5F5HA

X-ray structure of roquin roq domain in complex with ox40 hexa-loop rna motif
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
148
structure length
148
Chain Sequence
QLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Roquin-1
publication title Roquin recognizes a non-canonical hexaloop structure in the 3'-UTR of Ox40.
pubmed doi rcsb
source organism Mus musculus
total genus 48
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5f5hA00
3X1OA 4YWQA 4QI2A 5F5FA 4ZLDA 4QI0A 4ULWA 4ZLCA 5F5HA
chains in the Genus database with same CATH superfamily
3JZ0A 4NTBA 4C7OB 1Q0FA 4U5CE 3EHMA 4LERA 2J7PA 5COFA 2MWQA 1QLEC 4W8KA 1VLTA 2XLDA 2W45A 1H9TA 4I1MA 2OQMA 3I5PA 4JJFA 3T6GB 3PHF2 1OCCC 2X51A 3TJ6A 5JVEA 2EIMC 3W2WA 3X2QC 3FOPA 3AOUA 2XS8A 4BJ1A 4MTOA 4AL1A 3O10A 1OW6A 3LJBA 4K7BA 4KBLA 2A6EF 4XWJA 3U5SA 2VASA 1NG1A 4JTDB 1E84A 1OXBA 2R7SA 1C17M 3ZSUA 4XQ1A 1T5OA 3HKKA 4LLCA 1TWHA 4G7HF 4N6HA 1WWPA 2J9VA 2LFFA 1ZU4A 3NKEA 3NG1A 4OIQF 2ZXPA 5L0GA 1VK5A 1I5NA 1FMVA 3RQFA 4CS8A 2HMZA 2ZD9A 5AGFA 3GEEA 3T4RA 3ABKC 1R4TA 3SXZA 4M63A 4PJMA 1T6UA 4ULWA 3C7JA 5L0DA 2XXAB 1JOGA 2H8AA 2MYSA 2YVKA 3K1IC 5KYYA 1Z6AA 4WABA 4YK5A 2KNHA 3ZQVA 5A6BD 5L0CA 4FESA 4JEAA 4CIHA 1C02A 4YT5A 3SXMA 1V55C 1TQGA 2EILC 2W4BA 4DRHB 4LDRA 1MMGA 2XLVA 3GWNA 2HSQA 3L8IA 2LFDA 1O87A 2NG1A 2YLIA 1AEPA 5BQHA 1TFKB 2D4UA 1M56C 3LUTB 4Z9JA 3MBGA 5DS4A 3AGUA 3OA1A 2PP4A 4WGYA 2LCHA 3IHUA 4YN0B 3L0IA 3V5XA 4EWCA 1KTMA 1I4ZA 1OR3A 1GS9A 3UMIA 2OCCC 4JIOA 2JPUA 1EI7A 2DYSC 4UDVA 2V26A 3JSZA 4WJ0A 4PFPA 3TOMA 1F1MA 1T6IA 1NFNA 2HFIA 3RW0A 4CSAC 1QZXA 3NMJA 3ABLC 3KKBA 4Z9HA 2HMQA 4Z9IA 1AUEA 4Q4ZF 1LE4A 4QI2A 4E7SA 3SEOA 1Q0GA 2OEVA 4FWVA 3CAXA 4U5EE 3POVA 1WASA 5IY5C 2C03A 2A68F 2HV7A 1VB5A 3C8GD 2XLMA 4I3MA 3Q6NA 3ASOC 4H54A 4I1OB 4JE9A 4O79A 2XLWA 3HNIA 5DQZA 1MQVA 3GORA 1B68A 2OKUA 2Y39A 3LAYA 3MLGA 4R32A 1RXQA 3BRJA 1JRAA 3FHDA 2YQYA 3S28A 1M6TA 5E3CA 4DRIB 3PDMP 5D92A 2VH3A 1RJ9A 2RD9A 1Z63A 5KYXA 4EBJA 2NUTB 2H7OA 2R02A 4LLEA 1VMAA 1NZEA 4HEAJ 3DJUB 4WGZA 4U5GA 3EHNA 3ZTZA 3VF0A 5E3AA 1FFHA 3DKAA 1Y6DA 1TKNA 2BE5F 2L9JA 3US6A 4LDKA 4PJJA 3SNHA 2AVKA 3IEEA 4PR9A 2G62A 3EGDA 1ORYA 2EINC 4QI0A 2W4MA 3FXHA 1PD1A 3GWLA 3RFYA 3SXKA 1A0BA 2M4EA 1U6HA 2VCBA 3FOOA 3LNRA 3S27A 4YT8A 4A2NB 1K04A 5FZTA 1LIHA 1A7DA 3NMKA 1KU2A 1HMDA 2Q4FA 3NKDA 2G3KA 2J9BA 4J7YA 4P9FA 2L7AA 2EPKX 5COGA 4AX2A 5DLJA 3AG1C 2KW3C 2FAPB 4O7GA 5BQIA 1NU9C 1CPRA 3Q7GA 3M1CB 2LQGA 1FFTC 2GAQA 2Y3DA 4ONSA 2ICWG 4CS9C 2R03A 3GODA 3HJCA 3LS0A 4JCZA 4MVSA 2QE9A 4NQFA 5KYWA 3DAFA 3NRHA 4Q7CA 5F28E 3EFOB 4QDLA 2CNWD 3JYYA 4XPWA 1OXKA 4MVRA 3EH1A 4U5HA 1YJGA 2PX0A 1H6GA 1MMDA 1CGOA 3HNKA 3A9CA 3S29A 5HV9A 4BJ5A 1HW1A 2J9UA 1MNEA 2A69F 4NTFA 4MW3A 2R7OA 1S7ZA 4MTGA 1OKKA 2AP3A 3C8GB 4D4NA 5FCLA 2CCYA 5T3TA 4BPMA 1OCOC 3WAQA 5A6AA 4KC9A 3AG4C 3EJNA 2VB6A 4JVSA 2P1AA 1QQ3A 2R7XA 1OCRC 2L6HA 4NC3A 3GM3A 4P9TA 4P6IC 2L6GA 4CBEA 3J06A 1BR4A 2LK4A 5T1DB 1D1BA 2HV6A 3B71A 5BQGA 1QPUA 2QUPA 2ETSA 2IOQA 5L0IA 3KYJA 5EHHA 4PFOA 4N4WA 3IQ5A 3ZDLA 4U9DA 1E85A 2ZXWC 1D0XA 4DOZA 2J8WA 3S84A 2J9WA 3AJMA 5DS5A 3EPVA 1M57C 4BEJA 3IQ6A 3KYIA 1ZHYA 2P0NA 4XTKA 3UGPA 5B3IA 2NUPA 2BC5A 4U9EA 2JX0A 1ZYRF 1JPNA 3RIPA 1V74B 2YHSA 1ST6A 2Q3TA 2D5RB 2YLGA 3ECSA 4RDAA 1O5HA 5B1AC 4DBRA 2ASRA 1CGNA 3U0CA 2YKZA 2A1DD 4FAPB 4KI2A 1ZHWA 2HJMA 5AC4A 3C8ZA 2XXAA 2Q00A 4MTFA 4BJTA 2YL1A 4RD9A 2XSEA 2YL0A 3UMHA 3DWWA 3C63A 2QY9A 3HTKC 4XLNF 4X0RA 3V7OA 4CJGA 3O39A 1LPEA 2R05A 4FX5A 2G3VA 2HJ3A 4JCHA 5JUAA 1MMNA 5E33A 1ZHTA 3H65A 2V3CC 2XLEA 3GANA 1A7EA 3NYMA 4HFFB 1J8MF 4YL3A 3VRCA 1RKEA 2UUIA 5A69A 4MVUA 2W9YA 1JR8A 3EG9B 3JCUQ 2LD6A 2R7VA 1H7IA 3T6BA 2XL6A 1PD0A 1SYQA 1A41A 5F5FA 3ZWIA 3NMIA 3I5QA 1CGME 3O6XA 1GM5A 4PJLA 3M4BA 3IQTA 1VOMA 1M2VB 2GDCA 2VC9A 2XLOA 4MVQA 3I4UA 2DB4A 3EGXB 3DAGA 2WVQA 3DZAA 3QTHA 3JT1A 4EHPA 5L3QA 5A6KA 3G4ZA 4RBNA 3WODF 4XLPF 3M79A 2Y3BA 1S05A 5TJ5E 3WG7C 3L8JA 4XPYA 4E0IA 3B0VC 4YJWA 3JTLO 4GYTA 1ZW3A 3K6BA 3E70C 1QKRA 3ZG1A 3DXJF 4JW1A 4YWQA 2PBEA 1M2OA 3B9QA 3PCVA 3JSEO 1E83A 1K40A 1YZAA 3L34A 4JEBA 2KQ9A 1FAPB 4BJ6C 3TK0A 1HE9A 2EPOA 3KPHA 4ZLDA 3AQCA 1XZQA 4IGGA 5KYNA 256BA 3HNLA 3ITFA 4MVZA 4F4BA 3SZRA 5E2QA 4XEKA 1NSGB 2KJGA 5KYUA 1YDIA 4IAQA 5CIVA 3H2VA 3TD7A 2XL4A 4XEVA 3S90A 5T3WA 4XEFA 3RVYA 2GFHA 5L0HA 2Q7RA 1LS4A 2NUTA 4OD4A 4IJJA 4CDAA 1YVIA 2EPNA 4CS7A 5A6BA 1D1CA 4J32B 1WTYA 4EKWA 3A11A 4MVOA 3TOLA 1BR2A 2OEXA 1L3PA 1T6QA 3KMIA 1RMVA 2GA0A 3RQGA 1APCA 3QVYA 4AE4A 1ZHXA 5L0JA 1MMAA 2ZXRA 2NSGA 5BUOA 2R7QA 1G4WR 2EPMX 4GEHA 4C3BA 2Y3GA 4L6RA 4YT2A 2XS1A 2I8BA 2YEVA 2ZXOA 4CS8C 1VYIA 4NY3A 2DYRC 4KNWA 4NTAA 3K66A 2J7PD 3MFNA 1HW2A 3Q6MA 1YA7O 3GM2A 1KNYA 1ORJA 1J8YF 1VLSA 2A0UA 2EIJC 3ASNC 4I44A 1D1AA 5F5HA 2FFHA 5KYXB 1TR2A 1JPJA 4HE8D 1IZMA 3N24A 3Q7LA 1I4YA 1BZ4A 1Y4CA 3QW0A 3K1IA 3FAJA 5DS6A 3LLKA 2QNLA 3M15A 2H7VC 1Z7Qc 3ZIBA 4ZLCA 1EA8A 4EBBA 2XL8A 4OIRF 1Q0KA 2YL7A 3SP1A 1T01A 2I15A 2PNOA 1OW7A 2CGEA 3DE9A 3NYJA 3QZCA 2CDQA 4IB4A 2B0JA 1NFOA 4U5BE 4C3DA 3UGOA 4OIPF 3F47A 3W8HA 4LACB 3C8GA 2L6FA 3AQBA 3FMSA 3HNJA 4GQHA 4DVYP 2IXOA 1U89A 5AC5A 1XWJA 2Z15A 1LVKA 3M4CA 2AWYA 2R7TA 3G50A 3ATPA 4E7ZA 1OR2A 2IXPA 2AU5A 4C7OA 3LNMB 5JLIA 1QSPA 2UUHA 1A7VA 3T9OA 2BL2A 3EQLF 3KH2A 2YL3A 2DI3A 3SYNA 4AK9A 3AG3C 4B6IA 2EPLX 4N06A 3S0XA 1BDJB 2FGYA 5HSWA 1ZW2A 1ZVZA 1TFOB 3K33A 3QW1A 2VCAA 4CSAA 1TWGA 1SZIA 1HE1A 1GGQA 4JTAB 4PK4A 3LEOA 4JURI 2TMVP 2O9XA 1QVXA 3MYFA 1FR0A 3DM9B 1G5ZA 4JJGA 1YYXA 1D0ZA 4AL0A 1JAFA 3CZ6A 3DI5A 5EK0A 3UMKA 1WGWA 2Y69C 1WATA 3CEXA 2IYLD 5GPGB 2J0WA 1EKYA 1E2XA 2IM8A 2QLAA 1YLMA 3U2LA 1E86A 4MW8A 5EGYA 2RSEB 3DM5A 3DJNB 3GEIA 1TWCA 5JS5A 1R5ID 4Q5SF 1FMWA 2QTVA 4NCQA 4CX9A 2NPUA 3ABMC 3DMDA 2OOCA 1V54C 2B0HA 5B1BC 3AGTA 1ZU5A 2CNWA 4DRJB 3R7CA 1BR1A 4JRZA 2WZLA 3TQOA 2XRHA 4U5DE 1G4US 3EG9A 3ZC4A 4MNDA 2XM0A 1RCPA 1ZZPA 3CQZA 4CJOA 4DJ9A 2P61A 3O55A 3RYLA 2NUPB 2AWCA 3RH3A 4E18A 3QVZA 4JTCB 1HMOA 5DQTA 1D0YA 2KK1A 2HUJA 4CDYA 1M2VA 1LM3B 3GM1A 3TJ5A 3V5YA 1VYKA 3EGXA 2WB7A 2P6VA 2PF4E 1Z3IX 3C18A 3LLIA 4O6NA 4ULVA 3W2VA 1XZPA 4G7OF 2P7VA 3IPMO 3HLZA 1RKCA 2MHRA 4YL0A 2OJED 2VCCA 4IARA 3NYLA 4CS9A 2WZGA 4PJNA 2R7RA 1CPQA 2KSFA 2J0XA 5KYYB 4G0HA 1DOVA 2WVOA 2LP4A 2H7BA 3BEHA 1PV3A 1WN0A 1BBHA 2J46A 1MNDA 1YYJA 4IRUA 3U9MA 4BJ5C 4EBKA 4EUKB 1Q0DA 1OQCA 1RKEB 2HSBA 2XM4A 2YRFA 3RQEA 4W8PA 1Z5ZA 3CSKA 1G8XA 4IWBA 4CDVA 1V4AA 1H9GA 2KGOA 2ZPAA 3W4YA 4A4AA 1UG7A 4EIYA 2CYDA 4C3EA 5A6JA 2WZFA 3FDQA 1LKXA 1ORSC 1VTMP 1N1CA 1UFBA 4OIOF 1TWAA 3C62A 1NBBA 3JYHA 4J30B 4PACA 2OJQA 2IXMA 3H2UA 1ZHZA 3U8PA 5JRAA 3B0PA 3UNGC 3OWTA 2HZ8A 1FTSA 2X0CA 1SMYF 1U0BB 1WOLA 1OW8A 2CW0F 2WL8A 2JD3A 3QMKA 4OINF 1SF8A 4BEMJ 2R9RB 1YAUO 3F46A 3VM6A 2YLDA 2PX3A 3U2MA 4N6CA 3V5ZA 5COMA 3LESA 3VYWA 3X1OA 2LSEA 1LI7A 2R7WA 2Q9BA 1T9KA 1YA9A 3GEHA 2PFDA 4MVMA 3MYIA 5DVWA 4K1OA 2YWAA 1OKKD 1DOWA 2WVNA 2A6HF 3EZIA 3U3FA 2IBFA 3B29A 3TULA 3N2ZB 3RF3A 4KNVA 4HFKB 5KYUB 4CIPA 2L81A 2C04A 5L0FA 3S9OA 2Q9CA 1HY5A 4JZAA 4ANJA 3MX3A 3B0UX 2M64A 3T6JA 1RJ9B 2LIGA 1FNTc 1O3UA 1Q0MA 2HKVA 3G4XA 3LS1A 4YT4A 2KYHA 3KL4A 4K0DA 3AG2C 3U9JA 4E17A 3ZQYA 3EFOA 5D91A 1C03A 4DVZA 2Y3HA 3ZVRA 1YARO 2Q9AA 3JRMO 3DD7A 3JRTA 3IQCA 1W2WA 2DGJA 4G78A 4G7ZF 3EGDB 1LS1A 4JC7A 1AVOB 2E87A 3OEOA 4AE4B 4U5FE 2OU6A 3DE8A 1L7CA 4YL1A 3EH2A 2GWWA 3W8IA 4IAOA 1NLXA 5CI8A 3WHNA 1OCZC 2R25A 4XPXA 2OG2A 2YZSA 3FVYA 2EIKC 4ER9A 3K7DA 5L3VA 1Z23A 4DXWA 3U3BA 3ZTMA 1YZCA 3L1MA 4O6MA 3UR3C 2IXNA 5B3SC 3NDBB 1K05A 3U8VA 5CI9A 4E0HA 4DBQA 2HS5A 3FAPB 4MS2A 2R7UA 5KYWB 1LE2A 3R2PA 2KC3A 3SXYA 4O6YA 4D4XA 1SR2A 1GQAA 2A0BA 2F22A 3K1HA 3PMRA 3RKOF 2NSFA 3LEVA 1LI5A 4JKVA 5JT4A 1JMWA 4MQ9F 5JSLA 4BG0A 2XLHA 1IW7F 3EZHA 5JP7A 4BJ6A 3RVZA 5K0IA 4J7TA 1EQ1A 3VAYA 1PCXA 4LDQA 4OD5A 4H4KC 3N0TA 2J45A 1NU7D 3E9VA
chains in the Genus database with same CATH topology
4C7OB 4U5CE 3EHMA 4LERA 2J7PA 2MWQA 1QLEC 4W8KA 2W45A 4I1MA 3I5PA 4JJFA 3PHF2 1OCCC 2X51A 2EIMC 3W2WA 3X2QC 4BJ1A 4KBLA 3LJBA 4K7BA 2A6EF 4XWJA 2VASA 1NG1A 2R7SA 3ZSUA 4LLCA 1TWHA 4G7HF 2J9VA 1ZU4A 3NKEA 3NG1A 4OIQF 2ZXPA 1VK5A 1FMVA 4CS8A 3T4RA 3ABKC 4M63A 4PJMA 4ULWA 2XXAB 2MYSA 3K1IC 5KYYA 1Z6AA 2KNHA 4FESA 4CIHA 4YT5A 1V55C 2EILC 2W4BA 1MMGA 1O87A 2NG1A 1M56C 5DS4A 3OA1A 2PP4A 4YN0B 4EWCA 3L0IA 3UMIA 2OCCC 2DYSC 2V26A 3JSZA 4WJ0A 4PFPA 4CSAC 1QZXA 3ABLC 3KKBA 4Q4ZF 4QI2A 4E7SA 3SEOA 3POVA 4FWVA 4U5EE 5IY5C 2C03A 2A68F 2HV7A 4I1OB 4I3MA 3Q6NA 3ASOC 4O79A 5DQZA 2Y39A 3LAYA 3MLGA 3FHDA 3S28A 5E3CA 5D92A 2VH3A 1RJ9A 1Z63A 5KYXA 2NUTB 2H7OA 4LLEA 1VMAA 1NZEA 4HEAJ 3DJUB 4U5GA 3EHNA 5E3AA 1FFHA 2L9JA 1TKNA 2BE5F 4PJJA 3SNHA 3IEEA 2G62A 3EGDA 2EINC 4QI0A 2W4MA 1PD1A 3RFYA 2M4EA 3LNRA 3S27A 4YT8A 4A2NB 1KU2A 3NKDA 2G3KA 5DLJA 4AX2A 3AG1C 2KW3C 4O7GA 1NU9C 3Q7GA 3M1CB 1FFTC 2Y3DA 4CS9C 3HJCA 3GODA 3LS0A 5KYWA 3DAFA 3NRHA 4Q7CA 3EFOB 4QDLA 2CNWD 3EH1A 4U5HA 2PX0A 1MMDA 3S29A 4BJ5A 2J9UA 1MNEA 2A69F 2R7OA 1S7ZA 1OKKA 5FCLA 5T3TA 1OCOC 4KC9A 3AG4C 3EJNA 2VB6A 4JVSA 2R7XA 1OCRC 4CBEA 4P6IC 1BR4A 5T1DB 1D1BA 2HV6A 2IOQA 5EHHA 4PFOA 2ZXWC 1D0XA 4DOZA 2J9WA 5DS5A 3EPVA 1M57C 4BEJA 3UGPA 4XTKA 1ZHYA 2NUPA 1ZYRF 1JPNA 3RIPA 2YHSA 1ST6A 2Q3TA 2D5RB 3ECSA 4RDAA 5B1AC 1O5HA 4DBRA 4KI2A 2A1DD 1ZHWA 2XXAA 4BJTA 4RD9A 2XSEA 3UMHA 4XLNF 2QY9A 3HTKC 4X0RA 3V7OA 3O39A 4FX5A 2G3VA 4JCHA 1MMNA 5E33A 1ZHTA 3H65A 2V3CC 3GANA 3NYMA 4HFFB 1J8MF 2R7VA 2W9YA 3EG9B 3JCUQ 3T6BA 1PD0A 5F5FA 3I5QA 3O6XA 4PJLA 1VOMA 1M2VB 3I4UA 3EGXB 3DAGA 2WVQA 3DZAA 3JT1A 5L3QA 4RBNA 3WODF 2Y3BA 3WG7C 3B0VC 4YJWA 4GYTA 3K6BA 3E70C 3ZG1A 3DXJF 4JW1A 4YWQA 1M2OA 3B9QA 3L34A 2KQ9A 4BJ6C 4ZLDA 3AQCA 5KYNA 4F4BA 3ITFA 3SZRA 5E2QA 2KJGA 5KYUA 3TD7A 2XL4A 5T3WA 2GFHA 2NUTA 4OD4A 4IJJA 4CS7A 1D1CA 4J32B 1BR2A 3KMIA 4AE4A 1ZHXA 1MMAA 2ZXRA 5BUOA 2R7QA 4C3BA 4GEHA 2Y3GA 4YT2A 2YEVA 2I8BA 2ZXOA 4CS8C 1VYIA 4NY3A 2DYRC 4KNWA 3K66A 2J7PD 3Q6MA 3ASNC 1J8YF 2EIJC 4I44A 5KYXB 1D1AA 5F5HA 2FFHA 1TR2A 1JPJA 4HE8D 1IZMA 3N24A 3Q7LA 3FAJA 5DS6A 3LLKA 2H7VC 4ZLCA 3ZIBA 4EBBA 4OIRF 3SP1A 3NYJA 4O6MA 4XLPF 2CGEA 3QZCA 2CDQA 4U5BE 2B0JA 4C3DA 3UGOA 4OIPF 3F47A 3W8HA 4LACB 4DVYP 3AQBA 2IXOA 2Z15A 1LVKA 2R7TA 4E7ZA 2IXPA 4C7OA 3EQLF 3KH2A 3SYNA 4AK9A 3AG3C 4B6IA 4N06A 3S0XA 2FGYA 5HSWA 3K33A 4CSAA 1TWGA 1SZIA 4PK4A 4JURI 2O9XA 3DM9B 4JJGA 1D0ZA 3CZ6A 3UMKA 1WGWA 2Y69C 2IYLD 2J0WA 5EGYA 3DM5A 3DJNB 1TWCA 4Q5SF 1FMWA 2QTVA 3ABMC 3DMDA 1V54C 5B1BC 1ZU5A 2CNWA 1BR1A 2WZLA 2XRHA 4U5DE 3EG9A 3ZC4A 4MNDA 3CQZA 3RYLA 2NUPB 3RH3A 5DQTA 1D0YA 1M2VA 1VYKA 3EGXA 2WB7A 2P6VA 2PF4E 1Z3IX 3LLIA 4O6NA 4G7OF 3W2VA 2P7VA 3HLZA 4CS9A 3NYLA 2WZGA 4PJNA 2R7RA 5KYYB 2J0XA 4G0HA 2WVOA 2H7BA 2J46A 1MNDA 4IRUA 4BJ5C 1Z5ZA 3CSKA 1G8XA 4IWBA 2KGOA 2ZPAA 3FDQA 4C3EA 2WZFA 4OIOF 1LKXA 1N1CA 1TWAA 3JYHA 4J30B 2IXMA 1ZHZA 3B0PA 3UNGC 3OWTA 1FTSA 1SMYF 2CW0F 3QMKA 2WL8A 2JD3A 4OINF 1SF8A 3F46A 2PX3A 3VYWA 3X1OA 3LESA 2LSEA 2R7WA 2Q9BA 2PFDA 5DVWA 1OKKD 2WVNA 2A6HF 3EZIA 3N2ZB 4KNVA 4HFKB 5KYUB 2L81A 2C04A 2Q9CA 4JZAA 4ANJA 3MX3A 3B0UX 3T6JA 1RJ9B 3LS1A 4YT4A 3KL4A 4K0DA 3AG2C 3EFOA 5D91A 4DVZA 2Y3HA 3ZVRA 2Q9AA 3DD7A 3JRTA 1W2WA 2DGJA 4G7ZF 3EGDB 1LS1A 2E87A 3OEOA 4AE4B 4U5FE 3EH2A 3W8IA 4IAOA 5CI8A 1OCZC 2OG2A 2YZSA 3FVYA 2EIKC 3K7DA 5L3VA 1Z23A 3UR3C 2IXNA 5B3SC 3NDBB 4DBQA 5CI9A 2R7UA 5KYWB 4O6YA 3PMRA 3K1HA 3RKOF 3LEVA 4MQ9F 4BG0A 1IW7F 3EZHA 4BJ6A 3VAYA 1PCXA 4OD5A 4H4KC 3N0TA 2J45A 1NU7D 3E9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1O A;  4YWQ A;  4QI2 A;  5F5F A;  4ZLD A;  4QI0 A;  4ULW A;  4ZLC A;  5F5H A; 
#chains in the Genus database with same CATH topology
 3JZ0 A;  4NTB A;  4C7O B;  1Q0F A;  4U5C E;  3EHM A;  4LER A;  2J7P A;  5COF A;  2MWQ A;  1QLE C;  4W8K A;  1VLT A;  2XLD A;  2W45 A;  1H9T A;  4I1M A;  2OQM A;  3I5P A;  4JJF A;  3T6G B;  3PHF 2;  1OCC C;  2X51 A;  3TJ6 A;  5JVE A;  2EIM C;  3W2W A;  3X2Q C;  3FOP A;  3AOU A;  2XS8 A;  4BJ1 A;  4MTO A;  4AL1 A;  3O10 A;  1OW6 A;  3LJB A;  4K7B A;  4KBL A;  2A6E F;  4XWJ A;  3U5S A;  2VAS A;  1NG1 A;  4JTD B;  1E84 A;  1OXB A;  2R7S A;  1C17 M;  3ZSU A;  4XQ1 A;  1T5O A;  3HKK A;  4LLC A;  1TWH A;  4G7H F;  4N6H A;  1WWP A;  2J9V A;  2LFF A;  1ZU4 A;  3NKE A;  3NG1 A;  4OIQ F;  2ZXP A;  5L0G A;  1VK5 A;  1I5N A;  1FMV A;  3RQF A;  4CS8 A;  2HMZ A;  2ZD9 A;  5AGF A;  3GEE A;  3T4R A;  3ABK C;  1R4T A;  3SXZ A;  4M63 A;  4PJM A;  1T6U A;  4ULW A;  3C7J A;  5L0D A;  2XXA B;  1JOG A;  2H8A A;  2MYS A;  2YVK A;  3K1I C;  5KYY A;  1Z6A A;  4WAB A;  4YK5 A;  2KNH A;  3ZQV A;  5A6B D;  5L0C A;  4FES A;  4JEA A;  4CIH A;  1C02 A;  4YT5 A;  3SXM A;  1V55 C;  1TQG A;  2EIL C;  2W4B A;  4DRH B;  4LDR A;  1MMG A;  2XLV A;  3GWN A;  2HSQ A;  3L8I A;  2LFD A;  1O87 A;  2NG1 A;  2YLI A;  1AEP A;  5BQH A;  1TFK B;  2D4U A;  1M56 C;  3LUT B;  4Z9J A;  3MBG A;  5DS4 A;  3AGU A;  3OA1 A;  2PP4 A;  4WGY A;  2LCH A;  3IHU A;  4YN0 B;  3L0I A;  3V5X A;  4EWC A;  1KTM A;  1I4Z A;  1OR3 A;  1GS9 A;  3UMI A;  2OCC C;  4JIO A;  2JPU A;  1EI7 A;  2DYS C;  4UDV A;  2V26 A;  3JSZ A;  4WJ0 A;  4PFP A;  3TOM A;  1F1M A;  1T6I A;  1NFN A;  2HFI A;  3RW0 A;  4CSA C;  1QZX A;  3NMJ A;  3ABL C;  3KKB A;  4Z9H A;  2HMQ A;  4Z9I A;  1AUE A;  4Q4Z F;  1LE4 A;  4QI2 A;  4E7S A;  3SEO A;  1Q0G A;  2OEV A;  4FWV A;  3CAX A;  4U5E E;  3POV A;  1WAS A;  5IY5 C;  2C03 A;  2A68 F;  2HV7 A;  1VB5 A;  3C8G D;  2XLM A;  4I3M A;  3Q6N A;  3ASO C;  4H54 A;  4I1O B;  4JE9 A;  4O79 A;  2XLW A;  3HNI A;  5DQZ A;  1MQV A;  3GOR A;  1B68 A;  2OKU A;  2Y39 A;  3LAY A;  3MLG A;  4R32 A;  1RXQ A;  3BRJ A;  1JRA A;  3FHD A;  2YQY A;  3S28 A;  1M6T A;  5E3C A;  4DRI B;  3PDM P;  5D92 A;  2VH3 A;  1RJ9 A;  2RD9 A;  1Z63 A;  5KYX A;  4EBJ A;  2NUT B;  2H7O A;  2R02 A;  4LLE A;  1VMA A;  1NZE A;  4HEA J;  3DJU B;  4WGZ A;  4U5G A;  3EHN A;  3ZTZ A;  3VF0 A;  5E3A A;  1FFH A;  3DKA A;  1Y6D A;  1TKN A;  2BE5 F;  2L9J A;  3US6 A;  4LDK A;  4PJJ A;  3SNH A;  2AVK A;  3IEE A;  4PR9 A;  2G62 A;  3EGD A;  1ORY A;  2EIN C;  4QI0 A;  2W4M A;  3FXH A;  1PD1 A;  3GWL A;  3RFY A;  3SXK A;  1A0B A;  2M4E A;  1U6H A;  2VCB A;  3FOO A;  3LNR A;  3S27 A;  4YT8 A;  4A2N B;  1K04 A;  5FZT A;  1LIH A;  1A7D A;  3NMK A;  1KU2 A;  1HMD A;  2Q4F A;  3NKD A;  2G3K A;  2J9B A;  4J7Y A;  4P9F A;  2L7A A;  2EPK X;  5COG A;  4AX2 A;  5DLJ A;  3AG1 C;  2KW3 C;  2FAP B;  4O7G A;  5BQI A;  1NU9 C;  1CPR A;  3Q7G A;  3M1C B;  2LQG A;  1FFT C;  2GAQ A;  2Y3D A;  4ONS A;  2ICW G;  4CS9 C;  2R03 A;  3GOD A;  3HJC A;  3LS0 A;  4JCZ A;  4MVS A;  2QE9 A;  4NQF A;  5KYW A;  3DAF A;  3NRH A;  4Q7C A;  5F28 E;  3EFO B;  4QDL A;  2CNW D;  3JYY A;  4XPW A;  1OXK A;  4MVR A;  3EH1 A;  4U5H A;  1YJG A;  2PX0 A;  1H6G A;  1MMD A;  1CGO A;  3HNK A;  3A9C A;  3S29 A;  5HV9 A;  4BJ5 A;  1HW1 A;  2J9U A;  1MNE A;  2A69 F;  4NTF A;  4MW3 A;  2R7O A;  1S7Z A;  4MTG A;  1OKK A;  2AP3 A;  3C8G B;  4D4N A;  5FCL A;  2CCY A;  5T3T A;  4BPM A;  1OCO C;  3WAQ A;  5A6A A;  4KC9 A;  3AG4 C;  3EJN A;  2VB6 A;  4JVS A;  2P1A A;  1QQ3 A;  2R7X A;  1OCR C;  2L6H A;  4NC3 A;  3GM3 A;  4P9T A;  4P6I C;  2L6G A;  4CBE A;  3J06 A;  1BR4 A;  2LK4 A;  5T1D B;  1D1B A;  2HV6 A;  3B71 A;  5BQG A;  1QPU A;  2QUP A;  2ETS A;  2IOQ A;  5L0I A;  3KYJ A;  5EHH A;  4PFO A;  4N4W A;  3IQ5 A;  3ZDL A;  4U9D A;  1E85 A;  2ZXW C;  1D0X A;  4DOZ A;  2J8W A;  3S84 A;  2J9W A;  3AJM A;  5DS5 A;  3EPV A;  1M57 C;  4BEJ A;  3IQ6 A;  3KYI A;  1ZHY A;  2P0N A;  4XTK A;  3UGP A;  5B3I A;  2NUP A;  2BC5 A;  4U9E A;  2JX0 A;  1ZYR F;  1JPN A;  3RIP A;  1V74 B;  2YHS A;  1ST6 A;  2Q3T A;  2D5R B;  2YLG A;  3ECS A;  4RDA A;  1O5H A;  5B1A C;  4DBR A;  2ASR A;  1CGN A;  3U0C A;  2YKZ A;  2A1D D;  4FAP B;  4KI2 A;  1ZHW A;  2HJM A;  5AC4 A;  3C8Z A;  2XXA A;  2Q00 A;  4MTF A;  4BJT A;  2YL1 A;  4RD9 A;  2XSE A;  2YL0 A;  3UMH A;  3DWW A;  3C63 A;  2QY9 A;  3HTK C;  4XLN F;  4X0R A;  3V7O A;  4CJG A;  3O39 A;  1LPE A;  2R05 A;  4FX5 A;  2G3V A;  2HJ3 A;  4JCH A;  5JUA A;  1MMN A;  5E33 A;  1ZHT A;  3H65 A;  2V3C C;  2XLE A;  3GAN A;  1A7E A;  3NYM A;  4HFF B;  1J8M F;  4YL3 A;  3VRC A;  1RKE A;  2UUI A;  5A69 A;  4MVU A;  2W9Y A;  1JR8 A;  3EG9 B;  3JCU Q;  2LD6 A;  2R7V A;  1H7I A;  3T6B A;  2XL6 A;  1PD0 A;  1SYQ A;  1A41 A;  5F5F A;  3ZWI A;  3NMI A;  3I5Q A;  1CGM E;  3O6X A;  1GM5 A;  4PJL A;  3M4B A;  3IQT A;  1VOM A;  1M2V B;  2GDC A;  2VC9 A;  2XLO A;  4MVQ A;  3I4U A;  2DB4 A;  3EGX B;  3DAG A;  2WVQ A;  3DZA A;  3QTH A;  3JT1 A;  4EHP A;  5L3Q A;  5A6K A;  3G4Z A;  4RBN A;  3WOD F;  4XLP F;  3M79 A;  2Y3B A;  1S05 A;  5TJ5 E;  3WG7 C;  3L8J A;  4XPY A;  4E0I A;  3B0V C;  4YJW A;  3JTL O;  4GYT A;  1ZW3 A;  3K6B A;  3E70 C;  1QKR A;  3ZG1 A;  3DXJ F;  4JW1 A;  4YWQ A;  2PBE A;  1M2O A;  3B9Q A;  3PCV A;  3JSE O;  1E83 A;  1K40 A;  1YZA A;  3L34 A;  4JEB A;  2KQ9 A;  1FAP B;  4BJ6 C;  3TK0 A;  1HE9 A;  2EPO A;  3KPH A;  4ZLD A;  3AQC A;  1XZQ A;  4IGG A;  5KYN A;  256B A;  3HNL A;  3ITF A;  4MVZ A;  4F4B A;  3SZR A;  5E2Q A;  4XEK A;  1NSG B;  2KJG A;  5KYU A;  1YDI A;  4IAQ A;  5CIV A;  3H2V A;  3TD7 A;  2XL4 A;  4XEV A;  3S90 A;  5T3W A;  4XEF A;  3RVY A;  2GFH A;  5L0H A;  2Q7R A;  1LS4 A;  2NUT A;  4OD4 A;  4IJJ A;  4CDA A;  1YVI A;  2EPN A;  4CS7 A;  5A6B A;  1D1C A;  4J32 B;  1WTY A;  4EKW A;  3A11 A;  4MVO A;  3TOL A;  1BR2 A;  2OEX A;  1L3P A;  1T6Q A;  3KMI A;  1RMV A;  2GA0 A;  3RQG A;  1APC A;  3QVY A;  4AE4 A;  1ZHX A;  5L0J A;  1MMA A;  2ZXR A;  2NSG A;  5BUO A;  2R7Q A;  1G4W R;  2EPM X;  4GEH A;  4C3B A;  2Y3G A;  4L6R A;  4YT2 A;  2XS1 A;  2I8B A;  2YEV A;  2ZXO A;  4CS8 C;  1VYI A;  4NY3 A;  2DYR C;  4KNW A;  4NTA A;  3K66 A;  2J7P D;  3MFN A;  1HW2 A;  3Q6M A;  1YA7 O;  3GM2 A;  1KNY A;  1ORJ A;  1J8Y F;  1VLS A;  2A0U A;  2EIJ C;  3ASN C;  4I44 A;  1D1A A;  5F5H A;  2FFH A;  5KYX B;  1TR2 A;  1JPJ A;  4HE8 D;  1IZM A;  3N24 A;  3Q7L A;  1I4Y A;  1BZ4 A;  1Y4C A;  3QW0 A;  3K1I A;  3FAJ A;  5DS6 A;  3LLK A;  2QNL A;  3M15 A;  2H7V C;  1Z7Q c;  3ZIB A;  4ZLC A;  1EA8 A;  4EBB A;  2XL8 A;  4OIR F;  1Q0K A;  2YL7 A;  3SP1 A;  1T01 A;  2I15 A;  2PNO A;  1OW7 A;  2CGE A;  3DE9 A;  3NYJ A;  3QZC A;  2CDQ A;  4IB4 A;  2B0J A;  1NFO A;  4U5B E;  4C3D A;  3UGO A;  4OIP F;  3F47 A;  3W8H A;  4LAC B;  3C8G A;  2L6F A;  3AQB A;  3FMS A;  3HNJ A;  4GQH A;  4DVY P;  2IXO A;  1U89 A;  5AC5 A;  1XWJ A;  2Z15 A;  1LVK A;  3M4C A;  2AWY A;  2R7T A;  3G50 A;  3ATP A;  4E7Z A;  1OR2 A;  2IXP A;  2AU5 A;  4C7O A;  3LNM B;  5JLI A;  1QSP A;  2UUH A;  1A7V A;  3T9O A;  2BL2 A;  3EQL F;  3KH2 A;  2YL3 A;  2DI3 A;  3SYN A;  4AK9 A;  3AG3 C;  4B6I A;  2EPL X;  4N06 A;  3S0X A;  1BDJ B;  2FGY A;  5HSW A;  1ZW2 A;  1ZVZ A;  1TFO B;  3K33 A;  3QW1 A;  2VCA A;  4CSA A;  1TWG A;  1SZI A;  1HE1 A;  1GGQ A;  4JTA B;  4PK4 A;  3LEO A;  4JUR I;  2TMV P;  2O9X A;  1QVX A;  3MYF A;  1FR0 A;  3DM9 B;  1G5Z A;  4JJG A;  1YYX A;  1D0Z A;  4AL0 A;  1JAF A;  3CZ6 A;  3DI5 A;  5EK0 A;  3UMK A;  1WGW A;  2Y69 C;  1WAT A;  3CEX A;  2IYL D;  5GPG B;  2J0W A;  1EKY A;  1E2X A;  2IM8 A;  2QLA A;  1YLM A;  3U2L A;  1E86 A;  4MW8 A;  5EGY A;  2RSE B;  3DM5 A;  3DJN B;  3GEI A;  1TWC A;  5JS5 A;  1R5I D;  4Q5S F;  1FMW A;  2QTV A;  4NCQ A;  4CX9 A;  2NPU A;  3ABM C;  3DMD A;  2OOC A;  1V54 C;  2B0H A;  5B1B C;  3AGT A;  1ZU5 A;  2CNW A;  4DRJ B;  3R7C A;  1BR1 A;  4JRZ A;  2WZL A;  3TQO A;  2XRH A;  4U5D E;  1G4U S;  3EG9 A;  3ZC4 A;  4MND A;  2XM0 A;  1RCP A;  1ZZP A;  3CQZ A;  4CJO A;  4DJ9 A;  2P61 A;  3O55 A;  3RYL A;  2NUP B;  2AWC A;  3RH3 A;  4E18 A;  3QVZ A;  4JTC B;  1HMO A;  5DQT A;  1D0Y A;  2KK1 A;  2HUJ A;  4CDY A;  1M2V A;  1LM3 B;  3GM1 A;  3TJ5 A;  3V5Y A;  1VYK A;  3EGX A;  2WB7 A;  2P6V A;  2PF4 E;  1Z3I X;  3C18 A;  3LLI A;  4O6N A;  4ULV A;  3W2V A;  1XZP A;  4G7O F;  2P7V A;  3IPM O;  3HLZ A;  1RKC A;  2MHR A;  4YL0 A;  2OJE D;  2VCC A;  4IAR A;  3NYL A;  4CS9 A;  2WZG A;  4PJN A;  2R7R A;  1CPQ A;  2KSF A;  2J0X A;  5KYY B;  4G0H A;  1DOV A;  2WVO A;  2LP4 A;  2H7B A;  3BEH A;  1PV3 A;  1WN0 A;  1BBH A;  2J46 A;  1MND A;  1YYJ A;  4IRU A;  3U9M A;  4BJ5 C;  4EBK A;  4EUK B;  1Q0D A;  1OQC A;  1RKE B;  2HSB A;  2XM4 A;  2YRF A;  3RQE A;  4W8P A;  1Z5Z A;  3CSK A;  1G8X A;  4IWB A;  4CDV A;  1V4A A;  1H9G A;  2KGO A;  2ZPA A;  3W4Y A;  4A4A A;  1UG7 A;  4EIY A;  2CYD A;  4C3E A;  5A6J A;  2WZF A;  3FDQ A;  1LKX A;  1ORS C;  1VTM P;  1N1C A;  1UFB A;  4OIO F;  1TWA A;  3C62 A;  1NBB A;  3JYH A;  4J30 B;  4PAC A;  2OJQ A;  2IXM A;  3H2U A;  1ZHZ A;  3U8P A;  5JRA A;  3B0P A;  3UNG C;  3OWT A;  2HZ8 A;  1FTS A;  2X0C A;  1SMY F;  1U0B B;  1WOL A;  1OW8 A;  2CW0 F;  2WL8 A;  2JD3 A;  3QMK A;  4OIN F;  1SF8 A;  4BEM J;  2R9R B;  1YAU O;  3F46 A;  3VM6 A;  2YLD A;  2PX3 A;  3U2M A;  4N6C A;  3V5Z A;  5COM A;  3LES A;  3VYW A;  3X1O A;  2LSE A;  1LI7 A;  2R7W A;  2Q9B A;  1T9K A;  1YA9 A;  3GEH A;  2PFD A;  4MVM A;  3MYI A;  5DVW A;  4K1O A;  2YWA A;  1OKK D;  1DOW A;  2WVN A;  2A6H F;  3EZI A;  3U3F A;  2IBF A;  3B29 A;  3TUL A;  3N2Z B;  3RF3 A;  4KNV A;  4HFK B;  5KYU B;  4CIP A;  2L81 A;  2C04 A;  5L0F A;  3S9O A;  2Q9C A;  1HY5 A;  4JZA A;  4ANJ A;  3MX3 A;  3B0U X;  2M64 A;  3T6J A;  1RJ9 B;  2LIG A;  1FNT c;  1O3U A;  1Q0M A;  2HKV A;  3G4X A;  3LS1 A;  4YT4 A;  2KYH A;  3KL4 A;  4K0D A;  3AG2 C;  3U9J A;  4E17 A;  3ZQY A;  3EFO A;  5D91 A;  1C03 A;  4DVZ A;  2Y3H A;  3ZVR A;  1YAR O;  2Q9A A;  3JRM O;  3DD7 A;  3JRT A;  3IQC A;  1W2W A;  2DGJ A;  4G78 A;  4G7Z F;  3EGD B;  1LS1 A;  4JC7 A;  1AVO B;  2E87 A;  3OEO A;  4AE4 B;  4U5F E;  2OU6 A;  3DE8 A;  1L7C A;  4YL1 A;  3EH2 A;  2GWW A;  3W8I A;  4IAO A;  1NLX A;  5CI8 A;  3WHN A;  1OCZ C;  2R25 A;  4XPX A;  2OG2 A;  2YZS A;  3FVY A;  2EIK C;  4ER9 A;  3K7D A;  5L3V A;  1Z23 A;  4DXW A;  3U3B A;  3ZTM A;  1YZC A;  3L1M A;  4O6M A;  3UR3 C;  2IXN A;  5B3S C;  3NDB B;  1K05 A;  3U8V A;  5CI9 A;  4E0H A;  4DBQ A;  2HS5 A;  3FAP B;  4MS2 A;  2R7U A;  5KYW B;  1LE2 A;  3R2P A;  2KC3 A;  3SXY A;  4O6Y A;  4D4X A;  1SR2 A;  1GQA A;  2A0B A;  2F22 A;  3K1H A;  3PMR A;  3RKO F;  2NSF A;  3LEV A;  1LI5 A;  4JKV A;  5JT4 A;  1JMW A;  4MQ9 F;  5JSL A;  4BG0 A;  2XLH A;  1IW7 F;  3EZH A;  5JP7 A;  4BJ6 A;  3RVZ A;  5K0I A;  4J7T A;  1EQ1 A;  3VAY A;  1PCX A;  4LDQ A;  4OD5 A;  4H4K C;  3N0T A;  2J45 A;  1NU7 D;  3E9V A; 
#chains in the Genus database with same CATH homology
 4C7O B;  4U5C E;  3EHM A;  4LER A;  2J7P A;  2MWQ A;  1QLE C;  4W8K A;  2W45 A;  4I1M A;  3I5P A;  4JJF A;  3PHF 2;  1OCC C;  2X51 A;  2EIM C;  3W2W A;  3X2Q C;  4BJ1 A;  4KBL A;  3LJB A;  4K7B A;  2A6E F;  4XWJ A;  2VAS A;  1NG1 A;  2R7S A;  3ZSU A;  4LLC A;  1TWH A;  4G7H F;  2J9V A;  1ZU4 A;  3NKE A;  3NG1 A;  4OIQ F;  2ZXP A;  1VK5 A;  1FMV A;  4CS8 A;  3T4R A;  3ABK C;  4M63 A;  4PJM A;  4ULW A;  2XXA B;  2MYS A;  3K1I C;  5KYY A;  1Z6A A;  2KNH A;  4FES A;  4CIH A;  4YT5 A;  1V55 C;  2EIL C;  2W4B A;  1MMG A;  1O87 A;  2NG1 A;  1M56 C;  5DS4 A;  3OA1 A;  2PP4 A;  4YN0 B;  4EWC A;  3L0I A;  3UMI A;  2OCC C;  2DYS C;  2V26 A;  3JSZ A;  4WJ0 A;  4PFP A;  4CSA C;  1QZX A;  3ABL C;  3KKB A;  4Q4Z F;  4QI2 A;  4E7S A;  3SEO A;  3POV A;  4FWV A;  4U5E E;  5IY5 C;  2C03 A;  2A68 F;  2HV7 A;  4I1O B;  4I3M A;  3Q6N A;  3ASO C;  4O79 A;  5DQZ A;  2Y39 A;  3LAY A;  3MLG A;  3FHD A;  3S28 A;  5E3C A;  5D92 A;  2VH3 A;  1RJ9 A;  1Z63 A;  5KYX A;  2NUT B;  2H7O A;  4LLE A;  1VMA A;  1NZE A;  4HEA J;  3DJU B;  4U5G A;  3EHN A;  5E3A A;  1FFH A;  2L9J A;  1TKN A;  2BE5 F;  4PJJ A;  3SNH A;  3IEE A;  2G62 A;  3EGD A;  2EIN C;  4QI0 A;  2W4M A;  1PD1 A;  3RFY A;  2M4E A;  3LNR A;  3S27 A;  4YT8 A;  4A2N B;  1KU2 A;  3NKD A;  2G3K A;  5DLJ A;  4AX2 A;  3AG1 C;  2KW3 C;  4O7G A;  1NU9 C;  3Q7G A;  3M1C B;  1FFT C;  2Y3D A;  4CS9 C;  3HJC A;  3GOD A;  3LS0 A;  5KYW A;  3DAF A;  3NRH A;  4Q7C A;  3EFO B;  4QDL A;  2CNW D;  3EH1 A;  4U5H A;  2PX0 A;  1MMD A;  3S29 A;  4BJ5 A;  2J9U A;  1MNE A;  2A69 F;  2R7O A;  1S7Z A;  1OKK A;  5FCL A;  5T3T A;  1OCO C;  4KC9 A;  3AG4 C;  3EJN A;  2VB6 A;  4JVS A;  2R7X A;  1OCR C;  4CBE A;  4P6I C;  1BR4 A;  5T1D B;  1D1B A;  2HV6 A;  2IOQ A;  5EHH A;  4PFO A;  2ZXW C;  1D0X A;  4DOZ A;  2J9W A;  5DS5 A;  3EPV A;  1M57 C;  4BEJ A;  3UGP A;  4XTK A;  1ZHY A;  2NUP A;  1ZYR F;  1JPN A;  3RIP A;  2YHS A;  1ST6 A;  2Q3T A;  2D5R B;  3ECS A;  4RDA A;  5B1A C;  1O5H A;  4DBR A;  4KI2 A;  2A1D D;  1ZHW A;  2XXA A;  4BJT A;  4RD9 A;  2XSE A;  3UMH A;  4XLN F;  2QY9 A;  3HTK C;  4X0R A;  3V7O A;  3O39 A;  4FX5 A;  2G3V A;  4JCH A;  1MMN A;  5E33 A;  1ZHT A;  3H65 A;  2V3C C;  3GAN A;  3NYM A;  4HFF B;  1J8M F;  2R7V A;  2W9Y A;  3EG9 B;  3JCU Q;  3T6B A;  1PD0 A;  5F5F A;  3I5Q A;  3O6X A;  4PJL A;  1VOM A;  1M2V B;  3I4U A;  3EGX B;  3DAG A;  2WVQ A;  3DZA A;  3JT1 A;  5L3Q A;  4RBN A;  3WOD F;  2Y3B A;  3WG7 C;  3B0V C;  4YJW A;  4GYT A;  3K6B A;  3E70 C;  3ZG1 A;  3DXJ F;  4JW1 A;  4YWQ A;  1M2O A;  3B9Q A;  3L34 A;  2KQ9 A;  4BJ6 C;  4ZLD A;  3AQC A;  5KYN A;  4F4B A;  3ITF A;  3SZR A;  5E2Q A;  2KJG A;  5KYU A;  3TD7 A;  2XL4 A;  5T3W A;  2GFH A;  2NUT A;  4OD4 A;  4IJJ A;  4CS7 A;  1D1C A;  4J32 B;  1BR2 A;  3KMI A;  4AE4 A;  1ZHX A;  1MMA A;  2ZXR A;  5BUO A;  2R7Q A;  4C3B A;  4GEH A;  2Y3G A;  4YT2 A;  2YEV A;  2I8B A;  2ZXO A;  4CS8 C;  1VYI A;  4NY3 A;  2DYR C;  4KNW A;  3K66 A;  2J7P D;  3Q6M A;  3ASN C;  1J8Y F;  2EIJ C;  4I44 A;  5KYX B;  1D1A A;  5F5H A;  2FFH A;  1TR2 A;  1JPJ A;  4HE8 D;  1IZM A;  3N24 A;  3Q7L A;  3FAJ A;  5DS6 A;  3LLK A;  2H7V C;  4ZLC A;  3ZIB A;  4EBB A;  4OIR F;  3SP1 A;  3NYJ A;  4O6M A;  4XLP F;  2CGE A;  3QZC A;  2CDQ A;  4U5B E;  2B0J A;  4C3D A;  3UGO A;  4OIP F;  3F47 A;  3W8H A;  4LAC B;  4DVY P;  3AQB A;  2IXO A;  2Z15 A;  1LVK A;  2R7T A;  4E7Z A;  2IXP A;  4C7O A;  3EQL F;  3KH2 A;  3SYN A;  4AK9 A;  3AG3 C;  4B6I A;  4N06 A;  3S0X A;  2FGY A;  5HSW A;  3K33 A;  4CSA A;  1TWG A;  1SZI A;  4PK4 A;  4JUR I;  2O9X A;  3DM9 B;  4JJG A;  1D0Z A;  3CZ6 A;  3UMK A;  1WGW A;  2Y69 C;  2IYL D;  2J0W A;  5EGY A;  3DM5 A;  3DJN B;  1TWC A;  4Q5S F;  1FMW A;  2QTV A;  3ABM C;  3DMD A;  1V54 C;  5B1B C;  1ZU5 A;  2CNW A;  1BR1 A;  2WZL A;  2XRH A;  4U5D E;  3EG9 A;  3ZC4 A;  4MND A;  3CQZ A;  3RYL A;  2NUP B;  3RH3 A;  5DQT A;  1D0Y A;  1M2V A;  1VYK A;  3EGX A;  2WB7 A;  2P6V A;  2PF4 E;  1Z3I X;  3LLI A;  4O6N A;  4G7O F;  3W2V A;  2P7V A;  3HLZ A;  4CS9 A;  3NYL A;  2WZG A;  4PJN A;  2R7R A;  5KYY B;  2J0X A;  4G0H A;  2WVO A;  2H7B A;  2J46 A;  1MND A;  4IRU A;  4BJ5 C;  1Z5Z A;  3CSK A;  1G8X A;  4IWB A;  2KGO A;  2ZPA A;  3FDQ A;  4C3E A;  2WZF A;  4OIO F;  1LKX A;  1N1C A;  1TWA A;  3JYH A;  4J30 B;  2IXM A;  1ZHZ A;  3B0P A;  3UNG C;  3OWT A;  1FTS A;  1SMY F;  2CW0 F;  3QMK A;  2WL8 A;  2JD3 A;  4OIN F;  1SF8 A;  3F46 A;  2PX3 A;  3VYW A;  3X1O A;  3LES A;  2LSE A;  2R7W A;  2Q9B A;  2PFD A;  5DVW A;  1OKK D;  2WVN A;  2A6H F;  3EZI A;  3N2Z B;  4KNV A;  4HFK B;  5KYU B;  2L81 A;  2C04 A;  2Q9C A;  4JZA A;  4ANJ A;  3MX3 A;  3B0U X;  3T6J A;  1RJ9 B;  3LS1 A;  4YT4 A;  3KL4 A;  4K0D A;  3AG2 C;  3EFO A;  5D91 A;  4DVZ A;  2Y3H A;  3ZVR A;  2Q9A A;  3DD7 A;  3JRT A;  1W2W A;  2DGJ A;  4G7Z F;  3EGD B;  1LS1 A;  2E87 A;  3OEO A;  4AE4 B;  4U5F E;  3EH2 A;  3W8I A;  4IAO A;  5CI8 A;  1OCZ C;  2OG2 A;  2YZS A;  3FVY A;  2EIK C;  3K7D A;  5L3V A;  1Z23 A;  3UR3 C;  2IXN A;  5B3S C;  3NDB B;  4DBQ A;  5CI9 A;  2R7U A;  5KYW B;  4O6Y A;  3PMR A;  3K1H A;  3RKO F;  3LEV A;  4MQ9 F;  4BG0 A;  1IW7 F;  3EZH A;  4BJ6 A;  3VAY A;  1PCX A;  4OD5 A;  4H4K C;  3N0T A;  2J45 A;  1NU7 D;  3E9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...