3NMJA

Crystal structure of a nickel mediated dimer for the phenanthroline-modified cytochrome cb562 variant, mbp-phen2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFAILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Porous protein frameworks with unsaturated metal centers in sterically encumbered coordination sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 45
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3nmjA00
1RCPA 4CDVA 3M4BA 3VRCA 3NMJA 3IQ6A 4ER9A 5JP7A 5JLIA 4CJOA 1E86A 2YL3A 5JUAA 4U9DA 2J9BA 1QPUA 4ULVA 2BC5A 3QW0A 1NBBA 1MQVA 1E85A 1YYJA 3HNIA 3C63A 4N4WA 4WGZA 4CJGA 5JRAA 5JS5A 3ZTMA 2QLAA 1E84A 3QW1A 1EKYA 1CGOA 3QVZA 4WGYA 1S05A 2XM0A 3M4CA 2XLMA 2XL8A 3ZQVA 1LM3B 5JVEA 1QQ3A 4JKVA 3QVYA 4EIYA 1M6TA 5B3IA 2XL6A 1CGNA 2XLWA 2XLVA 5JT4A 2CCYA 256BA 3ZQYA 2YL0A 4N6HA 3M79A 4CIPA 4IAQA 2XLHA 2YLDA 2YL1A 5JSLA 4JE9A 1CPRA 2YLIA 3HNLA 3NMIA 3HNKA 4L6RA 3L1MA 3U8PA 3HNJA 2XLOA 4D4XA 2YL7A 4CX9A 4JEBA 4IARA 1E83A 1GQAA 4JEAA 1BBHA 2J8WA 5AGFA 4NC3A 3FOOA 1JAFA 1APCA 1YZCA 3FOPA 2YLGA 4CDAA 2XM4A 1YYXA 4CDYA 3TOLA 2YKZA 3NMKA 1YZAA 1A7VA 3DE9A 2XLEA 4U9EA 4IB4A 3TOMA 3C62A 3ZTZA 2XLDA 3M15A 3IQ5A 3ZWIA 3DE8A 4D4NA 1CPQA
chains in the Genus database with same CATH superfamily
1L7CA 2J45A 3U3BA 2G3VA 4LDQA 1Y4CA 3HLZA 4YK5A 3ZC4A 2B0JA 1T6UA 1YLMA 1ZHXA 2JX0A 4OD4A 2R03A 5JP7A 4IWBA 5DQTA 4CJOA 3WG7C 2V3CC 4MVQA 2QTVA 1OR3A 3EH2A 3L0IA 3SZRA 1AUEA 4U9DA 1WASA 2J9WA 1IZMA 2J9BA 3GM3A 4ULVA 4NQFA 3RIPA 1NBBA 2UUHA 5EGYA 3K1IA 2PF4E 4EWCA 5COMA 2LP4A 2J0XA 2X51A 2GDCA 3HKKA 3HNIA 4O7GA 2A1DD 1XZQA 3DD7A 1Z3IX 1TWHA 3GORA 1GGQA 3EG9B 1OQCA 1TR2A 2KQ9A 4G0HA 4PFPA 3JTLO 3TJ6A 1YDIA 2LK4A 2P6VA 1YA7O 4MVMA 3C8GD 3DAGA 4G7ZF 5L3VA 5COGA 1AVOB 1S05A 5GPGB 3AJMA 1Q0GA 3AOUA 3UR3C 2YQYA 3ZQVA 4MW8A 1R5ID 5CI8A 1QQ3A 4JKVA 3GEHA 2L9JA 2HMZA 3KYIA 4EBKA 4CSAA 1A7DA 1D0YA 4YT5A 3L34A 4CIHA 1CGNA 1FMWA 2DGJA 4IAOA 1OCZC 4AE4B 4LDRA 2QNLA 2GAQA 2I15A 1ZYRF 4M63A 2XS8A 1U89A 4BEJA 4JJGA 2EPKX 3T9OA 3ZQYA 4JIOA 1D1BA 3H2UA 4JCHA 4PJJA 3RFYA 1BR2A 1TQGA 2WVNA 3RQEA 2VH3A 3B0UX 3IHUA 3GWLA 5CI9A 1ZVZA 2OEXA 3T6GB 2J9VA 3RW0A 4JZAA 2WZGA 3G4XA 1FFHA 1SZIA 4XLPF 1LE2A 1OXBA 2KYHA 1HW2A 5L0FA 1RXQA 2BL2A 2OOCA 3EZHA 1Z23A 2QY9A 1UFBA 3L8IA 2HUJA 3NDBB 4DBQA 2TMVP 1GM5A 4D4XA 4DJ9A 4EUKB 4AX2A 3EHMA 3CAXA 3JSZA 4NY3A 3VM6A 5HSWA 1OCRC 2IBFA 1KNYA 2IXPA 3DWWA 2R7RA 4JEBA 1T01A 2XL4A 4CS9C 5A6KA 2HV7A 2HKVA 4BJ6C 1HW1A 2WZFA 5F28E 3DZAA 1JOGA 1GQAA 4I3MA 3JRMO 2W45A 2J8WA 2KK1A 2L6HA 3JCUQ 5AGFA 3W2VA 5CIVA 3FOOA 2NUTA 3DJNB 2ICWG 4W8PA 1RJ9B 3M1CB 4QI2A 4LLCA 1H9TA 1T9KA 2HFIA 2GFHA 3EQLF 3JSEO 4EBBA 3CEXA 3VYWA 1LS1A 1YYXA 2KJGA 3TK0A 3UMHA 2J0WA 4XEKA 5B1BC 3TOLA 2KGOA 3OWTA 3NMKA 1RKEB 1LPEA 1WOLA 2OEVA 2RD9A 3Q6MA 4GEHA 4CSAC 3UNGC 2NG1A 2NUPB 3TOMA 3ZSUA 3X1OA 2IXOA 5D91A 2P61A 1M2VB 2XLDA 2EIJC 1NG1A 2P1AA 1N1CA 4J30B 1VK5A 3A9CA 3IQ5A 3ZWIA 4XLNF 4E0IA 1NSGB 3PMRA 4Q4ZF 3F46A 1FR0A 3S9OA 2GWWA 4XEFA 2ZXPA 3JT1A 3RYLA 3EG9A 5T3WA 3LAYA 1OW6A 4D4NA 3Q6NA 1NU9C 2A0UA 4ONSA 4CDVA 1Q0FA 4U5FE 5B1AC 2J9UA 1I4ZA 1FFTC 5T1DB 3W4YA 3KMIA 3O6XA 4WABA 1E86A 1LKXA 2DB4A 2OKUA 1Q0KA 2ZD9A 3HJCA 4H54A 4PK4A 5E3AA 3ASOC 5BUOA 5JUAA 4OIPF 5BQGA 2WB7A 1A7EA 2MHRA 2BC5A 5E2QA 3QW0A 2AWYA 1BZ4A 1E85A 1YYJA 3GODA 3TULA 1PV3A 2V26A 4IJJA 2EIMC 4U5BE 2MWQA 4AE4A 4PJMA 4OIQF 3V7OA 2WVOA 1QZXA 1E84A 4CJGA 5JRAA 5E3CA 3NKEA 1VLSA 1LI7A 3GEIA 3DM5A 2OG2A 4O79A 4OIOF 2BE5F 4JTDB 5T3TA 3DM9B 3U2MA 1CGOA 2NUTB 1ZHWA 2CNWA 5L0HA 2KC3A 3V5YA 1VMAA 1VYIA 1SMYF 3ECSA 3KH2A 4K1OA 3U8VA 4A4AA 1MMNA 3G4ZA 1W2WA 4QI0A 2XL8A 3US6A 4F4BA 3ZVRA 2IOQA 2NSGA 3EGXB 3PHF2 2XXAB 3DI5A 1L3PA 3OA1A 5JVEA 4G7HF 4AK9A 3NRHA 5FCLA 4KNVA 2UUIA 3V5ZA 2XRHA 3GWNA 3SYNA 2Y39A 1OCCC 3O39A 3W2WA 2XS1A 3AG2C 3MLGA 4YJWA 2F22A 1B68A 4MVRA 3EPVA 4CS9A 1YVIA 3CZ6A 3QTHA 2J7PA 2YL0A 3ITFA 4BJ6A 4E17A 2L7AA 2Q9CA 3GANA 4YT4A 1ZHZA 2ASRA 4Z9IA 5A6JA 4LACB 1JPNA 4CIPA 2IXNA 3S84A 3FHDA 4BJ5C 2PX3A 5HV9A 1YJGA 2DI3A 4KBLA 1GS9A 2PX0A 1Q0DA 4P9FA 3W8IA 1LVKA 4KC9A 2Y3DA 1CPRA 1RJ9A 2YLIA 3WAQA 2CGEA 2Q4FA 3ABMC 3UMKA 1PCXA 3ATPA 3RQFA 5KYNA 5KYUB 1KTMA 2OJQA 3VAYA 4BPMA 2JD3A 2LCHA 2YHSA 1YA9A 4XPYA 3LEVA 4Q7CA 1MNEA 1RKEA 2XLOA 3RQGA 2R7SA 1HE1A 2YL7A 5E33A 2NUPA 4CX9A 2Q00A 1LIHA 3GEEA 3U2LA 5AC5A 1M2VA 3C8GB 2KNHA 1DOVA 2VCBA 1TFKB 4U5HA 3VF0A 4C3EA 4DVYP 4JEAA 1BBHA 3ZG1A 3I4UA 1U0BB 1YAUO 4PFOA 1MMGA 4IRUA 3TD7A 2KW3C 4C3BA 2CNWD 3SXKA 2YLGA 3ASNC 2OJED 4JVSA 3RVYA 3NYMA 1A41A 4OD5A 4A2NB 2HS5A 4MQ9F 3AG1C 5AC4A 5B3IA 1ZW2A 5A69A 1EQ1A 2YKZA 1RMVA 5B3SC 4MNDA 4XWJA 1RKCA 5COFA 4DXWA 1V4AA 3AQBA 4AL1A 1D0XA 1O3UA 2L81A 3DMDA 4LERA 3SXZA 3K7DA 1ZU4A 3E9VA 4GQHA 4O6MA 4CS8A 3AGUA 2R7QA 4U5EE 3ZTZA 4DRJB 3S0XA 3U0CA 1BR1A 1ZU5A 1U6HA 3N24A 2A69F 3IEEA 2O9XA 2ETSA 2IXMA 1F1MA 4JRZA 2J7PD 2YRFA 3LLKA 3FMSA 1M56C 4MVSA 1CPQA 2E87A 1VB5A 3Q7LA 2YEVA 3M4BA 3QZCA 3VRCA 1K05A 1HY5A 4MTFA 1C17M 4NTAA 4O6NA 4ER9A 2R25A 1QVXA 1NLXA 2YL3A 4ZLDA 3DKAA 1TWCA 3EGXA 1ZHTA 3JYYA 4HFKB 4RD9A 4U5DE 1M57C 2XXAA 1VOMA 4W8KA 1HMDA 2WL8A 3C8ZA 2Z15A 2PBEA 5DQZA 1ORSC 5A6AA 3F47A 5KYWB 1ST6A 5DVWA 3C7JA 4I44A 5K0IA 2LIGA 3B0VC 3CQZA 3S28A 3HTKC 1FTSA 2AP3A 4WGZA 4BG0A 5JS5A 2QLAA 4ZLCA 3QW1A 3DJUB 4N06A 1C03A 1OKKA 5L0GA 1EKYA 3K1HA 2EPOA 2AVKA 4C7OB 1QLEC 4FESA 4Q5SF 1OXKA 4JCZA 3T6JA 2DYRC 1PD1A 2PNOA 3JZ0A 4WGYA 1T6QA 1HMOA 3ZIBA 4YN0B 1LS4A 4BJ5A 2XM0A 2X0CA 1K40A 3BEHA 4P9TA 3RH3A 3ABKC 2AU5A 4E0HA 3LEOA 1R4TA 3AGTA 1WWPA 3H2VA 3LS0A 1LM3B 2R7WA 4BEMJ 3GM1A 4P6IC 3X2QC 2M64A 4EIYA 1M6TA 2FFHA 2R02A 4PACA 5KYUA 3MYIA 2GA0A 1WGWA 4J32B 2CDQA 1Z7Qc 1D0ZA 1MNDA 1NZEA 1IW7F 1MMDA 2XL6A 2XLWA 4U5CE 4YL3A 2P7VA 2QE9A 2XLVA 5TJ5E 3R7CA 5F5HA 2DYSC 1YARO 2OQMA 1J8MF 4MTOA 3U9JA 4CS8C 5JT4A 3UMIA 3CSKA 2PP4A 1UG7A 3EZIA 3T6BA 3E70C 3O55A 1I5NA 1I4YA 3I5PA 3C8GA 4N6HA 2JPUA 3K33A 4AL0A 3PDMP 2G3KA 2OCCC 3B9QA 5IY5C 4LLEA 4IAQA 1D1AA 1OW7A 2EPMX 2LFFA 2YL1A 2YLDA 3K66A 5JSLA 2R9RB 2C03A 2H7BA 4U5GA 1E2XA 3LS1A 2NPUA 2HMQA 1G4US 3LNMB 1Z6AA 4Z9JA 3H65A 3L1MA 3U8PA 1V74B 3KPHA 2Y69C 3SXMA 1QSPA 4K7BA 4MVOA 2IYLD 2VCCA 1FAPB 5EK0A 2Y3BA 2YVKA 4IARA 1XWJA 3PCVA 2D5RB 5FZTA 3RF3A 2ZXWC 1E83A 3EFOB 2EIKC 2H8AA 4E7ZA 1CGME 2R7XA 3ZDLA 1FNTc 1PD0A 5DS4A 3AG4C 4ULWA 1ZW3A 1OKKD 4JJFA 4NC3A 3V5XA 1JAFA 1D1CA 2H7VC 3MX3A 1YZCA 2HJMA 3FOPA 1QKRA 5KYXB 3FVYA 3BRJA 3NYJA 2Y3HA 4DBRA 1G4WR 4RDAA 2Q9BA 2VC9A 4CDYA 4FAPB 1MMAA 3EH1A 4U9EA 4E7SA 4X0RA 2HSQA 2NSFA 3EJNA 3B71A 4IB4A 3SP1A 3EHNA 4I1OB 1A0BA 3C62A 3K6BA 5A6BA 5KYWA 3FDQA 3A11A 1HE9A 2VCAA 4PJLA 4FWVA 1V55C 4C3DA 1G8XA 1M2OA 5L0JA 4PR9A 2R7VA 3IQTA 1VTMP 4JTAB 2G62A 3SNHA 3B29A 4JTCB 3S29A 2P0NA 2I8BA 1EA8A 2R05A 5KYXA 5L3QA 3G50A 5D92A 4C7OA 1RCPA 1OW8A 4DRIB 2VASA 3NMJA 3IQ6A 3JRTA 1JMWA 1JR8A 1LI5A 3O10A 3L8JA 1BDJB 2WZLA 4O6YA 3SEOA 2OU6A 4YL0A 2ZXOA 1S7ZA 5JLIA 2LSEA 2Y3GA 1WATA 4CS7A 3N0TA 5L0CA 1TFOB 1H7IA 2FGYA 2LQGA 4MS2A 1QPUA 4LDKA 4YL1A 4BJTA 4JC7A 1T6IA 4EBJA 1J8YF 1MQVA 4HFFB 3S27A 3WHNA 2YWAA 4EKWA 4G7OF 2LD6A 3KL4A 2ZXRA 3C63A 2WVQA 3MYFA 4N4WA 3OEOA 3ZTMA 1NFOA 5KYYB 3EGDB 4Z9HA 3NYLA 3MFNA 4YT8A 4I1MA 2Q7RA 1TWAA 1Y6DA 4IGGA 3QVZA 3POVA 1JRAA 1VLTA 5F5FA 3M4CA 3KKBA 1C02A 1BR4A 2W4BA 2XLMA 3ABLC 3R2PA 1O87A 3U5SA 3LLIA 4XPWA 1NFNA 4YWQA 4J7TA 3W8HA 3QVYA 3NG1A 3U3FA 1OR2A 1FMVA 2W9YA 2A0BA 3AG3C 4OINF 5DS5A 3AQCA 1Z5ZA 3K1IC 3N2ZB 3B0PA 4B6IA 1H9GA 2L6FA 2PFDA 2R7OA 2J46A 5DLJA 2CCYA 4XQ1A 5A6BD 1ORJA 1EI7A 256BA 2VB6A 3IQCA 4K0DA 1VYKA 5L0DA 2R7TA 3EFOA 3JYHA 3M79A 5BQIA 4EHPA 2IM8A 4H4KC 4N6CA 2A6EF 4MVUA 3C18A 2XLHA 3LJBA 3TQOA 4JE9A 1XZPA 2EPLX 1LE4A 2ZPAA 3HNLA 1KU2A 1WTYA 4JW1A 2LFDA 3NMIA 1O5HA 4GYTA 1K04A 3HNKA 4MW3A 2Q9AA 4WJ0A 4NCQA 4L6RA 4XPXA 2EILC 3T4RA 2HV6A 3RVZA 2Q3TA 4NTFA 5DS6A 5EHHA 1Z63A 3HNJA 4HEAJ 1JPJA 3FXHA 1NU7D 1ORYA 3RKOF 4BJ1A 3LNRA 3U9MA 2A6HF 1TWGA 2EPNA 2R7UA 1SF8A 3WODF 4DOZA 4RBNA 1SYQA 2RSEB 3FAJA 4OIRF 2CW0F 2D4UA 1ZHYA 1AEPA 1WN0A 2XSEA 1OCOC 3NKDA 4MVZA 3UGOA 2HJ3A 1H6GA 1APCA 4KNWA 5BQHA 3DXJF 4CDAA 5L0IA 1T5OA 1TKNA 3S90A 2A68F 3J06A 2XM4A 4R32A 3UGPA 4ANJA 2KSFA 4DVZA 2W4MA 1ZZPA 2HZ8A 3QMKA 4XEVA 3FAPB 4QDLA 4UDVA 2H7OA 4E18A 1YZAA 2HSBA 2FAPB 4YT2A 1A7VA 3DE9A 2XLEA 3DAFA 4MTGA 2L6GA 2B0HA 4CBEA 4KI2A 1SR2A 3TJ5A 4FX5A 3M15A 3GM2A 3MBGA 4HE8D 3KYJA 4J7YA 4NTBA 3SXYA 2MYSA 3I5QA 4JURI 4PJNA 3DE8A 5KYYA 1DOWA 1Q0MA 1V54C 2M4EA 1G5ZA 3EGDA 2YZSA 4DRHB 3IPMO 2EINC 2QUPA 3Q7GA 3LESA 4G78A 2CYDA 4XTKA 3LUTB 2AWCA 2C04A
chains in the Genus database with same CATH topology
1RCPA 4CDVA 3M4BA 3VRCA 3NMJA 3IQ6A 4ER9A 5JP7A 5JLIA 4CJOA 1E86A 2YL3A 5JUAA 4U9DA 2J9BA 1QPUA 4ULVA 2BC5A 3QW0A 1NBBA 1MQVA 1E85A 1YYJA 3HNIA 3C63A 4N4WA 4WGZA 4CJGA 5JRAA 5JS5A 3ZTMA 2QLAA 1E84A 3QW1A 1EKYA 1CGOA 3QVZA 4WGYA 1S05A 2XM0A 3M4CA 2XLMA 2XL8A 3ZQVA 1LM3B 5JVEA 1QQ3A 4JKVA 3QVYA 4EIYA 1M6TA 5B3IA 2XL6A 1CGNA 2XLWA 2XLVA 5JT4A 2CCYA 256BA 3ZQYA 2YL0A 4N6HA 3M79A 4CIPA 4IAQA 2XLHA 2YLDA 2YL1A 5JSLA 4JE9A 1CPRA 2YLIA 3HNLA 3NMIA 3HNKA 4L6RA 3L1MA 3U8PA 3HNJA 2XLOA 4D4XA 2YL7A 4CX9A 4JEBA 4IARA 1E83A 1GQAA 4JEAA 1BBHA 2J8WA 5AGFA 4NC3A 3FOOA 1JAFA 1APCA 1YZCA 3FOPA 2YLGA 4CDAA 2XM4A 1YYXA 4CDYA 3TOLA 2YKZA 3NMKA 1YZAA 1A7VA 3DE9A 2XLEA 4U9EA 4IB4A 3TOMA 3C62A 3ZTZA 2XLDA 3M15A 3IQ5A 3ZWIA 3DE8A 4D4NA 1CPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RCP A;  4CDV A;  3M4B A;  3VRC A;  3NMJ A;  3IQ6 A;  4ER9 A;  5JP7 A;  5JLI A;  4CJO A;  1E86 A;  2YL3 A;  5JUA A;  4U9D A;  2J9B A;  1QPU A;  4ULV A;  2BC5 A;  3QW0 A;  1NBB A;  1MQV A;  1E85 A;  1YYJ A;  3HNI A;  3C63 A;  4N4W A;  4WGZ A;  4CJG A;  5JRA A;  5JS5 A;  3ZTM A;  2QLA A;  1E84 A;  3QW1 A;  1EKY A;  1CGO A;  3QVZ A;  4WGY A;  1S05 A;  2XM0 A;  3M4C A;  2XLM A;  2XL8 A;  3ZQV A;  1LM3 B;  5JVE A;  1QQ3 A;  4JKV A;  3QVY A;  4EIY A;  1M6T A;  5B3I A;  2XL6 A;  1CGN A;  2XLW A;  2XLV A;  5JT4 A;  2CCY A;  256B A;  3ZQY A;  2YL0 A;  4N6H A;  3M79 A;  4CIP A;  4IAQ A;  2XLH A;  2YLD A;  2YL1 A;  5JSL A;  4JE9 A;  1CPR A;  2YLI A;  3HNL A;  3NMI A;  3HNK A;  4L6R A;  3L1M A;  3U8P A;  3HNJ A;  2XLO A;  4D4X A;  2YL7 A;  4CX9 A;  4JEB A;  4IAR A;  1E83 A;  1GQA A;  4JEA A;  1BBH A;  2J8W A;  5AGF A;  4NC3 A;  3FOO A;  1JAF A;  1APC A;  1YZC A;  3FOP A;  2YLG A;  4CDA A;  2XM4 A;  1YYX A;  4CDY A;  3TOL A;  2YKZ A;  3NMK A;  1YZA A;  1A7V A;  3DE9 A;  2XLE A;  4U9E A;  4IB4 A;  3TOM A;  3C62 A;  3ZTZ A;  2XLD A;  3M15 A;  3IQ5 A;  3ZWI A;  3DE8 A;  4D4N A;  1CPQ A; 
#chains in the Genus database with same CATH topology
 1L7C A;  2J45 A;  3U3B A;  2G3V A;  4LDQ A;  1Y4C A;  3HLZ A;  4YK5 A;  3ZC4 A;  2B0J A;  1T6U A;  1YLM A;  1ZHX A;  2JX0 A;  4OD4 A;  2R03 A;  5JP7 A;  4IWB A;  5DQT A;  4CJO A;  3WG7 C;  2V3C C;  4MVQ A;  2QTV A;  1OR3 A;  3EH2 A;  3L0I A;  3SZR A;  1AUE A;  4U9D A;  1WAS A;  2J9W A;  1IZM A;  2J9B A;  3GM3 A;  4ULV A;  4NQF A;  3RIP A;  1NBB A;  2UUH A;  5EGY A;  3K1I A;  2PF4 E;  4EWC A;  5COM A;  2LP4 A;  2J0X A;  2X51 A;  2GDC A;  3HKK A;  3HNI A;  4O7G A;  2A1D D;  1XZQ A;  3DD7 A;  1Z3I X;  1TWH A;  3GOR A;  1GGQ A;  3EG9 B;  1OQC A;  1TR2 A;  2KQ9 A;  4G0H A;  4PFP A;  3JTL O;  3TJ6 A;  1YDI A;  2LK4 A;  2P6V A;  1YA7 O;  4MVM A;  3C8G D;  3DAG A;  4G7Z F;  5L3V A;  5COG A;  1AVO B;  1S05 A;  5GPG B;  3AJM A;  1Q0G A;  3AOU A;  3UR3 C;  2YQY A;  3ZQV A;  4MW8 A;  1R5I D;  5CI8 A;  1QQ3 A;  4JKV A;  3GEH A;  2L9J A;  2HMZ A;  3KYI A;  4EBK A;  4CSA A;  1A7D A;  1D0Y A;  4YT5 A;  3L34 A;  4CIH A;  1CGN A;  1FMW A;  2DGJ A;  4IAO A;  1OCZ C;  4AE4 B;  4LDR A;  2QNL A;  2GAQ A;  2I15 A;  1ZYR F;  4M63 A;  2XS8 A;  1U89 A;  4BEJ A;  4JJG A;  2EPK X;  3T9O A;  3ZQY A;  4JIO A;  1D1B A;  3H2U A;  4JCH A;  4PJJ A;  3RFY A;  1BR2 A;  1TQG A;  2WVN A;  3RQE A;  2VH3 A;  3B0U X;  3IHU A;  3GWL A;  5CI9 A;  1ZVZ A;  2OEX A;  3T6G B;  2J9V A;  3RW0 A;  4JZA A;  2WZG A;  3G4X A;  1FFH A;  1SZI A;  4XLP F;  1LE2 A;  1OXB A;  2KYH A;  1HW2 A;  5L0F A;  1RXQ A;  2BL2 A;  2OOC A;  3EZH A;  1Z23 A;  2QY9 A;  1UFB A;  3L8I A;  2HUJ A;  3NDB B;  4DBQ A;  2TMV P;  1GM5 A;  4D4X A;  4DJ9 A;  4EUK B;  4AX2 A;  3EHM A;  3CAX A;  3JSZ A;  4NY3 A;  3VM6 A;  5HSW A;  1OCR C;  2IBF A;  1KNY A;  2IXP A;  3DWW A;  2R7R A;  4JEB A;  1T01 A;  2XL4 A;  4CS9 C;  5A6K A;  2HV7 A;  2HKV A;  4BJ6 C;  1HW1 A;  2WZF A;  5F28 E;  3DZA A;  1JOG A;  1GQA A;  4I3M A;  3JRM O;  2W45 A;  2J8W A;  2KK1 A;  2L6H A;  3JCU Q;  5AGF A;  3W2V A;  5CIV A;  3FOO A;  2NUT A;  3DJN B;  2ICW G;  4W8P A;  1RJ9 B;  3M1C B;  4QI2 A;  4LLC A;  1H9T A;  1T9K A;  2HFI A;  2GFH A;  3EQL F;  3JSE O;  4EBB A;  3CEX A;  3VYW A;  1LS1 A;  1YYX A;  2KJG A;  3TK0 A;  3UMH A;  2J0W A;  4XEK A;  5B1B C;  3TOL A;  2KGO A;  3OWT A;  3NMK A;  1RKE B;  1LPE A;  1WOL A;  2OEV A;  2RD9 A;  3Q6M A;  4GEH A;  4CSA C;  3UNG C;  2NG1 A;  2NUP B;  3TOM A;  3ZSU A;  3X1O A;  2IXO A;  5D91 A;  2P61 A;  1M2V B;  2XLD A;  2EIJ C;  1NG1 A;  2P1A A;  1N1C A;  4J30 B;  1VK5 A;  3A9C A;  3IQ5 A;  3ZWI A;  4XLN F;  4E0I A;  1NSG B;  3PMR A;  4Q4Z F;  3F46 A;  1FR0 A;  3S9O A;  2GWW A;  4XEF A;  2ZXP A;  3JT1 A;  3RYL A;  3EG9 A;  5T3W A;  3LAY A;  1OW6 A;  4D4N A;  3Q6N A;  1NU9 C;  2A0U A;  4ONS A;  4CDV A;  1Q0F A;  4U5F E;  5B1A C;  2J9U A;  1I4Z A;  1FFT C;  5T1D B;  3W4Y A;  3KMI A;  3O6X A;  4WAB A;  1E86 A;  1LKX A;  2DB4 A;  2OKU A;  1Q0K A;  2ZD9 A;  3HJC A;  4H54 A;  4PK4 A;  5E3A A;  3ASO C;  5BUO A;  5JUA A;  4OIP F;  5BQG A;  2WB7 A;  1A7E A;  2MHR A;  2BC5 A;  5E2Q A;  3QW0 A;  2AWY A;  1BZ4 A;  1E85 A;  1YYJ A;  3GOD A;  3TUL A;  1PV3 A;  2V26 A;  4IJJ A;  2EIM C;  4U5B E;  2MWQ A;  4AE4 A;  4PJM A;  4OIQ F;  3V7O A;  2WVO A;  1QZX A;  1E84 A;  4CJG A;  5JRA A;  5E3C A;  3NKE A;  1VLS A;  1LI7 A;  3GEI A;  3DM5 A;  2OG2 A;  4O79 A;  4OIO F;  2BE5 F;  4JTD B;  5T3T A;  3DM9 B;  3U2M A;  1CGO A;  2NUT B;  1ZHW A;  2CNW A;  5L0H A;  2KC3 A;  3V5Y A;  1VMA A;  1VYI A;  1SMY F;  3ECS A;  3KH2 A;  4K1O A;  3U8V A;  4A4A A;  1MMN A;  3G4Z A;  1W2W A;  4QI0 A;  2XL8 A;  3US6 A;  4F4B A;  3ZVR A;  2IOQ A;  2NSG A;  3EGX B;  3PHF 2;  2XXA B;  3DI5 A;  1L3P A;  3OA1 A;  5JVE A;  4G7H F;  4AK9 A;  3NRH A;  5FCL A;  4KNV A;  2UUI A;  3V5Z A;  2XRH A;  3GWN A;  3SYN A;  2Y39 A;  1OCC C;  3O39 A;  3W2W A;  2XS1 A;  3AG2 C;  3MLG A;  4YJW A;  2F22 A;  1B68 A;  4MVR A;  3EPV A;  4CS9 A;  1YVI A;  3CZ6 A;  3QTH A;  2J7P A;  2YL0 A;  3ITF A;  4BJ6 A;  4E17 A;  2L7A A;  2Q9C A;  3GAN A;  4YT4 A;  1ZHZ A;  2ASR A;  4Z9I A;  5A6J A;  4LAC B;  1JPN A;  4CIP A;  2IXN A;  3S84 A;  3FHD A;  4BJ5 C;  2PX3 A;  5HV9 A;  1YJG A;  2DI3 A;  4KBL A;  1GS9 A;  2PX0 A;  1Q0D A;  4P9F A;  3W8I A;  1LVK A;  4KC9 A;  2Y3D A;  1CPR A;  1RJ9 A;  2YLI A;  3WAQ A;  2CGE A;  2Q4F A;  3ABM C;  3UMK A;  1PCX A;  3ATP A;  3RQF A;  5KYN A;  5KYU B;  1KTM A;  2OJQ A;  3VAY A;  4BPM A;  2JD3 A;  2LCH A;  2YHS A;  1YA9 A;  4XPY A;  3LEV A;  4Q7C A;  1MNE A;  1RKE A;  2XLO A;  3RQG A;  2R7S A;  1HE1 A;  2YL7 A;  5E33 A;  2NUP A;  4CX9 A;  2Q00 A;  1LIH A;  3GEE A;  3U2L A;  5AC5 A;  1M2V A;  3C8G B;  2KNH A;  1DOV A;  2VCB A;  1TFK B;  4U5H A;  3VF0 A;  4C3E A;  4DVY P;  4JEA A;  1BBH A;  3ZG1 A;  3I4U A;  1U0B B;  1YAU O;  4PFO A;  1MMG A;  4IRU A;  3TD7 A;  2KW3 C;  4C3B A;  2CNW D;  3SXK A;  2YLG A;  3ASN C;  2OJE D;  4JVS A;  3RVY A;  3NYM A;  1A41 A;  4OD5 A;  4A2N B;  2HS5 A;  4MQ9 F;  3AG1 C;  5AC4 A;  5B3I A;  1ZW2 A;  5A69 A;  1EQ1 A;  2YKZ A;  1RMV A;  5B3S C;  4MND A;  4XWJ A;  1RKC A;  5COF A;  4DXW A;  1V4A A;  3AQB A;  4AL1 A;  1D0X A;  1O3U A;  2L81 A;  3DMD A;  4LER A;  3SXZ A;  3K7D A;  1ZU4 A;  3E9V A;  4GQH A;  4O6M A;  4CS8 A;  3AGU A;  2R7Q A;  4U5E E;  3ZTZ A;  4DRJ B;  3S0X A;  3U0C A;  1BR1 A;  1ZU5 A;  1U6H A;  3N24 A;  2A69 F;  3IEE A;  2O9X A;  2ETS A;  2IXM A;  1F1M A;  4JRZ A;  2J7P D;  2YRF A;  3LLK A;  3FMS A;  1M56 C;  4MVS A;  1CPQ A;  2E87 A;  1VB5 A;  3Q7L A;  2YEV A;  3M4B A;  3QZC A;  3VRC A;  1K05 A;  1HY5 A;  4MTF A;  1C17 M;  4NTA A;  4O6N A;  4ER9 A;  2R25 A;  1QVX A;  1NLX A;  2YL3 A;  4ZLD A;  3DKA A;  1TWC A;  3EGX A;  1ZHT A;  3JYY A;  4HFK B;  4RD9 A;  4U5D E;  1M57 C;  2XXA A;  1VOM A;  4W8K A;  1HMD A;  2WL8 A;  3C8Z A;  2Z15 A;  2PBE A;  5DQZ A;  1ORS C;  5A6A A;  3F47 A;  5KYW B;  1ST6 A;  5DVW A;  3C7J A;  4I44 A;  5K0I A;  2LIG A;  3B0V C;  3CQZ A;  3S28 A;  3HTK C;  1FTS A;  2AP3 A;  4WGZ A;  4BG0 A;  5JS5 A;  2QLA A;  4ZLC A;  3QW1 A;  3DJU B;  4N06 A;  1C03 A;  1OKK A;  5L0G A;  1EKY A;  3K1H A;  2EPO A;  2AVK A;  4C7O B;  1QLE C;  4FES A;  4Q5S F;  1OXK A;  4JCZ A;  3T6J A;  2DYR C;  1PD1 A;  2PNO A;  3JZ0 A;  4WGY A;  1T6Q A;  1HMO A;  3ZIB A;  4YN0 B;  1LS4 A;  4BJ5 A;  2XM0 A;  2X0C A;  1K40 A;  3BEH A;  4P9T A;  3RH3 A;  3ABK C;  2AU5 A;  4E0H A;  3LEO A;  1R4T A;  3AGT A;  1WWP A;  3H2V A;  3LS0 A;  1LM3 B;  2R7W A;  4BEM J;  3GM1 A;  4P6I C;  3X2Q C;  2M64 A;  4EIY A;  1M6T A;  2FFH A;  2R02 A;  4PAC A;  5KYU A;  3MYI A;  2GA0 A;  1WGW A;  4J32 B;  2CDQ A;  1Z7Q c;  1D0Z A;  1MND A;  1NZE A;  1IW7 F;  1MMD A;  2XL6 A;  2XLW A;  4U5C E;  4YL3 A;  2P7V A;  2QE9 A;  2XLV A;  5TJ5 E;  3R7C A;  5F5H A;  2DYS C;  1YAR O;  2OQM A;  1J8M F;  4MTO A;  3U9J A;  4CS8 C;  5JT4 A;  3UMI A;  3CSK A;  2PP4 A;  1UG7 A;  3EZI A;  3T6B A;  3E70 C;  3O55 A;  1I5N A;  1I4Y A;  3I5P A;  3C8G A;  4N6H A;  2JPU A;  3K33 A;  4AL0 A;  3PDM P;  2G3K A;  2OCC C;  3B9Q A;  5IY5 C;  4LLE A;  4IAQ A;  1D1A A;  1OW7 A;  2EPM X;  2LFF A;  2YL1 A;  2YLD A;  3K66 A;  5JSL A;  2R9R B;  2C03 A;  2H7B A;  4U5G A;  1E2X A;  3LS1 A;  2NPU A;  2HMQ A;  1G4U S;  3LNM B;  1Z6A A;  4Z9J A;  3H65 A;  3L1M A;  3U8P A;  1V74 B;  3KPH A;  2Y69 C;  3SXM A;  1QSP A;  4K7B A;  4MVO A;  2IYL D;  2VCC A;  1FAP B;  5EK0 A;  2Y3B A;  2YVK A;  4IAR A;  1XWJ A;  3PCV A;  2D5R B;  5FZT A;  3RF3 A;  2ZXW C;  1E83 A;  3EFO B;  2EIK C;  2H8A A;  4E7Z A;  1CGM E;  2R7X A;  3ZDL A;  1FNT c;  1PD0 A;  5DS4 A;  3AG4 C;  4ULW A;  1ZW3 A;  1OKK D;  4JJF A;  4NC3 A;  3V5X A;  1JAF A;  1D1C A;  2H7V C;  3MX3 A;  1YZC A;  2HJM A;  3FOP A;  1QKR A;  5KYX B;  3FVY A;  3BRJ A;  3NYJ A;  2Y3H A;  4DBR A;  1G4W R;  4RDA A;  2Q9B A;  2VC9 A;  4CDY A;  4FAP B;  1MMA A;  3EH1 A;  4U9E A;  4E7S A;  4X0R A;  2HSQ A;  2NSF A;  3EJN A;  3B71 A;  4IB4 A;  3SP1 A;  3EHN A;  4I1O B;  1A0B A;  3C62 A;  3K6B A;  5A6B A;  5KYW A;  3FDQ A;  3A11 A;  1HE9 A;  2VCA A;  4PJL A;  4FWV A;  1V55 C;  4C3D A;  1G8X A;  1M2O A;  5L0J A;  4PR9 A;  2R7V A;  3IQT A;  1VTM P;  4JTA B;  2G62 A;  3SNH A;  3B29 A;  4JTC B;  3S29 A;  2P0N A;  2I8B A;  1EA8 A;  2R05 A;  5KYX A;  5L3Q A;  3G50 A;  5D92 A;  4C7O A;  1RCP A;  1OW8 A;  4DRI B;  2VAS A;  3NMJ A;  3IQ6 A;  3JRT A;  1JMW A;  1JR8 A;  1LI5 A;  3O10 A;  3L8J A;  1BDJ B;  2WZL A;  4O6Y A;  3SEO A;  2OU6 A;  4YL0 A;  2ZXO A;  1S7Z A;  5JLI A;  2LSE A;  2Y3G A;  1WAT A;  4CS7 A;  3N0T A;  5L0C A;  1TFO B;  1H7I A;  2FGY A;  2LQG A;  4MS2 A;  1QPU A;  4LDK A;  4YL1 A;  4BJT A;  4JC7 A;  1T6I A;  4EBJ A;  1J8Y F;  1MQV A;  4HFF B;  3S27 A;  3WHN A;  2YWA A;  4EKW A;  4G7O F;  2LD6 A;  3KL4 A;  2ZXR A;  3C63 A;  2WVQ A;  3MYF A;  4N4W A;  3OEO A;  3ZTM A;  1NFO A;  5KYY B;  3EGD B;  4Z9H A;  3NYL A;  3MFN A;  4YT8 A;  4I1M A;  2Q7R A;  1TWA A;  1Y6D A;  4IGG A;  3QVZ A;  3POV A;  1JRA A;  1VLT A;  5F5F A;  3M4C A;  3KKB A;  1C02 A;  1BR4 A;  2W4B A;  2XLM A;  3ABL C;  3R2P A;  1O87 A;  3U5S A;  3LLI A;  4XPW A;  1NFN A;  4YWQ A;  4J7T A;  3W8H A;  3QVY A;  3NG1 A;  3U3F A;  1OR2 A;  1FMV A;  2W9Y A;  2A0B A;  3AG3 C;  4OIN F;  5DS5 A;  3AQC A;  1Z5Z A;  3K1I C;  3N2Z B;  3B0P A;  4B6I A;  1H9G A;  2L6F A;  2PFD A;  2R7O A;  2J46 A;  5DLJ A;  2CCY A;  4XQ1 A;  5A6B D;  1ORJ A;  1EI7 A;  256B A;  2VB6 A;  3IQC A;  4K0D A;  1VYK A;  5L0D A;  2R7T A;  3EFO A;  3JYH A;  3M79 A;  5BQI A;  4EHP A;  2IM8 A;  4H4K C;  4N6C A;  2A6E F;  4MVU A;  3C18 A;  2XLH A;  3LJB A;  3TQO A;  4JE9 A;  1XZP A;  2EPL X;  1LE4 A;  2ZPA A;  3HNL A;  1KU2 A;  1WTY A;  4JW1 A;  2LFD A;  3NMI A;  1O5H A;  4GYT A;  1K04 A;  3HNK A;  4MW3 A;  2Q9A A;  4WJ0 A;  4NCQ A;  4L6R A;  4XPX A;  2EIL C;  3T4R A;  2HV6 A;  3RVZ A;  2Q3T A;  4NTF A;  5DS6 A;  5EHH A;  1Z63 A;  3HNJ A;  4HEA J;  1JPJ A;  3FXH A;  1NU7 D;  1ORY A;  3RKO F;  4BJ1 A;  3LNR A;  3U9M A;  2A6H F;  1TWG A;  2EPN A;  2R7U A;  1SF8 A;  3WOD F;  4DOZ A;  4RBN A;  1SYQ A;  2RSE B;  3FAJ A;  4OIR F;  2CW0 F;  2D4U A;  1ZHY A;  1AEP A;  1WN0 A;  2XSE A;  1OCO C;  3NKD A;  4MVZ A;  3UGO A;  2HJ3 A;  1H6G A;  1APC A;  4KNW A;  5BQH A;  3DXJ F;  4CDA A;  5L0I A;  1T5O A;  1TKN A;  3S90 A;  2A68 F;  3J06 A;  2XM4 A;  4R32 A;  3UGP A;  4ANJ A;  2KSF A;  4DVZ A;  2W4M A;  1ZZP A;  2HZ8 A;  3QMK A;  4XEV A;  3FAP B;  4QDL A;  4UDV A;  2H7O A;  4E18 A;  1YZA A;  2HSB A;  2FAP B;  4YT2 A;  1A7V A;  3DE9 A;  2XLE A;  3DAF A;  4MTG A;  2L6G A;  2B0H A;  4CBE A;  4KI2 A;  1SR2 A;  3TJ5 A;  4FX5 A;  3M15 A;  3GM2 A;  3MBG A;  4HE8 D;  3KYJ A;  4J7Y A;  4NTB A;  3SXY A;  2MYS A;  3I5Q A;  4JUR I;  4PJN A;  3DE8 A;  5KYY A;  1DOW A;  1Q0M A;  1V54 C;  2M4E A;  1G5Z A;  3EGD A;  2YZS A;  4DRH B;  3IPM O;  2EIN C;  2QUP A;  3Q7G A;  3LES A;  4G78 A;  2CYD A;  4XTK A;  3LUT B;  2AWC A;  2C04 A; 
#chains in the Genus database with same CATH homology
 1RCP A;  4CDV A;  3M4B A;  3VRC A;  3NMJ A;  3IQ6 A;  4ER9 A;  5JP7 A;  5JLI A;  4CJO A;  1E86 A;  2YL3 A;  5JUA A;  4U9D A;  2J9B A;  1QPU A;  4ULV A;  2BC5 A;  3QW0 A;  1NBB A;  1MQV A;  1E85 A;  1YYJ A;  3HNI A;  3C63 A;  4N4W A;  4WGZ A;  4CJG A;  5JRA A;  5JS5 A;  3ZTM A;  2QLA A;  1E84 A;  3QW1 A;  1EKY A;  1CGO A;  3QVZ A;  4WGY A;  1S05 A;  2XM0 A;  3M4C A;  2XLM A;  2XL8 A;  3ZQV A;  1LM3 B;  5JVE A;  1QQ3 A;  4JKV A;  3QVY A;  4EIY A;  1M6T A;  5B3I A;  2XL6 A;  1CGN A;  2XLW A;  2XLV A;  5JT4 A;  2CCY A;  256B A;  3ZQY A;  2YL0 A;  4N6H A;  3M79 A;  4CIP A;  4IAQ A;  2XLH A;  2YLD A;  2YL1 A;  5JSL A;  4JE9 A;  1CPR A;  2YLI A;  3HNL A;  3NMI A;  3HNK A;  4L6R A;  3L1M A;  3U8P A;  3HNJ A;  2XLO A;  4D4X A;  2YL7 A;  4CX9 A;  4JEB A;  4IAR A;  1E83 A;  1GQA A;  4JEA A;  1BBH A;  2J8W A;  5AGF A;  4NC3 A;  3FOO A;  1JAF A;  1APC A;  1YZC A;  3FOP A;  2YLG A;  4CDA A;  2XM4 A;  1YYX A;  4CDY A;  3TOL A;  2YKZ A;  3NMK A;  1YZA A;  1A7V A;  3DE9 A;  2XLE A;  4U9E A;  4IB4 A;  3TOM A;  3C62 A;  3ZTZ A;  2XLD A;  3M15 A;  3IQ5 A;  3ZWI A;  3DE8 A;  4D4N A;  1CPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...