3NMJA

Crystal structure of a nickel mediated dimer for the phenanthroline-modified cytochrome cb562 variant, mbp-phen2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFAILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porous protein frameworks with unsaturated metal centers in sterically encumbered coordination sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
total genus 45
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3nmjA00
1NBBA 2QLAA 1YZCA 5B3IA 4ER9A 2XLWA 3IQ5A 256BA 1E85A 4CJOA 1LM3B 5JUAA 1CGNA 3ZWIA 1YZAA 2XLOA 3FOPA 2YLGA 3M79A 4N6HA 1A7VA 3ZTZA 4ULVA 1YYXA 3M4CA 5JS5A 3QVZA 5JVEA 1APCA 4JE9A 4U9DA 4JKVA 4WGYA 1JAFA 4WGZA 1QQ3A 2CCYA 3C62A 3NMKA 4CX9A 2YL7A 3NMJA 2BC5A 3TOMA 2YLDA 4JEBA 1BBHA 2XLMA 4NC3A 4CDAA 2YLIA 3L1MA 1E84A 3QW1A 1M6TA 5JP7A 5AGFA 5JSLA 4L6RA 3C63A 4CDVA 4IB4A 2XM0A 3DE9A 3DE8A 1GQAA 4CIPA 4EIYA 2XLEA 1MQVA 3HNIA 2J8WA 4N4WA 5JRAA 1QPUA 2YKZA 2YL1A 2YL0A 1CPRA 5JT4A 2XM4A 1EKYA 3M4BA 4IARA 3IQ6A 1CGOA 3ZQVA 3QVYA 5JLIA 3FOOA 4IAQA 3HNKA 3M15A 1S05A 4JEAA 4D4NA 4CDYA 4U9EA 1E86A 1E83A 2XLDA 3QW0A 4CJGA 4D4XA 2XLVA 2YL3A 3ZQYA 3HNJA 1CPQA 2XL8A 3U8PA 2J9BA 1YYJA 3VRCA 3ZTMA 3TOLA 2XLHA 3HNLA 1RCPA 3NMIA 2XL6A
chains in the Genus database with same CATH superfamily
2HV7A 2OEVA 3N24A 1K05A 2EPKX 2Q3TA 2HSQA 2LQGA 3DJNB 1G4WR 4WABA 4EUKB 3ABLC 1V55C 3FAJA 3EPVA 2IBFA 3VYWA 4JURI 1LM3B 3US6A 1HW2A 1BR2A 1CGNA 3NYMA 5KYUB 4YL3A 3ZWIA 1RJ9B 1Q0GA 2R05A 1A41A 2YEVA 3DXJF 3EGDA 3MYIA 3RYLA 5E3CA 2XXAB 2OOCA 3FAPB 1ZZPA 3M79A 2NUTA 4NTFA 1ORYA 1L3PA 3H65A 4OIRF 3R2PA 3W8IA 1M2VB 1YYXA 2KSFA 2WVQA 4AX2A 4YJWA 2WZGA 4U5FE 2MHRA 5IY5C 4F4BA 3QVZA 2YWAA 4N6CA 1OR3A 1AEPA 2W9YA 1ZHWA 2HSBA 3K33A 3V7OA 3GM1A 1B68A 4MTOA 4JE9A 5DQZA 3EGXA 3LUTB 4XLNF 4DRIB 2VASA 1JAFA 4WGZA 1D1CA 2CCYA 5D91A 3KMIA 2YL7A 3OWTA 1HE1A 4MVMA 4YK5A 4Q4ZF 2MYSA 1F1MA 3AQBA 5KYWB 3TJ5A 1C02A 1NSGB 2L7AA 4NC3A 4O7GA 2I15A 2R7TA 4W8PA 1O3UA 1FMWA 2HUJA 4XLPF 1TKNA 2PBEA 2ETSA 1IZMA 1YARO 5JP7A 5JSLA 2JX0A 1ZU4A 4E17A 2R7VA 2R03A 2ZXWC 5DVWA 1WOLA 4CDVA 1YAUO 1QVXA 2KYHA 3V5XA 5DQTA 4CS8C 2XRHA 4ZLCA 4CSAC 3RKOF 3KYJA 1OR2A 3K1IA 2DGJA 1OKKD 3T6GB 5E3AA 4G7OF 3SNHA 5F5FA 1MQVA 1BZ4A 1YA9A 2HV6A 2J8WA 1PD0A 3H2VA 4N4WA 4AE4A 5BUOA 5A6BA 1QKRA 2H7BA 3C7JA 4H4KC 2XXAA 3GORA 3U9JA 1Q0DA 1TFKB 2YL1A 2YL0A 3LLKA 2NUTB 1RXQA 2W4MA 1QLEC 3L8IA 4K7BA 4KNVA 1Y4CA 1SMYF 2EIKC 2J0XA 3EH1A 4G7HF 2LSEA 3M4BA 4LLCA 2M64A 1Q0FA 1RMVA 5L0CA 3IQ6A 2C04A 2GAQA 3MBGA 4MVOA 1XZPA 1J8YF 2GWWA 4OD4A 3ITFA 5L0DA 4DOZA 3ZQVA 1JPJA 2PFDA 5JLIA 2AWYA 2NSFA 1FFHA 1OKKA 3U0CA 4JRZA 3TULA 2OCCC 3CQZA 3M15A 1MNEA 3N0TA 1TWCA 1VYKA 4H54A 3EG9B 4BPMA 3ASNC 5A69A 3ZG1A 2DYRC 4JEAA 4OIPF 2H7VC 3ZSUA 4CDYA 4D4NA 3JRMO 2LFDA 4BEMJ 2J9WA 3S0XA 1E86A 2LP4A 3AG2C 2G3VA 3CAXA 1YJGA 1BDJB 3C8ZA 2WB7A 1OXBA 3C18A 1S7ZA 1G4US 2OJQA 3U5SA 2FFHA 5HSWA 2WZLA 4ANJA 1GGQA 5HV9A 2YL3A 4J7YA 4EBKA 3S84A 4BJ6C 5L0FA 3WODF 3FDQA 3ZQYA 2I8BA 5T3TA 4CS9A 3UGOA 3G4XA 4J32B 2J9BA 3VAYA 1MNDA 3VRCA 2MWQA 2VCAA 2ZXOA 5L0IA 3GWNA 2X51A 2B0JA 3BEHA 3FXHA 3SZRA 3UMKA 2GA0A 4OINF 3SXMA 1WN0A 3SP1A 1ZHXA 2EPOA 4E18A 3X2QC 1WASA 2E87A 2J7PD 2ICWG 2WZFA 2XSEA 3GM3A 3HNLA 1NU7D 2VCBA 2Y39A 3RQGA 3POVA 3S9OA 3EHMA 3GWLA 1OW8A 1SF8A 3NKDA 5B3IA 3JYYA 1TWGA 1MMAA 2XLWA 2DI3A 4JTCB 256BA 2KJGA 4MQ9F 4ER9A 4CJOA 2A1DD 4EKWA 3RIPA 1OCRC 5A6KA 3U3FA 3TQOA 3GEHA 2DYSC 3A9CA 1U6HA 3RH3A 2PX0A 5BQIA 3EFOA 3EQLF 3DZAA 4MW3A 1ZW3A 5BQGA 2Q9BA 1VMAA 1A7VA 1ZYRF 3IHUA 5KYUA 5JS5A 5CIVA 2CDQA 2RD9A 1OW6A 1SZIA 5K0IA 1T5OA 1EQ1A 3DWWA 1E2XA 1JPNA 2EIMC 2IXMA 1K40A 3AG1C 2CYDA 1D0XA 3DJUB 1LPEA 2P61A 4MVUA 4WGYA 2A6EF 4XEVA 4E0IA 1LE4A 1ZVZA 3E70C 3AG4C 1JR8A 5KYNA 2EPMX 2QTVA 3C62A 3LS0A 4RBNA 3ABMC 4GYTA 1I5NA 2L6GA 4U5GA 1T01A 2R7QA 4PJMA 3K66A 2YRFA 1W2WA 2KW3C 3W8HA 2IYLD 2R7XA 2NUPB 5A6BD 3L1MA 4K0DA 1Z7Qc 4BJ5A 5KYYB 2VC9A 3HTKC 3RF3A 1G5ZA 4DBQA 3E9VA 3ABKC 1LS4A 2NPUA 3KPHA 3MYFA 4CS8A 1HY5A 2YHSA 3C63A 4G7ZF 4C7OB 4YT2A 4JC7A 3DE9A 3OA1A 4LDRA 4ONSA 3DM9B 1BR1A 3B71A 2R7UA 3I5QA 3DD7A 2LCHA 4EHPA 3HJCA 4R32A 2R9RB 4U5DE 5DS6A 4CIPA 2Y3BA 3DI5A 2XLEA 4EIYA 1KNYA 2Q4FA 4O6YA 4JW1A 3QMKA 1QSPA 3UGPA 1VTMP 1Z23A 3JSZA 2HS5A 3C8GB 1Q0MA 3MFNA 3O10A 3DMDA 4FWVA 1V4AA 4Z9HA 3H2UA 4IARA 1CGOA 5B1AC 4WJ0A 2X0CA 2G3KA 1YDIA 2ZXPA 3C8GA 2L6FA 1MMNA 2LIGA 5KYWA 3FOOA 4IAQA 1VYIA 1LKXA 4LDQA 4Q7CA 4B6IA 2YQYA 3GEEA 3K6BA 4MTFA 2VB6A 1O87A 3EGDB 3JZ0A 2KGOA 4BJ5C 5EHHA 2J7PA 2D4UA 4OD5A 1S05A 2PP4A 1FMVA 3U8PA 1EA8A 4U9EA 4OIQF 3G50A 1OXKA 2R25A 4DRHB 3GANA 3NYLA 3T4RA 4YWQA 4PJNA 2B0HA 3F46A 1VLSA 1E83A 3QW0A 4D4XA 3EG9A 1R4TA 1UG7A 1XWJA 2OKUA 2IM8A 5L0HA 3C8GD 4MW8A 2EPNA 4U5HA 1T6UA 2WVNA 5CI8A 1LI7A 2WL8A 3BRJA 2P7VA 2GDCA 2BE5F 1K04A 3DM5A 3HLZA 3IPMO 1NU9C 1D0ZA 3ASOC 3TOLA 4CSAA 1JRAA 3LNRA 3SXKA 2HMQA 5COGA 3CZ6A 3SXYA 3NYJA 4MVSA 1YZAA 1TWAA 1RCPA 4N06A 3TJ6A 2Y3DA 1NBBA 2QLAA 2H7OA 4J7TA 3LEOA 4KNWA 2ZXRA 3NG1A 5TJ5E 3RW0A 3IQ5A 4LACB 3PHF2 3L0IA 1T6IA 1NLXA 4C3EA 2AP3A 2J9UA 5T3WA 2W4BA 4IWBA 3X1OA 2PX3A 3A11A 5JUAA 3RVYA 3RQEA 4MVZA 3R7CA 4XWJA 1D0YA 4MVQA 4AL0A 2CNWA 3EFOB 5F28E 2XLOA 1SYQA 2UUIA 3FOPA 3G4ZA 4PJJA 1HMOA 4CS7A 4LLEA 4I1MA 4JTDB 4N6HA 3ZTZA 2R7SA 4ULVA 3LEVA 1R5ID 3M4CA 3B9QA 4HFKB 1HE9A 4MS2A 5L0GA 2OG2A 2NG1A 3DKAA 2QNLA 3TK0A 4EWCA 4JJGA 2R02A 5EGYA 1FNTc 4MNDA 3V5YA 1ZW2A 2AWCA 3WAQA 5JVEA 5L3QA 4ZLDA 4P9TA 3EH2A 3Q7LA 2Z15A 4BJ1A 4DVZA 4QI2A 4JVSA 3HKKA 4A2NB 2JD3A 3V5ZA 2XS1A 1XZQA 4FAPB 3IQCA 2CW0F 3NMJA 1Z6AA 4PFPA 4XQ1A 3AGUA 3KL4A 4G0HA 1U0BB 3UMIA 1QZXA 1Y6DA 1ZU5A 3NRHA 4KC9A 2XL4A 4EBBA 3ZTMA 4AL1A 3U2LA 2NUPA 4P9FA 4PFOA 4CDAA 4IGGA 4NCQA 3QTHA 1ZHZA 2IXNA 5DS4A 4KI2A 1M6TA 2BL2A 3KKBA 4HE8D 4FESA 1A0BA 2HZ8A 3GEIA 3Q6MA 4L6RA 4DVYP 4LDKA 5GPGB 2XM0A 4G78A 1V74B 2XS8A 3JTLO 3DE8A 3MLGA 1ZHTA 1H9GA 4O79A 4NY3A 1GQAA 2QE9A 2QUPA 3Q7GA 5F5HA 4JCHA 3B0PA 1VB5A 2OU6A 1GS9A 2WVOA 2A0BA 3HNIA 3KYIA 3PCVA 3S28A 3B0VC 3UMHA 3ZIBA 5JRAA 4XPWA 5D92A 3O6XA 2OEXA 1D1BA 3GM2A 4E0HA 1Q0KA 2YKZA 3PDMP 1CPRA 5JT4A 2XM4A 4OIOF 4M63A 2H8AA 3K1IC 4JTAB 1WATA 2L81A 4JJFA 4W8KA 1KTMA 5COFA 5A6JA 2G62A 1O5HA 3ZC4A 2P1AA 3NKEA 4P6IC 3FVYA 4PK4A 3B29A 4ULWA 3RQFA 1Z63A 3WG7C 1PCXA 4JZAA 4XPYA 5BQHA 2Q00A 1AUEA 4IJJA 5L3VA 1HMDA 1DOWA 1C17M 4Q5SF 3LESA 1C03A 2F22A 2UUHA 1YVIA 5B3SC 3ECSA 4XPXA 3UR3C 2A0UA 3LS1A 2OQMA 4PJLA 5COMA 1H6GA 3W4YA 5KYXA 3O39A 4AK9A 5AC5A 1CGME 1OQCA 1WWPA 2GFHA 1TR2A 2XLDA 2Y3GA 4NQFA 3JRTA 4O6MA 4XEKA 4CJGA 1FR0A 2XLVA 4NTBA 2W45A 3IEEA 4EBJA 5DLJA 2HFIA 5FCLA 4HEAJ 3HNJA 4DXWA 3LLIA 4YN0B 1CPQA 1T6QA 4DRJB 5KYXB 2FGYA 2CNWD 2ZD9A 3OEOA 1VOMA 1OCCC 1EI7A 2A6HF 2J9VA 3EJNA 2QY9A 2XLHA 3LAYA 1TWHA 2Y3HA 3AJMA 5CI9A 3JSEO 1ORSC 1FAPB 3S27A 3T9OA 4DBRA 1KU2A 1NG1A 2XL6A 4U5EE 3I4UA 1ZHYA 2M4EA 1DOVA 1YZCA 5FZTA 4XTKA 1Z5ZA 3S90A 3Q6NA 1UFBA 3ATPA 1E85A 3MX3A 2P6VA 2A68F 2EILC 3LJBA 3WHNA 2KC3A 1OCOC 2VH3A 3JT1A 1A7EA 3RFYA 3U9MA 3CSKA 5T1DB 4C7OA 1BR4A 1U89A 2TMVP 1MMGA 4GQHA 1MMDA 5A6AA 4IAOA 2IOQA 1V54C 2YLGA 4Z9IA 2V26A 4YT8A 2HJMA 3B0UX 4RD9A 4PR9A 1PV3A 2A69F 4JCZA 4CBEA 1M57C 1NFOA 3KH2A 3ZVRA 4A4AA 2R7WA 2LFFA 2PF4E 2KK1A 1H7IA 4BEJA 1HW1A 1M56C 2JPUA 3EHNA 4DJ9A 2LD6A 1NFNA 1G8XA 2Q7RA 4MVRA 3SYNA 1APCA 4U9DA 2YZSA 3I5PA 4JKVA 5L0JA 4CS9C 4C3BA 1JOGA 4QI0A 1QQ3A 4BJ6A 3GODA 3K1HA 1LVKA 3NMKA 3L34A 4MTGA 3L8JA 4CX9A 2J45A 1NZEA 3JCUQ 3TD7A 2Y69C 3S29A 3SXZA 4BJTA 2Q9CA 4YL0A 1GM5A 5DS5A 1PD1A 1TQGA 2EPLX 2AU5A 2BC5A 4JIOA 3TOMA 1YA7O 2YLDA 4JEBA 5EK0A 1BBHA 2XLMA 2YLIA 2LK4A 1A7DA 5KYYA 2L6HA 3K7DA 1E84A 1J8MF 3AG3C 3QW1A 5AGFA 3DAGA 3U2MA 1I4ZA 3DAFA 1D1AA 3LNMB 3ZDLA 4Z9JA 1IW7F 4IB4A 3T6JA 3AOUA 4AE4B 2NSGA 3O55A 1SR2A 2J46A 2YVKA 3W2WA 2ASRA 1I4YA 2KQ9A 4J30B 1RKEB 4CIHA 2KNHA 3U3BA 3W2VA 1LI5A 2DB4A 3M1CB 2OJED 4YL1A 2HJ3A 4FX5A 1VLTA 3F47A 3QZCA 4IRUA 1Z3IX 3T6BA 2IXOA 1TFOB 1QPUA 1T9KA 3AGTA 1RKEA 2L9JA 4BG0A 4XEFA 4GEHA 2C03A 5E2QA 1OCZC 4YT5A 1WTYA 1EKYA 1L7CA 1RJ9A 1RKCA 1VK5A 3EZIA 1FFTC 4KBLA 2O9XA 4HFFB 2EINC 3JYHA 3RVZA 3VF0A 1AVOB 1N1CA 3QVYA 3PMRA 3EZHA 1M2VA 3NDBB 4I1OB 1YLMA 3FHDA 2R7OA 2VCCA 2ZPAA 3FMSA 2FAPB 4LERA 2HMZA 4K1OA 3N2ZB 4QDLA 3HNKA 4YT4A 4UDVA 2P0NA 1LE2A 2IXPA 5B1BC 1OW7A 1JMWA 4U5CE 2HKVA 3EGXB 4PACA 4RDAA 3UNGC 1WGWA 1LIHA 2EIJC 1FTSA 2J0WA 4X0RA 5E33A 1ST6A 3VM6A 3J06A 1LS1A 4NTAA 3SEOA 3IQTA 2CGEA 4E7ZA 5AC4A 1ORJA 4I3MA 2XL8A 2AVKA 4C3DA 4E7SA 1YYJA 2R7RA 2RSEB 3U8VA 2V3CC 4U5BE 4O6NA 1H9TA 2D5RB 4I44A 3CEXA 1M2OA 2Q9AA 2PNOA 3NMIA 3AQCA
chains in the Genus database with same CATH topology
1NBBA 2QLAA 1YZCA 5B3IA 4ER9A 2XLWA 3IQ5A 256BA 1E85A 4CJOA 1LM3B 5JUAA 1CGNA 3ZWIA 1YZAA 2XLOA 3FOPA 2YLGA 3M79A 4N6HA 1A7VA 3ZTZA 4ULVA 1YYXA 3M4CA 5JS5A 3QVZA 5JVEA 1APCA 4JE9A 4U9DA 4JKVA 4WGYA 1JAFA 4WGZA 1QQ3A 2CCYA 3C62A 3NMKA 4CX9A 2YL7A 3NMJA 2BC5A 3TOMA 2YLDA 4JEBA 1BBHA 2XLMA 4NC3A 4CDAA 2YLIA 3L1MA 1E84A 3QW1A 1M6TA 5JP7A 5AGFA 5JSLA 4L6RA 3C63A 4CDVA 4IB4A 2XM0A 3DE9A 3DE8A 1GQAA 4CIPA 4EIYA 2XLEA 1MQVA 3HNIA 2J8WA 4N4WA 5JRAA 1QPUA 2YKZA 2YL1A 2YL0A 1CPRA 5JT4A 2XM4A 1EKYA 3M4BA 4IARA 3IQ6A 1CGOA 3ZQVA 3QVYA 5JLIA 3FOOA 4IAQA 3HNKA 3M15A 1S05A 4JEAA 4D4NA 4CDYA 4U9EA 1E86A 1E83A 2XLDA 3QW0A 4CJGA 4D4XA 2XLVA 2YL3A 3ZQYA 3HNJA 1CPQA 2XL8A 3U8PA 2J9BA 1YYJA 3VRCA 3ZTMA 3TOLA 2XLHA 3HNLA 1RCPA 3NMIA 2XL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NBB A;  2QLA A;  1YZC A;  5B3I A;  4ER9 A;  2XLW A;  3IQ5 A;  256B A;  1E85 A;  4CJO A;  1LM3 B;  5JUA A;  1CGN A;  3ZWI A;  1YZA A;  2XLO A;  3FOP A;  2YLG A;  3M79 A;  4N6H A;  1A7V A;  3ZTZ A;  4ULV A;  1YYX A;  3M4C A;  5JS5 A;  3QVZ A;  5JVE A;  1APC A;  4JE9 A;  4U9D A;  4JKV A;  4WGY A;  1JAF A;  4WGZ A;  1QQ3 A;  2CCY A;  3C62 A;  3NMK A;  4CX9 A;  2YL7 A;  3NMJ A;  2BC5 A;  3TOM A;  2YLD A;  4JEB A;  1BBH A;  2XLM A;  4NC3 A;  4CDA A;  2YLI A;  3L1M A;  1E84 A;  3QW1 A;  1M6T A;  5JP7 A;  5AGF A;  5JSL A;  4L6R A;  3C63 A;  4CDV A;  4IB4 A;  2XM0 A;  3DE9 A;  3DE8 A;  1GQA A;  4CIP A;  4EIY A;  2XLE A;  1MQV A;  3HNI A;  2J8W A;  4N4W A;  5JRA A;  1QPU A;  2YKZ A;  2YL1 A;  2YL0 A;  1CPR A;  5JT4 A;  2XM4 A;  1EKY A;  3M4B A;  4IAR A;  3IQ6 A;  1CGO A;  3ZQV A;  3QVY A;  5JLI A;  3FOO A;  4IAQ A;  3HNK A;  3M15 A;  1S05 A;  4JEA A;  4D4N A;  4CDY A;  4U9E A;  1E86 A;  1E83 A;  2XLD A;  3QW0 A;  4CJG A;  4D4X A;  2XLV A;  2YL3 A;  3ZQY A;  3HNJ A;  1CPQ A;  2XL8 A;  3U8P A;  2J9B A;  1YYJ A;  3VRC A;  3ZTM A;  3TOL A;  2XLH A;  3HNL A;  1RCP A;  3NMI A;  2XL6 A; 
#chains in the Genus database with same CATH topology
 2HV7 A;  2OEV A;  3N24 A;  1K05 A;  2EPK X;  2Q3T A;  2HSQ A;  2LQG A;  3DJN B;  1G4W R;  4WAB A;  4EUK B;  3ABL C;  1V55 C;  3FAJ A;  3EPV A;  2IBF A;  3VYW A;  4JUR I;  1LM3 B;  3US6 A;  1HW2 A;  1BR2 A;  1CGN A;  3NYM A;  5KYU B;  4YL3 A;  3ZWI A;  1RJ9 B;  1Q0G A;  2R05 A;  1A41 A;  2YEV A;  3DXJ F;  3EGD A;  3MYI A;  3RYL A;  5E3C A;  2XXA B;  2OOC A;  3FAP B;  1ZZP A;  3M79 A;  2NUT A;  4NTF A;  1ORY A;  1L3P A;  3H65 A;  4OIR F;  3R2P A;  3W8I A;  1M2V B;  1YYX A;  2KSF A;  2WVQ A;  4AX2 A;  4YJW A;  2WZG A;  4U5F E;  2MHR A;  5IY5 C;  4F4B A;  3QVZ A;  2YWA A;  4N6C A;  1OR3 A;  1AEP A;  2W9Y A;  1ZHW A;  2HSB A;  3K33 A;  3V7O A;  3GM1 A;  1B68 A;  4MTO A;  4JE9 A;  5DQZ A;  3EGX A;  3LUT B;  4XLN F;  4DRI B;  2VAS A;  1JAF A;  4WGZ A;  1D1C A;  2CCY A;  5D91 A;  3KMI A;  2YL7 A;  3OWT A;  1HE1 A;  4MVM A;  4YK5 A;  4Q4Z F;  2MYS A;  1F1M A;  3AQB A;  5KYW B;  3TJ5 A;  1C02 A;  1NSG B;  2L7A A;  4NC3 A;  4O7G A;  2I15 A;  2R7T A;  4W8P A;  1O3U A;  1FMW A;  2HUJ A;  4XLP F;  1TKN A;  2PBE A;  2ETS A;  1IZM A;  1YAR O;  5JP7 A;  5JSL A;  2JX0 A;  1ZU4 A;  4E17 A;  2R7V A;  2R03 A;  2ZXW C;  5DVW A;  1WOL A;  4CDV A;  1YAU O;  1QVX A;  2KYH A;  3V5X A;  5DQT A;  4CS8 C;  2XRH A;  4ZLC A;  4CSA C;  3RKO F;  3KYJ A;  1OR2 A;  3K1I A;  2DGJ A;  1OKK D;  3T6G B;  5E3A A;  4G7O F;  3SNH A;  5F5F A;  1MQV A;  1BZ4 A;  1YA9 A;  2HV6 A;  2J8W A;  1PD0 A;  3H2V A;  4N4W A;  4AE4 A;  5BUO A;  5A6B A;  1QKR A;  2H7B A;  3C7J A;  4H4K C;  2XXA A;  3GOR A;  3U9J A;  1Q0D A;  1TFK B;  2YL1 A;  2YL0 A;  3LLK A;  2NUT B;  1RXQ A;  2W4M A;  1QLE C;  3L8I A;  4K7B A;  4KNV A;  1Y4C A;  1SMY F;  2EIK C;  2J0X A;  3EH1 A;  4G7H F;  2LSE A;  3M4B A;  4LLC A;  2M64 A;  1Q0F A;  1RMV A;  5L0C A;  3IQ6 A;  2C04 A;  2GAQ A;  3MBG A;  4MVO A;  1XZP A;  1J8Y F;  2GWW A;  4OD4 A;  3ITF A;  5L0D A;  4DOZ A;  3ZQV A;  1JPJ A;  2PFD A;  5JLI A;  2AWY A;  2NSF A;  1FFH A;  1OKK A;  3U0C A;  4JRZ A;  3TUL A;  2OCC C;  3CQZ A;  3M15 A;  1MNE A;  3N0T A;  1TWC A;  1VYK A;  4H54 A;  3EG9 B;  4BPM A;  3ASN C;  5A69 A;  3ZG1 A;  2DYR C;  4JEA A;  4OIP F;  2H7V C;  3ZSU A;  4CDY A;  4D4N A;  3JRM O;  2LFD A;  4BEM J;  2J9W A;  3S0X A;  1E86 A;  2LP4 A;  3AG2 C;  2G3V A;  3CAX A;  1YJG A;  1BDJ B;  3C8Z A;  2WB7 A;  1OXB A;  3C18 A;  1S7Z A;  1G4U S;  2OJQ A;  3U5S A;  2FFH A;  5HSW A;  2WZL A;  4ANJ A;  1GGQ A;  5HV9 A;  2YL3 A;  4J7Y A;  4EBK A;  3S84 A;  4BJ6 C;  5L0F A;  3WOD F;  3FDQ A;  3ZQY A;  2I8B A;  5T3T A;  4CS9 A;  3UGO A;  3G4X A;  4J32 B;  2J9B A;  3VAY A;  1MND A;  3VRC A;  2MWQ A;  2VCA A;  2ZXO A;  5L0I A;  3GWN A;  2X51 A;  2B0J A;  3BEH A;  3FXH A;  3SZR A;  3UMK A;  2GA0 A;  4OIN F;  3SXM A;  1WN0 A;  3SP1 A;  1ZHX A;  2EPO A;  4E18 A;  3X2Q C;  1WAS A;  2E87 A;  2J7P D;  2ICW G;  2WZF A;  2XSE A;  3GM3 A;  3HNL A;  1NU7 D;  2VCB A;  2Y39 A;  3RQG A;  3POV A;  3S9O A;  3EHM A;  3GWL A;  1OW8 A;  1SF8 A;  3NKD A;  5B3I A;  3JYY A;  1TWG A;  1MMA A;  2XLW A;  2DI3 A;  4JTC B;  256B A;  2KJG A;  4MQ9 F;  4ER9 A;  4CJO A;  2A1D D;  4EKW A;  3RIP A;  1OCR C;  5A6K A;  3U3F A;  3TQO A;  3GEH A;  2DYS C;  3A9C A;  1U6H A;  3RH3 A;  2PX0 A;  5BQI A;  3EFO A;  3EQL F;  3DZA A;  4MW3 A;  1ZW3 A;  5BQG A;  2Q9B A;  1VMA A;  1A7V A;  1ZYR F;  3IHU A;  5KYU A;  5JS5 A;  5CIV A;  2CDQ A;  2RD9 A;  1OW6 A;  1SZI A;  5K0I A;  1T5O A;  1EQ1 A;  3DWW A;  1E2X A;  1JPN A;  2EIM C;  2IXM A;  1K40 A;  3AG1 C;  2CYD A;  1D0X A;  3DJU B;  1LPE A;  2P61 A;  4MVU A;  4WGY A;  2A6E F;  4XEV A;  4E0I A;  1LE4 A;  1ZVZ A;  3E70 C;  3AG4 C;  1JR8 A;  5KYN A;  2EPM X;  2QTV A;  3C62 A;  3LS0 A;  4RBN A;  3ABM C;  4GYT A;  1I5N A;  2L6G A;  4U5G A;  1T01 A;  2R7Q A;  4PJM A;  3K66 A;  2YRF A;  1W2W A;  2KW3 C;  3W8H A;  2IYL D;  2R7X A;  2NUP B;  5A6B D;  3L1M A;  4K0D A;  1Z7Q c;  4BJ5 A;  5KYY B;  2VC9 A;  3HTK C;  3RF3 A;  1G5Z A;  4DBQ A;  3E9V A;  3ABK C;  1LS4 A;  2NPU A;  3KPH A;  3MYF A;  4CS8 A;  1HY5 A;  2YHS A;  3C63 A;  4G7Z F;  4C7O B;  4YT2 A;  4JC7 A;  3DE9 A;  3OA1 A;  4LDR A;  4ONS A;  3DM9 B;  1BR1 A;  3B71 A;  2R7U A;  3I5Q A;  3DD7 A;  2LCH A;  4EHP A;  3HJC A;  4R32 A;  2R9R B;  4U5D E;  5DS6 A;  4CIP A;  2Y3B A;  3DI5 A;  2XLE A;  4EIY A;  1KNY A;  2Q4F A;  4O6Y A;  4JW1 A;  3QMK A;  1QSP A;  3UGP A;  1VTM P;  1Z23 A;  3JSZ A;  2HS5 A;  3C8G B;  1Q0M A;  3MFN A;  3O10 A;  3DMD A;  4FWV A;  1V4A A;  4Z9H A;  3H2U A;  4IAR A;  1CGO A;  5B1A C;  4WJ0 A;  2X0C A;  2G3K A;  1YDI A;  2ZXP A;  3C8G A;  2L6F A;  1MMN A;  2LIG A;  5KYW A;  3FOO A;  4IAQ A;  1VYI A;  1LKX A;  4LDQ A;  4Q7C A;  4B6I A;  2YQY A;  3GEE A;  3K6B A;  4MTF A;  2VB6 A;  1O87 A;  3EGD B;  3JZ0 A;  2KGO A;  4BJ5 C;  5EHH A;  2J7P A;  2D4U A;  4OD5 A;  1S05 A;  2PP4 A;  1FMV A;  3U8P A;  1EA8 A;  4U9E A;  4OIQ F;  3G50 A;  1OXK A;  2R25 A;  4DRH B;  3GAN A;  3NYL A;  3T4R A;  4YWQ A;  4PJN A;  2B0H A;  3F46 A;  1VLS A;  1E83 A;  3QW0 A;  4D4X A;  3EG9 A;  1R4T A;  1UG7 A;  1XWJ A;  2OKU A;  2IM8 A;  5L0H A;  3C8G D;  4MW8 A;  2EPN A;  4U5H A;  1T6U A;  2WVN A;  5CI8 A;  1LI7 A;  2WL8 A;  3BRJ A;  2P7V A;  2GDC A;  2BE5 F;  1K04 A;  3DM5 A;  3HLZ A;  3IPM O;  1NU9 C;  1D0Z A;  3ASO C;  3TOL A;  4CSA A;  1JRA A;  3LNR A;  3SXK A;  2HMQ A;  5COG A;  3CZ6 A;  3SXY A;  3NYJ A;  4MVS A;  1YZA A;  1TWA A;  1RCP A;  4N06 A;  3TJ6 A;  2Y3D A;  1NBB A;  2QLA A;  2H7O A;  4J7T A;  3LEO A;  4KNW A;  2ZXR A;  3NG1 A;  5TJ5 E;  3RW0 A;  3IQ5 A;  4LAC B;  3PHF 2;  3L0I A;  1T6I A;  1NLX A;  4C3E A;  2AP3 A;  2J9U A;  5T3W A;  2W4B A;  4IWB A;  3X1O A;  2PX3 A;  3A11 A;  5JUA A;  3RVY A;  3RQE A;  4MVZ A;  3R7C A;  4XWJ A;  1D0Y A;  4MVQ A;  4AL0 A;  2CNW A;  3EFO B;  5F28 E;  2XLO A;  1SYQ A;  2UUI A;  3FOP A;  3G4Z A;  4PJJ A;  1HMO A;  4CS7 A;  4LLE A;  4I1M A;  4JTD B;  4N6H A;  3ZTZ A;  2R7S A;  4ULV A;  3LEV A;  1R5I D;  3M4C A;  3B9Q A;  4HFK B;  1HE9 A;  4MS2 A;  5L0G A;  2OG2 A;  2NG1 A;  3DKA A;  2QNL A;  3TK0 A;  4EWC A;  4JJG A;  2R02 A;  5EGY A;  1FNT c;  4MND A;  3V5Y A;  1ZW2 A;  2AWC A;  3WAQ A;  5JVE A;  5L3Q A;  4ZLD A;  4P9T A;  3EH2 A;  3Q7L A;  2Z15 A;  4BJ1 A;  4DVZ A;  4QI2 A;  4JVS A;  3HKK A;  4A2N B;  2JD3 A;  3V5Z A;  2XS1 A;  1XZQ A;  4FAP B;  3IQC A;  2CW0 F;  3NMJ A;  1Z6A A;  4PFP A;  4XQ1 A;  3AGU A;  3KL4 A;  4G0H A;  1U0B B;  3UMI A;  1QZX A;  1Y6D A;  1ZU5 A;  3NRH A;  4KC9 A;  2XL4 A;  4EBB A;  3ZTM A;  4AL1 A;  3U2L A;  2NUP A;  4P9F A;  4PFO A;  4CDA A;  4IGG A;  4NCQ A;  3QTH A;  1ZHZ A;  2IXN A;  5DS4 A;  4KI2 A;  1M6T A;  2BL2 A;  3KKB A;  4HE8 D;  4FES A;  1A0B A;  2HZ8 A;  3GEI A;  3Q6M A;  4L6R A;  4DVY P;  4LDK A;  5GPG B;  2XM0 A;  4G78 A;  1V74 B;  2XS8 A;  3JTL O;  3DE8 A;  3MLG A;  1ZHT A;  1H9G A;  4O79 A;  4NY3 A;  1GQA A;  2QE9 A;  2QUP A;  3Q7G A;  5F5H A;  4JCH A;  3B0P A;  1VB5 A;  2OU6 A;  1GS9 A;  2WVO A;  2A0B A;  3HNI A;  3KYI A;  3PCV A;  3S28 A;  3B0V C;  3UMH A;  3ZIB A;  5JRA A;  4XPW A;  5D92 A;  3O6X A;  2OEX A;  1D1B A;  3GM2 A;  4E0H A;  1Q0K A;  2YKZ A;  3PDM P;  1CPR A;  5JT4 A;  2XM4 A;  4OIO F;  4M63 A;  2H8A A;  3K1I C;  4JTA B;  1WAT A;  2L81 A;  4JJF A;  4W8K A;  1KTM A;  5COF A;  5A6J A;  2G62 A;  1O5H A;  3ZC4 A;  2P1A A;  3NKE A;  4P6I C;  3FVY A;  4PK4 A;  3B29 A;  4ULW A;  3RQF A;  1Z63 A;  3WG7 C;  1PCX A;  4JZA A;  4XPY A;  5BQH A;  2Q00 A;  1AUE A;  4IJJ A;  5L3V A;  1HMD A;  1DOW A;  1C17 M;  4Q5S F;  3LES A;  1C03 A;  2F22 A;  2UUH A;  1YVI A;  5B3S C;  3ECS A;  4XPX A;  3UR3 C;  2A0U A;  3LS1 A;  2OQM A;  4PJL A;  5COM A;  1H6G A;  3W4Y A;  5KYX A;  3O39 A;  4AK9 A;  5AC5 A;  1CGM E;  1OQC A;  1WWP A;  2GFH A;  1TR2 A;  2XLD A;  2Y3G A;  4NQF A;  3JRT A;  4O6M A;  4XEK A;  4CJG A;  1FR0 A;  2XLV A;  4NTB A;  2W45 A;  3IEE A;  4EBJ A;  5DLJ A;  2HFI A;  5FCL A;  4HEA J;  3HNJ A;  4DXW A;  3LLI A;  4YN0 B;  1CPQ A;  1T6Q A;  4DRJ B;  5KYX B;  2FGY A;  2CNW D;  2ZD9 A;  3OEO A;  1VOM A;  1OCC C;  1EI7 A;  2A6H F;  2J9V A;  3EJN A;  2QY9 A;  2XLH A;  3LAY A;  1TWH A;  2Y3H A;  3AJM A;  5CI9 A;  3JSE O;  1ORS C;  1FAP B;  3S27 A;  3T9O A;  4DBR A;  1KU2 A;  1NG1 A;  2XL6 A;  4U5E E;  3I4U A;  1ZHY A;  2M4E A;  1DOV A;  1YZC A;  5FZT A;  4XTK A;  1Z5Z A;  3S90 A;  3Q6N A;  1UFB A;  3ATP A;  1E85 A;  3MX3 A;  2P6V A;  2A68 F;  2EIL C;  3LJB A;  3WHN A;  2KC3 A;  1OCO C;  2VH3 A;  3JT1 A;  1A7E A;  3RFY A;  3U9M A;  3CSK A;  5T1D B;  4C7O A;  1BR4 A;  1U89 A;  2TMV P;  1MMG A;  4GQH A;  1MMD A;  5A6A A;  4IAO A;  2IOQ A;  1V54 C;  2YLG A;  4Z9I A;  2V26 A;  4YT8 A;  2HJM A;  3B0U X;  4RD9 A;  4PR9 A;  1PV3 A;  2A69 F;  4JCZ A;  4CBE A;  1M57 C;  1NFO A;  3KH2 A;  3ZVR A;  4A4A A;  2R7W A;  2LFF A;  2PF4 E;  2KK1 A;  1H7I A;  4BEJ A;  1HW1 A;  1M56 C;  2JPU A;  3EHN A;  4DJ9 A;  2LD6 A;  1NFN A;  1G8X A;  2Q7R A;  4MVR A;  3SYN A;  1APC A;  4U9D A;  2YZS A;  3I5P A;  4JKV A;  5L0J A;  4CS9 C;  4C3B A;  1JOG A;  4QI0 A;  1QQ3 A;  4BJ6 A;  3GOD A;  3K1H A;  1LVK A;  3NMK A;  3L34 A;  4MTG A;  3L8J A;  4CX9 A;  2J45 A;  1NZE A;  3JCU Q;  3TD7 A;  2Y69 C;  3S29 A;  3SXZ A;  4BJT A;  2Q9C A;  4YL0 A;  1GM5 A;  5DS5 A;  1PD1 A;  1TQG A;  2EPL X;  2AU5 A;  2BC5 A;  4JIO A;  3TOM A;  1YA7 O;  2YLD A;  4JEB A;  5EK0 A;  1BBH A;  2XLM A;  2YLI A;  2LK4 A;  1A7D A;  5KYY A;  2L6H A;  3K7D A;  1E84 A;  1J8M F;  3AG3 C;  3QW1 A;  5AGF A;  3DAG A;  3U2M A;  1I4Z A;  3DAF A;  1D1A A;  3LNM B;  3ZDL A;  4Z9J A;  1IW7 F;  4IB4 A;  3T6J A;  3AOU A;  4AE4 B;  2NSG A;  3O55 A;  1SR2 A;  2J46 A;  2YVK A;  3W2W A;  2ASR A;  1I4Y A;  2KQ9 A;  4J30 B;  1RKE B;  4CIH A;  2KNH A;  3U3B A;  3W2V A;  1LI5 A;  2DB4 A;  3M1C B;  2OJE D;  4YL1 A;  2HJ3 A;  4FX5 A;  1VLT A;  3F47 A;  3QZC A;  4IRU A;  1Z3I X;  3T6B A;  2IXO A;  1TFO B;  1QPU A;  1T9K A;  3AGT A;  1RKE A;  2L9J A;  4BG0 A;  4XEF A;  4GEH A;  2C03 A;  5E2Q A;  1OCZ C;  4YT5 A;  1WTY A;  1EKY A;  1L7C A;  1RJ9 A;  1RKC A;  1VK5 A;  3EZI A;  1FFT C;  4KBL A;  2O9X A;  4HFF B;  2EIN C;  3JYH A;  3RVZ A;  3VF0 A;  1AVO B;  1N1C A;  3QVY A;  3PMR A;  3EZH A;  1M2V A;  3NDB B;  4I1O B;  1YLM A;  3FHD A;  2R7O A;  2VCC A;  2ZPA A;  3FMS A;  2FAP B;  4LER A;  2HMZ A;  4K1O A;  3N2Z B;  4QDL A;  3HNK A;  4YT4 A;  4UDV A;  2P0N A;  1LE2 A;  2IXP A;  5B1B C;  1OW7 A;  1JMW A;  4U5C E;  2HKV A;  3EGX B;  4PAC A;  4RDA A;  3UNG C;  1WGW A;  1LIH A;  2EIJ C;  1FTS A;  2J0W A;  4X0R A;  5E33 A;  1ST6 A;  3VM6 A;  3J06 A;  1LS1 A;  4NTA A;  3SEO A;  3IQT A;  2CGE A;  4E7Z A;  5AC4 A;  1ORJ A;  4I3M A;  2XL8 A;  2AVK A;  4C3D A;  4E7S A;  1YYJ A;  2R7R A;  2RSE B;  3U8V A;  2V3C C;  4U5B E;  4O6N A;  1H9T A;  2D5R B;  4I44 A;  3CEX A;  1M2O A;  2Q9A A;  2PNO A;  3NMI A;  3AQC A; 
#chains in the Genus database with same CATH homology
 1NBB A;  2QLA A;  1YZC A;  5B3I A;  4ER9 A;  2XLW A;  3IQ5 A;  256B A;  1E85 A;  4CJO A;  1LM3 B;  5JUA A;  1CGN A;  3ZWI A;  1YZA A;  2XLO A;  3FOP A;  2YLG A;  3M79 A;  4N6H A;  1A7V A;  3ZTZ A;  4ULV A;  1YYX A;  3M4C A;  5JS5 A;  3QVZ A;  5JVE A;  1APC A;  4JE9 A;  4U9D A;  4JKV A;  4WGY A;  1JAF A;  4WGZ A;  1QQ3 A;  2CCY A;  3C62 A;  3NMK A;  4CX9 A;  2YL7 A;  3NMJ A;  2BC5 A;  3TOM A;  2YLD A;  4JEB A;  1BBH A;  2XLM A;  4NC3 A;  4CDA A;  2YLI A;  3L1M A;  1E84 A;  3QW1 A;  1M6T A;  5JP7 A;  5AGF A;  5JSL A;  4L6R A;  3C63 A;  4CDV A;  4IB4 A;  2XM0 A;  3DE9 A;  3DE8 A;  1GQA A;  4CIP A;  4EIY A;  2XLE A;  1MQV A;  3HNI A;  2J8W A;  4N4W A;  5JRA A;  1QPU A;  2YKZ A;  2YL1 A;  2YL0 A;  1CPR A;  5JT4 A;  2XM4 A;  1EKY A;  3M4B A;  4IAR A;  3IQ6 A;  1CGO A;  3ZQV A;  3QVY A;  5JLI A;  3FOO A;  4IAQ A;  3HNK A;  3M15 A;  1S05 A;  4JEA A;  4D4N A;  4CDY A;  4U9E A;  1E86 A;  1E83 A;  2XLD A;  3QW0 A;  4CJG A;  4D4X A;  2XLV A;  2YL3 A;  3ZQY A;  3HNJ A;  1CPQ A;  2XL8 A;  3U8P A;  2J9B A;  1YYJ A;  3VRC A;  3ZTM A;  3TOL A;  2XLH A;  3HNL A;  1RCP A;  3NMI A;  2XL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...