3JSEO

Crystal structure of archaeal 20s proteasome in complex with mutated p26 activator
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
228
structure length
218
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAAEAHGVIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDNLGVAVQHAVLKIIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRTGTDHMFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase activator
molecule keywords Proteasome subunit alpha
publication title Structural models for interactions between the 20S proteasome and its PAN/19S activators.
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 84
structure length 218
sequence length 228
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 3jseO01
1YARO 3JSEO 1YA7O 1AVOB 3IPMO 3JTLO 3JRMO 1YAUO 1Z7Qc 1FNTc
chains in the Genus database with same CATH superfamily
1OXBA 2GAQA 1ORSC 2Q00A 3Q7GA 2LCHA 3X1OA 1PCXA 2A6HF 5JLIA 1NG1A 2ASRA 3M1CB 5KYYB 4WABA 3TJ6A 3K66A 4U9DA 3NMIA 1C02A 3SXKA 1VTMP 4O7GA 1Z63A 1YAUO 3EJNA 5A6JA 3POVA 1H6GA 4LLCA 1YVIA 2Y3GA 1W2WA 3MLGA 5JS5A 1RCPA 2FFHA 4N4WA 4MVRA 2Q4FA 5DLJA 4AE4A 2OQMA 2IBFA 4Q4ZF 2DYSC 4BJ6C 3E9VA 5DS6A 3S84A 1EKYA 3ZIBA 1BR2A 1R4TA 4HEAJ 3WHNA 4EBJA 3EH2A 4CS7A 1LS4A 2XL8A 4GEHA 2HSQA 3MBGA 4U5HA 1HE1A 3DJUB 3Q6MA 1GQAA 3MYFA 3WAQA 1E2XA 2HKVA 1NFNA 3K6BA 2HUJA 3V7OA 4XLNF 2BL2A 2FGYA 4JVSA 3KYJA 4PJLA 2PX0A 5F5HA 1O87A 2J45A 2KGOA 3KKBA 2VC9A 3NYMA 4JTAB 3C18A 3CEXA 3EG9B 5T3TA 1OCOC 2W45A 3B9QA 4GYTA 2XLDA 1M6TA 4K0DA 1TWGA 4LDRA 4NTFA 5JSLA 5A69A 3S28A 4U5FE 1AVOB 3QZCA 4DRHB 2V26A 2MYSA 3RW0A 1Q0KA 1H9TA 1BDJB 1L3PA 3DXJF 4KC9A 1M56C 3NKEA 3RYLA 256BA 2RD9A 4MTFA 4G7HF 3C7JA 3EGXB 4I44A 1A41A 2DGJA 4PJJA 4C3DA 3IQTA 3ZSUA 2L6FA 3LEOA 5L3QA 1MMNA 4K1OA 4XEKA 3RQFA 3PDMP 2KW3C 4NC3A 3AG1C 3QMKA 3QVYA 3B29A 3JTLO 1M2VB 1OCZC 3QW0A 2MHRA 3LJBA 3HTKC 4K7BA 4P6IC 3UGOA 2R7TA 4YL3A 2YZSA 1RKCA 2HS5A 2HMZA 3C8GB 1I4YA 3RQEA 4Q7CA 2YL3A 3AG4C 3LLIA 2IXOA 1OR2A 3K1IA 3WG7C 4NTBA 2EPNA 1YYJA 2J46A 1WOLA 2BC5A 2OOCA 1OXKA 3DM5A 3MFNA 2XLOA 3GEHA 2A68F 5COFA 1ST6A 3U0CA 4XPXA 3NDBB 2R03A 4MVZA 2FAPB 4PFPA 3JSEO 3EG9A 5BQGA 1WTYA 2YLIA 1EA8A 2D4UA 1I5NA 1S7ZA 2YVKA 4I1OB 5JP7A 4U5DE 1JOGA 1OKKA 4KNVA 2GDCA 1VMAA 2VCBA 3PHF2 2GA0A 1RXQA 3JYYA 3LS0A 4O6YA 4UDVA 1H7IA 2PFDA 3Q7LA 3FOPA 2ZD9A 4LLEA 1K04A 4IGGA 1JPNA 3H2UA 2XS1A 4O6NA 3EGXA 2C03A 3LLKA 4YT4A 2MWQA 2Q9BA 3IHUA 5KYUB 2R7UA 2D5RB 2DI3A 3MX3A 4JJFA 2VCCA 3ECSA 4N6HA 4C3BA 4DJ9A 5E2QA 3DM9B 4EUKB 2CYDA 4CSAA 1L7CA 3U9JA 5AC4A 1A7EA 2H8AA 1ZVZA 4P9FA 1PV3A 3JT1A 1QPUA 4D4XA 4EIYA 3PCVA 1EI7A 2KYHA 4O79A 4CDVA 1M2VA 3AJMA 3VF0A 4AE4B 4B6IA 5K0IA 4XPYA 3N0TA 4PJNA 3S90A 3HNJA 1BBHA 1LKXA 1CGME 2ZPAA 1HE9A 1JR8A 3RF3A 5B3SC 3C8GA 2F22A 4XEVA 2J9UA 4IAOA 4OIOF 4Z9HA 2R7XA 2EILC 2OG2A 4FESA 4XPWA 4CDYA 2H7BA 2NG1A 2HJMA 3T6JA 3GWNA 4YT5A 4J7TA 1SF8A 3ZWIA 1JPJA 4YJWA 3U3FA 1G5ZA 3UGPA 4ZLDA 1I4ZA 5FZTA 2P0NA 2EPKX 1D1BA 2OJED 5L0HA 2NUPB 3FHDA 3W8IA 4DRIB 2PBEA 1WN0A 4I1MA 2R05A 3CZ6A 4I3MA 4J32B 2DB4A 1YLMA 3F46A 4LERA 4BJTA 4DXWA 2YL0A 3BRJA 4RBNA 1H9GA 1Q0DA 3U9MA 3PMRA 3JYHA 2XLEA 4H4KC 4MTOA 4CS8A 1GM5A 3NYJA 4G7OF 1XWJA 3IQ6A 2NUTB 5L3VA 4A4AA 1V55C 2OEXA 5KYUA 4F4BA 2YL1A 5T3WA 4ZLCA 1OR3A 2IYLD 3O39A 2J9BA 3VM6A 2OEVA 1K05A 2M64A 3QW1A 3TJ5A 4WJ0A 1LE4A 1A7DA 1QQ3A 2C04A 2H7OA 4JCHA 4PFOA 1S05A 5EK0A 3A11A 2A1DD 2EINC 1LE2A 4JTCB 2Q9AA 2YEVA 3UMHA 2B0HA 1T6UA 2WB7A 1ORJA 1QLEC 1QZXA 2UUIA 3ZC4A 2ZXWC 3KYIA 4LDKA 1BR1A 3V5YA 2VASA 2HJ3A 2ZXPA 5TJ5E 2HV6A 5D92A 4JEBA 3EH1A 5AGFA 1FFHA 1RJ9B 3ZQVA 5BUOA 3U5SA 4DRJB 1M2OA 3L1MA 2NUPA 2J8WA 3A9CA 2VH3A 3DMDA 2JX0A 4R32A 1B68A 3SYNA 2R02A 3ZQYA 2XXAB 1T01A 1LM3B 2HMQA 4PACA 1PD0A 2PNOA 5A6BD 3ABKC 1O3UA 5A6BA 1ZHXA 4OIPF 3AGTA 1BZ4A 4Q5SF 3CAXA 4H54A 2YLGA 4QI2A 4EBKA 1D0ZA 5D91A 3M15A 4OIQF 1JMWA 3O6XA 5A6KA 2NUTA 3WODF 2AWYA 2ZXOA 5B3IA 2XLVA 2X0CA 3ZTZA 4D4NA 5DQTA 3T6BA 4C3EA 4QDLA 4HFKB 3VAYA 3W8HA 4BJ5C 4HE8D 3SXYA 2XSEA 3OEOA 2V3CC 4QI0A 1T6QA 2KSFA 1OCCC 3RH3A 2P1AA 1M57C 2IXMA 2EPMX 1T5OA 2KK1A 5E3AA 4DVZA 1WGWA 3CSKA 4G0HA 3SNHA 1D0YA 1Z6AA 1K40A 1FNTc 4JC7A 2J7PD 4E7SA 1VK5A 2J7PA 5A6AA 3OWTA 1HY5A 3IQCA 4MNDA 4E0IA 5L0GA 4C7OB 4KI2A 1APCA 1MMAA 2R25A 1BR4A 2XLMA 4EKWA 2OJQA 4YT8A 5EGYA 1ZHWA 2J9VA 3DWWA 3FOOA 5GPGB 5CIVA 2XL4A 2IXNA 5DVWA 3UR3C 1RJ9A 2WVNA 4JRZA 1SZIA 1VYKA 2WZLA 4MVMA 5B1AC 4ER9A 4BG0A 4XQ1A 3LNRA 2IXPA 1FMVA 3RQGA 2XXAA 5FCLA 3I5QA 2Z15A 4MTGA 3S9OA 1YYXA 2Q9CA 3ABLC 3IPMO 3N2ZB 2KJGA 3DZAA 3LNMB 3T6GB 3V5XA 4FAPB 3L0IA 1SMYF 5KYWA 2QTVA 3IEEA 1OKKD 1G4US 1MNDA 3DAGA 4ULWA 2R9RB 3K1HA 4PK4A 4BPMA 1GGQA 4BEMJ 3B71A 3JRTA 1JRAA 1CGNA 2E87A 2R7OA 4DBQA 2EPLX 3G4ZA 4CSAC 2J0WA 4KNWA 3RVYA 2LIGA 3VYWA 1IZMA 2HV7A 4CDAA 5KYNA 3FXHA 2DYRC 1Z3IX 4HFFB 2W4BA 4OD4A 5JT4A 3GEEA 3TOMA 5BQIA 1C03A 2YLDA 4JEAA 5KYXB 3U2LA 1Y6DA 2NSFA 3DE9A 2Y3DA 1N1CA 2A69F 1RKEB 3OA1A 4CIHA 1LIHA 2A0UA 1NZEA 4ONSA 1Q0MA 1ZHTA 4E7ZA 4XLPF 1U0BB 1MNEA 1YDIA 4MVQA 3IQ5A 3SEOA 3H65A 1ZU4A 3GANA 3C8GD 4Z9JA 4A2NB 5DS4A 1MMDA 4CS9A 4DVYP 3EQLF 4NTAA 5B1BC 3GORA 2P61A 3HNKA 3M79A 5E33A 2RSEB 3UMKA 3AQBA 4BJ1A 5JUAA 4EHPA 1GS9A 1Z5ZA 3ATPA 4C7OA 2CGEA 2WVQA 1ZU5A 3VRCA 1LPEA 1DOWA 3T4RA 2L6GA 3M4BA 2KC3A 5HV9A 3O55A 1E86A 1TFOB 2JD3A 2I8BA 2XLHA 3G4XA 3DJNB 4FWVA 2NPUA 4EBBA 1ZHYA 2L81A 1FAPB 3W2VA 4MW3A 1V74B 1LI5A 2L6HA 1QKRA 1VLTA 3NKDA 1Q0GA 2OCCC 3TULA 4P9TA 2G3VA 1ZHZA 1AEPA 1OCRC 1CGOA 2CNWA 2CNWD 2HFIA 3HLZA 3KH2A 1ZZPA 4JW1A 1RMVA 4O6MA 4E17A 5L0JA 2LFFA 3SXZA 3AG2C 2Y3HA 2L7AA 4JCZA 5BQHA 3JRMO 3JZ0A 4U5EE 1NBBA 1NLXA 3CQZA 3LS1A 1HW2A 1TWCA 2PP4A 1F1MA 2Q3TA 4AL0A 4U5BE 5HSWA 5KYXA 1E85A 4JZAA 3EFOA 3LUTB 1ZW3A 3N24A 3O10A 1Z7Qc 1T9KA 1TWAA 1RKEA 2X51A 2R7VA 2W9YA 3G50A 3L34A 3FAPB 3EGDA 4MVUA 1G4WR 1WASA 1UG7A 4RDAA 4NCQA 2R7WA 1V54C 1XZPA 1G8XA 3E70C 3FAJA 3TOLA 3ASOC 3R2PA 3TD7A 4AX2A 2YKZA 2H7VC 3I4UA 1WATA 1D1AA 2AWCA 4E18A 4YN0B 3RKOF 3US6A 3DAFA 1ORYA 1YA7O 1OW7A 1D1CA 3AG3C 5L0IA 1OW6A 2AVKA 5F28E 3UMIA 4U9EA 4YL1A 3MYIA 5L0CA 4WGZA 1TQGA 4LACB 4IB4A 4N06A 2BE5F 2WL8A 2XM0A 2YHSA 3SXMA 2ICWG 3AOUA 2Y69C 4N6CA 4U5GA 4KBLA 3ZTMA 5E3CA 1HMOA 3LEVA 4CJOA 5KYWB 1A7VA 1FFTC 2QE9A 3KPHA 1FTSA 2XLWA 1Z23A 2AP3A 3DD7A 4CIPA 1ZYRF 1VLSA 2Q7RA 3JSZA 4MS2A 3L8IA 4BJ6A 3GM3A 4IARA 2IM8A 3L8JA 2GWWA 4NQFA 1KNYA 3EPVA 3UNGC 2IOQA 2G3KA 2EIJC 3DE8A 1CPQA 2YL7A 1V4AA 2ZXRA 1CPRA 1R5ID 4XEFA 2JPUA 4OIRF 3R7CA 2YWAA 2ETSA 3EHNA 3LAYA 2I15A 4U5CE 5COGA 2CCYA 3S29A 5JRAA 1PD1A 4G7ZF 2TMVP 3F47A 1A0BA 2WZGA 1LS1A 4J30B 2QY9A 5DS5A 4G78A 1O5HA 5T1DB 3FDQA 3V5ZA 2W4MA 1YA9A 2QNLA 3AGUA 5CI8A 3K1IC 2R7QA 2HSBA 4XWJA 1EQ1A 3FMSA 3KL4A 1OW8A 1IW7F 1FMWA 1QVXA 3GEIA 4YK5A 1E84A 4IJJA 3HJCA 5KYYA 1VYIA 3ASNC 2KNHA 2R7RA 1FR0A 3U8PA 2Y39A 3T9OA 1YJGA 5COMA 5L0DA 2LD6A 2A0BA 3HKKA 3DI5A 4AL1A 2G62A 3EHMA 3I5PA 4AK9A 4W8KA 4CBEA 1XZQA 4BJ5A 3SZRA 2P6VA 3NG1A 4BEJA 1YARO 2QUPA 3K33A 1HW1A 3H2VA 2M4EA 4YWQA 3B0UX 2OU6A 1AUEA 3GM1A 1C17M 1JAFA 4ANJA 5L0FA 2P7VA 3QVZA 3NMKA 2GFHA 1KU2A 1YZAA 3QTHA 1U6HA 4M63A 5AC5A 4X0RA 2PF4E 5DQZA 4JKVA 1QSPA 4CX9A 3HNLA 2QLAA 4MW8A 4OD5A 4E0HA 4ULVA 1YZCA 4MVSA 4Z9IA 4OINF 2R7SA 2B0JA 2O9XA 1SR2A 1LI7A 4FX5A 4IRUA 3U2MA 5CI9A 4EWCA 4XTKA 3EFOB 1ZW2A 1E83A 1VOMA 2CW0F 3W2WA 4JIOA 4CS9C 2VB6A 2VCAA 2XL6A 4YT2A 3EGDB 3U8VA 1D0XA 3W4YA 4J7YA 1TKNA 4W8PA 2Y3BA 3FVYA 4NY3A 1NFOA 3X2QC 2LQGA 3NYLA 5F5FA 4IAQA 4JJGA 3RFYA 1MQVA 2AU5A 1DOVA 4JURI 1SYQA 2EIMC 2J9WA 2PX3A 3KMIA 2HZ8A 1VB5A 2LSEA 3ZG1A 2KQ9A 2WZFA 3U3BA 3ABMC 1WWPA 2CDQA 4GQHA 3RVZA 5EHHA 1T6IA 2EPOA 2LK4A 4RD9A 3ZDLA 5JVEA 4L6RA 3BEHA 2OKUA 3AQCA 4CJGA 4WGYA 1Y4CA 3HNIA 3M4CA 4CS8C 3B0PA 1NU9C 2UUHA 3K7DA 2XM4A 2LFDA 3JCUQ 2L9JA 3DKAA 2J0XA 1OQCA 3GM2A 4YL0A 3RIPA 1Q0FA 1TWHA 3ITFA 1TR2A 3S27A 1J8MF 1LVKA 3B0VC 1KTMA 3EZHA 4MVOA 2NSGA 2YRFA 3C62A 3C63A 4JTDB 4LDQA 3TK0A 3GODA 3C8ZA 3ZVRA 1U89A 4DBRA 2A6EF 3NMJA 3J06A 3NRHA 5IY5C 4JE9A 1UFBA 2XS8A 1HMDA 2LP4A 3GWLA 1NSGB 3LESA 3S0XA 2EIKC 2WVOA 4IWBA 1TFKB 4PR9A 4MQ9F 1J8YF 2XRHA 3EZIA 1NU7D 4DOZA 3SP1A 3TQOA 2YQYA 3Q6NA 4PJMA 1MMGA
chains in the Genus database with same CATH topology
1YARO 3JSEO 1YA7O 1AVOB 3IPMO 3JTLO 3JRMO 1YAUO 1Z7Qc 1FNTc
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YAR O;  3JSE O;  1YA7 O;  1AVO B;  3IPM O;  3JTL O;  3JRM O;  1YAU O;  1Z7Q c;  1FNT c; 
#chains in the Genus database with same CATH topology
 1OXB A;  2GAQ A;  1ORS C;  2Q00 A;  3Q7G A;  2LCH A;  3X1O A;  1PCX A;  2A6H F;  5JLI A;  1NG1 A;  2ASR A;  3M1C B;  5KYY B;  4WAB A;  3TJ6 A;  3K66 A;  4U9D A;  3NMI A;  1C02 A;  3SXK A;  1VTM P;  4O7G A;  1Z63 A;  1YAU O;  3EJN A;  5A6J A;  3POV A;  1H6G A;  4LLC A;  1YVI A;  2Y3G A;  1W2W A;  3MLG A;  5JS5 A;  1RCP A;  2FFH A;  4N4W A;  4MVR A;  2Q4F A;  5DLJ A;  4AE4 A;  2OQM A;  2IBF A;  4Q4Z F;  2DYS C;  4BJ6 C;  3E9V A;  5DS6 A;  3S84 A;  1EKY A;  3ZIB A;  1BR2 A;  1R4T A;  4HEA J;  3WHN A;  4EBJ A;  3EH2 A;  4CS7 A;  1LS4 A;  2XL8 A;  4GEH A;  2HSQ A;  3MBG A;  4U5H A;  1HE1 A;  3DJU B;  3Q6M A;  1GQA A;  3MYF A;  3WAQ A;  1E2X A;  2HKV A;  1NFN A;  3K6B A;  2HUJ A;  3V7O A;  4XLN F;  2BL2 A;  2FGY A;  4JVS A;  3KYJ A;  4PJL A;  2PX0 A;  5F5H A;  1O87 A;  2J45 A;  2KGO A;  3KKB A;  2VC9 A;  3NYM A;  4JTA B;  3C18 A;  3CEX A;  3EG9 B;  5T3T A;  1OCO C;  2W45 A;  3B9Q A;  4GYT A;  2XLD A;  1M6T A;  4K0D A;  1TWG A;  4LDR A;  4NTF A;  5JSL A;  5A69 A;  3S28 A;  4U5F E;  1AVO B;  3QZC A;  4DRH B;  2V26 A;  2MYS A;  3RW0 A;  1Q0K A;  1H9T A;  1BDJ B;  1L3P A;  3DXJ F;  4KC9 A;  1M56 C;  3NKE A;  3RYL A;  256B A;  2RD9 A;  4MTF A;  4G7H F;  3C7J A;  3EGX B;  4I44 A;  1A41 A;  2DGJ A;  4PJJ A;  4C3D A;  3IQT A;  3ZSU A;  2L6F A;  3LEO A;  5L3Q A;  1MMN A;  4K1O A;  4XEK A;  3RQF A;  3PDM P;  2KW3 C;  4NC3 A;  3AG1 C;  3QMK A;  3QVY A;  3B29 A;  3JTL O;  1M2V B;  1OCZ C;  3QW0 A;  2MHR A;  3LJB A;  3HTK C;  4K7B A;  4P6I C;  3UGO A;  2R7T A;  4YL3 A;  2YZS A;  1RKC A;  2HS5 A;  2HMZ A;  3C8G B;  1I4Y A;  3RQE A;  4Q7C A;  2YL3 A;  3AG4 C;  3LLI A;  2IXO A;  1OR2 A;  3K1I A;  3WG7 C;  4NTB A;  2EPN A;  1YYJ A;  2J46 A;  1WOL A;  2BC5 A;  2OOC A;  1OXK A;  3DM5 A;  3MFN A;  2XLO A;  3GEH A;  2A68 F;  5COF A;  1ST6 A;  3U0C A;  4XPX A;  3NDB B;  2R03 A;  4MVZ A;  2FAP B;  4PFP A;  3JSE O;  3EG9 A;  5BQG A;  1WTY A;  2YLI A;  1EA8 A;  2D4U A;  1I5N A;  1S7Z A;  2YVK A;  4I1O B;  5JP7 A;  4U5D E;  1JOG A;  1OKK A;  4KNV A;  2GDC A;  1VMA A;  2VCB A;  3PHF 2;  2GA0 A;  1RXQ A;  3JYY A;  3LS0 A;  4O6Y A;  4UDV A;  1H7I A;  2PFD A;  3Q7L A;  3FOP A;  2ZD9 A;  4LLE A;  1K04 A;  4IGG A;  1JPN A;  3H2U A;  2XS1 A;  4O6N A;  3EGX A;  2C03 A;  3LLK A;  4YT4 A;  2MWQ A;  2Q9B A;  3IHU A;  5KYU B;  2R7U A;  2D5R B;  2DI3 A;  3MX3 A;  4JJF A;  2VCC A;  3ECS A;  4N6H A;  4C3B A;  4DJ9 A;  5E2Q A;  3DM9 B;  4EUK B;  2CYD A;  4CSA A;  1L7C A;  3U9J A;  5AC4 A;  1A7E A;  2H8A A;  1ZVZ A;  4P9F A;  1PV3 A;  3JT1 A;  1QPU A;  4D4X A;  4EIY A;  3PCV A;  1EI7 A;  2KYH A;  4O79 A;  4CDV A;  1M2V A;  3AJM A;  3VF0 A;  4AE4 B;  4B6I A;  5K0I A;  4XPY A;  3N0T A;  4PJN A;  3S90 A;  3HNJ A;  1BBH A;  1LKX A;  1CGM E;  2ZPA A;  1HE9 A;  1JR8 A;  3RF3 A;  5B3S C;  3C8G A;  2F22 A;  4XEV A;  2J9U A;  4IAO A;  4OIO F;  4Z9H A;  2R7X A;  2EIL C;  2OG2 A;  4FES A;  4XPW A;  4CDY A;  2H7B A;  2NG1 A;  2HJM A;  3T6J A;  3GWN A;  4YT5 A;  4J7T A;  1SF8 A;  3ZWI A;  1JPJ A;  4YJW A;  3U3F A;  1G5Z A;  3UGP A;  4ZLD A;  1I4Z A;  5FZT A;  2P0N A;  2EPK X;  1D1B A;  2OJE D;  5L0H A;  2NUP B;  3FHD A;  3W8I A;  4DRI B;  2PBE A;  1WN0 A;  4I1M A;  2R05 A;  3CZ6 A;  4I3M A;  4J32 B;  2DB4 A;  1YLM A;  3F46 A;  4LER A;  4BJT A;  4DXW A;  2YL0 A;  3BRJ A;  4RBN A;  1H9G A;  1Q0D A;  3U9M A;  3PMR A;  3JYH A;  2XLE A;  4H4K C;  4MTO A;  4CS8 A;  1GM5 A;  3NYJ A;  4G7O F;  1XWJ A;  3IQ6 A;  2NUT B;  5L3V A;  4A4A A;  1V55 C;  2OEX A;  5KYU A;  4F4B A;  2YL1 A;  5T3W A;  4ZLC A;  1OR3 A;  2IYL D;  3O39 A;  2J9B A;  3VM6 A;  2OEV A;  1K05 A;  2M64 A;  3QW1 A;  3TJ5 A;  4WJ0 A;  1LE4 A;  1A7D A;  1QQ3 A;  2C04 A;  2H7O A;  4JCH A;  4PFO A;  1S05 A;  5EK0 A;  3A11 A;  2A1D D;  2EIN C;  1LE2 A;  4JTC B;  2Q9A A;  2YEV A;  3UMH A;  2B0H A;  1T6U A;  2WB7 A;  1ORJ A;  1QLE C;  1QZX A;  2UUI A;  3ZC4 A;  2ZXW C;  3KYI A;  4LDK A;  1BR1 A;  3V5Y A;  2VAS A;  2HJ3 A;  2ZXP A;  5TJ5 E;  2HV6 A;  5D92 A;  4JEB A;  3EH1 A;  5AGF A;  1FFH A;  1RJ9 B;  3ZQV A;  5BUO A;  3U5S A;  4DRJ B;  1M2O A;  3L1M A;  2NUP A;  2J8W A;  3A9C A;  2VH3 A;  3DMD A;  2JX0 A;  4R32 A;  1B68 A;  3SYN A;  2R02 A;  3ZQY A;  2XXA B;  1T01 A;  1LM3 B;  2HMQ A;  4PAC A;  1PD0 A;  2PNO A;  5A6B D;  3ABK C;  1O3U A;  5A6B A;  1ZHX A;  4OIP F;  3AGT A;  1BZ4 A;  4Q5S F;  3CAX A;  4H54 A;  2YLG A;  4QI2 A;  4EBK A;  1D0Z A;  5D91 A;  3M15 A;  4OIQ F;  1JMW A;  3O6X A;  5A6K A;  2NUT A;  3WOD F;  2AWY A;  2ZXO A;  5B3I A;  2XLV A;  2X0C A;  3ZTZ A;  4D4N A;  5DQT A;  3T6B A;  4C3E A;  4QDL A;  4HFK B;  3VAY A;  3W8H A;  4BJ5 C;  4HE8 D;  3SXY A;  2XSE A;  3OEO A;  2V3C C;  4QI0 A;  1T6Q A;  2KSF A;  1OCC C;  3RH3 A;  2P1A A;  1M57 C;  2IXM A;  2EPM X;  1T5O A;  2KK1 A;  5E3A A;  4DVZ A;  1WGW A;  3CSK A;  4G0H A;  3SNH A;  1D0Y A;  1Z6A A;  1K40 A;  1FNT c;  4JC7 A;  2J7P D;  4E7S A;  1VK5 A;  2J7P A;  5A6A A;  3OWT A;  1HY5 A;  3IQC A;  4MND A;  4E0I A;  5L0G A;  4C7O B;  4KI2 A;  1APC A;  1MMA A;  2R25 A;  1BR4 A;  2XLM A;  4EKW A;  2OJQ A;  4YT8 A;  5EGY A;  1ZHW A;  2J9V A;  3DWW A;  3FOO A;  5GPG B;  5CIV A;  2XL4 A;  2IXN A;  5DVW A;  3UR3 C;  1RJ9 A;  2WVN A;  4JRZ A;  1SZI A;  1VYK A;  2WZL A;  4MVM A;  5B1A C;  4ER9 A;  4BG0 A;  4XQ1 A;  3LNR A;  2IXP A;  1FMV A;  3RQG A;  2XXA A;  5FCL A;  3I5Q A;  2Z15 A;  4MTG A;  3S9O A;  1YYX A;  2Q9C A;  3ABL C;  3IPM O;  3N2Z B;  2KJG A;  3DZA A;  3LNM B;  3T6G B;  3V5X A;  4FAP B;  3L0I A;  1SMY F;  5KYW A;  2QTV A;  3IEE A;  1OKK D;  1G4U S;  1MND A;  3DAG A;  4ULW A;  2R9R B;  3K1H A;  4PK4 A;  4BPM A;  1GGQ A;  4BEM J;  3B71 A;  3JRT A;  1JRA A;  1CGN A;  2E87 A;  2R7O A;  4DBQ A;  2EPL X;  3G4Z A;  4CSA C;  2J0W A;  4KNW A;  3RVY A;  2LIG A;  3VYW A;  1IZM A;  2HV7 A;  4CDA A;  5KYN A;  3FXH A;  2DYR C;  1Z3I X;  4HFF B;  2W4B A;  4OD4 A;  5JT4 A;  3GEE A;  3TOM A;  5BQI A;  1C03 A;  2YLD A;  4JEA A;  5KYX B;  3U2L A;  1Y6D A;  2NSF A;  3DE9 A;  2Y3D A;  1N1C A;  2A69 F;  1RKE B;  3OA1 A;  4CIH A;  1LIH A;  2A0U A;  1NZE A;  4ONS A;  1Q0M A;  1ZHT A;  4E7Z A;  4XLP F;  1U0B B;  1MNE A;  1YDI A;  4MVQ A;  3IQ5 A;  3SEO A;  3H65 A;  1ZU4 A;  3GAN A;  3C8G D;  4Z9J A;  4A2N B;  5DS4 A;  1MMD A;  4CS9 A;  4DVY P;  3EQL F;  4NTA A;  5B1B C;  3GOR A;  2P61 A;  3HNK A;  3M79 A;  5E33 A;  2RSE B;  3UMK A;  3AQB A;  4BJ1 A;  5JUA A;  4EHP A;  1GS9 A;  1Z5Z A;  3ATP A;  4C7O A;  2CGE A;  2WVQ A;  1ZU5 A;  3VRC A;  1LPE A;  1DOW A;  3T4R A;  2L6G A;  3M4B A;  2KC3 A;  5HV9 A;  3O55 A;  1E86 A;  1TFO B;  2JD3 A;  2I8B A;  2XLH A;  3G4X A;  3DJN B;  4FWV A;  2NPU A;  4EBB A;  1ZHY A;  2L81 A;  1FAP B;  3W2V A;  4MW3 A;  1V74 B;  1LI5 A;  2L6H A;  1QKR A;  1VLT A;  3NKD A;  1Q0G A;  2OCC C;  3TUL A;  4P9T A;  2G3V A;  1ZHZ A;  1AEP A;  1OCR C;  1CGO A;  2CNW A;  2CNW D;  2HFI A;  3HLZ A;  3KH2 A;  1ZZP A;  4JW1 A;  1RMV A;  4O6M A;  4E17 A;  5L0J A;  2LFF A;  3SXZ A;  3AG2 C;  2Y3H A;  2L7A A;  4JCZ A;  5BQH A;  3JRM O;  3JZ0 A;  4U5E E;  1NBB A;  1NLX A;  3CQZ A;  3LS1 A;  1HW2 A;  1TWC A;  2PP4 A;  1F1M A;  2Q3T A;  4AL0 A;  4U5B E;  5HSW A;  5KYX A;  1E85 A;  4JZA A;  3EFO A;  3LUT B;  1ZW3 A;  3N24 A;  3O10 A;  1Z7Q c;  1T9K A;  1TWA A;  1RKE A;  2X51 A;  2R7V A;  2W9Y A;  3G50 A;  3L34 A;  3FAP B;  3EGD A;  4MVU A;  1G4W R;  1WAS A;  1UG7 A;  4RDA A;  4NCQ A;  2R7W A;  1V54 C;  1XZP A;  1G8X A;  3E70 C;  3FAJ A;  3TOL A;  3ASO C;  3R2P A;  3TD7 A;  4AX2 A;  2YKZ A;  2H7V C;  3I4U A;  1WAT A;  1D1A A;  2AWC A;  4E18 A;  4YN0 B;  3RKO F;  3US6 A;  3DAF A;  1ORY A;  1YA7 O;  1OW7 A;  1D1C A;  3AG3 C;  5L0I A;  1OW6 A;  2AVK A;  5F28 E;  3UMI A;  4U9E A;  4YL1 A;  3MYI A;  5L0C A;  4WGZ A;  1TQG A;  4LAC B;  4IB4 A;  4N06 A;  2BE5 F;  2WL8 A;  2XM0 A;  2YHS A;  3SXM A;  2ICW G;  3AOU A;  2Y69 C;  4N6C A;  4U5G A;  4KBL A;  3ZTM A;  5E3C A;  1HMO A;  3LEV A;  4CJO A;  5KYW B;  1A7V A;  1FFT C;  2QE9 A;  3KPH A;  1FTS A;  2XLW A;  1Z23 A;  2AP3 A;  3DD7 A;  4CIP A;  1ZYR F;  1VLS A;  2Q7R A;  3JSZ A;  4MS2 A;  3L8I A;  4BJ6 A;  3GM3 A;  4IAR A;  2IM8 A;  3L8J A;  2GWW A;  4NQF A;  1KNY A;  3EPV A;  3UNG C;  2IOQ A;  2G3K A;  2EIJ C;  3DE8 A;  1CPQ A;  2YL7 A;  1V4A A;  2ZXR A;  1CPR A;  1R5I D;  4XEF A;  2JPU A;  4OIR F;  3R7C A;  2YWA A;  2ETS A;  3EHN A;  3LAY A;  2I15 A;  4U5C E;  5COG A;  2CCY A;  3S29 A;  5JRA A;  1PD1 A;  4G7Z F;  2TMV P;  3F47 A;  1A0B A;  2WZG A;  1LS1 A;  4J30 B;  2QY9 A;  5DS5 A;  4G78 A;  1O5H A;  5T1D B;  3FDQ A;  3V5Z A;  2W4M A;  1YA9 A;  2QNL A;  3AGU A;  5CI8 A;  3K1I C;  2R7Q A;  2HSB A;  4XWJ A;  1EQ1 A;  3FMS A;  3KL4 A;  1OW8 A;  1IW7 F;  1FMW A;  1QVX A;  3GEI A;  4YK5 A;  1E84 A;  4IJJ A;  3HJC A;  5KYY A;  1VYI A;  3ASN C;  2KNH A;  2R7R A;  1FR0 A;  3U8P A;  2Y39 A;  3T9O A;  1YJG A;  5COM A;  5L0D A;  2LD6 A;  2A0B A;  3HKK A;  3DI5 A;  4AL1 A;  2G62 A;  3EHM A;  3I5P A;  4AK9 A;  4W8K A;  4CBE A;  1XZQ A;  4BJ5 A;  3SZR A;  2P6V A;  3NG1 A;  4BEJ A;  1YAR O;  2QUP A;  3K33 A;  1HW1 A;  3H2V A;  2M4E A;  4YWQ A;  3B0U X;  2OU6 A;  1AUE A;  3GM1 A;  1C17 M;  1JAF A;  4ANJ A;  5L0F A;  2P7V A;  3QVZ A;  3NMK A;  2GFH A;  1KU2 A;  1YZA A;  3QTH A;  1U6H A;  4M63 A;  5AC5 A;  4X0R A;  2PF4 E;  5DQZ A;  4JKV A;  1QSP A;  4CX9 A;  3HNL A;  2QLA A;  4MW8 A;  4OD5 A;  4E0H A;  4ULV A;  1YZC A;  4MVS A;  4Z9I A;  4OIN F;  2R7S A;  2B0J A;  2O9X A;  1SR2 A;  1LI7 A;  4FX5 A;  4IRU A;  3U2M A;  5CI9 A;  4EWC A;  4XTK A;  3EFO B;  1ZW2 A;  1E83 A;  1VOM A;  2CW0 F;  3W2W A;  4JIO A;  4CS9 C;  2VB6 A;  2VCA A;  2XL6 A;  4YT2 A;  3EGD B;  3U8V A;  1D0X A;  3W4Y A;  4J7Y A;  1TKN A;  4W8P A;  2Y3B A;  3FVY A;  4NY3 A;  1NFO A;  3X2Q C;  2LQG A;  3NYL A;  5F5F A;  4IAQ A;  4JJG A;  3RFY A;  1MQV A;  2AU5 A;  1DOV A;  4JUR I;  1SYQ A;  2EIM C;  2J9W A;  2PX3 A;  3KMI A;  2HZ8 A;  1VB5 A;  2LSE A;  3ZG1 A;  2KQ9 A;  2WZF A;  3U3B A;  3ABM C;  1WWP A;  2CDQ A;  4GQH A;  3RVZ A;  5EHH A;  1T6I A;  2EPO A;  2LK4 A;  4RD9 A;  3ZDL A;  5JVE A;  4L6R A;  3BEH A;  2OKU A;  3AQC A;  4CJG A;  4WGY A;  1Y4C A;  3HNI A;  3M4C A;  4CS8 C;  3B0P A;  1NU9 C;  2UUH A;  3K7D A;  2XM4 A;  2LFD A;  3JCU Q;  2L9J A;  3DKA A;  2J0X A;  1OQC A;  3GM2 A;  4YL0 A;  3RIP A;  1Q0F A;  1TWH A;  3ITF A;  1TR2 A;  3S27 A;  1J8M F;  1LVK A;  3B0V C;  1KTM A;  3EZH A;  4MVO A;  2NSG A;  2YRF A;  3C62 A;  3C63 A;  4JTD B;  4LDQ A;  3TK0 A;  3GOD A;  3C8Z A;  3ZVR A;  1U89 A;  4DBR A;  2A6E F;  3NMJ A;  3J06 A;  3NRH A;  5IY5 C;  4JE9 A;  1UFB A;  2XS8 A;  1HMD A;  2LP4 A;  3GWL A;  1NSG B;  3LES A;  3S0X A;  2EIK C;  2WVO A;  4IWB A;  1TFK B;  4PR9 A;  4MQ9 F;  1J8Y F;  2XRH A;  3EZI A;  1NU7 D;  4DOZ A;  3SP1 A;  3TQO A;  2YQY A;  3Q6N A;  4PJM A;  1MMG A; 
#chains in the Genus database with same CATH homology
 1YAR O;  3JSE O;  1YA7 O;  1AVO B;  3IPM O;  3JTL O;  3JRM O;  1YAU O;  1Z7Q c;  1FNT c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...