3NMJA

Crystal structure of a nickel mediated dimer for the phenanthroline-modified cytochrome cb562 variant, mbp-phen2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFAILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
molecule tags Electron transport
source organism Escherichia coli
publication title Porous protein frameworks with unsaturated metal centers in sterically encumbered coordination sites.
pubmed doi rcsb
total genus 45
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3nmjA00
1YYXA 2XL6A 1E85A 4IB4A 2XLHA 5JVEA 4N6HA 2YL1A 5JUAA 3HNIA 1CGOA 1BBHA 1LM3B 1CGNA 3DE8A 3L1MA 3QVZA 3ZWIA 4CDYA 4CDVA 2XL8A 3C62A 5JS5A 1S05A 4U9EA 3ZQYA 4IARA 2YL0A 4WGYA 2XLDA 3NMKA 4N4WA 3IQ5A 1YZCA 2J9BA 5JRAA 3HNJA 1E84A 3M4CA 3ZQVA 3IQ6A 1JAFA 2QLAA 4CX9A 3QVYA 1CPRA 4NC3A 3ZTZA 4JE9A 1QPUA 2YLGA 3VRCA 2YL3A 1NBBA 4CJGA 3FOPA 4D4NA 4EIYA 3NMJA 2YKZA 4CJOA 5JP7A 3ZTMA 3U8PA 3TOLA 1M6TA 2XLMA 1YZAA 1CPQA 1E86A 3QW0A 5AGFA 3HNLA 2XLVA 1GQAA 2BC5A 4JKVA 1A7VA 2XM0A 3C63A 3M79A 2YL7A 3M4BA 2XLOA 1E83A 3M15A 4CDAA 1APCA 1QQ3A 4D4XA 4ER9A 2XLEA 1MQVA 3HNKA 2XLWA 2YLIA 1RCPA 5JT4A 2J8WA 4IAQA 4ULVA 2XM4A 4U9DA 3TOMA 2YLDA 4JEBA 2CCYA 1EKYA 4CIPA 3FOOA 3QW1A 4JEAA 4L6RA 1YYJA 3DE9A 256BA 4WGZA 5JLIA 5JSLA 3NMIA 5B3IA
chains in the Genus database with same CATH superfamily
1MMAA 1DOVA 1E85A 2TMVP 2BL2A 4PFPA 1QKRA 4IB4A 3I5PA 1VOMA 3W2VA 3LAYA 4R32A 4G7HF 1YAUO 4PR9A 3EGXA 5IY5C 2P0NA 4UDVA 1I4YA 2HSBA 2UUHA 2AWYA 3KMIA 2WZLA 2CW0F 4DXWA 1LM3B 4MVSA 5A6JA 5HSWA 3POVA 5T3WA 4HE8D 1BDJB 1JPJA 2JX0A 3LLIA 2AWCA 3QVZA 3AJMA 5E2QA 1Q0GA 3VF0A 4J7TA 1Q0DA 4CDVA 4YT2A 5JS5A 1S05A 2Z15A 4JCHA 4U9EA 3SYNA 4OINF 4WGYA 1T9KA 2LFFA 3VAYA 5L0JA 1RKCA 2WVQA 1SF8A 4A4AA 4C7OA 1KTMA 3EQLF 3B0VC 2DGJA 3B0UX 5AC4A 2ZXRA 2M4EA 4PFOA 4EBJA 3NDBB 4MVZA 3F46A 2KC3A 4NTFA 2W4MA 5L0HA 3JZ0A 4NQFA 3ZSUA 3M4CA 4CSAA 4J32B 1WTYA 1YLMA 2H8AA 2HV6A 3PMRA 4CX9A 4P6IC 3U9JA 3MBGA 5E3CA 3JTLO 4C7OB 4LLCA 2C03A 1ST6A 2QTVA 3GEHA 4O7GA 4C3EA 3T6JA 1OCRC 4PK4A 3ABMC 1NBBA 4YL3A 4FWVA 3Q6MA 4RD9A 4C3BA 3LUTB 2J9WA 4H4KC 3UMHA 2XXAA 1EI7A 3WHNA 1VK5A 3DM5A 3S90A 1SZIA 3JRMO 1WGWA 1FAPB 2YWAA 2OEVA 5COMA 1M56C 4CJOA 1NSGB 2L7AA 1ZU4A 1VLSA 3UMIA 1ZHTA 3NRHA 4BJ6C 5KYNA 2O9XA 2I15A 3FXHA 3T9OA 3U3BA 3W8IA 2DI3A 2J0XA 2A0UA 4O79A 4G7ZF 4MW3A 2IM8A 3GM2A 1BZ4A 5F5HA 3WODF 4Q5SF 4FESA 1GQAA 3AOUA 4JKVA 3SNHA 3C7JA 4GYTA 3TJ6A 4EKWA 1BR1A 4YT5A 5GPGB 1OW8A 4BJ6A 2Y39A 4LDKA 4EBBA 1T5OA 1W2WA 2P7VA 3M79A 2QUPA 2YL7A 1H6GA 4BJTA 2PF4E 1KU2A 1D1AA 4U5EE 4B6IA 1ZW3A 3KYJA 3LNRA 1Q0MA 4DBRA 4H54A 3O10A 2YQYA 4ULWA 1U6HA 2GFHA 3BEHA 5KYXA 4O6YA 2VASA 4WJ0A 4YWQA 2KW3C 1NFOA 5KYYA 3CAXA 1C02A 1SYQA 4IGGA 3RFYA 3L0IA 3O55A 4MVRA 1I4ZA 4FX5A 5L0GA 2KJGA 4Z9HA 3AG4C 2YLDA 1VLTA 3NYMA 2R7XA 1MMDA 2PFDA 4XEFA 3EG9B 3WG7C 2L6FA 2Y69C 1Q0FA 4ZLCA 4PJJA 4DVYP 5F28E 5A6KA 2JD3A 4MVQA 4YL0A 3DM9B 3DZAA 2PNOA 2ZXPA 3G4XA 1YYJA 3DE9A 3AGTA 3JSZA 1NG1A 3TJ5A 1VTMP 1RJ9A 1YDIA 1IW7F 3O6XA 3S9OA 1HW2A 4XEVA 3A9CA 4CS7A 1VYIA 4KI2A 1YYXA 2XL6A 1ZHXA 3I5QA 4QDLA 3V7OA 4K0DA 1TQGA 2R7UA 2G3VA 3O39A 2EPLX 4JIOA 2XLHA 4DOZA 2KQ9A 3FDQA 1Z5ZA 4XPWA 5JVEA 3C18A 3I4UA 4W8PA 2Y3BA 3AG2C 4Z9IA 4PJNA 1HE9A 1A41A 1L7CA 2OJQA 1O5HA 3Q7GA 4U5GA 4X0RA 4YK5A 2P1AA 2X0CA 1D0YA 2IYLD 3DE8A 4QI0A 3RVZA 2WVNA 1XZQA 2XL8A 2EPMX 3M1CB 2LD6A 2FAPB 1D0ZA 5FCLA 2XLDA 2OEXA 3S0XA 3SXYA 2ASRA 1FR0A 4N4WA 3IQ5A 1YZCA 2OQMA 2J9BA 5B1BC 1YVIA 5JRAA 2E87A 2J0WA 2V3CC 1OXBA 4XPYA 2LQGA 4EUKB 1E84A 4I1MA 3JYHA 3SXZA 2KNHA 3HJCA 5KYYB 3BRJA 1OKKA 3K66A 4JCZA 3QVYA 3N0TA 5KYXB 1GS9A 2KGOA 2MWQA 2YZSA 3LEVA 3U3FA 1HMDA 1PD0A 3RKOF 1A0BA 4JVSA 1K05A 2Q3TA 3VRCA 2PBEA 1E2XA 4LACB 3DAFA 3EG9A 2R7WA 1JMWA 1QLEC 2H7OA 3RH3A 4U5HA 3HLZA 3ABLC 2NG1A 3K1IA 3FOPA 1D1CA 3KYIA 3S29A 2W4BA 3OEOA 3MFNA 3SEOA 4YT8A 2YKZA 4LDRA 4GEHA 3UGPA 1TWAA 1PCXA 2KK1A 1ORYA 3TD7A 2HKVA 4DRHB 3K1IC 4JTCB 3AG1C 3LNMB 1BR2A 1E86A 1CPQA 3F47A 1NZEA 1XZPA 1YA7O 2WB7A 3SZRA 3LS1A 4AL1A 5AGFA 3HNLA 2XLVA 3Q6NA 1JPNA 3A11A 3AQBA 4J30B 5FZTA 3VYWA 1R4TA 3HTKC 1J8MF 3C63A 4NY3A 2LK4A 3V5ZA 1CGME 2LCHA 3K6BA 4F4BA 1MNEA 4A2NB 2XLOA 2UUIA 1ZU5A 4MS2A 3JYYA 1V74B 1F1MA 2P61A 1M2VB 4JRZA 3T6BA 2Q7RA 3K1HA 5HV9A 2EIKC 2IXNA 4U5CE 1MQVA 2OOCA 4ER9A 4G78A 4IAOA 1A7DA 5F5FA 1UG7A 4MTOA 5BQGA 2HJ3A 1RCPA 4W8KA 3ATPA 3W2WA 1R5ID 3N24A 4CS8C 4XQ1A 5L0IA 2M64A 1G8XA 4XPXA 2VCAA 3TK0A 1I5NA 1TR2A 2EILC 2MHRA 1RJ9B 3K7DA 2Y3HA 4IRUA 2ZD9A 1AEPA 4ULVA 3UNGC 1GGQA 2XM4A 4E7ZA 4YN0B 4N6CA 3FHDA 3KL4A 4U9DA 3EZHA 1J8YF 2Y3GA 1RMVA 4I44A 4CS8A 2CDQA 2LFDA 3FMSA 1T6IA 1LS4A 2WVOA 4BJ5A 1RKEA 1OCCC 3ZVRA 3G4ZA 1TFKB 2Q00A 2PP4A 4E7SA 3IPMO 3LEOA 3PDMP 3RQFA 2HZ8A 2H7VC 3CZ6A 2AU5A 1UFBA 4BJ5C 1FMWA 5B3IA 1NU7D 3AG3C 5D91A 3SXKA 3UMKA 1Z23A 2RSEB 3RVYA 1LI7A 4M63A 4OIPF 1A7EA 1U89A 4RDAA 4ANJA 1Z6AA 2EINC 4JTAB 3T4RA 1G5ZA 2L6HA 2CYDA 1NLXA 1TKNA 2I8BA 4N6HA 4U5BE 5JUAA 1CGOA 2VCBA 2F22A 1WWPA 4MVOA 4O6NA 2R02A 3EJNA 1IZMA 2PX3A 1G4US 2WZFA 2L9JA 3VM6A 3GORA 4NTAA 1HMOA 4Q7CA 3ZWIA 1H9TA 3DAGA 1M57C 2ZXWC 3C62A 3EHNA 1LPEA 3EFOB 2L6GA 2XSEA 4NCQA 4K7BA 4IARA 5EGYA 2DB4A 3G50A 2RD9A 1RKEB 2X51A 1Z63A 1LVKA 4OIRF 3NMKA 4MQ9F 1K40A 4CS9A 1LE2A 2XRHA 4BJ1A 4QI2A 3E9VA 1RXQA 2J46A 4XLPF 1NFNA 3E70C 1HY5A 2XXAB 2EPKX 4BEJA 3NKDA 2GA0A 2QE9A 4WABA 5T1DB 2J45A 4BEMJ 2G3KA 2HS5A 3ASOC 3DXJF 3SP1A 4EBKA 2BE5F 3DJUB 4CS9C 1CPRA 2A0BA 2QY9A 1TFOB 3GEEA 4JC7A 5L3QA 4PJLA 1MMNA 3EFOA 2A6EF 4CSAC 2YLGA 1O3UA 1VMAA 2LIGA 3TQOA 3QZCA 2NUPA 4GQHA 3W4YA 2YRFA 4AK9A 1O87A 1NU9C 2HSQA 4JZAA 3IQTA 3ZG1A 4P9TA 2KSFA 3FAPB 4N06A 4D4NA 4EIYA 2NUTA 1T6UA 5BUOA 5EHHA 1ZW2A 1OR2A 2YVKA 2KYHA 1JRAA 3DD7A 3H2UA 3TOLA 2GAQA 3ZTMA 1H9GA 3EGXB 4IJJA 4MW8A 3C8GD 3GODA 2YEVA 1M6TA 3H2VA 3J06A 2QNLA 4LLEA 4MVUA 1YZAA 4YT4A 3B71A 1HE1A 1LE4A 1M2OA 1Y6DA 1WN0A 4JJFA 4KNVA 2ICWG 3KKBA 3W8HA 1TWHA 5L0CA 2BC5A 1SMYF 1A7VA 4IWBA 2WZGA 5COFA 2DYRC 3B9QA 3ECSA 3X2QC 2EPOA 4XWJA 3CEXA 1ZZPA 3WAQA 1LI5A 3U2MA 3OA1A 3NYJA 1GM5A 1E83A 3M15A 4P9FA 4CDAA 4DRJB 4RBNA 1QQ3A 3RYLA 3RQEA 3ZDLA 2FGYA 3ITFA 4DRIB 1PD1A 3GM3A 2OKUA 1OKKD 3GM1A 2XLEA 3HNKA 3KPHA 3LESA 4ONSA 1H7IA 3B29A 2Q9CA 1YJGA 2YLIA 3KH2A 5BQHA 2NUTB 3C8ZA 4Z9JA 5A69A 2NSFA 2J8WA 4CBEA 4IAQA 1D1BA 1YA9A 1VB5A 1ZYRF 3T6GB 2VC9A 1OQCA 2A69F 2NUPB 4JTDB 4OD4A 2VH3A 5KYUA 5B1AC 4HFKB 2HMZA 4AL0A 2G62A 2CCYA 4EWCA 5B3SC 4CIPA 4E18A 3JT1A 4U5DE 1ZHZA 2HFIA 3U2LA 3QW1A 1XWJA 1M2VA 2HJMA 1QZXA 4JEAA 3SXMA 3DKAA 1FTSA 4PACA 1OCZC 5CIVA 3EGDB 3IHUA 1T6QA 3ABKC 1C03A 256BA 5DS5A 4AE4A 2A1DD 1V54C 2XS1A 3NMIA 4WGZA 3JSEO 5E33A 5JSLA 4EHPA 1S7ZA 1Y4CA 2J9VA 4MNDA 1FMVA 4O6MA 1KNYA 5T3TA 3HKKA 1SR2A 2CNWA 3RQGA 3X1OA 4YJWA 3NYLA 2R9RB 3Q7LA 3C8GA 1Z7Qc 5D92A 3OWTA 5CI8A 2MYSA 2YL1A 3PCVA 3HNIA 3GANA 2HMQA 3U0CA 1BBHA 1MNDA 1MMGA 2HUJA 1AUEA 1CGNA 2AP3A 2J9UA 2OG2A 4G0HA 1C17M 3L1MA 3RIPA 3R7CA 3DJNB 2GWWA 4AE4B 4AX2A 4FAPB 4KC9A 4OIQF 3EGDA 2YHSA 4CDYA 3PHF2 3V5XA 4E0HA 1ZHYA 5A6BD 5KYWB 3TULA 2LP4A 1G4WR 3ZQYA 3IEEA 4OIOF 3NG1A 2YL0A 4HFFB 4LDQA 4CIHA 3LLKA 2R7RA 2CGEA 3FAJA 3S84A 3MYFA 1ORSC 2C04A 3AQCA 1QSPA 1Q0KA 2FFHA 1FFHA 3JRTA 5A6AA 1D0XA 2W45A 3HNJA 2D4UA 5DS4A 1K04A 5DLJA 4K1OA 3ZQVA 3GWLA 3EH1A 3IQ6A 4DBQA 1JAFA 4MVMA 4BPMA 1B68A 2QLAA 4LERA 3L34A 1LS1A 5L3VA 2OCCC 4KBLA 4NC3A 2OJED 3MYIA 5L0DA 3ZTZA 3N2ZB 3S28A 4JE9A 3ZC4A 1QPUA 5KYWA 2IXPA 1JOGA 3QTHA 3L8JA 2B0JA 4XTKA 1LKXA 3U8VA 1EA8A 2YL3A 3DWWA 4E0IA 4C3DA 5DS6A 4NTBA 3L8IA 2Q4FA 4CJGA 5E3AA 1PV3A 2B0HA 3AGUA 2IXMA 2NPUA 4I1OB 2EIJC 4JURI 3NMJA 4J7YA 1TWGA 3ASNC 3RW0A 4I3MA 1V55C 1TWCA 2CNWD 2R7VA 4OD5A 5JP7A 3EH2A 3U8PA 1DOWA 3US6A 2OU6A 2J7PD 4PJMA 1WOLA 3EPVA 1U0BB 2D5RB 2R7SA 4BG0A 2IXOA 2R03A 2WL8A 2VCCA 2XLMA 1OXKA 4U5FE 2EPNA 3B0PA 3QW0A 3GEIA 4MTGA 2GDCA 2JPUA 2XL4A 3U9MA 3FVYA 5CI9A 3UGOA 2L81A 1AVOB 3QMKA 3RF3A 1OCOC 5DVWA 2XM0A 2R7OA 1N1CA 1LIHA 3UR3C 3EHMA 4MTFA 2DYSC 1V4AA 2R05A 4HEAJ 5BQIA 3M4BA 5EK0A 2XS8A 1QVXA 2ZXOA 3ZIBA 1ORJA 1BR4A 2VB6A 5COGA 4YL1A 5DQTA 1APCA 2Q9BA 3K33A 5A6BA 5L0FA 4KNWA 3JCUQ 1YARO 4D4XA 1Z3IX 2R25A 1WASA 5KYUB 5TJ5E 5K0IA 3U5SA 2V26A 3C8GB 2XLWA 4JW1A 3GWNA 3IQCA 4DVZA 1OW7A 1ZVZA 2Q9AA 3NKEA 4JJGA 2IBFA 4XEKA 1WATA 4DJ9A 5JT4A 1ZHWA 2PX0A 3EZIA 1OR3A 2NSGA 1JR8A 3MLGA 4ZLDA 2AVKA 1T01A 4G7OF 3TOMA 1VYKA 3H65A 4JEBA 3R2PA 1FNTc 1EKYA 2R7QA 2EIMC 2ETSA 1OW6A 2HV7A 3FOOA 4E17A 3LS0A 3CQZA 3CSKA 3DI5A 3DMDA 2LSEA 2A6HF 2IOQA 2P6VA 2W9YA 4L6RA 2A68F 2ZPAA 1L3PA 2H7BA 5DQZA 5AC5A 4Q4ZF 3MX3A 4XLNF 3V5YA 1FFTC 1EQ1A 3LJBA 2R7TA 5JLIA 1HW1A 2Y3DA 3S27A 2J7PA
chains in the Genus database with same CATH topology
1YYXA 2XL6A 1E85A 4IB4A 2XLHA 5JVEA 4N6HA 2YL1A 5JUAA 3HNIA 1CGOA 1BBHA 1LM3B 1CGNA 3DE8A 3L1MA 3QVZA 3ZWIA 4CDYA 4CDVA 2XL8A 3C62A 5JS5A 1S05A 4U9EA 3ZQYA 4IARA 2YL0A 4WGYA 2XLDA 3NMKA 4N4WA 3IQ5A 1YZCA 2J9BA 5JRAA 3HNJA 1E84A 3M4CA 3ZQVA 3IQ6A 1JAFA 2QLAA 4CX9A 3QVYA 1CPRA 4NC3A 3ZTZA 4JE9A 1QPUA 2YLGA 3VRCA 2YL3A 1NBBA 4CJGA 3FOPA 4D4NA 4EIYA 3NMJA 2YKZA 4CJOA 5JP7A 3ZTMA 3U8PA 3TOLA 1M6TA 2XLMA 1YZAA 1CPQA 1E86A 3QW0A 5AGFA 3HNLA 2XLVA 1GQAA 2BC5A 4JKVA 1A7VA 2XM0A 3C63A 3M79A 2YL7A 3M4BA 2XLOA 1E83A 3M15A 4CDAA 1APCA 1QQ3A 4D4XA 4ER9A 2XLEA 1MQVA 3HNKA 2XLWA 2YLIA 1RCPA 5JT4A 2J8WA 4IAQA 4ULVA 2XM4A 4U9DA 3TOMA 2YLDA 4JEBA 2CCYA 1EKYA 4CIPA 3FOOA 3QW1A 4JEAA 4L6RA 1YYJA 3DE9A 256BA 4WGZA 5JLIA 5JSLA 3NMIA 5B3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYX A;  2XL6 A;  1E85 A;  4IB4 A;  2XLH A;  5JVE A;  4N6H A;  2YL1 A;  5JUA A;  3HNI A;  1CGO A;  1BBH A;  1LM3 B;  1CGN A;  3DE8 A;  3L1M A;  3QVZ A;  3ZWI A;  4CDY A;  4CDV A;  2XL8 A;  3C62 A;  5JS5 A;  1S05 A;  4U9E A;  3ZQY A;  4IAR A;  2YL0 A;  4WGY A;  2XLD A;  3NMK A;  4N4W A;  3IQ5 A;  1YZC A;  2J9B A;  5JRA A;  3HNJ A;  1E84 A;  3M4C A;  3ZQV A;  3IQ6 A;  1JAF A;  2QLA A;  4CX9 A;  3QVY A;  1CPR A;  4NC3 A;  3ZTZ A;  4JE9 A;  1QPU A;  2YLG A;  3VRC A;  2YL3 A;  1NBB A;  4CJG A;  3FOP A;  4D4N A;  4EIY A;  3NMJ A;  2YKZ A;  4CJO A;  5JP7 A;  3ZTM A;  3U8P A;  3TOL A;  1M6T A;  2XLM A;  1YZA A;  1CPQ A;  1E86 A;  3QW0 A;  5AGF A;  3HNL A;  2XLV A;  1GQA A;  2BC5 A;  4JKV A;  1A7V A;  2XM0 A;  3C63 A;  3M79 A;  2YL7 A;  3M4B A;  2XLO A;  1E83 A;  3M15 A;  4CDA A;  1APC A;  1QQ3 A;  4D4X A;  4ER9 A;  2XLE A;  1MQV A;  3HNK A;  2XLW A;  2YLI A;  1RCP A;  5JT4 A;  2J8W A;  4IAQ A;  4ULV A;  2XM4 A;  4U9D A;  3TOM A;  2YLD A;  4JEB A;  2CCY A;  1EKY A;  4CIP A;  3FOO A;  3QW1 A;  4JEA A;  4L6R A;  1YYJ A;  3DE9 A;  256B A;  4WGZ A;  5JLI A;  5JSL A;  3NMI A;  5B3I A; 
#chains in the Genus database with same CATH topology
 1MMA A;  1DOV A;  1E85 A;  2TMV P;  2BL2 A;  4PFP A;  1QKR A;  4IB4 A;  3I5P A;  1VOM A;  3W2V A;  3LAY A;  4R32 A;  4G7H F;  1YAU O;  4PR9 A;  3EGX A;  5IY5 C;  2P0N A;  4UDV A;  1I4Y A;  2HSB A;  2UUH A;  2AWY A;  3KMI A;  2WZL A;  2CW0 F;  4DXW A;  1LM3 B;  4MVS A;  5A6J A;  5HSW A;  3POV A;  5T3W A;  4HE8 D;  1BDJ B;  1JPJ A;  2JX0 A;  3LLI A;  2AWC A;  3QVZ A;  3AJM A;  5E2Q A;  1Q0G A;  3VF0 A;  4J7T A;  1Q0D A;  4CDV A;  4YT2 A;  5JS5 A;  1S05 A;  2Z15 A;  4JCH A;  4U9E A;  3SYN A;  4OIN F;  4WGY A;  1T9K A;  2LFF A;  3VAY A;  5L0J A;  1RKC A;  2WVQ A;  1SF8 A;  4A4A A;  4C7O A;  1KTM A;  3EQL F;  3B0V C;  2DGJ A;  3B0U X;  5AC4 A;  2ZXR A;  2M4E A;  4PFO A;  4EBJ A;  3NDB B;  4MVZ A;  3F46 A;  2KC3 A;  4NTF A;  2W4M A;  5L0H A;  3JZ0 A;  4NQF A;  3ZSU A;  3M4C A;  4CSA A;  4J32 B;  1WTY A;  1YLM A;  2H8A A;  2HV6 A;  3PMR A;  4CX9 A;  4P6I C;  3U9J A;  3MBG A;  5E3C A;  3JTL O;  4C7O B;  4LLC A;  2C03 A;  1ST6 A;  2QTV A;  3GEH A;  4O7G A;  4C3E A;  3T6J A;  1OCR C;  4PK4 A;  3ABM C;  1NBB A;  4YL3 A;  4FWV A;  3Q6M A;  4RD9 A;  4C3B A;  3LUT B;  2J9W A;  4H4K C;  3UMH A;  2XXA A;  1EI7 A;  3WHN A;  1VK5 A;  3DM5 A;  3S90 A;  1SZI A;  3JRM O;  1WGW A;  1FAP B;  2YWA A;  2OEV A;  5COM A;  1M56 C;  4CJO A;  1NSG B;  2L7A A;  1ZU4 A;  1VLS A;  3UMI A;  1ZHT A;  3NRH A;  4BJ6 C;  5KYN A;  2O9X A;  2I15 A;  3FXH A;  3T9O A;  3U3B A;  3W8I A;  2DI3 A;  2J0X A;  2A0U A;  4O79 A;  4G7Z F;  4MW3 A;  2IM8 A;  3GM2 A;  1BZ4 A;  5F5H A;  3WOD F;  4Q5S F;  4FES A;  1GQA A;  3AOU A;  4JKV A;  3SNH A;  3C7J A;  4GYT A;  3TJ6 A;  4EKW A;  1BR1 A;  4YT5 A;  5GPG B;  1OW8 A;  4BJ6 A;  2Y39 A;  4LDK A;  4EBB A;  1T5O A;  1W2W A;  2P7V A;  3M79 A;  2QUP A;  2YL7 A;  1H6G A;  4BJT A;  2PF4 E;  1KU2 A;  1D1A A;  4U5E E;  4B6I A;  1ZW3 A;  3KYJ A;  3LNR A;  1Q0M A;  4DBR A;  4H54 A;  3O10 A;  2YQY A;  4ULW A;  1U6H A;  2GFH A;  3BEH A;  5KYX A;  4O6Y A;  2VAS A;  4WJ0 A;  4YWQ A;  2KW3 C;  1NFO A;  5KYY A;  3CAX A;  1C02 A;  1SYQ A;  4IGG A;  3RFY A;  3L0I A;  3O55 A;  4MVR A;  1I4Z A;  4FX5 A;  5L0G A;  2KJG A;  4Z9H A;  3AG4 C;  2YLD A;  1VLT A;  3NYM A;  2R7X A;  1MMD A;  2PFD A;  4XEF A;  3EG9 B;  3WG7 C;  2L6F A;  2Y69 C;  1Q0F A;  4ZLC A;  4PJJ A;  4DVY P;  5F28 E;  5A6K A;  2JD3 A;  4MVQ A;  4YL0 A;  3DM9 B;  3DZA A;  2PNO A;  2ZXP A;  3G4X A;  1YYJ A;  3DE9 A;  3AGT A;  3JSZ A;  1NG1 A;  3TJ5 A;  1VTM P;  1RJ9 A;  1YDI A;  1IW7 F;  3O6X A;  3S9O A;  1HW2 A;  4XEV A;  3A9C A;  4CS7 A;  1VYI A;  4KI2 A;  1YYX A;  2XL6 A;  1ZHX A;  3I5Q A;  4QDL A;  3V7O A;  4K0D A;  1TQG A;  2R7U A;  2G3V A;  3O39 A;  2EPL X;  4JIO A;  2XLH A;  4DOZ A;  2KQ9 A;  3FDQ A;  1Z5Z A;  4XPW A;  5JVE A;  3C18 A;  3I4U A;  4W8P A;  2Y3B A;  3AG2 C;  4Z9I A;  4PJN A;  1HE9 A;  1A41 A;  1L7C A;  2OJQ A;  1O5H A;  3Q7G A;  4U5G A;  4X0R A;  4YK5 A;  2P1A A;  2X0C A;  1D0Y A;  2IYL D;  3DE8 A;  4QI0 A;  3RVZ A;  2WVN A;  1XZQ A;  2XL8 A;  2EPM X;  3M1C B;  2LD6 A;  2FAP B;  1D0Z A;  5FCL A;  2XLD A;  2OEX A;  3S0X A;  3SXY A;  2ASR A;  1FR0 A;  4N4W A;  3IQ5 A;  1YZC A;  2OQM A;  2J9B A;  5B1B C;  1YVI A;  5JRA A;  2E87 A;  2J0W A;  2V3C C;  1OXB A;  4XPY A;  2LQG A;  4EUK B;  1E84 A;  4I1M A;  3JYH A;  3SXZ A;  2KNH A;  3HJC A;  5KYY B;  3BRJ A;  1OKK A;  3K66 A;  4JCZ A;  3QVY A;  3N0T A;  5KYX B;  1GS9 A;  2KGO A;  2MWQ A;  2YZS A;  3LEV A;  3U3F A;  1HMD A;  1PD0 A;  3RKO F;  1A0B A;  4JVS A;  1K05 A;  2Q3T A;  3VRC A;  2PBE A;  1E2X A;  4LAC B;  3DAF A;  3EG9 A;  2R7W A;  1JMW A;  1QLE C;  2H7O A;  3RH3 A;  4U5H A;  3HLZ A;  3ABL C;  2NG1 A;  3K1I A;  3FOP A;  1D1C A;  3KYI A;  3S29 A;  2W4B A;  3OEO A;  3MFN A;  3SEO A;  4YT8 A;  2YKZ A;  4LDR A;  4GEH A;  3UGP A;  1TWA A;  1PCX A;  2KK1 A;  1ORY A;  3TD7 A;  2HKV A;  4DRH B;  3K1I C;  4JTC B;  3AG1 C;  3LNM B;  1BR2 A;  1E86 A;  1CPQ A;  3F47 A;  1NZE A;  1XZP A;  1YA7 O;  2WB7 A;  3SZR A;  3LS1 A;  4AL1 A;  5AGF A;  3HNL A;  2XLV A;  3Q6N A;  1JPN A;  3A11 A;  3AQB A;  4J30 B;  5FZT A;  3VYW A;  1R4T A;  3HTK C;  1J8M F;  3C63 A;  4NY3 A;  2LK4 A;  3V5Z A;  1CGM E;  2LCH A;  3K6B A;  4F4B A;  1MNE A;  4A2N B;  2XLO A;  2UUI A;  1ZU5 A;  4MS2 A;  3JYY A;  1V74 B;  1F1M A;  2P61 A;  1M2V B;  4JRZ A;  3T6B A;  2Q7R A;  3K1H A;  5HV9 A;  2EIK C;  2IXN A;  4U5C E;  1MQV A;  2OOC A;  4ER9 A;  4G78 A;  4IAO A;  1A7D A;  5F5F A;  1UG7 A;  4MTO A;  5BQG A;  2HJ3 A;  1RCP A;  4W8K A;  3ATP A;  3W2W A;  1R5I D;  3N24 A;  4CS8 C;  4XQ1 A;  5L0I A;  2M64 A;  1G8X A;  4XPX A;  2VCA A;  3TK0 A;  1I5N A;  1TR2 A;  2EIL C;  2MHR A;  1RJ9 B;  3K7D A;  2Y3H A;  4IRU A;  2ZD9 A;  1AEP A;  4ULV A;  3UNG C;  1GGQ A;  2XM4 A;  4E7Z A;  4YN0 B;  4N6C A;  3FHD A;  3KL4 A;  4U9D A;  3EZH A;  1J8Y F;  2Y3G A;  1RMV A;  4I44 A;  4CS8 A;  2CDQ A;  2LFD A;  3FMS A;  1T6I A;  1LS4 A;  2WVO A;  4BJ5 A;  1RKE A;  1OCC C;  3ZVR A;  3G4Z A;  1TFK B;  2Q00 A;  2PP4 A;  4E7S A;  3IPM O;  3LEO A;  3PDM P;  3RQF A;  2HZ8 A;  2H7V C;  3CZ6 A;  2AU5 A;  1UFB A;  4BJ5 C;  1FMW A;  5B3I A;  1NU7 D;  3AG3 C;  5D91 A;  3SXK A;  3UMK A;  1Z23 A;  2RSE B;  3RVY A;  1LI7 A;  4M63 A;  4OIP F;  1A7E A;  1U89 A;  4RDA A;  4ANJ A;  1Z6A A;  2EIN C;  4JTA B;  3T4R A;  1G5Z A;  2L6H A;  2CYD A;  1NLX A;  1TKN A;  2I8B A;  4N6H A;  4U5B E;  5JUA A;  1CGO A;  2VCB A;  2F22 A;  1WWP A;  4MVO A;  4O6N A;  2R02 A;  3EJN A;  1IZM A;  2PX3 A;  1G4U S;  2WZF A;  2L9J A;  3VM6 A;  3GOR A;  4NTA A;  1HMO A;  4Q7C A;  3ZWI A;  1H9T A;  3DAG A;  1M57 C;  2ZXW C;  3C62 A;  3EHN A;  1LPE A;  3EFO B;  2L6G A;  2XSE A;  4NCQ A;  4K7B A;  4IAR A;  5EGY A;  2DB4 A;  3G50 A;  2RD9 A;  1RKE B;  2X51 A;  1Z63 A;  1LVK A;  4OIR F;  3NMK A;  4MQ9 F;  1K40 A;  4CS9 A;  1LE2 A;  2XRH A;  4BJ1 A;  4QI2 A;  3E9V A;  1RXQ A;  2J46 A;  4XLP F;  1NFN A;  3E70 C;  1HY5 A;  2XXA B;  2EPK X;  4BEJ A;  3NKD A;  2GA0 A;  2QE9 A;  4WAB A;  5T1D B;  2J45 A;  4BEM J;  2G3K A;  2HS5 A;  3ASO C;  3DXJ F;  3SP1 A;  4EBK A;  2BE5 F;  3DJU B;  4CS9 C;  1CPR A;  2A0B A;  2QY9 A;  1TFO B;  3GEE A;  4JC7 A;  5L3Q A;  4PJL A;  1MMN A;  3EFO A;  2A6E F;  4CSA C;  2YLG A;  1O3U A;  1VMA A;  2LIG A;  3TQO A;  3QZC A;  2NUP A;  4GQH A;  3W4Y A;  2YRF A;  4AK9 A;  1O87 A;  1NU9 C;  2HSQ A;  4JZA A;  3IQT A;  3ZG1 A;  4P9T A;  2KSF A;  3FAP B;  4N06 A;  4D4N A;  4EIY A;  2NUT A;  1T6U A;  5BUO A;  5EHH A;  1ZW2 A;  1OR2 A;  2YVK A;  2KYH A;  1JRA A;  3DD7 A;  3H2U A;  3TOL A;  2GAQ A;  3ZTM A;  1H9G A;  3EGX B;  4IJJ A;  4MW8 A;  3C8G D;  3GOD A;  2YEV A;  1M6T A;  3H2V A;  3J06 A;  2QNL A;  4LLE A;  4MVU A;  1YZA A;  4YT4 A;  3B71 A;  1HE1 A;  1LE4 A;  1M2O A;  1Y6D A;  1WN0 A;  4JJF A;  4KNV A;  2ICW G;  3KKB A;  3W8H A;  1TWH A;  5L0C A;  2BC5 A;  1SMY F;  1A7V A;  4IWB A;  2WZG A;  5COF A;  2DYR C;  3B9Q A;  3ECS A;  3X2Q C;  2EPO A;  4XWJ A;  3CEX A;  1ZZP A;  3WAQ A;  1LI5 A;  3U2M A;  3OA1 A;  3NYJ A;  1GM5 A;  1E83 A;  3M15 A;  4P9F A;  4CDA A;  4DRJ B;  4RBN A;  1QQ3 A;  3RYL A;  3RQE A;  3ZDL A;  2FGY A;  3ITF A;  4DRI B;  1PD1 A;  3GM3 A;  2OKU A;  1OKK D;  3GM1 A;  2XLE A;  3HNK A;  3KPH A;  3LES A;  4ONS A;  1H7I A;  3B29 A;  2Q9C A;  1YJG A;  2YLI A;  3KH2 A;  5BQH A;  2NUT B;  3C8Z A;  4Z9J A;  5A69 A;  2NSF A;  2J8W A;  4CBE A;  4IAQ A;  1D1B A;  1YA9 A;  1VB5 A;  1ZYR F;  3T6G B;  2VC9 A;  1OQC A;  2A69 F;  2NUP B;  4JTD B;  4OD4 A;  2VH3 A;  5KYU A;  5B1A C;  4HFK B;  2HMZ A;  4AL0 A;  2G62 A;  2CCY A;  4EWC A;  5B3S C;  4CIP A;  4E18 A;  3JT1 A;  4U5D E;  1ZHZ A;  2HFI A;  3U2L A;  3QW1 A;  1XWJ A;  1M2V A;  2HJM A;  1QZX A;  4JEA A;  3SXM A;  3DKA A;  1FTS A;  4PAC A;  1OCZ C;  5CIV A;  3EGD B;  3IHU A;  1T6Q A;  3ABK C;  1C03 A;  256B A;  5DS5 A;  4AE4 A;  2A1D D;  1V54 C;  2XS1 A;  3NMI A;  4WGZ A;  3JSE O;  5E33 A;  5JSL A;  4EHP A;  1S7Z A;  1Y4C A;  2J9V A;  4MND A;  1FMV A;  4O6M A;  1KNY A;  5T3T A;  3HKK A;  1SR2 A;  2CNW A;  3RQG A;  3X1O A;  4YJW A;  3NYL A;  2R9R B;  3Q7L A;  3C8G A;  1Z7Q c;  5D92 A;  3OWT A;  5CI8 A;  2MYS A;  2YL1 A;  3PCV A;  3HNI A;  3GAN A;  2HMQ A;  3U0C A;  1BBH A;  1MND A;  1MMG A;  2HUJ A;  1AUE A;  1CGN A;  2AP3 A;  2J9U A;  2OG2 A;  4G0H A;  1C17 M;  3L1M A;  3RIP A;  3R7C A;  3DJN B;  2GWW A;  4AE4 B;  4AX2 A;  4FAP B;  4KC9 A;  4OIQ F;  3EGD A;  2YHS A;  4CDY A;  3PHF 2;  3V5X A;  4E0H A;  1ZHY A;  5A6B D;  5KYW B;  3TUL A;  2LP4 A;  1G4W R;  3ZQY A;  3IEE A;  4OIO F;  3NG1 A;  2YL0 A;  4HFF B;  4LDQ A;  4CIH A;  3LLK A;  2R7R A;  2CGE A;  3FAJ A;  3S84 A;  3MYF A;  1ORS C;  2C04 A;  3AQC A;  1QSP A;  1Q0K A;  2FFH A;  1FFH A;  3JRT A;  5A6A A;  1D0X A;  2W45 A;  3HNJ A;  2D4U A;  5DS4 A;  1K04 A;  5DLJ A;  4K1O A;  3ZQV A;  3GWL A;  3EH1 A;  3IQ6 A;  4DBQ A;  1JAF A;  4MVM A;  4BPM A;  1B68 A;  2QLA A;  4LER A;  3L34 A;  1LS1 A;  5L3V A;  2OCC C;  4KBL A;  4NC3 A;  2OJE D;  3MYI A;  5L0D A;  3ZTZ A;  3N2Z B;  3S28 A;  4JE9 A;  3ZC4 A;  1QPU A;  5KYW A;  2IXP A;  1JOG A;  3QTH A;  3L8J A;  2B0J A;  4XTK A;  1LKX A;  3U8V A;  1EA8 A;  2YL3 A;  3DWW A;  4E0I A;  4C3D A;  5DS6 A;  4NTB A;  3L8I A;  2Q4F A;  4CJG A;  5E3A A;  1PV3 A;  2B0H A;  3AGU A;  2IXM A;  2NPU A;  4I1O B;  2EIJ C;  4JUR I;  3NMJ A;  4J7Y A;  1TWG A;  3ASN C;  3RW0 A;  4I3M A;  1V55 C;  1TWC A;  2CNW D;  2R7V A;  4OD5 A;  5JP7 A;  3EH2 A;  3U8P A;  1DOW A;  3US6 A;  2OU6 A;  2J7P D;  4PJM A;  1WOL A;  3EPV A;  1U0B B;  2D5R B;  2R7S A;  4BG0 A;  2IXO A;  2R03 A;  2WL8 A;  2VCC A;  2XLM A;  1OXK A;  4U5F E;  2EPN A;  3B0P A;  3QW0 A;  3GEI A;  4MTG A;  2GDC A;  2JPU A;  2XL4 A;  3U9M A;  3FVY A;  5CI9 A;  3UGO A;  2L81 A;  1AVO B;  3QMK A;  3RF3 A;  1OCO C;  5DVW A;  2XM0 A;  2R7O A;  1N1C A;  1LIH A;  3UR3 C;  3EHM A;  4MTF A;  2DYS C;  1V4A A;  2R05 A;  4HEA J;  5BQI A;  3M4B A;  5EK0 A;  2XS8 A;  1QVX A;  2ZXO A;  3ZIB A;  1ORJ A;  1BR4 A;  2VB6 A;  5COG A;  4YL1 A;  5DQT A;  1APC A;  2Q9B A;  3K33 A;  5A6B A;  5L0F A;  4KNW A;  3JCU Q;  1YAR O;  4D4X A;  1Z3I X;  2R25 A;  1WAS A;  5KYU B;  5TJ5 E;  5K0I A;  3U5S A;  2V26 A;  3C8G B;  2XLW A;  4JW1 A;  3GWN A;  3IQC A;  4DVZ A;  1OW7 A;  1ZVZ A;  2Q9A A;  3NKE A;  4JJG A;  2IBF A;  4XEK A;  1WAT A;  4DJ9 A;  5JT4 A;  1ZHW A;  2PX0 A;  3EZI A;  1OR3 A;  2NSG A;  1JR8 A;  3MLG A;  4ZLD A;  2AVK A;  1T01 A;  4G7O F;  3TOM A;  1VYK A;  3H65 A;  4JEB A;  3R2P A;  1FNT c;  1EKY A;  2R7Q A;  2EIM C;  2ETS A;  1OW6 A;  2HV7 A;  3FOO A;  4E17 A;  3LS0 A;  3CQZ A;  3CSK A;  3DI5 A;  3DMD A;  2LSE A;  2A6H F;  2IOQ A;  2P6V A;  2W9Y A;  4L6R A;  2A68 F;  2ZPA A;  1L3P A;  2H7B A;  5DQZ A;  5AC5 A;  4Q4Z F;  3MX3 A;  4XLN F;  3V5Y A;  1FFT C;  1EQ1 A;  3LJB A;  2R7T A;  5JLI A;  1HW1 A;  2Y3D A;  3S27 A;  2J7P A; 
#chains in the Genus database with same CATH homology
 1YYX A;  2XL6 A;  1E85 A;  4IB4 A;  2XLH A;  5JVE A;  4N6H A;  2YL1 A;  5JUA A;  3HNI A;  1CGO A;  1BBH A;  1LM3 B;  1CGN A;  3DE8 A;  3L1M A;  3QVZ A;  3ZWI A;  4CDY A;  4CDV A;  2XL8 A;  3C62 A;  5JS5 A;  1S05 A;  4U9E A;  3ZQY A;  4IAR A;  2YL0 A;  4WGY A;  2XLD A;  3NMK A;  4N4W A;  3IQ5 A;  1YZC A;  2J9B A;  5JRA A;  3HNJ A;  1E84 A;  3M4C A;  3ZQV A;  3IQ6 A;  1JAF A;  2QLA A;  4CX9 A;  3QVY A;  1CPR A;  4NC3 A;  3ZTZ A;  4JE9 A;  1QPU A;  2YLG A;  3VRC A;  2YL3 A;  1NBB A;  4CJG A;  3FOP A;  4D4N A;  4EIY A;  3NMJ A;  2YKZ A;  4CJO A;  5JP7 A;  3ZTM A;  3U8P A;  3TOL A;  1M6T A;  2XLM A;  1YZA A;  1CPQ A;  1E86 A;  3QW0 A;  5AGF A;  3HNL A;  2XLV A;  1GQA A;  2BC5 A;  4JKV A;  1A7V A;  2XM0 A;  3C63 A;  3M79 A;  2YL7 A;  3M4B A;  2XLO A;  1E83 A;  3M15 A;  4CDA A;  1APC A;  1QQ3 A;  4D4X A;  4ER9 A;  2XLE A;  1MQV A;  3HNK A;  2XLW A;  2YLI A;  1RCP A;  5JT4 A;  2J8W A;  4IAQ A;  4ULV A;  2XM4 A;  4U9D A;  3TOM A;  2YLD A;  4JEB A;  2CCY A;  1EKY A;  4CIP A;  3FOO A;  3QW1 A;  4JEA A;  4L6R A;  1YYJ A;  3DE9 A;  256B A;  4WGZ A;  5JLI A;  5JSL A;  3NMI A;  5B3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...