3NMJA

Crystal structure of a nickel mediated dimer for the phenanthroline-modified cytochrome cb562 variant, mbp-phen2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFAILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
publication title Porous protein frameworks with unsaturated metal centers in sterically encumbered coordination sites.
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3nmjA00
3QW1A 2YKZA 2YL1A 1BBHA 5JT4A 3IQ6A 4N6HA 4JE9A 4EIYA 2J9BA 1E86A 3NMKA 2XM0A 3C62A 3IQ5A 1CGNA 3C63A 3TOMA 4CJGA 2YL7A 3ZTZA 2XM4A 3HNKA 4ER9A 3M4CA 1YZAA 4JKVA 1QQ3A 4IAQA 1GQAA 2YL3A 1E84A 2XLDA 1E83A 3QVZA 1QPUA 5JUAA 1EKYA 1JAFA 2CCYA 2YL0A 2BC5A 2XLHA 3QW0A 1YYJA 2YLIA 3ZTMA 1MQVA 3DE8A 4N4WA 3FOOA 3L1MA 4WGZA 1M6TA 3TOLA 2XL6A 2XLWA 1S05A 4IB4A 5B3IA 3QVYA 3DE9A 5JP7A 1RCPA 3HNJA 1A7VA 1NBBA 4CDVA 3ZWIA 3M15A 3FOPA 2XLEA 1CPQA 4D4NA 2YLDA 3HNLA 4U9DA 2XLMA 4L6RA 3ZQYA 5JSLA 4CDYA 5AGFA 1APCA 256BA 2XLVA 3HNIA 3M79A 3ZQVA 3NMIA 5JVEA 5JS5A 4ULVA 4U9EA 2YLGA 3U8PA 3M4BA 5JLIA 4D4XA 1YZCA 4WGYA 3VRCA 2J8WA 4CDAA 5JRAA 1CGOA 4CJOA 4IARA 2XLOA 2QLAA 3NMJA 1E85A 1YYXA 4CIPA 1LM3B 1CPRA 4JEBA 4CX9A 2XL8A 4JEAA 4NC3A
chains in the Genus database with same CATH superfamily
3EGXB 3QW1A 2YL1A 3CSKA 3UMKA 5JT4A 3ECSA 3SXYA 2R7UA 4CS7A 1GS9A 5L0HA 4N6HA 2LP4A 1OCOC 4KBLA 4MVZA 3K7DA 3KYJA 4JE9A 3JRMO 4EIYA 1I4ZA 5TJ5E 2GAQA 3V7OA 4AE4A 1SZIA 3NMKA 2MHRA 3B0VC 2EILC 1NSGB 3L0IA 2YVKA 4FWVA 4R32A 3X2QC 4CIHA 1CGNA 1ORYA 2H7BA 2P6VA 4I1MA 2HV6A 2Y3GA 3EZIA 3MX3A 2O9XA 1ZHXA 4YT5A 2R7SA 1SYQA 4DRJB 4CJGA 3RH3A 1Q0KA 1ZHYA 1OKKD 4AL1A 2TMVP 4C7OB 3HNKA 3LESA 4ER9A 1RKCA 2DB4A 2HJ3A 1QQ3A 4JKVA 1NFOA 4AX2A 3T6JA 3CAXA 4LLCA 5D92A 2YL3A 3EG9A 2ASRA 1BR4A 1KNYA 3JT1A 1PV3A 2XLDA 2LFDA 1PD1A 3GEEA 3RYLA 3U8VA 3T9OA 1YVIA 4FX5A 4PFPA 1EKYA 4XQ1A 5KYNA 2V26A 3U3BA 3JYHA 3K6BA 4E7SA 4JCHA 2YL0A 3WODF 1VYKA 2R03A 3EPVA 2XLHA 3QW0A 1R5ID 2YEVA 2AWYA 5KYWA 3K33A 4W8PA 1OKKA 2YWAA 3JTLO 1TKNA 1NU7D 4U5EE 1MMDA 4OINF 1YA7O 4E0HA 1Q0FA 3S9OA 2QUPA 2LIGA 3LAYA 1H9GA 3TQOA 2XL6A 1IZMA 3IQTA 3QZCA 2KSFA 3CEXA 1V55C 1S05A 4O6NA 4O79A 4IB4A 1FMWA 2L6GA 2UUHA 3DE9A 3KPHA 3NYMA 3UR3C 5EGYA 2XXAA 4G7ZF 4X0RA 1A7VA 1H6GA 3BEHA 2R7QA 2EPLX 4RD9A 3FAJA 3GWLA 1E2XA 1U6HA 3EGDA 4U5BE 5B3SC 2PBEA 2XLMA 5T1DB 2J9UA 2P0NA 2HMZA 3DAGA 4CDYA 1M56C 2OJED 2XSEA 4XPWA 1OW8A 5AGFA 2ETSA 4JVSA 3AG3C 4KNWA 3B0UX 3M79A 3HNIA 2J46A 4G7HF 1HMOA 3UGPA 1XZPA 2Y39A 1ZHZA 5HV9A 1VK5A 2NPUA 2R02A 3RW0A 2P61A 4AL0A 2HSBA 1G4WR 4JJGA 2OJQA 4XLNF 1AVOB 2YLGA 2HUJA 3OA1A 2A0BA 1C02A 4N6CA 3RVZA 2A6EF 4D4XA 5CI9A 2J7PD 3EQLF 2VCCA 4JTAB 2J8WA 2L7AA 1MNDA 1VMAA 1A41A 2Q9BA 4OD4A 2FAPB 5JRAA 1FR0A 3O6XA 2MWQA 1Y4CA 3I5PA 5IY5C 4MTOA 3AJMA 2AVKA 2W4BA 1ZVZA 2ZXPA 2R25A 4AE4B 4QI0A 3LUTB 1YYXA 4U5GA 4ZLCA 5L0GA 2KQ9A 2GFHA 1CPRA 2FFHA 3O39A 1HW2A 1Q0DA 3AG2C 3DM5A 2A1DD 5GPGB 2G62A 4XEVA 1Z5ZA 1AUEA 2W45A 1Z7Qc 1EA8A 4P6IC 2J7PA 4BEMJ 1BBHA 1YJGA 1YAUO 3T4RA 3LJBA 3WG7C 1T9KA 1OR2A 3SZRA 2NSFA 1AEPA 1L7CA 3I5QA 3JSZA 3Q7GA 3FXHA 1WTYA 3RQFA 2EIJC 2Y3BA 5A6AA 2OEVA 1JPJA 1ZZPA 3B0PA 3EG9B 2W9YA 4JRZA 4HFKB 2WVOA 4E0IA 4NCQA 3C8GD 3C62A 2DGJA 3AG4C 3IQ5A 1BDJB 4K0DA 2AWCA 2D4UA 4M63A 1HE9A 4HEAJ 3V5XA 3POVA 5AC4A 2QNLA 3ABLC 4Z9JA 3KKBA 4KC9A 5KYWB 3DJNB 2YL7A 4OIRF 4C3EA 5L0IA 2H8AA 1WWPA 2XM4A 3W2VA 1YZAA 1IW7F 3LNRA 2EPNA 1WATA 1OW7A 3B9QA 3JRTA 3TULA 2D5RB 2G3KA 1QVXA 1GQAA 2VC9A 3F47A 4MVUA 2WVQA 3C8GA 2DYSC 5COGA 2KK1A 5JUAA 1WASA 1VOMA 4G78A 4HFFB 3LS1A 4BJ6A 3U3FA 5L0DA 2PF4E 3IEEA 4A2NB 3PMRA 5EHHA 2LSEA 1YYJA 4J32B 1T6QA 4J7YA 1MQVA 3K1HA 3DE8A 4N4WA 4Z9HA 1RJ9A 3ZTMA 1M57C 1M2VA 4WGZA 1UFBA 3HLZA 1M6TA 4WABA 1H9TA 2V3CC 3IQCA 4G7OF 2LQGA 5DS5A 5E3CA 1S7ZA 2I8BA 3ABKC 2WVNA 3LLIA 1D0ZA 1OCZC 3M1CB 3ZDLA 1GM5A 1NFNA 5F5FA 3QVYA 5JP7A 4CS9A 1T01A 3L34A 2Q7RA 1CGME 2BL2A 4CDVA 3J06A 3ATPA 3B71A 1K40A 4IRUA 4O6MA 1CPQA 4A4AA 1I5NA 4MTGA 3VF0A 3LEVA 2YLDA 3DM9B 4CS9C 5JSLA 2EIMC 4BPMA 3S84A 3FAPB 4DBRA 2H7OA 2IXPA 3SYNA 2YQYA 1KTMA 2RD9A 2HSQA 2W4MA 4NTAA 1FAPB 5DLJA 3W8HA 1BZ4A 4DRHB 4Q5SF 3W8IA 1FFTC 1Q0GA 4EBJA 2R9RB 5DS4A 5AC5A 4K7BA 2J45A 5L3VA 3W2WA 2PX3A 3VYWA 4U9EA 4XPXA 2CNWD 5BUOA 3TJ5A 3M4BA 5KYUA 3N0TA 1RKEB 2LCHA 4YL3A 4NTBA 1NG1A 4YN0B 3FMSA 1YZCA 4BJ1A 4EWCA 4MTFA 4XTKA 4YL1A 3SEOA 1YARO 4FESA 5BQIA 1R4TA 2I15A 4LERA 3RQEA 4IARA 2C03A 4CSAA 2QLAA 3NKDA 2P7VA 3WHNA 3SXKA 3S27A 2PX0A 1LM3B 2AP3A 3NDBB 4I3MA 1MMNA 2RSEB 3DJUB 3GANA 4CX9A 4W8KA 4DVZA 2CNWA 3SXMA 5DQTA 4BJ5A 3PDMP 2ZXWC 3MFNA 1ZYRF 1YLMA 4CSAC 1F1MA 3KMIA 3UNGC 4XLPF 3UMIA 2B0JA 3ITFA 3OWTA 2CGEA 2WZGA 2HZ8A 2JD3A 2HS5A 1D0XA 3RKOF 3SXZA 4FAPB 1LKXA 3GORA 3QMKA 4U5FE 4JJFA 1H7IA 1LE2A 2QTVA 2WZFA 3CZ6A 3L8JA 4PK4A 2J9BA 3GM2A 1FNTc 2NG1A 4JW1A 1LE4A 3DKAA 3EH1A 3LEOA 4H54A 3LLKA 3K1IA 3IPMO 2IYLD 4JC7A 2MYSA 1ZW3A 1A7DA 3V5YA 3GWNA 4J30B 4NTFA 1ST6A 1T6IA 3DI5A 5FZTA 3ZVRA 3S90A 5COFA 3E9VA 3DD7A 3ZTZA 5CIVA 4BG0A 3EH2A 1V4AA 4IWBA 1SR2A 2VH3A 2EPKX 1KU2A 3GM3A 2Q9AA 4JTCB 2HFIA 2AU5A 3O55A 1D1AA 4UDVA 1E84A 2R7VA 4LACB 2HKVA 2FGYA 3K66A 2NUPA 3QVZA 3UMHA 2CW0F 2EINC 3G4XA 3CQZA 1D1BA 1JAFA 5B1AC 2NUTA 1M2OA 1BR2A 1N1CA 3TK0A 4OIOF 2L6FA 1J8MF 3T6GB 1LVKA 2BC5A 2IXOA 3ABMC 3JZ0A 1QLEC 4N06A 1UG7A 3JSEO 1TWCA 2LK4A 3DAFA 1FFHA 3I4UA 1ZHTA 2J9VA 3TJ6A 2BE5F 3T6BA 1OR3A 3BRJA 1VTMP 4BJTA 1Z6AA 2KW3C 3RQGA 2J9WA 4MS2A 5D91A 1TWGA 3FOOA 3U0CA 2R7WA 3L1MA 4JTDB 5BQGA 3U9MA 1QSPA 3RF3A 5CI8A 4MW8A 1ZU5A 1K04A 2R05A 4O7GA 3C7JA 1TFKB 4E17A 3AG1C 3OEOA 3A9CA 2XLWA 2HV7A 1O3UA 1GGQA 4KI2A 2YHSA 5B3IA 5T3TA 1QKRA 1JOGA 1T5OA 1EQ1A 3HNJA 1NBBA 1J8YF 1NU9C 2B0HA 3ZWIA 4EBKA 5L0JA 5KYUB 2OCCC 3R7CA 2EIKC 1OXKA 1FMVA 3C18A 2XXAB 3HNLA 2GA0A 4DJ9A 3VM6A 1G8XA 4NQFA 4RDAA 3ZQYA 4YT4A 3Q6NA 3RVYA 4GYTA 5EK0A 3EFOA 1APCA 1EI7A 2DYRC 3EGDB 3KL4A 2X0CA 3IHUA 2EPMX 3ZSUA 256BA 2XLVA 1B68A 3PHF2 4BJ6C 1A0BA 5JVEA 3S0XA 4DVYP 3GEHA 2R7XA 3H2UA 3RFYA 2A6HF 1ZW2A 4DXWA 4ANJA 1OW6A 3AGUA 3R2PA 4H4KC 4YT2A 1PCXA 2Y69C 2M4EA 3EZHA 2PNOA 2X51A 4YJWA 5DVWA 3U8PA 1VLSA 2OEXA 4BJ5C 1I4YA 1TWAA 1V54C 5JLIA 1BR1A 4OD5A 1ZHWA 4C3BA 5KYYA 1RXQA 2CDQA 2F22A 2KYHA 2PP4A 4IGGA 3V5ZA 3VRCA 1QZXA 3DXJF 2EPOA 3W4YA 3HTKC 5KYXA 3EJNA 4ONSA 4E7ZA 2OQMA 3O10A 3Q7LA 1ORSC 2WL8A 1CGOA 3NRHA 1O87A 4CJOA 5E3AA 3F46A 3NMJA 4MQ9F 1Z3IX 1C03A 4EUKB 2VASA 4YWQA 1E85A 3MYIA 2KJGA 2QE9A 4AK9A 3FDQA 4QDLA 3GM1A 4JEBA 2JPUA 1MMGA 2KC3A 4KNVA 2XL8A 2IXNA 4RBNA 4LDQA 5K0IA 3C8ZA 2A68F 2IOQA 3GEIA 2LFFA 5DQZA 3NYJA 1JR8A 1K05A 4NC3A 2ZXRA 2YKZA 3AGTA 3NG1A 4U5HA 1WOLA 4PR9A 4DRIB 4XEFA 2ZD9A 3IQ6A 4NY3A 3SP1A 3AQCA 4OIQF 3NKEA 5E2QA 2L81A 2Y3DA 2Q3TA 2XL4A 1Q0MA 4ULWA 4YL0A 1U89A 2KGOA 4Z9IA 5A6KA 5L0FA 2UUIA 4LDKA 1NLXA 3AQBA 2Q00A 4PJMA 1Y6DA 1FTSA 1VB5A 1E86A 3UGOA 2XM0A 2NUPB 2JX0A 3U2MA 2NUTB 4P9TA 3S28A 2Q4FA 3S29A 3H65A 1LI5A 1D0YA 2XS8A 3N24A 4OIPF 3C63A 3HKKA 3RIPA 4GEHA 2OG2A 4HE8D 3TOMA 1MMAA 2PFDA 3EHMA 3EGXA 3JYYA 1G4US 1HMDA 4CBEA 5DS6A 4XWJA 2HMQA 3M4CA 3N2ZB 4GQHA 1DOWA 1Z23A 2OOCA 2XRHA 1WN0A 2YZSA 4MW3A 3ZG1A 2C04A 3ASNC 4IAQA 4J7TA 4DOZA 5A6BD 2HJMA 4C3DA 2A69F 1LI7A 1YDIA 4U5CE 3U5SA 4MVQA 1E83A 1HE1A 1QPUA 1O5HA 2J0XA 1TR2A 3KH2A 2A0UA 1LS1A 3TD7A 4WJ0A 4EBBA 2CCYA 4E18A 4LLEA 1TQGA 2R7TA 2OKUA 1D1CA 3C8GB 3EHNA 3VAYA 3SNHA 2M64A 3G50A 3Q6MA 4MVMA 3ZC4A 3FVYA 3WAQA 1RMVA 1TFOB 2YLIA 4EKWA 4C7OA 4IJJA 1NZEA 1WGWA 4YK5A 4BEJA 5L0CA 2J0WA 1OXBA 4XEKA 5L3QA 2QY9A 2VCBA 5T3WA 2VCAA 1LPEA 5A6BA 3AOUA 1W2WA 2Q9CA 3DMDA 3TOLA 1XZQA 1L3PA 2IXMA 3EFOB 4JIOA 1XWJA 1TWHA 2L9JA 1OCCC 2WZLA 4IAOA 1RJ9B 3ASOC 1LS4A 1DOVA 1M2VB 3FHDA 3K1IC 5A6JA 2R7RA 4QI2A 1PD0A 5FCLA 4Q4ZF 3DWWA 1SMYF 2GDCA 1RCPA 1HW1A 5E33A 4I1OB 3U9JA 4DBQA 4K1OA 2ZXOA 1T6UA 2L6HA 2OU6A 3L8IA 3M15A 4U5DE 3FOPA 2XLEA 5F5HA 2GWWA 5KYYB 3G4ZA 1G5ZA 2IM8A 4CS8A 4D4NA 4U9DA 1MNEA 5A69A 1HY5A 4Q7CA 2ZPAA 2IBFA 4LDRA 5KYXB 3HJCA 4L6RA 1U0BB 1VLTA 1YA9A 2Y3HA 4P9FA 3JCUQ 3B29A 1JPNA 4MVOA 2KNHA 1JMWA 4MVSA 3ZQVA 1Z63A 3DZAA 1OCRC 3NMIA 1RKEA 4JZAA 2H7VC 3A11A 4CS8C 3LNMB 2DI3A 3H2VA 3MBGA 4PACA 5JS5A 4ZLDA 3NYLA 2P1AA 4ULVA 5BQHA 3PCVA 4F4BA 1V74B 1VYIA 2LD6A 2E87A 4XPYA 4PJLA 2ICWG 1A7EA 3ZIBA 4EHPA 1LIHA 4JURI 5HSWA 5COMA 2XS1A 4WGYA 4PJNA 4CDAA 3E70C 5F28E 2VB6A 3LS0A 1ORJA 1ZU4A 4MVRA 3U2LA 3MYFA 5B1BC 4MNDA 2XLOA 3MLGA 4G0HA 4PJJA 2G3VA 3QTHA 4O6YA 4PFOA 4B6IA 4CIPA 1SF8A 1OQCA 2WB7A 1C17M 2NSGA 1JRAA 3X1OA 2Z15A 3KYIA 3US6A 4JEAA 3GODA 2YRFA 2R7OA 4YT8A 4I44A 2CYDA 4JCZA
chains in the Genus database with same CATH topology
3QW1A 2YKZA 2YL1A 1BBHA 5JT4A 3IQ6A 4N6HA 4JE9A 4EIYA 2J9BA 1E86A 3NMKA 2XM0A 3C62A 3IQ5A 1CGNA 3C63A 3TOMA 4CJGA 2YL7A 3ZTZA 2XM4A 3HNKA 4ER9A 3M4CA 1YZAA 4JKVA 1QQ3A 4IAQA 1GQAA 2YL3A 1E84A 2XLDA 1E83A 3QVZA 1QPUA 5JUAA 1EKYA 1JAFA 2CCYA 2YL0A 2BC5A 2XLHA 3QW0A 1YYJA 2YLIA 3ZTMA 1MQVA 3DE8A 4N4WA 3FOOA 3L1MA 4WGZA 1M6TA 3TOLA 2XL6A 2XLWA 1S05A 4IB4A 5B3IA 3QVYA 3DE9A 5JP7A 1RCPA 3HNJA 1A7VA 1NBBA 4CDVA 3ZWIA 3M15A 3FOPA 2XLEA 1CPQA 4D4NA 2YLDA 3HNLA 4U9DA 2XLMA 4L6RA 3ZQYA 5JSLA 4CDYA 5AGFA 1APCA 256BA 2XLVA 3HNIA 3M79A 3ZQVA 3NMIA 5JVEA 5JS5A 4ULVA 4U9EA 2YLGA 3U8PA 3M4BA 5JLIA 4D4XA 1YZCA 4WGYA 3VRCA 2J8WA 4CDAA 5JRAA 1CGOA 4CJOA 4IARA 2XLOA 2QLAA 3NMJA 1E85A 1YYXA 4CIPA 1LM3B 1CPRA 4JEBA 4CX9A 2XL8A 4JEAA 4NC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QW1 A;  2YKZ A;  2YL1 A;  1BBH A;  5JT4 A;  3IQ6 A;  4N6H A;  4JE9 A;  4EIY A;  2J9B A;  1E86 A;  3NMK A;  2XM0 A;  3C62 A;  3IQ5 A;  1CGN A;  3C63 A;  3TOM A;  4CJG A;  2YL7 A;  3ZTZ A;  2XM4 A;  3HNK A;  4ER9 A;  3M4C A;  1YZA A;  4JKV A;  1QQ3 A;  4IAQ A;  1GQA A;  2YL3 A;  1E84 A;  2XLD A;  1E83 A;  3QVZ A;  1QPU A;  5JUA A;  1EKY A;  1JAF A;  2CCY A;  2YL0 A;  2BC5 A;  2XLH A;  3QW0 A;  1YYJ A;  2YLI A;  3ZTM A;  1MQV A;  3DE8 A;  4N4W A;  3FOO A;  3L1M A;  4WGZ A;  1M6T A;  3TOL A;  2XL6 A;  2XLW A;  1S05 A;  4IB4 A;  5B3I A;  3QVY A;  3DE9 A;  5JP7 A;  1RCP A;  3HNJ A;  1A7V A;  1NBB A;  4CDV A;  3ZWI A;  3M15 A;  3FOP A;  2XLE A;  1CPQ A;  4D4N A;  2YLD A;  3HNL A;  4U9D A;  2XLM A;  4L6R A;  3ZQY A;  5JSL A;  4CDY A;  5AGF A;  1APC A;  256B A;  2XLV A;  3HNI A;  3M79 A;  3ZQV A;  3NMI A;  5JVE A;  5JS5 A;  4ULV A;  4U9E A;  2YLG A;  3U8P A;  3M4B A;  5JLI A;  4D4X A;  1YZC A;  4WGY A;  3VRC A;  2J8W A;  4CDA A;  5JRA A;  1CGO A;  4CJO A;  4IAR A;  2XLO A;  2QLA A;  3NMJ A;  1E85 A;  1YYX A;  4CIP A;  1LM3 B;  1CPR A;  4JEB A;  4CX9 A;  2XL8 A;  4JEA A;  4NC3 A; 
#chains in the Genus database with same CATH topology
 3EGX B;  3QW1 A;  2YL1 A;  3CSK A;  3UMK A;  5JT4 A;  3ECS A;  3SXY A;  2R7U A;  4CS7 A;  1GS9 A;  5L0H A;  4N6H A;  2LP4 A;  1OCO C;  4KBL A;  4MVZ A;  3K7D A;  3KYJ A;  4JE9 A;  3JRM O;  4EIY A;  1I4Z A;  5TJ5 E;  2GAQ A;  3V7O A;  4AE4 A;  1SZI A;  3NMK A;  2MHR A;  3B0V C;  2EIL C;  1NSG B;  3L0I A;  2YVK A;  4FWV A;  4R32 A;  3X2Q C;  4CIH A;  1CGN A;  1ORY A;  2H7B A;  2P6V A;  4I1M A;  2HV6 A;  2Y3G A;  3EZI A;  3MX3 A;  2O9X A;  1ZHX A;  4YT5 A;  2R7S A;  1SYQ A;  4DRJ B;  4CJG A;  3RH3 A;  1Q0K A;  1ZHY A;  1OKK D;  4AL1 A;  2TMV P;  4C7O B;  3HNK A;  3LES A;  4ER9 A;  1RKC A;  2DB4 A;  2HJ3 A;  1QQ3 A;  4JKV A;  1NFO A;  4AX2 A;  3T6J A;  3CAX A;  4LLC A;  5D92 A;  2YL3 A;  3EG9 A;  2ASR A;  1BR4 A;  1KNY A;  3JT1 A;  1PV3 A;  2XLD A;  2LFD A;  1PD1 A;  3GEE A;  3RYL A;  3U8V A;  3T9O A;  1YVI A;  4FX5 A;  4PFP A;  1EKY A;  4XQ1 A;  5KYN A;  2V26 A;  3U3B A;  3JYH A;  3K6B A;  4E7S A;  4JCH A;  2YL0 A;  3WOD F;  1VYK A;  2R03 A;  3EPV A;  2XLH A;  3QW0 A;  1R5I D;  2YEV A;  2AWY A;  5KYW A;  3K33 A;  4W8P A;  1OKK A;  2YWA A;  3JTL O;  1TKN A;  1NU7 D;  4U5E E;  1MMD A;  4OIN F;  1YA7 O;  4E0H A;  1Q0F A;  3S9O A;  2QUP A;  2LIG A;  3LAY A;  1H9G A;  3TQO A;  2XL6 A;  1IZM A;  3IQT A;  3QZC A;  2KSF A;  3CEX A;  1V55 C;  1S05 A;  4O6N A;  4O79 A;  4IB4 A;  1FMW A;  2L6G A;  2UUH A;  3DE9 A;  3KPH A;  3NYM A;  3UR3 C;  5EGY A;  2XXA A;  4G7Z F;  4X0R A;  1A7V A;  1H6G A;  3BEH A;  2R7Q A;  2EPL X;  4RD9 A;  3FAJ A;  3GWL A;  1E2X A;  1U6H A;  3EGD A;  4U5B E;  5B3S C;  2PBE A;  2XLM A;  5T1D B;  2J9U A;  2P0N A;  2HMZ A;  3DAG A;  4CDY A;  1M56 C;  2OJE D;  2XSE A;  4XPW A;  1OW8 A;  5AGF A;  2ETS A;  4JVS A;  3AG3 C;  4KNW A;  3B0U X;  3M79 A;  3HNI A;  2J46 A;  4G7H F;  1HMO A;  3UGP A;  1XZP A;  2Y39 A;  1ZHZ A;  5HV9 A;  1VK5 A;  2NPU A;  2R02 A;  3RW0 A;  2P61 A;  4AL0 A;  2HSB A;  1G4W R;  4JJG A;  2OJQ A;  4XLN F;  1AVO B;  2YLG A;  2HUJ A;  3OA1 A;  2A0B A;  1C02 A;  4N6C A;  3RVZ A;  2A6E F;  4D4X A;  5CI9 A;  2J7P D;  3EQL F;  2VCC A;  4JTA B;  2J8W A;  2L7A A;  1MND A;  1VMA A;  1A41 A;  2Q9B A;  4OD4 A;  2FAP B;  5JRA A;  1FR0 A;  3O6X A;  2MWQ A;  1Y4C A;  3I5P A;  5IY5 C;  4MTO A;  3AJM A;  2AVK A;  2W4B A;  1ZVZ A;  2ZXP A;  2R25 A;  4AE4 B;  4QI0 A;  3LUT B;  1YYX A;  4U5G A;  4ZLC A;  5L0G A;  2KQ9 A;  2GFH A;  1CPR A;  2FFH A;  3O39 A;  1HW2 A;  1Q0D A;  3AG2 C;  3DM5 A;  2A1D D;  5GPG B;  2G62 A;  4XEV A;  1Z5Z A;  1AUE A;  2W45 A;  1Z7Q c;  1EA8 A;  4P6I C;  2J7P A;  4BEM J;  1BBH A;  1YJG A;  1YAU O;  3T4R A;  3LJB A;  3WG7 C;  1T9K A;  1OR2 A;  3SZR A;  2NSF A;  1AEP A;  1L7C A;  3I5Q A;  3JSZ A;  3Q7G A;  3FXH A;  1WTY A;  3RQF A;  2EIJ C;  2Y3B A;  5A6A A;  2OEV A;  1JPJ A;  1ZZP A;  3B0P A;  3EG9 B;  2W9Y A;  4JRZ A;  4HFK B;  2WVO A;  4E0I A;  4NCQ A;  3C8G D;  3C62 A;  2DGJ A;  3AG4 C;  3IQ5 A;  1BDJ B;  4K0D A;  2AWC A;  2D4U A;  4M63 A;  1HE9 A;  4HEA J;  3V5X A;  3POV A;  5AC4 A;  2QNL A;  3ABL C;  4Z9J A;  3KKB A;  4KC9 A;  5KYW B;  3DJN B;  2YL7 A;  4OIR F;  4C3E A;  5L0I A;  2H8A A;  1WWP A;  2XM4 A;  3W2V A;  1YZA A;  1IW7 F;  3LNR A;  2EPN A;  1WAT A;  1OW7 A;  3B9Q A;  3JRT A;  3TUL A;  2D5R B;  2G3K A;  1QVX A;  1GQA A;  2VC9 A;  3F47 A;  4MVU A;  2WVQ A;  3C8G A;  2DYS C;  5COG A;  2KK1 A;  5JUA A;  1WAS A;  1VOM A;  4G78 A;  4HFF B;  3LS1 A;  4BJ6 A;  3U3F A;  5L0D A;  2PF4 E;  3IEE A;  4A2N B;  3PMR A;  5EHH A;  2LSE A;  1YYJ A;  4J32 B;  1T6Q A;  4J7Y A;  1MQV A;  3K1H A;  3DE8 A;  4N4W A;  4Z9H A;  1RJ9 A;  3ZTM A;  1M57 C;  1M2V A;  4WGZ A;  1UFB A;  3HLZ A;  1M6T A;  4WAB A;  1H9T A;  2V3C C;  3IQC A;  4G7O F;  2LQG A;  5DS5 A;  5E3C A;  1S7Z A;  2I8B A;  3ABK C;  2WVN A;  3LLI A;  1D0Z A;  1OCZ C;  3M1C B;  3ZDL A;  1GM5 A;  1NFN A;  5F5F A;  3QVY A;  5JP7 A;  4CS9 A;  1T01 A;  3L34 A;  2Q7R A;  1CGM E;  2BL2 A;  4CDV A;  3J06 A;  3ATP A;  3B71 A;  1K40 A;  4IRU A;  4O6M A;  1CPQ A;  4A4A A;  1I5N A;  4MTG A;  3VF0 A;  3LEV A;  2YLD A;  3DM9 B;  4CS9 C;  5JSL A;  2EIM C;  4BPM A;  3S84 A;  3FAP B;  4DBR A;  2H7O A;  2IXP A;  3SYN A;  2YQY A;  1KTM A;  2RD9 A;  2HSQ A;  2W4M A;  4NTA A;  1FAP B;  5DLJ A;  3W8H A;  1BZ4 A;  4DRH B;  4Q5S F;  3W8I A;  1FFT C;  1Q0G A;  4EBJ A;  2R9R B;  5DS4 A;  5AC5 A;  4K7B A;  2J45 A;  5L3V A;  3W2W A;  2PX3 A;  3VYW A;  4U9E A;  4XPX A;  2CNW D;  5BUO A;  3TJ5 A;  3M4B A;  5KYU A;  3N0T A;  1RKE B;  2LCH A;  4YL3 A;  4NTB A;  1NG1 A;  4YN0 B;  3FMS A;  1YZC A;  4BJ1 A;  4EWC A;  4MTF A;  4XTK A;  4YL1 A;  3SEO A;  1YAR O;  4FES A;  5BQI A;  1R4T A;  2I15 A;  4LER A;  3RQE A;  4IAR A;  2C03 A;  4CSA A;  2QLA A;  3NKD A;  2P7V A;  3WHN A;  3SXK A;  3S27 A;  2PX0 A;  1LM3 B;  2AP3 A;  3NDB B;  4I3M A;  1MMN A;  2RSE B;  3DJU B;  3GAN A;  4CX9 A;  4W8K A;  4DVZ A;  2CNW A;  3SXM A;  5DQT A;  4BJ5 A;  3PDM P;  2ZXW C;  3MFN A;  1ZYR F;  1YLM A;  4CSA C;  1F1M A;  3KMI A;  3UNG C;  4XLP F;  3UMI A;  2B0J A;  3ITF A;  3OWT A;  2CGE A;  2WZG A;  2HZ8 A;  2JD3 A;  2HS5 A;  1D0X A;  3RKO F;  3SXZ A;  4FAP B;  1LKX A;  3GOR A;  3QMK A;  4U5F E;  4JJF A;  1H7I A;  1LE2 A;  2QTV A;  2WZF A;  3CZ6 A;  3L8J A;  4PK4 A;  2J9B A;  3GM2 A;  1FNT c;  2NG1 A;  4JW1 A;  1LE4 A;  3DKA A;  3EH1 A;  3LEO A;  4H54 A;  3LLK A;  3K1I A;  3IPM O;  2IYL D;  4JC7 A;  2MYS A;  1ZW3 A;  1A7D A;  3V5Y A;  3GWN A;  4J30 B;  4NTF A;  1ST6 A;  1T6I A;  3DI5 A;  5FZT A;  3ZVR A;  3S90 A;  5COF A;  3E9V A;  3DD7 A;  3ZTZ A;  5CIV A;  4BG0 A;  3EH2 A;  1V4A A;  4IWB A;  1SR2 A;  2VH3 A;  2EPK X;  1KU2 A;  3GM3 A;  2Q9A A;  4JTC B;  2HFI A;  2AU5 A;  3O55 A;  1D1A A;  4UDV A;  1E84 A;  2R7V A;  4LAC B;  2HKV A;  2FGY A;  3K66 A;  2NUP A;  3QVZ A;  3UMH A;  2CW0 F;  2EIN C;  3G4X A;  3CQZ A;  1D1B A;  1JAF A;  5B1A C;  2NUT A;  1M2O A;  1BR2 A;  1N1C A;  3TK0 A;  4OIO F;  2L6F A;  1J8M F;  3T6G B;  1LVK A;  2BC5 A;  2IXO A;  3ABM C;  3JZ0 A;  1QLE C;  4N06 A;  1UG7 A;  3JSE O;  1TWC A;  2LK4 A;  3DAF A;  1FFH A;  3I4U A;  1ZHT A;  2J9V A;  3TJ6 A;  2BE5 F;  3T6B A;  1OR3 A;  3BRJ A;  1VTM P;  4BJT A;  1Z6A A;  2KW3 C;  3RQG A;  2J9W A;  4MS2 A;  5D91 A;  1TWG A;  3FOO A;  3U0C A;  2R7W A;  3L1M A;  4JTD B;  5BQG A;  3U9M A;  1QSP A;  3RF3 A;  5CI8 A;  4MW8 A;  1ZU5 A;  1K04 A;  2R05 A;  4O7G A;  3C7J A;  1TFK B;  4E17 A;  3AG1 C;  3OEO A;  3A9C A;  2XLW A;  2HV7 A;  1O3U A;  1GGQ A;  4KI2 A;  2YHS A;  5B3I A;  5T3T A;  1QKR A;  1JOG A;  1T5O A;  1EQ1 A;  3HNJ A;  1NBB A;  1J8Y F;  1NU9 C;  2B0H A;  3ZWI A;  4EBK A;  5L0J A;  5KYU B;  2OCC C;  3R7C A;  2EIK C;  1OXK A;  1FMV A;  3C18 A;  2XXA B;  3HNL A;  2GA0 A;  4DJ9 A;  3VM6 A;  1G8X A;  4NQF A;  4RDA A;  3ZQY A;  4YT4 A;  3Q6N A;  3RVY A;  4GYT A;  5EK0 A;  3EFO A;  1APC A;  1EI7 A;  2DYR C;  3EGD B;  3KL4 A;  2X0C A;  3IHU A;  2EPM X;  3ZSU A;  256B A;  2XLV A;  1B68 A;  3PHF 2;  4BJ6 C;  1A0B A;  5JVE A;  3S0X A;  4DVY P;  3GEH A;  2R7X A;  3H2U A;  3RFY A;  2A6H F;  1ZW2 A;  4DXW A;  4ANJ A;  1OW6 A;  3AGU A;  3R2P A;  4H4K C;  4YT2 A;  1PCX A;  2Y69 C;  2M4E A;  3EZH A;  2PNO A;  2X51 A;  4YJW A;  5DVW A;  3U8P A;  1VLS A;  2OEX A;  4BJ5 C;  1I4Y A;  1TWA A;  1V54 C;  5JLI A;  1BR1 A;  4OD5 A;  1ZHW A;  4C3B A;  5KYY A;  1RXQ A;  2CDQ A;  2F22 A;  2KYH A;  2PP4 A;  4IGG A;  3V5Z A;  3VRC A;  1QZX A;  3DXJ F;  2EPO A;  3W4Y A;  3HTK C;  5KYX A;  3EJN A;  4ONS A;  4E7Z A;  2OQM A;  3O10 A;  3Q7L A;  1ORS C;  2WL8 A;  1CGO A;  3NRH A;  1O87 A;  4CJO A;  5E3A A;  3F46 A;  3NMJ A;  4MQ9 F;  1Z3I X;  1C03 A;  4EUK B;  2VAS A;  4YWQ A;  1E85 A;  3MYI A;  2KJG A;  2QE9 A;  4AK9 A;  3FDQ A;  4QDL A;  3GM1 A;  4JEB A;  2JPU A;  1MMG A;  2KC3 A;  4KNV A;  2XL8 A;  2IXN A;  4RBN A;  4LDQ A;  5K0I A;  3C8Z A;  2A68 F;  2IOQ A;  3GEI A;  2LFF A;  5DQZ A;  3NYJ A;  1JR8 A;  1K05 A;  4NC3 A;  2ZXR A;  2YKZ A;  3AGT A;  3NG1 A;  4U5H A;  1WOL A;  4PR9 A;  4DRI B;  4XEF A;  2ZD9 A;  3IQ6 A;  4NY3 A;  3SP1 A;  3AQC A;  4OIQ F;  3NKE A;  5E2Q A;  2L81 A;  2Y3D A;  2Q3T A;  2XL4 A;  1Q0M A;  4ULW A;  4YL0 A;  1U89 A;  2KGO A;  4Z9I A;  5A6K A;  5L0F A;  2UUI A;  4LDK A;  1NLX A;  3AQB A;  2Q00 A;  4PJM A;  1Y6D A;  1FTS A;  1VB5 A;  1E86 A;  3UGO A;  2XM0 A;  2NUP B;  2JX0 A;  3U2M A;  2NUT B;  4P9T A;  3S28 A;  2Q4F A;  3S29 A;  3H65 A;  1LI5 A;  1D0Y A;  2XS8 A;  3N24 A;  4OIP F;  3C63 A;  3HKK A;  3RIP A;  4GEH A;  2OG2 A;  4HE8 D;  3TOM A;  1MMA A;  2PFD A;  3EHM A;  3EGX A;  3JYY A;  1G4U S;  1HMD A;  4CBE A;  5DS6 A;  4XWJ A;  2HMQ A;  3M4C A;  3N2Z B;  4GQH A;  1DOW A;  1Z23 A;  2OOC A;  2XRH A;  1WN0 A;  2YZS A;  4MW3 A;  3ZG1 A;  2C04 A;  3ASN C;  4IAQ A;  4J7T A;  4DOZ A;  5A6B D;  2HJM A;  4C3D A;  2A69 F;  1LI7 A;  1YDI A;  4U5C E;  3U5S A;  4MVQ A;  1E83 A;  1HE1 A;  1QPU A;  1O5H A;  2J0X A;  1TR2 A;  3KH2 A;  2A0U A;  1LS1 A;  3TD7 A;  4WJ0 A;  4EBB A;  2CCY A;  4E18 A;  4LLE A;  1TQG A;  2R7T A;  2OKU A;  1D1C A;  3C8G B;  3EHN A;  3VAY A;  3SNH A;  2M64 A;  3G50 A;  3Q6M A;  4MVM A;  3ZC4 A;  3FVY A;  3WAQ A;  1RMV A;  1TFO B;  2YLI A;  4EKW A;  4C7O A;  4IJJ A;  1NZE A;  1WGW A;  4YK5 A;  4BEJ A;  5L0C A;  2J0W A;  1OXB A;  4XEK A;  5L3Q A;  2QY9 A;  2VCB A;  5T3W A;  2VCA A;  1LPE A;  5A6B A;  3AOU A;  1W2W A;  2Q9C A;  3DMD A;  3TOL A;  1XZQ A;  1L3P A;  2IXM A;  3EFO B;  4JIO A;  1XWJ A;  1TWH A;  2L9J A;  1OCC C;  2WZL A;  4IAO A;  1RJ9 B;  3ASO C;  1LS4 A;  1DOV A;  1M2V B;  3FHD A;  3K1I C;  5A6J A;  2R7R A;  4QI2 A;  1PD0 A;  5FCL A;  4Q4Z F;  3DWW A;  1SMY F;  2GDC A;  1RCP A;  1HW1 A;  5E33 A;  4I1O B;  3U9J A;  4DBQ A;  4K1O A;  2ZXO A;  1T6U A;  2L6H A;  2OU6 A;  3L8I A;  3M15 A;  4U5D E;  3FOP A;  2XLE A;  5F5H A;  2GWW A;  5KYY B;  3G4Z A;  1G5Z A;  2IM8 A;  4CS8 A;  4D4N A;  4U9D A;  1MNE A;  5A69 A;  1HY5 A;  4Q7C A;  2ZPA A;  2IBF A;  4LDR A;  5KYX B;  3HJC A;  4L6R A;  1U0B B;  1VLT A;  1YA9 A;  2Y3H A;  4P9F A;  3JCU Q;  3B29 A;  1JPN A;  4MVO A;  2KNH A;  1JMW A;  4MVS A;  3ZQV A;  1Z63 A;  3DZA A;  1OCR C;  3NMI A;  1RKE A;  4JZA A;  2H7V C;  3A11 A;  4CS8 C;  3LNM B;  2DI3 A;  3H2V A;  3MBG A;  4PAC A;  5JS5 A;  4ZLD A;  3NYL A;  2P1A A;  4ULV A;  5BQH A;  3PCV A;  4F4B A;  1V74 B;  1VYI A;  2LD6 A;  2E87 A;  4XPY A;  4PJL A;  2ICW G;  1A7E A;  3ZIB A;  4EHP A;  1LIH A;  4JUR I;  5HSW A;  5COM A;  2XS1 A;  4WGY A;  4PJN A;  4CDA A;  3E70 C;  5F28 E;  2VB6 A;  3LS0 A;  1ORJ A;  1ZU4 A;  4MVR A;  3U2L A;  3MYF A;  5B1B C;  4MND A;  2XLO A;  3MLG A;  4G0H A;  4PJJ A;  2G3V A;  3QTH A;  4O6Y A;  4PFO A;  4B6I A;  4CIP A;  1SF8 A;  1OQC A;  2WB7 A;  1C17 M;  2NSG A;  1JRA A;  3X1O A;  2Z15 A;  3KYI A;  3US6 A;  4JEA A;  3GOD A;  2YRF A;  2R7O A;  4YT8 A;  4I44 A;  2CYD A;  4JCZ A; 
#chains in the Genus database with same CATH homology
 3QW1 A;  2YKZ A;  2YL1 A;  1BBH A;  5JT4 A;  3IQ6 A;  4N6H A;  4JE9 A;  4EIY A;  2J9B A;  1E86 A;  3NMK A;  2XM0 A;  3C62 A;  3IQ5 A;  1CGN A;  3C63 A;  3TOM A;  4CJG A;  2YL7 A;  3ZTZ A;  2XM4 A;  3HNK A;  4ER9 A;  3M4C A;  1YZA A;  4JKV A;  1QQ3 A;  4IAQ A;  1GQA A;  2YL3 A;  1E84 A;  2XLD A;  1E83 A;  3QVZ A;  1QPU A;  5JUA A;  1EKY A;  1JAF A;  2CCY A;  2YL0 A;  2BC5 A;  2XLH A;  3QW0 A;  1YYJ A;  2YLI A;  3ZTM A;  1MQV A;  3DE8 A;  4N4W A;  3FOO A;  3L1M A;  4WGZ A;  1M6T A;  3TOL A;  2XL6 A;  2XLW A;  1S05 A;  4IB4 A;  5B3I A;  3QVY A;  3DE9 A;  5JP7 A;  1RCP A;  3HNJ A;  1A7V A;  1NBB A;  4CDV A;  3ZWI A;  3M15 A;  3FOP A;  2XLE A;  1CPQ A;  4D4N A;  2YLD A;  3HNL A;  4U9D A;  2XLM A;  4L6R A;  3ZQY A;  5JSL A;  4CDY A;  5AGF A;  1APC A;  256B A;  2XLV A;  3HNI A;  3M79 A;  3ZQV A;  3NMI A;  5JVE A;  5JS5 A;  4ULV A;  4U9E A;  2YLG A;  3U8P A;  3M4B A;  5JLI A;  4D4X A;  1YZC A;  4WGY A;  3VRC A;  2J8W A;  4CDA A;  5JRA A;  1CGO A;  4CJO A;  4IAR A;  2XLO A;  2QLA A;  3NMJ A;  1E85 A;  1YYX A;  4CIP A;  1LM3 B;  1CPR A;  4JEB A;  4CX9 A;  2XL8 A;  4JEA A;  4NC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...