3NMJA

Crystal structure of a nickel mediated dimer for the phenanthroline-modified cytochrome cb562 variant, mbp-phen2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFAILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Porous protein frameworks with unsaturated metal centers in sterically encumbered coordination sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 45
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3nmjA00
1E83A 1CGOA 5JSLA 3TOLA 4ER9A 2YLGA 5JRAA 3NMJA 3HNLA 3ZTZA 2XL8A 3C63A 4IAQA 1E84A 2YL0A 3DE8A 5AGFA 2XL6A 1BBHA 2BC5A 2XM0A 4U9DA 3L1MA 3IQ6A 1E85A 4WGYA 1YZAA 3QVYA 3M15A 3NMKA 5JT4A 2XLDA 4CDYA 5B3IA 4IB4A 1APCA 2YL3A 3ZTMA 4JKVA 2CCYA 1LM3B 3QW0A 2YLDA 3ZQVA 3ZQYA 5JP7A 4WGZA 4CJOA 4D4NA 3HNKA 1A7VA 3VRCA 2XLWA 3IQ5A 1M6TA 2XLEA 3FOOA 1RCPA 3FOPA 4NC3A 2QLAA 1CPQA 3U8PA 4CJGA 3HNJA 1YYJA 5JUAA 1QPUA 2YL7A 3QW1A 4JE9A 1YYXA 1JAFA 3ZWIA 4U9EA 3NMIA 1GQAA 1NBBA 4N6HA 256BA 4CIPA 4JEAA 2XLHA 2YKZA 1CPRA 4JEBA 2J8WA 2XLOA 3DE9A 1CGNA 3M4CA 1QQ3A 3QVZA 5JVEA 3C62A 4IARA 3TOMA 5JLIA 3M4BA 2XLVA 4N4WA 4EIYA 4CDVA 2XLMA 2XM4A 1EKYA 4CX9A 3HNIA 2J9BA 5JS5A 4D4XA 1E86A 1MQVA 4L6RA 4CDAA 4ULVA 1YZCA 3M79A 2YL1A 1S05A 2YLIA
chains in the Genus database with same CATH superfamily
4AE4A 3DAGA 1E83A 5JSLA 3TOLA 2HS5A 4U5GA 3IPMO 3PHF2 3IQCA 1TQGA 2G3VA 1YDIA 4U5BE 3UMKA 2WB7A 2XL8A 4C3DA 1MMAA 2J46A 4IAQA 5FZTA 4BJ6A 5KYWB 2C03A 4N6CA 2CYDA 5L3VA 5HV9A 3UGOA 1YJGA 4AL0A 3FDQA 2QNLA 3HKKA 2BC5A 3WG7C 4E7SA 3MX3A 1LVKA 3M1CB 4K1OA 1HW2A 5A6AA 2L6GA 1XWJA 4NTFA 1L3PA 2DB4A 2WZLA 4DRJB 3K33A 3LESA 4E17A 1M56C 1YZAA 1H9GA 3G4XA 3MLGA 5L0DA 4BG0A 4ZLDA 3SEOA 3UNGC 3MBGA 4ANJA 3ATPA 4LDQA 1YARO 4PR9A 4PJNA 3PMRA 4BJ5C 5BQIA 5B1BC 2KYHA 2XLDA 1ORSC 2IOQA 4Z9HA 2OQMA 4LERA 4LDRA 1YAUO 3UMIA 4YT4A 2A1DD 5B3IA 1APCA 2PFDA 4U5FE 2JX0A 4CS7A 5A6KA 2X0CA 2R7VA 3ASNC 3VM6A 3FVYA 3W4YA 1BDJB 4BJ6C 3EGXB 4U5HA 2PX3A 5JP7A 5L0CA 3H65A 4MTGA 3MYIA 4C3BA 3LS0A 3CSKA 4MVMA 4CJOA 4D4NA 4YL3A 2NUPB 1FTSA 2IXMA 3Q6NA 1A7VA 5DVWA 3EGDA 4GYTA 2A0BA 1BZ4A 1WGWA 3E70C 3GWLA 3IQ5A 3TQOA 3S27A 3T6BA 1N1CA 2VB6A 3FOOA 3GANA 3EG9A 3SXMA 2V3CC 2EPNA 2H7OA 1LKXA 2OEXA 1VLTA 1NFNA 3FOPA 3AGUA 1M2VA 3MYFA 1CPQA 3DKAA 2LD6A 3AG1C 2DI3A 2Q3TA 5D91A 3U8PA 2VCAA 3A11A 1YVIA 2LFFA 3EFOA 3TJ6A 1A7EA 1EI7A 3GORA 3WHNA 4OINF 2EPMX 2M64A 3L8JA 3CEXA 4HEAJ 4MVUA 4XEKA 5E33A 1PD0A 1GM5A 1G5ZA 3LAYA 2YL7A 1UFBA 3DWWA 1YYXA 2AU5A 3DMDA 2OCCC 5B3SC 1ZW3A 2EIKC 1A0BA 4A4AA 4MVZA 4U5CE 2J7PD 4U9EA 1KU2A 1M57C 3I5QA 3IHUA 3AQBA 2P0NA 1PV3A 2YHSA 5T3TA 1TKNA 2PF4E 1IZMA 5CIVA 3C18A 2CDQA 3FAPB 2VH3A 2XLHA 2YKZA 4Q4ZF 1G8XA 3ZC4A 2A0UA 2Q9BA 4P9FA 4JEBA 2KQ9A 2YQYA 2GA0A 2J8WA 3NRHA 3O55A 3SXYA 4DOZA 3DE9A 4KNWA 1T6IA 1VMAA 2KSFA 4K0DA 2KC3A 4OIPF 1AUEA 2Y3GA 1T01A 1QQ3A 3GEEA 4BEJA 2VC9A 4YL0A 4I44A 1RMVA 3CQZA 3RYLA 3TOMA 1Q0GA 1VK5A 5JLIA 1Z5ZA 3M4BA 4IRUA 1WWPA 5L0HA 2Y3BA 4EIYA 1ZW2A 3H2VA 4CDVA 2B0HA 2GWWA 2YZSA 1O3UA 1Z7Qc 2G62A 1J8YF 4E0IA 4D4XA 1TR2A 4YT5A 3H2UA 4WABA 5KYWA 3C7JA 5A6BD 4L6RA 2XXAA 4MVRA 5KYYB 1A41A 1MMGA 2R02A 5E3CA 1T9KA 1R5ID 3DI5A 3RF3A 4CS8A 1Y4CA 3O39A 5F5HA 4O6YA 3LNRA 1XZPA 3NMJA 2Y3DA 2BL2A 4O7GA 3B9QA 1OCOC 2A69F 2YL0A 3DE8A 3S90A 4U5EE 4MW8A 4O6NA 3T6JA 4PJLA 1FMVA 2L6FA 2XM0A 4U9DA 2R03A 1Z63A 5CI8A 3U9JA 5L3QA 4XEFA 2WZGA 4E7ZA 1RJ9B 4NTAA 1WOLA 2J45A 4CBEA 3L1MA 3RVZA 2L9JA 4H54A 3C8GB 4WGYA 2AVKA 5BQGA 2Q00A 2Y39A 1S7ZA 5A69A 3FHDA 3RFYA 3EGXA 5L0IA 3EH1A 3M15A 3NMKA 3B71A 1NZEA 2OJED 4CS8C 1Q0DA 2A6HF 4CDYA 2I15A 1NFOA 2EILC 2XS1A 3HLZA 4MVOA 3ZTMA 3KYJA 4G7HF 1V54C 4DJ9A 3T9OA 2HV7A 2LSEA 2NG1A 3ZSUA 4FWVA 4JKVA 2PBEA 4JURI 2YLDA 3CAXA 3V5ZA 3ZQYA 4XTKA 2QUPA 2KJGA 4Q7CA 1T6UA 3EQLF 4WGZA 5COGA 3V5XA 3FXHA 3HNKA 5BUOA 3QTHA 2R7TA 4LLEA 4WJ0A 5F28E 4QDLA 5IY5C 1M6TA 1SR2A 2P7VA 1OW7A 2Y69C 3LLKA 5GPGB 1GGQA 2QE9A 1RXQA 3K1IA 3JTLO 2QLAA 4AL1A 1NLXA 2IXPA 1ST6A 4NY3A 2XL4A 2Q4FA 3UR3C 5B1AC 3HNJA 1IW7F 4JCHA 2UUIA 3R2PA 1FFHA 4JCZA 1B68A 4QI2A 2WZFA 1YYJA 3EZHA 4W8PA 2OJQA 3LEOA 1WASA 3PCVA 1LE2A 1V4AA 2IBFA 4BEMJ 4CS9A 1UG7A 2KGOA 1JOGA 1RKEA 2HSBA 1WN0A 1TWHA 3U9MA 3ZWIA 3QZCA 4PJMA 1XZQA 2QY9A 3NMIA 2F22A 1GQAA 1ZHXA 1NBBA 2EINC 3O10A 3SXZA 3LS1A 4EUKB 4PACA 1JMWA 3LJBA 1HMDA 2WVNA 4JEAA 2J0WA 1DOVA 1VB5A 2RSEB 2XS8A 3K1IC 3OEOA 1CPRA 2OOCA 4HE8D 3RQFA 3A9CA 1TWGA 1HW1A 1OXBA 1D1CA 4MTOA 5KYXB 4N06A 1ZHZA 2XLOA 2HV6A 3K66A 3OA1A 3RKOF 3BEHA 1TFOB 3NKDA 4NQFA 1NG1A 4LDKA 3M4CA 4ULWA 4AX2A 1PD1A 4I1OB 3U2LA 5KYYA 1ZZPA 2PX0A 3ZVRA 1O5HA 3KPHA 1M2OA 2W4BA 4CS9C 4G7OF 2WL8A 4LACB 4N4WA 2XLMA 4DRIB 1BR4A 1ZU5A 2DGJA 2P1AA 4XPYA 5DQTA 1MQVA 4ULVA 1VLSA 3Q7LA 2ASRA 3Q6MA 1Z6AA 4MTFA 1SZIA 2WVQA 4EBBA 4YT8A 2L81A 1EQ1A 2ICWG 2C04A 2EPOA 2NSGA 3VAYA 2OG2A 1YA9A 1RJ9A 4DRHB 4ER9A 1EA8A 1JRAA 1T5OA 1TWCA 2HJ3A 1D0ZA 3JYYA 3ZG1A 3C8GA 2YVKA 1JPNA 5JRAA 5DS6A 3F47A 2Q7RA 3VF0A 1WATA 4PK4A 1OCRC 3ZTZA 5CI9A 4H4KC 2CNWA 2XSEA 4M63A 3GODA 3C63A 3ABMC 3CZ6A 5E3AA 2HFIA 2IYLD 4GQHA 5KYUA 1TWAA 1ZU4A 5AGFA 3S9OA 2XL6A 3POVA 1ORJA 1HE1A 5AC4A 1BBHA 2ZPAA 5COMA 2W45A 1OCZC 4YJWA 2AWCA 3JSEO 3O6XA 4YWQA 1KTMA 4MVSA 3T6GB 2OU6A 3EZIA 3QMKA 2R05A 4JTCB 2J0XA 2A6EF 4KC9A 4E18A 2O9XA 3JSZA 3NYLA 3QVYA 1PCXA 2GFHA 2ZD9A 4G0HA 4J7YA 1OCCC 4OD4A 5FCLA 3B0UX 5JT4A 1VYIA 2XRHA 4XQ1A 3DM9B 2IM8A 2R9RB 3U8VA 4XLPF 3SXKA 1J8MF 5L0FA 3L34A 1JPJA 3EGDB 2YL3A 1OR2A 3V7OA 4EKWA 1ZHTA 3JRTA 3S28A 3AJMA 3RQEA 4NCQA 3U5SA 4DVZA 4OIOF 1OR3A 2CCYA 3EG9B 5TJ5E 1OKKA 1U6HA 1TFKB 2QTVA 1M2VB 2R25A 3GM3A 3V5YA 3ZDLA 3J06A 3EHMA 3FAJA 4NTBA 2LIGA 1OXKA 4JJGA 3B0PA 1ZVZA 2HMQA 4UDVA 3B29A 3VRCA 2PNOA 1Z23A 2XLWA 1K05A 1H7IA 1RCPA 3ZIBA 4NC3A 4BPMA 3B0VC 2HMZA 2LQGA 1D1BA 1G4WR 2CW0F 5DS4A 4HFKB 4CJGA 1RKCA 2NUPA 5L0GA 2XXAB 2NSFA 2NUTB 3TJ5A 1K04A 3T4RA 3U0CA 1WTYA 2G3KA 5JUAA 2W4MA 5EK0A 1LI5A 1OQCA 3TD7A 2ETSA 1ZHYA 4JZAA 3DJNB 1JAFA 1LIHA 5EGYA 5DS5A 1KNYA 2R7RA 4J32B 3S29A 2FGYA 3LEVA 3HTKC 4F4BA 5L0JA 4RD9A 3N24A 4QI0A 4JJFA 2R7QA 4R32A 4CSAA 2EPLX 4KI2A 3C8ZA 4CIPA 2W9YA 2VCBA 1AVOB 1NU9C 1QZXA 1VYKA 4Z9JA 5HSWA 3SP1A 1I4ZA 1QSPA 2MYSA 3EH2A 1YLMA 4I3MA 4JTDB 4MW3A 1SYQA 3GEIA 3W2WA 2AWYA 3N0TA 4DBRA 3WAQA 4E0HA 4EWCA 2B0JA 2RD9A 3SZRA 3S0XA 3DM5A 4EBJA 4EBKA 2Q9AA 2R7SA 4CIHA 1ZYRF 2EIMC 4O79A 3QVZA 4PFOA 1D1AA 5JVEA 2LP4A 3SYNA 1G4US 3JCUQ 3NG1A 3MFNA 4KNVA 3I4UA 2X51A 4AK9A 3OWTA 3AGTA 2GAQA 3ECSA 3X1OA 1CGME 1U0BB 1FAPB 5K0IA 1BR2A 3IEEA 3KYIA 1I4YA 2UUHA 1HMOA 2XM4A 1EKYA 1C17M 3HNIA 3IQTA 2I8BA 4JTAB 3K6BA 1AEPA 4IWBA 1E86A 3UGPA 4CSAC 1D0XA 4MVQA 3M79A 4MS2A 1E2XA 3KL4A 4B6IA 1K40A 4XPXA 2IXNA 2JPUA 2P61A 3GWNA 1CGOA 4IAOA 1C02A 2IXOA 5COFA 5F5FA 2YLGA 2WVOA 1MNEA 1ORYA 1VTMP 4C7OB 3HNLA 3C8GD 1HY5A 4BJTA 3RQGA 2CGEA 3KH2A 1GS9A 3FMSA 1Z3IX 2CNWD 2DYRC 3N2ZB 4G78A 4U5DE 3TK0A 1E84A 2EPKX 3NYMA 3TULA 4J7TA 1MNDA 1W2WA 2FAPB 3K7DA 4LLCA 4MNDA 3RIPA 5BQHA 4FESA 3F46A 2R7XA 4AE4B 2ZXPA 4XWJA 2A68F 2YRFA 3DD7A 5DQZA 3GEHA 3IQ6A 1E85A 3BRJA 5T1DB 4C3EA 5EHHA 2YWAA 3ITFA 3NYJA 3HJCA 3R7CA 1HE9A 3KMIA 3K1HA 4W8KA 4DXWA 3LLIA 2JD3A 2M4EA 3W8HA 2L7AA 4RDAA 3WODF 1H6GA 3DAFA 1OW6A 3AOUA 3JZ0A 1C03A 1A7DA 4G7ZF 4IB4A 1FR0A 4KBLA 3E9VA 4FAPB 1LM3B 1Q0MA 1U89A 3QW0A 4A2NB 4YT2A 4IGGA 3U3FA 1YA7O 3ZQVA 3EPVA 1OKKD 1F1MA 3I5PA 1I5NA 2BE5F 1SF8A 2NUTA 2H8AA 2PP4A 3GM1A 1MMDA 1LI7A 2D4UA 1BR1A 4FX5A 4JIOA 2DYSC 3UMHA 2NPUA 3EHNA 2XLEA 2OEVA 1JR8A 3G4ZA 4OIRF 4ZLCA 1FNTc 2H7VC 2R7UA 4I1MA 3US6A 3G50A 2GDCA 4JRZA 4P9TA 1RKEB 1L7CA 2KK1A 2P6VA 4OD5A 3RW0A 3JYHA 2OKUA 2ZXRA 1R4TA 1MMNA 2MWQA 3AG3C 3W2VA 1NSGB 2LCHA 3JT1A 3RVYA 1QKRA 4DBQA 4RBNA 4ONSA 5A6JA 4GEHA 4YL1A 2H7BA 1QPUA 3QW1A 4EHPA 4JE9A 3LUTB 4PJJA 2L6HA 3NDBB 4Q5SF 2HJMA 2J7PA 2HSQA 2J9WA 1V55C 3DZAA 1LS1A 4HFFB 5DLJA 4K7BA 1OW8A 3JRMO 4XPWA 2VASA 5E2QA 3EFOB 1LS4A 1NU7D 2Q9CA 3L8IA 3ASOC 3DJUB 4N6HA 4X0RA 4Z9IA 256BA 3PDMP 3X2QC 4OIQF 1O87A 2Y3HA 2J9VA 1Q0KA 4J30B 4JC7A 2Z15A 2YEVA 4JVSA 3S84A 2HUJA 3L0IA 4YN0B 2VCCA 2ZXWC 4XEVA 1H9TA 1SMYF 2R7OA 3SNHA 4BJ1A 3AG2C 3LNMB 2LK4A 2HZ8A 1CGNA 4P6IC 3GM2A 3AG4C 3C62A 5AC5A 1QVXA 4IARA 4DVYP 2MHRA 2KW3C 1DOWA 1Q0FA 4MQ9F 2J9UA 3NKEA 1LPEA 5D92A 5T3WA 1FMWA 4IJJA 3ABKC 3VYWA 4O6MA 1QLEC 3U3BA 2XLVA 4XLNF 5KYXA 5KYNA 1V74B 3AQCA 1Y6DA 4C7OA 4CX9A 1LE4A 2E87A 3Q7GA 2D5RB 2J9BA 3DXJF 4PFPA 2KNHA 5JS5A 3KKBA 2V26A 3EJNA 3RH3A 3ABLC 2AP3A 5A6BA 3U2MA 1ZHWA 1FFTC 2HKVA 4CDAA 2TMVP 2R7WA 1T6QA 1YZCA 3W8IA 5KYUB 2YL1A 2EIJC 1D0YA 4BJ5A 1S05A 2YLIA 4JW1A 2ZXOA 2FFHA 1VOMA 4YK5A 2LFDA
chains in the Genus database with same CATH topology
1E83A 1CGOA 5JSLA 3TOLA 4ER9A 2YLGA 5JRAA 3NMJA 3HNLA 3ZTZA 2XL8A 3C63A 4IAQA 1E84A 2YL0A 3DE8A 5AGFA 2XL6A 1BBHA 2BC5A 2XM0A 4U9DA 3L1MA 3IQ6A 1E85A 4WGYA 1YZAA 3QVYA 3M15A 3NMKA 5JT4A 2XLDA 4CDYA 5B3IA 4IB4A 1APCA 2YL3A 3ZTMA 4JKVA 2CCYA 1LM3B 3QW0A 2YLDA 3ZQVA 3ZQYA 5JP7A 4WGZA 4CJOA 4D4NA 3HNKA 1A7VA 3VRCA 2XLWA 3IQ5A 1M6TA 2XLEA 3FOOA 1RCPA 3FOPA 4NC3A 2QLAA 1CPQA 3U8PA 4CJGA 3HNJA 1YYJA 5JUAA 1QPUA 2YL7A 3QW1A 4JE9A 1YYXA 1JAFA 3ZWIA 4U9EA 3NMIA 1GQAA 1NBBA 4N6HA 256BA 4CIPA 4JEAA 2XLHA 2YKZA 1CPRA 4JEBA 2J8WA 2XLOA 3DE9A 1CGNA 3M4CA 1QQ3A 3QVZA 5JVEA 3C62A 4IARA 3TOMA 5JLIA 3M4BA 2XLVA 4N4WA 4EIYA 4CDVA 2XLMA 2XM4A 1EKYA 4CX9A 3HNIA 2J9BA 5JS5A 4D4XA 1E86A 1MQVA 4L6RA 4CDAA 4ULVA 1YZCA 3M79A 2YL1A 1S05A 2YLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E83 A;  1CGO A;  5JSL A;  3TOL A;  4ER9 A;  2YLG A;  5JRA A;  3NMJ A;  3HNL A;  3ZTZ A;  2XL8 A;  3C63 A;  4IAQ A;  1E84 A;  2YL0 A;  3DE8 A;  5AGF A;  2XL6 A;  1BBH A;  2BC5 A;  2XM0 A;  4U9D A;  3L1M A;  3IQ6 A;  1E85 A;  4WGY A;  1YZA A;  3QVY A;  3M15 A;  3NMK A;  5JT4 A;  2XLD A;  4CDY A;  5B3I A;  4IB4 A;  1APC A;  2YL3 A;  3ZTM A;  4JKV A;  2CCY A;  1LM3 B;  3QW0 A;  2YLD A;  3ZQV A;  3ZQY A;  5JP7 A;  4WGZ A;  4CJO A;  4D4N A;  3HNK A;  1A7V A;  3VRC A;  2XLW A;  3IQ5 A;  1M6T A;  2XLE A;  3FOO A;  1RCP A;  3FOP A;  4NC3 A;  2QLA A;  1CPQ A;  3U8P A;  4CJG A;  3HNJ A;  1YYJ A;  5JUA A;  1QPU A;  2YL7 A;  3QW1 A;  4JE9 A;  1YYX A;  1JAF A;  3ZWI A;  4U9E A;  3NMI A;  1GQA A;  1NBB A;  4N6H A;  256B A;  4CIP A;  4JEA A;  2XLH A;  2YKZ A;  1CPR A;  4JEB A;  2J8W A;  2XLO A;  3DE9 A;  1CGN A;  3M4C A;  1QQ3 A;  3QVZ A;  5JVE A;  3C62 A;  4IAR A;  3TOM A;  5JLI A;  3M4B A;  2XLV A;  4N4W A;  4EIY A;  4CDV A;  2XLM A;  2XM4 A;  1EKY A;  4CX9 A;  3HNI A;  2J9B A;  5JS5 A;  4D4X A;  1E86 A;  1MQV A;  4L6R A;  4CDA A;  4ULV A;  1YZC A;  3M79 A;  2YL1 A;  1S05 A;  2YLI A; 
#chains in the Genus database with same CATH topology
 4AE4 A;  3DAG A;  1E83 A;  5JSL A;  3TOL A;  2HS5 A;  4U5G A;  3IPM O;  3PHF 2;  3IQC A;  1TQG A;  2G3V A;  1YDI A;  4U5B E;  3UMK A;  2WB7 A;  2XL8 A;  4C3D A;  1MMA A;  2J46 A;  4IAQ A;  5FZT A;  4BJ6 A;  5KYW B;  2C03 A;  4N6C A;  2CYD A;  5L3V A;  5HV9 A;  3UGO A;  1YJG A;  4AL0 A;  3FDQ A;  2QNL A;  3HKK A;  2BC5 A;  3WG7 C;  4E7S A;  3MX3 A;  1LVK A;  3M1C B;  4K1O A;  1HW2 A;  5A6A A;  2L6G A;  1XWJ A;  4NTF A;  1L3P A;  2DB4 A;  2WZL A;  4DRJ B;  3K33 A;  3LES A;  4E17 A;  1M56 C;  1YZA A;  1H9G A;  3G4X A;  3MLG A;  5L0D A;  4BG0 A;  4ZLD A;  3SEO A;  3UNG C;  3MBG A;  4ANJ A;  3ATP A;  4LDQ A;  1YAR O;  4PR9 A;  4PJN A;  3PMR A;  4BJ5 C;  5BQI A;  5B1B C;  2KYH A;  2XLD A;  1ORS C;  2IOQ A;  4Z9H A;  2OQM A;  4LER A;  4LDR A;  1YAU O;  3UMI A;  4YT4 A;  2A1D D;  5B3I A;  1APC A;  2PFD A;  4U5F E;  2JX0 A;  4CS7 A;  5A6K A;  2X0C A;  2R7V A;  3ASN C;  3VM6 A;  3FVY A;  3W4Y A;  1BDJ B;  4BJ6 C;  3EGX B;  4U5H A;  2PX3 A;  5JP7 A;  5L0C A;  3H65 A;  4MTG A;  3MYI A;  4C3B A;  3LS0 A;  3CSK A;  4MVM A;  4CJO A;  4D4N A;  4YL3 A;  2NUP B;  1FTS A;  2IXM A;  3Q6N A;  1A7V A;  5DVW A;  3EGD A;  4GYT A;  2A0B A;  1BZ4 A;  1WGW A;  3E70 C;  3GWL A;  3IQ5 A;  3TQO A;  3S27 A;  3T6B A;  1N1C A;  2VB6 A;  3FOO A;  3GAN A;  3EG9 A;  3SXM A;  2V3C C;  2EPN A;  2H7O A;  1LKX A;  2OEX A;  1VLT A;  1NFN A;  3FOP A;  3AGU A;  1M2V A;  3MYF A;  1CPQ A;  3DKA A;  2LD6 A;  3AG1 C;  2DI3 A;  2Q3T A;  5D91 A;  3U8P A;  2VCA A;  3A11 A;  1YVI A;  2LFF A;  3EFO A;  3TJ6 A;  1A7E A;  1EI7 A;  3GOR A;  3WHN A;  4OIN F;  2EPM X;  2M64 A;  3L8J A;  3CEX A;  4HEA J;  4MVU A;  4XEK A;  5E33 A;  1PD0 A;  1GM5 A;  1G5Z A;  3LAY A;  2YL7 A;  1UFB A;  3DWW A;  1YYX A;  2AU5 A;  3DMD A;  2OCC C;  5B3S C;  1ZW3 A;  2EIK C;  1A0B A;  4A4A A;  4MVZ A;  4U5C E;  2J7P D;  4U9E A;  1KU2 A;  1M57 C;  3I5Q A;  3IHU A;  3AQB A;  2P0N A;  1PV3 A;  2YHS A;  5T3T A;  1TKN A;  2PF4 E;  1IZM A;  5CIV A;  3C18 A;  2CDQ A;  3FAP B;  2VH3 A;  2XLH A;  2YKZ A;  4Q4Z F;  1G8X A;  3ZC4 A;  2A0U A;  2Q9B A;  4P9F A;  4JEB A;  2KQ9 A;  2YQY A;  2GA0 A;  2J8W A;  3NRH A;  3O55 A;  3SXY A;  4DOZ A;  3DE9 A;  4KNW A;  1T6I A;  1VMA A;  2KSF A;  4K0D A;  2KC3 A;  4OIP F;  1AUE A;  2Y3G A;  1T01 A;  1QQ3 A;  3GEE A;  4BEJ A;  2VC9 A;  4YL0 A;  4I44 A;  1RMV A;  3CQZ A;  3RYL A;  3TOM A;  1Q0G A;  1VK5 A;  5JLI A;  1Z5Z A;  3M4B A;  4IRU A;  1WWP A;  5L0H A;  2Y3B A;  4EIY A;  1ZW2 A;  3H2V A;  4CDV A;  2B0H A;  2GWW A;  2YZS A;  1O3U A;  1Z7Q c;  2G62 A;  1J8Y F;  4E0I A;  4D4X A;  1TR2 A;  4YT5 A;  3H2U A;  4WAB A;  5KYW A;  3C7J A;  5A6B D;  4L6R A;  2XXA A;  4MVR A;  5KYY B;  1A41 A;  1MMG A;  2R02 A;  5E3C A;  1T9K A;  1R5I D;  3DI5 A;  3RF3 A;  4CS8 A;  1Y4C A;  3O39 A;  5F5H A;  4O6Y A;  3LNR A;  1XZP A;  3NMJ A;  2Y3D A;  2BL2 A;  4O7G A;  3B9Q A;  1OCO C;  2A69 F;  2YL0 A;  3DE8 A;  3S90 A;  4U5E E;  4MW8 A;  4O6N A;  3T6J A;  4PJL A;  1FMV A;  2L6F A;  2XM0 A;  4U9D A;  2R03 A;  1Z63 A;  5CI8 A;  3U9J A;  5L3Q A;  4XEF A;  2WZG A;  4E7Z A;  1RJ9 B;  4NTA A;  1WOL A;  2J45 A;  4CBE A;  3L1M A;  3RVZ A;  2L9J A;  4H54 A;  3C8G B;  4WGY A;  2AVK A;  5BQG A;  2Q00 A;  2Y39 A;  1S7Z A;  5A69 A;  3FHD A;  3RFY A;  3EGX A;  5L0I A;  3EH1 A;  3M15 A;  3NMK A;  3B71 A;  1NZE A;  2OJE D;  4CS8 C;  1Q0D A;  2A6H F;  4CDY A;  2I15 A;  1NFO A;  2EIL C;  2XS1 A;  3HLZ A;  4MVO A;  3ZTM A;  3KYJ A;  4G7H F;  1V54 C;  4DJ9 A;  3T9O A;  2HV7 A;  2LSE A;  2NG1 A;  3ZSU A;  4FWV A;  4JKV A;  2PBE A;  4JUR I;  2YLD A;  3CAX A;  3V5Z A;  3ZQY A;  4XTK A;  2QUP A;  2KJG A;  4Q7C A;  1T6U A;  3EQL F;  4WGZ A;  5COG A;  3V5X A;  3FXH A;  3HNK A;  5BUO A;  3QTH A;  2R7T A;  4LLE A;  4WJ0 A;  5F28 E;  4QDL A;  5IY5 C;  1M6T A;  1SR2 A;  2P7V A;  1OW7 A;  2Y69 C;  3LLK A;  5GPG B;  1GGQ A;  2QE9 A;  1RXQ A;  3K1I A;  3JTL O;  2QLA A;  4AL1 A;  1NLX A;  2IXP A;  1ST6 A;  4NY3 A;  2XL4 A;  2Q4F A;  3UR3 C;  5B1A C;  3HNJ A;  1IW7 F;  4JCH A;  2UUI A;  3R2P A;  1FFH A;  4JCZ A;  1B68 A;  4QI2 A;  2WZF A;  1YYJ A;  3EZH A;  4W8P A;  2OJQ A;  3LEO A;  1WAS A;  3PCV A;  1LE2 A;  1V4A A;  2IBF A;  4BEM J;  4CS9 A;  1UG7 A;  2KGO A;  1JOG A;  1RKE A;  2HSB A;  1WN0 A;  1TWH A;  3U9M A;  3ZWI A;  3QZC A;  4PJM A;  1XZQ A;  2QY9 A;  3NMI A;  2F22 A;  1GQA A;  1ZHX A;  1NBB A;  2EIN C;  3O10 A;  3SXZ A;  3LS1 A;  4EUK B;  4PAC A;  1JMW A;  3LJB A;  1HMD A;  2WVN A;  4JEA A;  2J0W A;  1DOV A;  1VB5 A;  2RSE B;  2XS8 A;  3K1I C;  3OEO A;  1CPR A;  2OOC A;  4HE8 D;  3RQF A;  3A9C A;  1TWG A;  1HW1 A;  1OXB A;  1D1C A;  4MTO A;  5KYX B;  4N06 A;  1ZHZ A;  2XLO A;  2HV6 A;  3K66 A;  3OA1 A;  3RKO F;  3BEH A;  1TFO B;  3NKD A;  4NQF A;  1NG1 A;  4LDK A;  3M4C A;  4ULW A;  4AX2 A;  1PD1 A;  4I1O B;  3U2L A;  5KYY A;  1ZZP A;  2PX0 A;  3ZVR A;  1O5H A;  3KPH A;  1M2O A;  2W4B A;  4CS9 C;  4G7O F;  2WL8 A;  4LAC B;  4N4W A;  2XLM A;  4DRI B;  1BR4 A;  1ZU5 A;  2DGJ A;  2P1A A;  4XPY A;  5DQT A;  1MQV A;  4ULV A;  1VLS A;  3Q7L A;  2ASR A;  3Q6M A;  1Z6A A;  4MTF A;  1SZI A;  2WVQ A;  4EBB A;  4YT8 A;  2L81 A;  1EQ1 A;  2ICW G;  2C04 A;  2EPO A;  2NSG A;  3VAY A;  2OG2 A;  1YA9 A;  1RJ9 A;  4DRH B;  4ER9 A;  1EA8 A;  1JRA A;  1T5O A;  1TWC A;  2HJ3 A;  1D0Z A;  3JYY A;  3ZG1 A;  3C8G A;  2YVK A;  1JPN A;  5JRA A;  5DS6 A;  3F47 A;  2Q7R A;  3VF0 A;  1WAT A;  4PK4 A;  1OCR C;  3ZTZ A;  5CI9 A;  4H4K C;  2CNW A;  2XSE A;  4M63 A;  3GOD A;  3C63 A;  3ABM C;  3CZ6 A;  5E3A A;  2HFI A;  2IYL D;  4GQH A;  5KYU A;  1TWA A;  1ZU4 A;  5AGF A;  3S9O A;  2XL6 A;  3POV A;  1ORJ A;  1HE1 A;  5AC4 A;  1BBH A;  2ZPA A;  5COM A;  2W45 A;  1OCZ C;  4YJW A;  2AWC A;  3JSE O;  3O6X A;  4YWQ A;  1KTM A;  4MVS A;  3T6G B;  2OU6 A;  3EZI A;  3QMK A;  2R05 A;  4JTC B;  2J0X A;  2A6E F;  4KC9 A;  4E18 A;  2O9X A;  3JSZ A;  3NYL A;  3QVY A;  1PCX A;  2GFH A;  2ZD9 A;  4G0H A;  4J7Y A;  1OCC C;  4OD4 A;  5FCL A;  3B0U X;  5JT4 A;  1VYI A;  2XRH A;  4XQ1 A;  3DM9 B;  2IM8 A;  2R9R B;  3U8V A;  4XLP F;  3SXK A;  1J8M F;  5L0F A;  3L34 A;  1JPJ A;  3EGD B;  2YL3 A;  1OR2 A;  3V7O A;  4EKW A;  1ZHT A;  3JRT A;  3S28 A;  3AJM A;  3RQE A;  4NCQ A;  3U5S A;  4DVZ A;  4OIO F;  1OR3 A;  2CCY A;  3EG9 B;  5TJ5 E;  1OKK A;  1U6H A;  1TFK B;  2QTV A;  1M2V B;  2R25 A;  3GM3 A;  3V5Y A;  3ZDL A;  3J06 A;  3EHM A;  3FAJ A;  4NTB A;  2LIG A;  1OXK A;  4JJG A;  3B0P A;  1ZVZ A;  2HMQ A;  4UDV A;  3B29 A;  3VRC A;  2PNO A;  1Z23 A;  2XLW A;  1K05 A;  1H7I A;  1RCP A;  3ZIB A;  4NC3 A;  4BPM A;  3B0V C;  2HMZ A;  2LQG A;  1D1B A;  1G4W R;  2CW0 F;  5DS4 A;  4HFK B;  4CJG A;  1RKC A;  2NUP A;  5L0G A;  2XXA B;  2NSF A;  2NUT B;  3TJ5 A;  1K04 A;  3T4R A;  3U0C A;  1WTY A;  2G3K A;  5JUA A;  2W4M A;  5EK0 A;  1LI5 A;  1OQC A;  3TD7 A;  2ETS A;  1ZHY A;  4JZA A;  3DJN B;  1JAF A;  1LIH A;  5EGY A;  5DS5 A;  1KNY A;  2R7R A;  4J32 B;  3S29 A;  2FGY A;  3LEV A;  3HTK C;  4F4B A;  5L0J A;  4RD9 A;  3N24 A;  4QI0 A;  4JJF A;  2R7Q A;  4R32 A;  4CSA A;  2EPL X;  4KI2 A;  3C8Z A;  4CIP A;  2W9Y A;  2VCB A;  1AVO B;  1NU9 C;  1QZX A;  1VYK A;  4Z9J A;  5HSW A;  3SP1 A;  1I4Z A;  1QSP A;  2MYS A;  3EH2 A;  1YLM A;  4I3M A;  4JTD B;  4MW3 A;  1SYQ A;  3GEI A;  3W2W A;  2AWY A;  3N0T A;  4DBR A;  3WAQ A;  4E0H A;  4EWC A;  2B0J A;  2RD9 A;  3SZR A;  3S0X A;  3DM5 A;  4EBJ A;  4EBK A;  2Q9A A;  2R7S A;  4CIH A;  1ZYR F;  2EIM C;  4O79 A;  3QVZ A;  4PFO A;  1D1A A;  5JVE A;  2LP4 A;  3SYN A;  1G4U S;  3JCU Q;  3NG1 A;  3MFN A;  4KNV A;  3I4U A;  2X51 A;  4AK9 A;  3OWT A;  3AGT A;  2GAQ A;  3ECS A;  3X1O A;  1CGM E;  1U0B B;  1FAP B;  5K0I A;  1BR2 A;  3IEE A;  3KYI A;  1I4Y A;  2UUH A;  1HMO A;  2XM4 A;  1EKY A;  1C17 M;  3HNI A;  3IQT A;  2I8B A;  4JTA B;  3K6B A;  1AEP A;  4IWB A;  1E86 A;  3UGP A;  4CSA C;  1D0X A;  4MVQ A;  3M79 A;  4MS2 A;  1E2X A;  3KL4 A;  4B6I A;  1K40 A;  4XPX A;  2IXN A;  2JPU A;  2P61 A;  3GWN A;  1CGO A;  4IAO A;  1C02 A;  2IXO A;  5COF A;  5F5F A;  2YLG A;  2WVO A;  1MNE A;  1ORY A;  1VTM P;  4C7O B;  3HNL A;  3C8G D;  1HY5 A;  4BJT A;  3RQG A;  2CGE A;  3KH2 A;  1GS9 A;  3FMS A;  1Z3I X;  2CNW D;  2DYR C;  3N2Z B;  4G78 A;  4U5D E;  3TK0 A;  1E84 A;  2EPK X;  3NYM A;  3TUL A;  4J7T A;  1MND A;  1W2W A;  2FAP B;  3K7D A;  4LLC A;  4MND A;  3RIP A;  5BQH A;  4FES A;  3F46 A;  2R7X A;  4AE4 B;  2ZXP A;  4XWJ A;  2A68 F;  2YRF A;  3DD7 A;  5DQZ A;  3GEH A;  3IQ6 A;  1E85 A;  3BRJ A;  5T1D B;  4C3E A;  5EHH A;  2YWA A;  3ITF A;  3NYJ A;  3HJC A;  3R7C A;  1HE9 A;  3KMI A;  3K1H A;  4W8K A;  4DXW A;  3LLI A;  2JD3 A;  2M4E A;  3W8H A;  2L7A A;  4RDA A;  3WOD F;  1H6G A;  3DAF A;  1OW6 A;  3AOU A;  3JZ0 A;  1C03 A;  1A7D A;  4G7Z F;  4IB4 A;  1FR0 A;  4KBL A;  3E9V A;  4FAP B;  1LM3 B;  1Q0M A;  1U89 A;  3QW0 A;  4A2N B;  4YT2 A;  4IGG A;  3U3F A;  1YA7 O;  3ZQV A;  3EPV A;  1OKK D;  1F1M A;  3I5P A;  1I5N A;  2BE5 F;  1SF8 A;  2NUT A;  2H8A A;  2PP4 A;  3GM1 A;  1MMD A;  1LI7 A;  2D4U A;  1BR1 A;  4FX5 A;  4JIO A;  2DYS C;  3UMH A;  2NPU A;  3EHN A;  2XLE A;  2OEV A;  1JR8 A;  3G4Z A;  4OIR F;  4ZLC A;  1FNT c;  2H7V C;  2R7U A;  4I1M A;  3US6 A;  3G50 A;  2GDC A;  4JRZ A;  4P9T A;  1RKE B;  1L7C A;  2KK1 A;  2P6V A;  4OD5 A;  3RW0 A;  3JYH A;  2OKU A;  2ZXR A;  1R4T A;  1MMN A;  2MWQ A;  3AG3 C;  3W2V A;  1NSG B;  2LCH A;  3JT1 A;  3RVY A;  1QKR A;  4DBQ A;  4RBN A;  4ONS A;  5A6J A;  4GEH A;  4YL1 A;  2H7B A;  1QPU A;  3QW1 A;  4EHP A;  4JE9 A;  3LUT B;  4PJJ A;  2L6H A;  3NDB B;  4Q5S F;  2HJM A;  2J7P A;  2HSQ A;  2J9W A;  1V55 C;  3DZA A;  1LS1 A;  4HFF B;  5DLJ A;  4K7B A;  1OW8 A;  3JRM O;  4XPW A;  2VAS A;  5E2Q A;  3EFO B;  1LS4 A;  1NU7 D;  2Q9C A;  3L8I A;  3ASO C;  3DJU B;  4N6H A;  4X0R A;  4Z9I A;  256B A;  3PDM P;  3X2Q C;  4OIQ F;  1O87 A;  2Y3H A;  2J9V A;  1Q0K A;  4J30 B;  4JC7 A;  2Z15 A;  2YEV A;  4JVS A;  3S84 A;  2HUJ A;  3L0I A;  4YN0 B;  2VCC A;  2ZXW C;  4XEV A;  1H9T A;  1SMY F;  2R7O A;  3SNH A;  4BJ1 A;  3AG2 C;  3LNM B;  2LK4 A;  2HZ8 A;  1CGN A;  4P6I C;  3GM2 A;  3AG4 C;  3C62 A;  5AC5 A;  1QVX A;  4IAR A;  4DVY P;  2MHR A;  2KW3 C;  1DOW A;  1Q0F A;  4MQ9 F;  2J9U A;  3NKE A;  1LPE A;  5D92 A;  5T3W A;  1FMW A;  4IJJ A;  3ABK C;  3VYW A;  4O6M A;  1QLE C;  3U3B A;  2XLV A;  4XLN F;  5KYX A;  5KYN A;  1V74 B;  3AQC A;  1Y6D A;  4C7O A;  4CX9 A;  1LE4 A;  2E87 A;  3Q7G A;  2D5R B;  2J9B A;  3DXJ F;  4PFP A;  2KNH A;  5JS5 A;  3KKB A;  2V26 A;  3EJN A;  3RH3 A;  3ABL C;  2AP3 A;  5A6B A;  3U2M A;  1ZHW A;  1FFT C;  2HKV A;  4CDA A;  2TMV P;  2R7W A;  1T6Q A;  1YZC A;  3W8I A;  5KYU B;  2YL1 A;  2EIJ C;  1D0Y A;  4BJ5 A;  1S05 A;  2YLI A;  4JW1 A;  2ZXO A;  2FFH A;  1VOM A;  4YK5 A;  2LFD A; 
#chains in the Genus database with same CATH homology
 1E83 A;  1CGO A;  5JSL A;  3TOL A;  4ER9 A;  2YLG A;  5JRA A;  3NMJ A;  3HNL A;  3ZTZ A;  2XL8 A;  3C63 A;  4IAQ A;  1E84 A;  2YL0 A;  3DE8 A;  5AGF A;  2XL6 A;  1BBH A;  2BC5 A;  2XM0 A;  4U9D A;  3L1M A;  3IQ6 A;  1E85 A;  4WGY A;  1YZA A;  3QVY A;  3M15 A;  3NMK A;  5JT4 A;  2XLD A;  4CDY A;  5B3I A;  4IB4 A;  1APC A;  2YL3 A;  3ZTM A;  4JKV A;  2CCY A;  1LM3 B;  3QW0 A;  2YLD A;  3ZQV A;  3ZQY A;  5JP7 A;  4WGZ A;  4CJO A;  4D4N A;  3HNK A;  1A7V A;  3VRC A;  2XLW A;  3IQ5 A;  1M6T A;  2XLE A;  3FOO A;  1RCP A;  3FOP A;  4NC3 A;  2QLA A;  1CPQ A;  3U8P A;  4CJG A;  3HNJ A;  1YYJ A;  5JUA A;  1QPU A;  2YL7 A;  3QW1 A;  4JE9 A;  1YYX A;  1JAF A;  3ZWI A;  4U9E A;  3NMI A;  1GQA A;  1NBB A;  4N6H A;  256B A;  4CIP A;  4JEA A;  2XLH A;  2YKZ A;  1CPR A;  4JEB A;  2J8W A;  2XLO A;  3DE9 A;  1CGN A;  3M4C A;  1QQ3 A;  3QVZ A;  5JVE A;  3C62 A;  4IAR A;  3TOM A;  5JLI A;  3M4B A;  2XLV A;  4N4W A;  4EIY A;  4CDV A;  2XLM A;  2XM4 A;  1EKY A;  4CX9 A;  3HNI A;  2J9B A;  5JS5 A;  4D4X A;  1E86 A;  1MQV A;  4L6R A;  4CDA A;  4ULV A;  1YZC A;  3M79 A;  2YL1 A;  1S05 A;  2YLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...