  1YVI A;  2XM0 A;  4I3M A;  4IGG A;  4PR9 A;  2XL8 A;  1HE1 A;  5JLI A;  1OW7 A;  2WVN A;  4BPM A;  2W45 A;  4JZA A;  2RSE B;  2NSF A;  3C8G B;  4BJ1 A;  4D4X A;  5A6A A;  1L7C A;  4MTO A;  4XPY A;  2NSG A;  3QVZ A;  2XM4 A;  4XTK A;  1APC A;  3EG9 B;  1N1C A;  4OIN F;  1HY5 A;  2KK1 A;  4YL1 A;  3R2P A;  1RKE B;  5JP7 A;  4N06 A;  1M2O A;  3DKA A;  1FFH A;  1H9G A;  4LAC B;  4FX5 A;  4BJ6 A;  4BJ6 C;  3PDM P;  2A1D D;  1O87 A;  4WGY A;  5KYU A;  2Y39 A;  4ZLC A;  4CX9 A;  2QNL A;  3GM2 A;  2XXA A;  1VYK A;  1K04 A;  2B0J A;  3KYJ A;  2X51 A;  2P7V A;  2HZ8 A;  3M4C A;  4WAB A;  2ZPA A;  4XEK A;  3LS1 A;  2WVQ A;  4JC7 A;  1A41 A;  4U9E A;  1XZP A;  2ICW G;  1K05 A;  3A11 A;  4LDK A;  2ZXW C;  3BEH A;  4X0R A;  5KYY B;  2F22 A;  1LI5 A;  3FDQ A;  4JJG A;  2A0U A;  4WJ0 A;  1RKC A;  2J45 A;  4Z9H A;  1A7E A;  2CGE A;  3LNR A;  4N6C A;  1O5H A;  3RIP A;  3VYW A;  4EBK A;  1BR1 A;  1J8M F;  1YZC A;  2WZG A;  1H6G A;  2PBE A;  4Z9I A;  2FAP B;  3VAY A;  2O9X A;  1JRA A;  2LD6 A;  2XRH A;  4JTA B;  2KC3 A;  2LFF A;  4FES A;  3V5X A;  3CSK A;  4GEH A;  3T9O A;  4DOZ A;  4DVZ A;  1XWJ A;  2R7S A;  2XLV A;  4XLN F;  2EIJ C;  1JPN A;  2HMQ A;  2DYS C;  5L3V A;  1S7Z A;  3WAQ A;  1G4W R;  5DS4 A;  3M15 A;  3ZQY A;  5T1D B;  1Z63 A;  1FTS A;  1KTM A;  4LLC A;  3Q6M A;  4MVM A;  2LIG A;  2XL6 A;  3ABK C;  3SP1 A;  3FOO A;  1A7D A;  3K1I A;  3K1I C;  2WZF A;  3ZQV A;  3TK0 A;  1F1M A;  2KYH A;  5JRA A;  4U5H A;  3MLG A;  2HJ3 A;  1SMY F;  1LM3 B;  1YLM A;  2HFI A;  4XWJ A;  2DYR C;  3NYM A;  3QMK A;  1EQ1 A;  2MWQ A;  3KPH A;  3AG1 C;  4NTA A;  3WOD F;  4C3D A;  4XEV A;  1ZU4 A;  1C02 A;  4YT2 A;  4NTB A;  1E85 A;  5BUO A;  3T6J A;  2KNH A;  4JJF A;  5A6J A;  1NLX A;  4XEF A;  5EHH A;  2CYD A;  3M1C B;  1ZU5 A;  3KYI A;  2YL3 A;  2J9B A;  2HV6 A;  1RCP A;  2WB7 A;  3ECS A;  4I1O B;  3AG4 C;  1OKK D;  3IPM O;  3M4B A;  2H7V C;  5B1A C;  1DOW A;  3FMS A;  3GEI A;  4QDL A;  5JT4 A;  4LDR A;  5B1B C;  3RKO F;  1MND A;  3DJU B;  3KMI A;  2YLD A;  3GM1 A;  1T9K A;  4DVY P;  3HNK A;  1OKK A;  3CZ6 A;  1TR2 A;  4H54 A;  1A0B A;  4MVS A;  4NTF A;  1OCC C;  1C03 A;  3EZH A;  4JEB A;  1W2W A;  2Q00 A;  4J30 B;  2A68 F;  3QVY A;  5AGF A;  5D92 A;  3F46 A;  2HSQ A;  5COG A;  5L0G A;  4N6H A;  1OXK A;  1D0X A;  3FHD A;  3AGT A;  3GWN A;  1PCX A;  3B9Q A;  2IYL D;  1RJ9 B;  3S90 A;  3CQZ A;  5HV9 A;  1T5O A;  3OA1 A;  1QSP A;  4OIO F;  4EUK B;  3LJB A;  2MYS A;  2XLD A;  3LLK A;  3GM3 A;  1BDJ B;  3RF3 A;  1YAR O;  1U89 A;  2P6V A;  4AE4 B;  3SXY A;  4JTC B;  2A6H F;  1ZHX A;  3X2Q C;  2XLH A;  3O55 A;  4ONS A;  5JUA A;  1I5N A;  2BC5 A;  2VCA A;  4ULW A;  2NUP A;  4E7S A;  5A6B D;  3NMJ A;  1JAF A;  1LS4 A;  1VLT A;  1NFO A;  4E0H A;  1NU9 C;  2P0N A;  2YL0 A;  2Z15 A;  3BRJ A;  4YWQ A;  2R7T A;  1MMN A;  5F5H A;  4E7Z A;  2IXM A;  5B3I A;  2PNO A;  2ZXP A;  5A6B A;  3J06 A;  2XS1 A;  3RH3 A;  2KQ9 A;  2QUP A;  2HJM A;  3U8V A;  5T3T A;  2EPO A;  2OEX A;  2QTV A;  3ABL C;  3TOL A;  4MS2 A;  1OCR C;  3DXJ F;  2XSE A;  2A0B A;  2A6E F;  2CNW D;  2GWW A;  4O6M A;  1B68 A;  3E70 C;  3EH1 A;  2AVK A;  4BJ5 C;  4BJ5 A;  1I4Z A;  2HS5 A;  3IQ5 A;  3QW1 A;  2KGO A;  1XZQ A;  1MMD A;  4G78 A;  3DE9 A;  5E3A A;  4IAQ A;  5FZT A;  2CNW A;  3U2L A;  4DXW A;  1EA8 A;  2WZL A;  4EBJ A;  4Q5S F;  4PK4 A;  3OEO A;  2QLA A;  1MMA A;  3U3B A;  4W8P A;  1K40 A;  2Q3T A;  1WTY A;  3ZTM A;  3GOR A;  4CDY A;  5E3C A;  4U5E E;  3NYJ A;  3ABM C;  1JR8 A;  3S27 A;  4ER9 A;  3U2M A;  1NU7 D;  2DI3 A;  4HEA J;  4KBL A;  2YQY A;  5KYX B;  4Q7C A;  3B0V C;  3JRT A;  4MTG A;  3EFO B;  3M79 A;  2XL4 A;  4E17 A;  3HNI A;  5A6K A;  3ZVR A;  3MBG A;  2R7W A;  2H7B A;  3NRH A;  2M64 A;  4OD4 A;  1Q0D A;  1ORJ A;  2NUT A;  2AU5 A;  4JCZ A;  1BBH A;  1KU2 A;  4MW3 A;  1YJG A;  2X0C A;  4EWC A;  4UDV A;  2KW3 C;  3NDB B;  1YZA A;  3V7O A;  4XLP F;  5DS6 A;  3FXH A;  4QI2 A;  2WVO A;  1D1A A;  1LE2 A;  3L34 A;  1UG7 A;  3IHU A;  2Q9B A;  3JRM O;  3S9O A;  3W2W A;  3ZSU A;  5DQT A;  1H7I A;  2Y3G A;  4DBQ A;  1HMO A;  1OCO C;  3V5Y A;  2OQM A;  4EBB A;  3B0U X;  2IBF A;  2R03 A;  2EPN A;  3FVY A;  1QPU A;  2JX0 A;  2RD9 A;  3DAF A;  2PX0 A;  4GQH A;  4JUR I;  1TKN A;  3V5Z A;  5JVE A;  3W8H A;  2OOC A;  2IOQ A;  4K1O A;  3JTL O;  1V4A A;  4IB4 A;  5CI9 A;  5EK0 A;  5E33 A;  5AC4 A;  2ASR A;  3DWW A;  1E2X A;  5K0I A;  4DRJ B;  3K33 A;  3UMK A;  4JE9 A;  1FMW A;  1LVK A;  4EIY A;  5KYW B;  4N4W A;  1QLE C;  5D91 A;  4G7Z F;  1JOG A;  3US6 A;  3LEO A;  3U9J A;  2R7V A;  1EI7 A;  5L0I A;  4J7T A;  4B6I A;  1E86 A;  2XLE A;  2IM8 A;  2UUH A;  2HKV A;  2L81 A;  4JTD B;  2YZS A;  2OJQ A;  5CI8 A;  3SYN A;  4JW1 A;  4MVU A;  3QZC A;  3U3F A;  2VCB A;  1LPE A;  3H2V A;  3IQC A;  2L9J A;  2GDC A;  2YWA A;  3N0T A;  2EIK C;  3N2Z B;  4IAR A;  5TJ5 E;  2V3C C;  1ZVZ A;  3JYH A;  2R25 A;  3L8J A;  3KH2 A;  1HE9 A;  2ZXR A;  1E84 A;  3GEH A;  4I1M A;  3W4Y A;  1Y4C A;  3LAY A;  4CDA A;  2IXP A;  3UMH A;  3HTK C;  3F47 A;  4U5F E;  4EKW A;  3G4Z A;  3B29 A;  3HJC A;  2EPK X;  1A7V A;  1MQV A;  3EGX B;  3X1O A;  3RQG A;  3UR3 C;  3T4R A;  1YDI A;  3C63 A;  4NC3 A;  2CDQ A;  1M2V A;  2OCC C;  4PJJ A;  4PFO A;  3PMR A;  4C7O A;  2L6F A;  1LE4 A;  4HFK B;  1G4U S;  1T6I A;  4PAC A;  3ZDL A;  2Q7R A;  4PJN A;  1ZYR F;  1C17 M;  4CSA A;  2JPU A;  4CSA C;  1MMG A;  2YL7 A;  1TWA A;  3L1M A;  3ASO C;  3NKD A;  2Y3H A;  4OIP F;  1VLS A;  4JKV A;  1MNE A;  1WWP A;  3EH2 A;  1BZ4 A;  4MVO A;  4BG0 A;  1VTM P;  4CJG A;  4OIQ F;  1D0Y A;  4A2N B;  3C18 A;  2YEV A;  4BEM J;  3FAJ A;  3I5Q A;  3U8P A;  5DLJ A;  3EG9 A;  2W4M A;  3EQL F;  1JPJ A;  4MQ9 F;  4IJJ A;  3Q7L A;  4RDA A;  1RKE A;  3W8I A;  1WAS A;  2FFH A;  4D4N A;  4Z9J A;  1PD1 A;  2YLI A;  1ZHW A;  5L0H A;  3IEE A;  2R7R A;  2ZXO A;  1D1C A;  2TMV P;  4DRH B;  2J0X A;  2QE9 A;  3ATP A;  4DRI B;  3K6B A;  4XQ1 A;  5KYU B;  4RBN A;  4AK9 A;  5L3Q A;  4ZLD A;  2L6H A;  4PJM A;  4M63 A;  2XXA B;  3O6X A;  2YRF A;  3ITF A;  1FNT c;  3LES A;  1QQ3 A;  4OD5 A;  5FCL A;  5KYY A;  3NMK A;  3RQF A;  2HMZ A;  2NPU A;  4BJT A;  1CGO A;  3EGD A;  1VMA A;  2UUI A;  3IQ6 A;  2AWC A;  4P6I C;  5A69 A;  3EHN A;  3GAN A;  4PFP A;  5JS5 A;  2G3K A;  4HFF B;  3U9M A;  3NKE A;  3RFY A;  4BEJ A;  3S29 A;  5BQI A;  1RMV A;  3FOP A;  1WAT A;  5BQG A;  3NMI A;  2LSE A;  4CS7 A;  2EIM C;  256B A;  4CS8 C;  4CS8 A;  1WOL A;  1YYX A;  4A4A A;  3JZ0 A;  3WG7 C;  3Q6N A;  3AG3 C;  3DAG A;  4NY3 A;  3L0I A;  1CGN A;  2G3V A;  4YT8 A;  2J7P D;  2B0H A;  4Q4Z F;  2YLG A;  3B0P A;  3QTH A;  2IXN A;  2YL1 A;  3G50 A;  1CPQ A;  1PV3 A;  4MND A;  1ZZP A;  2Y69 C;  4LLE A;  3T6G B;  4GYT A;  2JD3 A;  1D0Z A;  4O6Y A;  4DBR A;  1VOM A;  3MX3 A;  4PJL A;  1R5I D;  1ZHY A;  3GEE A;  1NSG B;  1CGM E;  2J7P A;  1FFT C;  1AEP A;  4CDV A;  1HW1 A;  2OG2 A;  1M57 C;  1QZX A;  4YK5 A;  3AGU A;  1GGQ A;  2J9V A;  2R7Q A;  3UNG C;  2Q4F A;  1SZI A;  3SEO A;  2AP3 A;  1Y6D A;  3PCV A;  2Q9C A;  3AQB A;  3DJN B;  2VH3 A;  4L6R A;  4U5C E;  1L3P A;  3G4X A;  5EGY A;  5DS5 A;  2EIL C;  4CS9 C;  1D1B A;  4CS9 A;  1HW2 A;  2J0W A;  3NG1 A;  1QVX A;  2LQG A;  2L7A A;  4H4K C;  4G7O F;  4YT4 A;  2YKZ A;  2R7X A;  1Q0K A;  2H7O A;  4J7Y A;  4KNW A;  4C3E A;  4LER A;  3UMI A;  2C04 A;  3RVZ A;  2BL2 A;  1G5Z A;  3MFN A;  4RD9 A;  3Q7G A;  2A69 F;  3ZG1 A;  4XPW A;  3B71 A;  1ZHT A;  1R4T A;  4QI0 A;  2VC9 A;  3GOD A;  1ORS C;  4YL3 A;  1YYJ A;  3RW0 A;  1LS1 A;  2R05 A;  1ZHZ A;  3RQE A;  3S28 A;  3H2U A;  4IRU A;  1OR2 A;  2P1A A;  3AJM A;  5L0J A;  2XLO A;  1RJ9 A;  1O3U A;  2YHS A;  4AL1 A;  1NBB A;  3S84 A;  1YA7 O;  1BR4 A;  2V26 A;  2G62 A;  1PD0 A;  1JMW A;  4MTF A;  3AOU A;  3KKB A;  3KL4 A;  3S0X A;  4ULV A;  4AE4 A;  1SYQ A;  1KNY A;  1V55 C;  1J8Y F;  4CIH A;  2PX3 A;  3ZC4 A;  1VB5 A;  4U5G A;  2AWY A;  4DJ9 A;  2IXO A;  5E2Q A;  1FAP B;  4MVQ A;  1WGW A;  2R7O A;  4MVZ A;  4C3B A;  3C7J A;  2VAS A;  3SZR A;  5DQZ A;  4K0D A;  1LIH A;  2NUP B;  2OJE D;  3TOM A;  3SNH A;  1HMD A;  2R02 A;  2ZD9 A;  1OCZ C;  3EGD B;  2OU6 A;  3RVY A;  3K1H A;  3HLZ A;  4J32 B;  3TJ5 A;  1LKX A;  1TQG A;  2J46 A;  3N24 A;  4MVR A;  1WN0 A;  2I8B A;  5JSL A;  3C62 A;  1IZM A;  1Z7Q c;  5AC5 A;  1S05 A;  1VK5 A;  2E87 A;  1GS9 A;  3TUL A;  2R7U A;  2OEV A;  1YAU O;  2HSB A;  3DMD A;  3TD7 A;  2LK4 A;  3EPV A;  3ZWI A;  3HKK A;  5B3S C;  3PHF 2;  4CBE A;  4R32 A;  2R9R B;  4LDQ A;  1OXB A;  1LI7 A;  2M4E A;  2D5R B;  4ANJ A;  3LUT B;  4NQF A;  3C8G D;  3LNM B;  1EKY A;  2LFD A;  3DE8 A;  4NCQ A;  1T6U A;  1H9T A;  3CEX A;  4U5D E;  2D4U A;  1AVO B;  2NG1 A;  3L8I A;  2PFD A;  3LS0 A;  3JYY A;  2KJG A;  2J8W A;  3ZTZ A;  2EPL X;  4W8K A;  3T6B A;  3C8Z A;  1QKR A;  3DI5 A;  3C8G A;  3JSZ A;  4EHP A;  4AX2 A;  2DGJ A;  3E9V A;  1OR3 A;  5KYX A;  3JT1 A;  2GFH A;  3VM6 A;  3JSE O;  3EFO A;  2Y3B A;  1GQA A;  1U0B B;  1Q0F A;  4P9T A;  3A9C A;  2EPM X;  1ORY A;  4AL0 A;  1TFK B;  4JEA A;  3DM5 A;  4YT5 A;  2XLW A;  3K66 A;  4FAP B;  3U0C A;  4OIR F;  3K7D A;  2Y3D A;  2PF4 E;  3TQO A;  3GWL A;  4YL0 A;  4E0I A;  2HUJ A;  3AQC A;  5BQH A;  3U5S A;  5CIV A;  3I5P A;  3UGP A;  1ZW2 A;  2NUT B;  4U5B E;  3EJN A;  1OW8 A;  3RYL A;  2ETS A;  5HSW A;  1Z23 A;  2MHR A;  3AG2 C;  2W9Y A;  4MW8 A;  1DOV A;  4U9D A;  1BR2 A;  1Q0M A;  1T01 A;  5KYN A;  2FGY A;  1TFO B;  2XLM A;  4CJO A;  2CW0 F;  1Z5Z A;  2Q9A A;  2VB6 A;  1SR2 A;  4I44 A;  4WGZ A;  4F4B A;  3MYF A;  2QY9 A;  3MYI A;  5COM A;  2W4B A;  3W2V A;  5KYW A;  5F5F A;  2WL8 A;  4HE8 D;  3R7C A;  1V54 C;  4O6N A;  4P9F A;  5L0F A;  1Z6A A;  3DD7 A;  1T6Q A;  3DM9 B;  4XPX A;  5COF A;  3UGO A;  1FR0 A;  3FAP B;  3LLI A;  2HV7 A;  2VCC A;  3JCU Q;  2EIN C;  4IWB A;  3SXZ A;  5F28 E;  1RXQ A;  5L0C A;  4JVS A;  2OKU A;  4CIP A;  4KI2 A;  3HNL A;  1Z3I X;  4JRZ A;  1CPR A;  1OW6 A;  5GPG B;  3IQT A;  4E18 A;  4YN0 B;  5DVW A;  3SXK A;  1M56 C;  2DB4 A;  3O39 A;  3OWT A;  1NZE A;  3ZIB A;  3POV A;  4K7B A; 
#chains in the Genus database with same CATH homology
 1IW7 F;  4O7G A;  5IY5 C;  3EGX A;  1ST6 A;  1TWG A;  1TWC A;  2J9W A;  3EHM A;  3NYL A;  3LEV A;  3EZI A;  4AX2 A;  1TWH A;  2PP4 A;  3DZA A;  4KC9 A;  2BE5 F;  4YJW A;  3H65 A;  1VYI A;  4KNV A;  4G7H F;  1FMV A;  1M2V B;  2C03 A;  4G0H A;  4C7O B;  4IAO A;  5T3W A;  1SF8 A;  4O79 A;  1NG1 A;  3I4U A;  3ASN C;  1G8X A;  2J9U A;  4JCH A;  4FWV A;  4I3M A;  2WVN A;  2W45 A;  4JZA A;  4BJ1 A;  4XTK A;  3EG9 B;  1N1C A;  4OIN F;  4N06 A;  1M2O A;  4LAC B;  1FFH A;  4FX5 A;  4BJ6 A;  4BJ6 C;  2A1D D;  1O87 A;  5KYU A;  2Y39 A;  4ZLC A;  2XXA A;  1VYK A;  2B0J A;  2X51 A;  2P7V A;  2ZPA A;  3LS1 A;  2WVQ A;  4X0R A;  2ZXW C;  5KYY B;  3FDQ A;  4JJG A;  4WJ0 A;  2J45 A;  2CGE A;  3LNR A;  3RIP A;  1O5H A;  3VYW A;  1BR1 A;  1J8M F;  2WZG A;  3VAY A;  2O9X A;  2XRH A;  4FES A;  4DOZ A;  3CSK A;  4GEH A;  4DVZ A;  2R7S A;  4XLN F;  2EIJ C;  1JPN A;  2DYS C;  5L3V A;  1S7Z A;  5DS4 A;  1Z63 A;  5T1D B;  1FTS A;  4LLC A;  3Q6M A;  3ABK C;  3SP1 A;  4EWC A;  3K1I C;  2WZF A;  4U5H A;  3MLG A;  1SMY F;  4XWJ A;  2DYR C;  3NYM A;  3QMK A;  2MWQ A;  3AG1 C;  3WOD F;  4C3D A;  4YT2 A;  1ZU4 A;  5BUO A;  3T6J A;  2KNH A;  4JJF A;  5EHH A;  3M1C B;  1ZU5 A;  2HV6 A;  3ECS A;  2WB7 A;  4I1O B;  3AG4 C;  1OKK D;  5B1A C;  2H7V C;  4QDL A;  5B1B C;  3RKO F;  1MND A;  3DJU B;  3KMI A;  4DVY P;  1OKK A;  3CZ6 A;  1TR2 A;  1OCC C;  3EZH A;  1W2W A;  4J30 B;  2A68 F;  5D92 A;  3F46 A;  1D0X A;  3FHD A;  1PCX A;  3B9Q A;  2IYL D;  1RJ9 B;  3CQZ A;  3OA1 A;  4OIO F;  3LJB A;  2MYS A;  3LLK A;  2P6V A;  4AE4 B;  2A6H F;  1ZHX A;  3X2Q C;  4ULW A;  2NUP A;  4E7S A;  1NU9 C;  2Z15 A;  4YWQ A;  2R7T A;  1MMN A;  5F5H A;  4E7Z A;  2IXM A;  2ZXP A;  3RH3 A;  2KQ9 A;  5T3T A;  2QTV A;  3ABL C;  1OCR C;  3DXJ F;  2XSE A;  2A6E F;  2CNW D;  4O6M A;  3E70 C;  3EH1 A;  4BJ5 C;  4BJ5 A;  2KGO A;  1MMD A;  5E3A A;  2CNW A;  2WZL A;  4Q5S F;  4PK4 A;  3OEO A;  1MMA A;  2Q3T A;  5E3C A;  4U5E E;  3NYJ A;  3ABM C;  3S27 A;  1NU7 D;  4HEA J;  4KBL A;  5KYX B;  4Q7C A;  3B0V C;  3JRT A;  3EFO B;  2XL4 A;  3ZVR A;  2R7W A;  2H7B A;  3NRH A;  4OD4 A;  2NUT A;  1KU2 A;  3NDB B;  2KW3 C;  3V7O A;  4XLP F;  5DS6 A;  4QI2 A;  2WVO A;  1D1A A;  3L34 A;  2Q9B A;  3W2W A;  3ZSU A;  5DQT A;  2Y3G A;  4DBQ A;  1OCO C;  4EBB A;  3B0U X;  3FVY A;  3DAF A;  2PX0 A;  4JUR I;  1TKN A;  3W8H A;  2IOQ A;  5CI9 A;  5E33 A;  3K33 A;  3UMK A;  1FMW A;  1LVK A;  5KYW B;  5D91 A;  1QLE C;  4G7Z F;  2R7V A;  4B6I A;  2L81 A;  2YZS A;  5CI8 A;  3SYN A;  4JW1 A;  3QZC A;  2L9J A;  3N0T A;  2V3C C;  2EIK C;  3N2Z B;  3JYH A;  3KH2 A;  2ZXR A;  4I1M A;  3LAY A;  2IXP A;  3UMH A;  3HTK C;  3F47 A;  4U5F E;  3HJC A;  3EGX B;  3X1O A;  3UR3 C;  3T4R A;  2CDQ A;  1M2V A;  2OCC C;  4PJJ A;  4PFO A;  3PMR A;  4C7O A;  4HFK B;  4PJN A;  1ZYR F;  4CSA A;  4CSA C;  1MMG A;  1TWA A;  3ASO C;  3NKD A;  2Y3H A;  4OIP F;  1MNE A;  3EH2 A;  4BG0 A;  4OIQ F;  1D0Y A;  4A2N B;  2YEV A;  3FAJ A;  3I5Q A;  5DLJ A;  3EG9 A;  2W4M A;  3EQL F;  1JPJ A;  4MQ9 F;  4IJJ A;  3Q7L A;  4RDA A;  3W8I A;  2FFH A;  1PD1 A;  1ZHW A;  3IEE A;  2R7R A;  2ZXO A;  1D1C A;  2J0X A;  3K6B A;  5KYU B;  4RBN A;  4AK9 A;  5L3Q A;  4ZLD A;  4PJM A;  4M63 A;  2XXA B;  3O6X A;  3ITF A;  3LES A;  4OD5 A;  5FCL A;  5KYY A;  4BJT A;  3EGD A;  1VMA A;  4P6I C;  3EHN A;  3GAN A;  4PFP A;  2G3K A;  4HFF B;  3NKE A;  3RFY A;  4BEJ A;  3S29 A;  2LSE A;  4CS7 A;  2EIM C;  4CS8 C;  4CS8 A;  3WG7 C;  3Q6N A;  3AG3 C;  3DAG A;  4NY3 A;  3L0I A;  2G3V A;  4YT8 A;  2J7P D;  4Q4Z F;  3B0P A;  2IXN A;  4MND A;  2Y69 C;  4LLE A;  4GYT A;  2JD3 A;  1D0Z A;  4O6Y A;  4DBR A;  1VOM A;  3MX3 A;  4PJL A;  1ZHY A;  2J7P A;  1FFT C;  2OG2 A;  1M57 C;  1QZX A;  2J9V A;  2R7Q A;  3UNG C;  1SZI A;  3SEO A;  2Q9C A;  3AQB A;  3DJN B;  2VH3 A;  5EGY A;  4U5C E;  5DS5 A;  2EIL C;  4CS9 C;  1D1B A;  4CS9 A;  2J0W A;  3NG1 A;  4H4K C;  4G7O F;  2R7X A;  2H7O A;  4KNW A;  4C3E A;  4LER A;  3UMI A;  2C04 A;  4RD9 A;  3Q7G A;  2A69 F;  3ZG1 A;  4QI0 A;  1ZHT A;  3GOD A;  1LS1 A;  1ZHZ A;  3S28 A;  4IRU A;  1RJ9 A;  2YHS A;  2V26 A;  1BR4 A;  2G62 A;  1PD0 A;  3KKB A;  3KL4 A;  3S0X A;  4AE4 A;  1V55 C;  4CIH A;  1J8Y F;  2PX3 A;  3ZC4 A;  4U5G A;  2IXO A;  5E2Q A;  1WGW A;  2R7O A;  4C3B A;  2VAS A;  3SZR A;  5DQZ A;  4K0D A;  2NUP B;  3SNH A;  1OCZ C;  3EGD B;  3K1H A;  3HLZ A;  4J32 B;  4YT4 A;  1LKX A;  2J46 A;  3N24 A;  2I8B A;  1IZM A;  1VK5 A;  2E87 A;  2R7U A;  3TD7 A;  3DMD A;  3EPV A;  5B3S C;  3PHF 2;  4CBE A;  2M4E A;  2D5R B;  4ANJ A;  4U5D E;  2NG1 A;  2PFD A;  3LS0 A;  2KJG A;  3T6B A;  4W8K A;  3JSZ A;  2DGJ A;  3E9V A;  5KYX A;  3JT1 A;  2GFH A;  3EFO A;  2Y3B A;  4YT5 A;  3DM5 A;  3K66 A;  4OIR F;  3K7D A;  2Y3D A;  2PF4 E;  3AQC A;  3I5P A;  3UGP A;  2NUT B;  4U5B E;  3EJN A;  3RYL A;  5HSW A;  1Z23 A;  3AG2 C;  2W9Y A;  1BR2 A;  5KYN A;  2FGY A;  2CW0 F;  1Z5Z A;  2Q9A A;  2VB6 A;  4I44 A;  4F4B A;  2QY9 A;  2W4B A;  3W2V A;  5KYW A;  5F5F A;  2WL8 A;  4HE8 D;  1V54 C;  4O6N A;  1Z6A A;  3DD7 A;  3DM9 B;  3UGO A;  3LLI A;  2HV7 A;  3JCU Q;  4IWB A;  2EIN C;  4JVS A;  4KI2 A;  1Z3I X;  4YN0 B;  5DVW A;  1M56 C;  3O39 A;  3OWT A;  3POV A;  1NZE A;  3ZIB A;  4K7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...