3QTHA

Crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
172
structure length
172
Chain Sequence
GMLSRIDLYIKHRDIFLKHLELLHKLIEKVEDSSLNESELLNARLVDDMFPFNVQAKIATNFALRACCPLSGKEYKELEGDIDSFCGLKTYVVTAIDYINKLSEPTLEQLNLNVQDTAGFKEISMPASEYMSSFVLPNFFFHISMVYAIAKNNGVSVTKGDFDGIHQYPKGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a Hypothetical DinB-like protein (CPS_3021) from Colwellia psychrerythraea 34H at 2.20 A resolution
rcsb
source organism Colwellia psychrerythraea
total genus 53
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09351 DUF1993 Domain of unknown function (DUF1993)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 3qthA00
2P1AA 5COGA 3GORA 2QNLA 1RXQA 3DI5A 5COFA 2NSGA 2OU6A 2NSFA 4N6CA 2HKVA 5CIVA 2F22A 3CEXA 3QTHA 2RD9A 5COMA 3DKAA 2YQYA 2QE9A 2OQMA
chains in the Genus database with same CATH superfamily
4MS2A 2J9UA 1L7CA 2H7VC 4CDYA 5JP7A 1TWHA 2CGEA 2YLGA 1SF8A 1VYKA 3EGDB 1HMDA 3JSEO 3FDQA 2LQGA 3WG7C 3JCUQ 2HJ3A 1WGWA 3C8GB 2HFIA 4AL1A 1ZW3A 4HEAJ 2A0UA 4U5FE 3GM1A 5JUAA 4JCHA 2EPLX 3NG1A 3SEOA 4MVQA 2A0BA 3CQZA 3LESA 4Q5SF 4OD5A 2XS8A 2R7VA 3G4ZA 1AUEA 2V3CC 5GPGB 1RJ9A 1FMVA 5A69A 4NY3A 4Z9JA 1ORSC 5HSWA 1G8XA 1VK5A 2IXNA 2YKZA 5KYUA 4JW1A 1NFOA 2KK1A 1LPEA 2GDCA 2KC3A 2VCCA 2ETSA 3CZ6A 2FGYA 2V26A 3EG9B 3X1OA 3X2QC 5DQTA 1WN0A 1OW7A 2C04A 2L6HA 2Y39A 4CS9A 1D1AA 1OKKD 2IM8A 4JCZA 1YAUO 1OW8A 2I15A 2P1AA 3S28A 4EBKA 2KQ9A 3V7OA 2HJMA 3B0VC 1Q0MA 5T3WA 3AJMA 3S9OA 1ZHYA 3ZTZA 2EPKX 1S05A 3G50A 2ICWG 1A7EA 2KW3C 3MFNA 3QVYA 3LJBA 3SXYA 3VAYA 3KPHA 2GFHA 2XL6A 4U5GA 4DRIB 2G62A 4FAPB 1ZHXA 1O5HA 3NDBB 4O7GA 4IJJA 3TJ6A 1OR2A 4XLPF 1BBHA 5D91A 3B9QA 1VLSA 3NYLA 1D1BA 1R5ID 3B29A 4AX2A 3ITFA 3MYIA 3LEOA 5E3CA 1E83A 2PF4E 1KTMA 1W2WA 2CYDA 4MVMA 4Q7CA 2H7BA 4K7BA 1OXBA 2QLAA 1YZCA 3UMIA 2MHRA 1IW7F 2EPNA 1ZU4A 5COGA 3FOOA 1ZHZA 2XLHA 2NUTB 2LP4A 3EG9A 4JJFA 4PK4A 3JYYA 5JSLA 3AGUA 4U5DE 4Z9HA 4CDAA 4N6CA 2D4UA 3TQOA 1MMGA 1J8MF 4MTFA 2ZPAA 4JKVA 2WL8A 3L0IA 2CNWD 4NTFA 2KYHA 2Z15A 2W4BA 3DE9A 4ER9A 2L7AA 1YVIA 2UUHA 2RD9A 4YT2A 5COMA 4AL0A 1C02A 3ASNC 1E86A 4OIQF 1A41A 1OCOC 2DYRC 2XS1A 1A0BA 1LS1A 4NC3A 3K1IC 4U9EA 4D4NA 3OEOA 3EHMA 3RVZA 2EILC 1A7DA 2J9VA 3I5QA 3VYWA 1ZYRF 4BPMA 1HMOA 3LUTB 2EPMX 4NTBA 2A6HF 4BJ5C 3V5ZA 1TQGA 4XPXA 5L0IA 2MYSA 3HTKC 5DLJA 1K04A 2YL0A 1FMWA 2QY9A 3UR3C 1U89A 1FR0A 2HSQA 4JURI 2HUJA 2Q3TA 2L81A 2E87A 1LI5A 1Q0DA 3FVYA 3GWNA 4RBNA 3RH3A 4WGZA 3W8IA 3LNMB 1LS4A 4JTCB 3SXZA 4I3MA 4P9TA 4QI0A 5E2QA 1ZW2A 4KBLA 1ORYA 2KGOA 1FAPB 3IHUA 3QTHA 4NQFA 4O6MA 1M56C 4BJTA 2LFDA 4CS7A 5FCLA 2PX3A 5K0IA 3JT1A 4CSAA 4J7TA 1LVKA 2DGJA 4XEFA 1HE9A 4L6RA 3KYJA 3JSZA 1QVXA 1VOMA 2YL3A 3V5YA 1JPJA 4U5EE 2VCBA 2D5RB 1V55C 2XM0A 4XWJA 4XPWA 4EWCA 5EHHA 1SR2A 1NU9C 1DOWA 3GEHA 3HLZA 2BE5F 1QQ3A 2QNLA 4LDQA 5T1DB 3AG1C 3PMRA 1SYQA 2XLOA 1LE4A 1WOLA 4PACA 5KYWB 1Y4CA 3U5SA 5KYXA 4OIPF 4AK9A 2EIJC 3R7CA 5JLIA 4K0DA 5TJ5E 2Q9AA 3FAJA 3JYHA 3U0CA 3RKOF 3W4YA 1A7VA 4PR9A 2W45A 5D92A 4OINF 5KYUB 1H6GA 1ST6A 2FFHA 3K1IA 3S90A 1ZVZA 4QDLA 3ZQYA 2OJED 4KC9A 3POVA 4GQHA 1ZHWA 1WWPA 3AG3C 4E0IA 2ZXRA 4BJ5A 4MQ9F 2R7RA 1HW2A 2O9XA 5B1BC 3T6BA 3DAGA 4JIOA 4CX9A 1U6HA 2A69F 4N6HA 2JD3A 1TR2A 5T3TA 1V74B 5DS4A 1VTMP 2OJQA 2LD6A 2XRHA 4EHPA 4ANJA 2UUIA 2YL7A 2WZLA 1NLXA 1C17M 2IXPA 3RIPA 4UDVA 2XLEA 3NMIA 4AE4A 4PJLA 5KYWA 2X51A 2WZGA 1HE1A 4LLCA 3GODA 3UMHA 3ZG1A 2CDQA 3EQLF 4MTGA 3NRHA 3EZIA 4N06A 3ABLC 5DVWA 4RD9A 2AWYA 3DXJF 2FAPB 3M79A 4FX5A 2LK4A 3OWTA 1FFHA 1HW1A 2KSFA 4EBJA 4CS8A 3EFOA 4JC7A 4C3BA 1OCCC 3R2PA 1YA9A 3SXMA 4C3EA 2OEXA 3N24A 2XM4A 1Z23A 3GEEA 1K05A 1M2VA 1F1MA 2LFFA 4D4XA 2H8AA 5L0FA 3PCVA 2HV7A 3U2MA 1Z63A 3IQCA 1V4AA 5DQZA 3DM5A 1T6IA 2YLIA 4YL3A 1YYXA 1IZMA 3I4UA 2DYSC 4IGGA 2A6EF 3AQCA 3GEIA 4IARA 4PJMA 3RW0A 2TMVP 2JX0A 1TWAA 4WGYA 1VB5A 3DJNB 1U0BB 3K1HA 2YHSA 5A6BA 256BA 5EK0A 1QKRA 2BL2A 1VLTA 2C03A 2XLMA 4B6IA 1PCXA 5CI8A 5JRAA 3DZAA 3WAQA 2J9WA 2Y3HA 3B71A 4XTKA 3GM2A 1RCPA 3T6JA 1NBBA 4XEVA 2P61A 2HMQA 4E7ZA 4X0RA 3O39A 5COFA 3M4BA 4J32B 3MYFA 4EIYA 2RSEB 5BQIA 3EZHA 1MMAA 5EGYA 3K7DA 2VASA 3TOMA 3W2VA 1JMWA 1H7IA 3T9OA 1NFNA 1WATA 4A2NB 2CCYA 3OA1A 1Q0FA 3DWWA 3NYMA 3RYLA 3RQEA 1J8YF 2R7QA 4FESA 4IAOA 1O87A 3VRCA 4A4AA 4ZLDA 4DBRA 2AVKA 2GA0A 1S7ZA 3U8VA 4XPYA 2J0WA 1CGOA 2M4EA 3NKDA 4IB4A 4P6IC 5KYXB 3E70C 3FHDA 2X0CA 3GORA 1Y6DA 4I44A 5A6KA 4I1MA 4PJJA 5DS5A 2GWWA 1SZIA 5FZTA 3N0TA 2XSEA 4XLNF 2R25A 2IXMA 3JTLO 4BG0A 2WZFA 3B0UX 3SZRA 4BEJA 4MVRA 1NZEA 3ECSA 5CI9A 3MBGA 2BC5A 2W4MA 4MW8A 4KNVA 5JVEA 5L3VA 4PJNA 3TULA 1VYIA 4MVZA 4C3DA 3EPVA 1CPQA 4MVSA 2PFDA 3C62A 2OCCC 1QPUA 3AG4C 1FNTc 3NYJA 4C7OA 1MNDA 1OCRC 3M4CA 4HFKB 1RKCA 5AGFA 1YLMA 2Y3BA 2YRFA 2R7TA 1NG1A 3Q6MA 5E3AA 1XZPA 1WTYA 4E18A 3L8IA 3ZQVA 1Z6AA 2J45A 1DOVA 4JE9A 4JZAA 2HV6A 5F5HA 2KJGA 4YN0B 3HNJA 4IRUA 4J7YA 4YL0A 1BR4A 1D0XA 2W9YA 3C63A 3DI5A 3Q7GA 4R32A 3HNIA 3F47A 4AE4B 2R7XA 4F4BA 4CS8C 3UNGC 4BJ6C 1TWGA 4G7OF 4JVSA 3NMJA 1Z3IX 2WVQA 5L3QA 1I4YA 3H2VA 3LS0A 3GWLA 2J7PA 5AC4A 3AGTA 4O6NA 2EIKC 4E17A 2DB4A 4ZLCA 4MW3A 4H4KC 5F5FA 4JRZA 1MMNA 1Z5ZA 1B68A 2ASRA 4IWBA 1H9TA 3LLIA 4JEBA 5A6BD 3HKKA 3NKEA 1EI7A 3EFOB 5KYNA 3Q6NA 4RDAA 3K6BA 2QUPA 2XLDA 3DJUB 2R7UA 4JJGA 5L0JA 4NCQA 2I8BA 4G0HA 4H54A 4DBQA 3U3BA 4MTOA 1QLEC 2GAQA 3DD7A 1M2VB 1GGQA 1GQAA 2G3VA 4LDKA 4G7ZF 1WASA 2Q00A 3O6XA 1YYJA 1L3PA 3LLKA 1AVOB 1OCZC 1KU2A 1Q0KA 2Q9BA 3C7JA 4E0HA 4DVYP 1T6QA 3L8JA 1T9KA 2HZ8A 3LNRA 2DI3A 3N2ZB 4CS9C 2R05A 3FAPB 1LI7A 5IY5C 4YT4A 4GYTA 1ZZPA 3ABKC 2M64A 1OXKA 3ATPA 2Y69C 4CJGA 1M6TA 1JAFA 3LS1A 4M63A 4YJWA 1Z7Qc 3J06A 3IPMO 2IBFA 2YL1A 4GEHA 4I1OB 3NMKA 3FXHA 3DKAA 1GS9A 1Q0GA 3UGPA 1ZU5A 3S27A 1T01A 5L0CA 3S0XA 1E2XA 1YARO 1YA7O 2F22A 2H7OA 3EJNA 3EH2A 3IQ5A 4BJ6A 2AP3A 2VB6A 3EH1A 3H2UA 4O6YA 4YT5A 1CGME 3EGXA 3US6A 3O10A 3HJCA 4CSAC 1EKYA 5AC5A 5A6AA 3AG2C 2OEVA 3A11A 1TFOB 1G5ZA 2NSFA 4JTDB 1G4WR 2B0JA 1UG7A 1LM3B 2ZXWC 1RKEA 3W2WA 5BQGA 5HV9A 3LAYA 1M57C 2P7VA 1I5NA 2L9JA 3U9MA 2XXAA 3S84A 3C8ZA 2WB7A 1GM5A 2VC9A 1BDJB 2ZXOA 3O55A 2Y3GA 1ZHTA 1FTSA 1JR8A 2YZSA 4WABA 4MNDA 4DJ9A 5L0HA 2ZXPA 4W8PA 2Q9CA 3M1CB 3SYNA 3VM6A 1BR1A 3KKBA 3HNKA 4MVUA 4U5BE 3PHF2 3MX3A 3ZDLA 4CIPA 3U9JA 1LKXA 4E7SA 1O3UA 2OQMA 3RFYA 5KYYA 2NUPB 4YT8A 4W8KA 1JOGA 3CAXA 4Q4ZF 3B0PA 4CDVA 4QI2A 1CPRA 3IEEA 4G78A 4DRHB 3ZIBA 3K33A 1SMYF 1E84A 2OU6A 1UFBA 2NPUA 1E85A 2R03A 3TD7A 1T6UA 2NG1A 3EGDA 4HE8D 2J7PD 2HKVA 1D0YA 2MWQA 2WVOA 3S29A 3TOLA 1G4US 1LIHA 1PD1A 2OKUA 3SXKA 3ZC4A 3C8GA 4OD4A 3UMKA 4C7OB 4DXWA 4CBEA 5B3SC 2G3KA 3DAFA 2EPOA 1BZ4A 5L0GA 2L6FA 3T6GB 4WJ0A 3U8PA 4YWQA 4G7HF 2A1DD 3MLGA 3AQBA 1OR3A 4PFPA 1VMAA 3GANA 5A6JA 4MVOA 5JS5A 2J0XA 2HS5A 3U3FA 3ZSUA 1NSGB 3UGOA 3AOUA 4XQ1A 3TK0A 3DE8A 2ZD9A 3K66A 3Q7LA 4EBBA 3T4RA 2R7SA 1ORJA 2Q4FA 5F28E 1XZQA 4EUKB 4IAQA 3F46A 3V5XA 1YJGA 3FOPA 3WODF 1EQ1A 2A68F 1TFKB 3IQTA 5BUOA 2VH3A 2NUPA 1XWJA 2EINC 3EHNA 3L1MA 3QVZA 3BRJA 3QW1A 3QW0A 3QZCA 3A9CA 4JEAA 4ULWA 5JT4A 4NTAA 1OQCA 4LDRA 4PFOA 2JPUA 4BEMJ 4KI2A 2YVKA 2LSEA 1PD0A 2KNHA 2R7WA 3C18A 2YLDA 2YWAA 2PX0A 2AU5A 3M15A 3RQGA 1JPNA 5B3IA 3ABMC 3H65A 1EA8A 2IXOA 2VCAA 1MNEA 2PP4A 2Q7RA 3KL4A 4LERA 3HNLA 1D0ZA 4LACB 4YK5A 1H9GA 1OKKA 2XL8A 2AWCA 2XLVA 4LLEA 1RXQA 1FFTC 3ASOC 1QZXA 2HMZA 3JZ0A 3KYIA 3LEVA 4U5CE 1MQVA 4ULVA 2HSBA 5DS6A 5E33A 1M2OA 1TKNA 4ONSA 2PBEA 2QTVA 2L6GA 2LIGA 1I4ZA 5BQHA 2NUTA 3I5PA 1RMVA 4U9DA 2R7OA 2Y3DA 3W8HA 4YL1A 2XLWA 3G4XA 4DOZA 3KMIA 3TJ5A 4K1OA 5CIVA 3JRTA 2B0HA 4DVZA 2YEVA 2P0NA 1JRAA 2PNOA 4OIOF 1K40A 3VF0A 1T5OA 4Z9IA 3E9VA 2OOCA 3DM9B 3SNHA 4HFFB 3RF3A 2CW0F 3EGXB 2R9RB 1R4TA 2YQYA 4OIRF 1YDIA 2J9BA 2QE9A 4KNWA 1YZAA 1BR2A 1KNYA 2XL4A 1OW6A 3CSKA 3IQ6A 1D1CA 3ZVRA 5B1AC 2EIMC 3RVYA 4FWVA 2J8WA 4JTAB 4EKWA 1APCA 1MMDA 1NU7D 1RKEB 2J46A 2LCHA 2NSGA 1TWCA 2OG2A 1C03A 2R02A 3GM3A 4BJ1A 4DRJB 3SP1A 2XXAB 1V54C 3BEHA 2IYLD 1LE2A 1RJ9B 3DMDA 3FMSA 3JRMO 3QMKA 3L34A 3ZWIA 3C8GD 1CGNA 4O79A 4U5HA 3PDMP 2CNWA 2P6VA 3CEXA 3RQFA 4CIHA 1HY5A 1QSPA 1AEPA 4CJOA 5KYYB 3WHNA 2IOQA 3ZTMA 2WVNA 4XEKA 1PV3A 4P9FA 4N4WA 3U2LA 3KH2A 4J30B 1N1CA 5L0DA
chains in the Genus database with same CATH topology
2P1AA 5COGA 3GORA 2QNLA 1RXQA 3DI5A 5COFA 2NSGA 2OU6A 2NSFA 4N6CA 2HKVA 5CIVA 2F22A 3CEXA 3QTHA 2RD9A 5COMA 3DKAA 2YQYA 2QE9A 2OQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P1A A;  5COG A;  3GOR A;  2QNL A;  1RXQ A;  3DI5 A;  5COF A;  2NSG A;  2OU6 A;  2NSF A;  4N6C A;  2HKV A;  5CIV A;  2F22 A;  3CEX A;  3QTH A;  2RD9 A;  5COM A;  3DKA A;  2YQY A;  2QE9 A;  2OQM A; 
#chains in the Genus database with same CATH topology
 4MS2 A;  2J9U A;  1L7C A;  2H7V C;  4CDY A;  5JP7 A;  1TWH A;  2CGE A;  2YLG A;  1SF8 A;  1VYK A;  3EGD B;  1HMD A;  3JSE O;  3FDQ A;  2LQG A;  3WG7 C;  3JCU Q;  2HJ3 A;  1WGW A;  3C8G B;  2HFI A;  4AL1 A;  1ZW3 A;  4HEA J;  2A0U A;  4U5F E;  3GM1 A;  5JUA A;  4JCH A;  2EPL X;  3NG1 A;  3SEO A;  4MVQ A;  2A0B A;  3CQZ A;  3LES A;  4Q5S F;  4OD5 A;  2XS8 A;  2R7V A;  3G4Z A;  1AUE A;  2V3C C;  5GPG B;  1RJ9 A;  1FMV A;  5A69 A;  4NY3 A;  4Z9J A;  1ORS C;  5HSW A;  1G8X A;  1VK5 A;  2IXN A;  2YKZ A;  5KYU A;  4JW1 A;  1NFO A;  2KK1 A;  1LPE A;  2GDC A;  2KC3 A;  2VCC A;  2ETS A;  3CZ6 A;  2FGY A;  2V26 A;  3EG9 B;  3X1O A;  3X2Q C;  5DQT A;  1WN0 A;  1OW7 A;  2C04 A;  2L6H A;  2Y39 A;  4CS9 A;  1D1A A;  1OKK D;  2IM8 A;  4JCZ A;  1YAU O;  1OW8 A;  2I15 A;  2P1A A;  3S28 A;  4EBK A;  2KQ9 A;  3V7O A;  2HJM A;  3B0V C;  1Q0M A;  5T3W A;  3AJM A;  3S9O A;  1ZHY A;  3ZTZ A;  2EPK X;  1S05 A;  3G50 A;  2ICW G;  1A7E A;  2KW3 C;  3MFN A;  3QVY A;  3LJB A;  3SXY A;  3VAY A;  3KPH A;  2GFH A;  2XL6 A;  4U5G A;  4DRI B;  2G62 A;  4FAP B;  1ZHX A;  1O5H A;  3NDB B;  4O7G A;  4IJJ A;  3TJ6 A;  1OR2 A;  4XLP F;  1BBH A;  5D91 A;  3B9Q A;  1VLS A;  3NYL A;  1D1B A;  1R5I D;  3B29 A;  4AX2 A;  3ITF A;  3MYI A;  3LEO A;  5E3C A;  1E83 A;  2PF4 E;  1KTM A;  1W2W A;  2CYD A;  4MVM A;  4Q7C A;  2H7B A;  4K7B A;  1OXB A;  2QLA A;  1YZC A;  3UMI A;  2MHR A;  1IW7 F;  2EPN A;  1ZU4 A;  5COG A;  3FOO A;  1ZHZ A;  2XLH A;  2NUT B;  2LP4 A;  3EG9 A;  4JJF A;  4PK4 A;  3JYY A;  5JSL A;  3AGU A;  4U5D E;  4Z9H A;  4CDA A;  4N6C A;  2D4U A;  3TQO A;  1MMG A;  1J8M F;  4MTF A;  2ZPA A;  4JKV A;  2WL8 A;  3L0I A;  2CNW D;  4NTF A;  2KYH A;  2Z15 A;  2W4B A;  3DE9 A;  4ER9 A;  2L7A A;  1YVI A;  2UUH A;  2RD9 A;  4YT2 A;  5COM A;  4AL0 A;  1C02 A;  3ASN C;  1E86 A;  4OIQ F;  1A41 A;  1OCO C;  2DYR C;  2XS1 A;  1A0B A;  1LS1 A;  4NC3 A;  3K1I C;  4U9E A;  4D4N A;  3OEO A;  3EHM A;  3RVZ A;  2EIL C;  1A7D A;  2J9V A;  3I5Q A;  3VYW A;  1ZYR F;  4BPM A;  1HMO A;  3LUT B;  2EPM X;  4NTB A;  2A6H F;  4BJ5 C;  3V5Z A;  1TQG A;  4XPX A;  5L0I A;  2MYS A;  3HTK C;  5DLJ A;  1K04 A;  2YL0 A;  1FMW A;  2QY9 A;  3UR3 C;  1U89 A;  1FR0 A;  2HSQ A;  4JUR I;  2HUJ A;  2Q3T A;  2L81 A;  2E87 A;  1LI5 A;  1Q0D A;  3FVY A;  3GWN A;  4RBN A;  3RH3 A;  4WGZ A;  3W8I A;  3LNM B;  1LS4 A;  4JTC B;  3SXZ A;  4I3M A;  4P9T A;  4QI0 A;  5E2Q A;  1ZW2 A;  4KBL A;  1ORY A;  2KGO A;  1FAP B;  3IHU A;  3QTH A;  4NQF A;  4O6M A;  1M56 C;  4BJT A;  2LFD A;  4CS7 A;  5FCL A;  2PX3 A;  5K0I A;  3JT1 A;  4CSA A;  4J7T A;  1LVK A;  2DGJ A;  4XEF A;  1HE9 A;  4L6R A;  3KYJ A;  3JSZ A;  1QVX A;  1VOM A;  2YL3 A;  3V5Y A;  1JPJ A;  4U5E E;  2VCB A;  2D5R B;  1V55 C;  2XM0 A;  4XWJ A;  4XPW A;  4EWC A;  5EHH A;  1SR2 A;  1NU9 C;  1DOW A;  3GEH A;  3HLZ A;  2BE5 F;  1QQ3 A;  2QNL A;  4LDQ A;  5T1D B;  3AG1 C;  3PMR A;  1SYQ A;  2XLO A;  1LE4 A;  1WOL A;  4PAC A;  5KYW B;  1Y4C A;  3U5S A;  5KYX A;  4OIP F;  4AK9 A;  2EIJ C;  3R7C A;  5JLI A;  4K0D A;  5TJ5 E;  2Q9A A;  3FAJ A;  3JYH A;  3U0C A;  3RKO F;  3W4Y A;  1A7V A;  4PR9 A;  2W45 A;  5D92 A;  4OIN F;  5KYU B;  1H6G A;  1ST6 A;  2FFH A;  3K1I A;  3S90 A;  1ZVZ A;  4QDL A;  3ZQY A;  2OJE D;  4KC9 A;  3POV A;  4GQH A;  1ZHW A;  1WWP A;  3AG3 C;  4E0I A;  2ZXR A;  4BJ5 A;  4MQ9 F;  2R7R A;  1HW2 A;  2O9X A;  5B1B C;  3T6B A;  3DAG A;  4JIO A;  4CX9 A;  1U6H A;  2A69 F;  4N6H A;  2JD3 A;  1TR2 A;  5T3T A;  1V74 B;  5DS4 A;  1VTM P;  2OJQ A;  2LD6 A;  2XRH A;  4EHP A;  4ANJ A;  2UUI A;  2YL7 A;  2WZL A;  1NLX A;  1C17 M;  2IXP A;  3RIP A;  4UDV A;  2XLE A;  3NMI A;  4AE4 A;  4PJL A;  5KYW A;  2X51 A;  2WZG A;  1HE1 A;  4LLC A;  3GOD A;  3UMH A;  3ZG1 A;  2CDQ A;  3EQL F;  4MTG A;  3NRH A;  3EZI A;  4N06 A;  3ABL C;  5DVW A;  4RD9 A;  2AWY A;  3DXJ F;  2FAP B;  3M79 A;  4FX5 A;  2LK4 A;  3OWT A;  1FFH A;  1HW1 A;  2KSF A;  4EBJ A;  4CS8 A;  3EFO A;  4JC7 A;  4C3B A;  1OCC C;  3R2P A;  1YA9 A;  3SXM A;  4C3E A;  2OEX A;  3N24 A;  2XM4 A;  1Z23 A;  3GEE A;  1K05 A;  1M2V A;  1F1M A;  2LFF A;  4D4X A;  2H8A A;  5L0F A;  3PCV A;  2HV7 A;  3U2M A;  1Z63 A;  3IQC A;  1V4A A;  5DQZ A;  3DM5 A;  1T6I A;  2YLI A;  4YL3 A;  1YYX A;  1IZM A;  3I4U A;  2DYS C;  4IGG A;  2A6E F;  3AQC A;  3GEI A;  4IAR A;  4PJM A;  3RW0 A;  2TMV P;  2JX0 A;  1TWA A;  4WGY A;  1VB5 A;  3DJN B;  1U0B B;  3K1H A;  2YHS A;  5A6B A;  256B A;  5EK0 A;  1QKR A;  2BL2 A;  1VLT A;  2C03 A;  2XLM A;  4B6I A;  1PCX A;  5CI8 A;  5JRA A;  3DZA A;  3WAQ A;  2J9W A;  2Y3H A;  3B71 A;  4XTK A;  3GM2 A;  1RCP A;  3T6J A;  1NBB A;  4XEV A;  2P61 A;  2HMQ A;  4E7Z A;  4X0R A;  3O39 A;  5COF A;  3M4B A;  4J32 B;  3MYF A;  4EIY A;  2RSE B;  5BQI A;  3EZH A;  1MMA A;  5EGY A;  3K7D A;  2VAS A;  3TOM A;  3W2V A;  1JMW A;  1H7I A;  3T9O A;  1NFN A;  1WAT A;  4A2N B;  2CCY A;  3OA1 A;  1Q0F A;  3DWW A;  3NYM A;  3RYL A;  3RQE A;  1J8Y F;  2R7Q A;  4FES A;  4IAO A;  1O87 A;  3VRC A;  4A4A A;  4ZLD A;  4DBR A;  2AVK A;  2GA0 A;  1S7Z A;  3U8V A;  4XPY A;  2J0W A;  1CGO A;  2M4E A;  3NKD A;  4IB4 A;  4P6I C;  5KYX B;  3E70 C;  3FHD A;  2X0C A;  3GOR A;  1Y6D A;  4I44 A;  5A6K A;  4I1M A;  4PJJ A;  5DS5 A;  2GWW A;  1SZI A;  5FZT A;  3N0T A;  2XSE A;  4XLN F;  2R25 A;  2IXM A;  3JTL O;  4BG0 A;  2WZF A;  3B0U X;  3SZR A;  4BEJ A;  4MVR A;  1NZE A;  3ECS A;  5CI9 A;  3MBG A;  2BC5 A;  2W4M A;  4MW8 A;  4KNV A;  5JVE A;  5L3V A;  4PJN A;  3TUL A;  1VYI A;  4MVZ A;  4C3D A;  3EPV A;  1CPQ A;  4MVS A;  2PFD A;  3C62 A;  2OCC C;  1QPU A;  3AG4 C;  1FNT c;  3NYJ A;  4C7O A;  1MND A;  1OCR C;  3M4C A;  4HFK B;  1RKC A;  5AGF A;  1YLM A;  2Y3B A;  2YRF A;  2R7T A;  1NG1 A;  3Q6M A;  5E3A A;  1XZP A;  1WTY A;  4E18 A;  3L8I A;  3ZQV A;  1Z6A A;  2J45 A;  1DOV A;  4JE9 A;  4JZA A;  2HV6 A;  5F5H A;  2KJG A;  4YN0 B;  3HNJ A;  4IRU A;  4J7Y A;  4YL0 A;  1BR4 A;  1D0X A;  2W9Y A;  3C63 A;  3DI5 A;  3Q7G A;  4R32 A;  3HNI A;  3F47 A;  4AE4 B;  2R7X A;  4F4B A;  4CS8 C;  3UNG C;  4BJ6 C;  1TWG A;  4G7O F;  4JVS A;  3NMJ A;  1Z3I X;  2WVQ A;  5L3Q A;  1I4Y A;  3H2V A;  3LS0 A;  3GWL A;  2J7P A;  5AC4 A;  3AGT A;  4O6N A;  2EIK C;  4E17 A;  2DB4 A;  4ZLC A;  4MW3 A;  4H4K C;  5F5F A;  4JRZ A;  1MMN A;  1Z5Z A;  1B68 A;  2ASR A;  4IWB A;  1H9T A;  3LLI A;  4JEB A;  5A6B D;  3HKK A;  3NKE A;  1EI7 A;  3EFO B;  5KYN A;  3Q6N A;  4RDA A;  3K6B A;  2QUP A;  2XLD A;  3DJU B;  2R7U A;  4JJG A;  5L0J A;  4NCQ A;  2I8B A;  4G0H A;  4H54 A;  4DBQ A;  3U3B A;  4MTO A;  1QLE C;  2GAQ A;  3DD7 A;  1M2V B;  1GGQ A;  1GQA A;  2G3V A;  4LDK A;  4G7Z F;  1WAS A;  2Q00 A;  3O6X A;  1YYJ A;  1L3P A;  3LLK A;  1AVO B;  1OCZ C;  1KU2 A;  1Q0K A;  2Q9B A;  3C7J A;  4E0H A;  4DVY P;  1T6Q A;  3L8J A;  1T9K A;  2HZ8 A;  3LNR A;  2DI3 A;  3N2Z B;  4CS9 C;  2R05 A;  3FAP B;  1LI7 A;  5IY5 C;  4YT4 A;  4GYT A;  1ZZP A;  3ABK C;  2M64 A;  1OXK A;  3ATP A;  2Y69 C;  4CJG A;  1M6T A;  1JAF A;  3LS1 A;  4M63 A;  4YJW A;  1Z7Q c;  3J06 A;  3IPM O;  2IBF A;  2YL1 A;  4GEH A;  4I1O B;  3NMK A;  3FXH A;  3DKA A;  1GS9 A;  1Q0G A;  3UGP A;  1ZU5 A;  3S27 A;  1T01 A;  5L0C A;  3S0X A;  1E2X A;  1YAR O;  1YA7 O;  2F22 A;  2H7O A;  3EJN A;  3EH2 A;  3IQ5 A;  4BJ6 A;  2AP3 A;  2VB6 A;  3EH1 A;  3H2U A;  4O6Y A;  4YT5 A;  1CGM E;  3EGX A;  3US6 A;  3O10 A;  3HJC A;  4CSA C;  1EKY A;  5AC5 A;  5A6A A;  3AG2 C;  2OEV A;  3A11 A;  1TFO B;  1G5Z A;  2NSF A;  4JTD B;  1G4W R;  2B0J A;  1UG7 A;  1LM3 B;  2ZXW C;  1RKE A;  3W2W A;  5BQG A;  5HV9 A;  3LAY A;  1M57 C;  2P7V A;  1I5N A;  2L9J A;  3U9M A;  2XXA A;  3S84 A;  3C8Z A;  2WB7 A;  1GM5 A;  2VC9 A;  1BDJ B;  2ZXO A;  3O55 A;  2Y3G A;  1ZHT A;  1FTS A;  1JR8 A;  2YZS A;  4WAB A;  4MND A;  4DJ9 A;  5L0H A;  2ZXP A;  4W8P A;  2Q9C A;  3M1C B;  3SYN A;  3VM6 A;  1BR1 A;  3KKB A;  3HNK A;  4MVU A;  4U5B E;  3PHF 2;  3MX3 A;  3ZDL A;  4CIP A;  3U9J A;  1LKX A;  4E7S A;  1O3U A;  2OQM A;  3RFY A;  5KYY A;  2NUP B;  4YT8 A;  4W8K A;  1JOG A;  3CAX A;  4Q4Z F;  3B0P A;  4CDV A;  4QI2 A;  1CPR A;  3IEE A;  4G78 A;  4DRH B;  3ZIB A;  3K33 A;  1SMY F;  1E84 A;  2OU6 A;  1UFB A;  2NPU A;  1E85 A;  2R03 A;  3TD7 A;  1T6U A;  2NG1 A;  3EGD A;  4HE8 D;  2J7P D;  2HKV A;  1D0Y A;  2MWQ A;  2WVO A;  3S29 A;  3TOL A;  1G4U S;  1LIH A;  1PD1 A;  2OKU A;  3SXK A;  3ZC4 A;  3C8G A;  4OD4 A;  3UMK A;  4C7O B;  4DXW A;  4CBE A;  5B3S C;  2G3K A;  3DAF A;  2EPO A;  1BZ4 A;  5L0G A;  2L6F A;  3T6G B;  4WJ0 A;  3U8P A;  4YWQ A;  4G7H F;  2A1D D;  3MLG A;  3AQB A;  1OR3 A;  4PFP A;  1VMA A;  3GAN A;  5A6J A;  4MVO A;  5JS5 A;  2J0X A;  2HS5 A;  3U3F A;  3ZSU A;  1NSG B;  3UGO A;  3AOU A;  4XQ1 A;  3TK0 A;  3DE8 A;  2ZD9 A;  3K66 A;  3Q7L A;  4EBB A;  3T4R A;  2R7S A;  1ORJ A;  2Q4F A;  5F28 E;  1XZQ A;  4EUK B;  4IAQ A;  3F46 A;  3V5X A;  1YJG A;  3FOP A;  3WOD F;  1EQ1 A;  2A68 F;  1TFK B;  3IQT A;  5BUO A;  2VH3 A;  2NUP A;  1XWJ A;  2EIN C;  3EHN A;  3L1M A;  3QVZ A;  3BRJ A;  3QW1 A;  3QW0 A;  3QZC A;  3A9C A;  4JEA A;  4ULW A;  5JT4 A;  4NTA A;  1OQC A;  4LDR A;  4PFO A;  2JPU A;  4BEM J;  4KI2 A;  2YVK A;  2LSE A;  1PD0 A;  2KNH A;  2R7W A;  3C18 A;  2YLD A;  2YWA A;  2PX0 A;  2AU5 A;  3M15 A;  3RQG A;  1JPN A;  5B3I A;  3ABM C;  3H65 A;  1EA8 A;  2IXO A;  2VCA A;  1MNE A;  2PP4 A;  2Q7R A;  3KL4 A;  4LER A;  3HNL A;  1D0Z A;  4LAC B;  4YK5 A;  1H9G A;  1OKK A;  2XL8 A;  2AWC A;  2XLV A;  4LLE A;  1RXQ A;  1FFT C;  3ASO C;  1QZX A;  2HMZ A;  3JZ0 A;  3KYI A;  3LEV A;  4U5C E;  1MQV A;  4ULV A;  2HSB A;  5DS6 A;  5E33 A;  1M2O A;  1TKN A;  4ONS A;  2PBE A;  2QTV A;  2L6G A;  2LIG A;  1I4Z A;  5BQH A;  2NUT A;  3I5P A;  1RMV A;  4U9D A;  2R7O A;  2Y3D A;  3W8H A;  4YL1 A;  2XLW A;  3G4X A;  4DOZ A;  3KMI A;  3TJ5 A;  4K1O A;  5CIV A;  3JRT A;  2B0H A;  4DVZ A;  2YEV A;  2P0N A;  1JRA A;  2PNO A;  4OIO F;  1K40 A;  3VF0 A;  1T5O A;  4Z9I A;  3E9V A;  2OOC A;  3DM9 B;  3SNH A;  4HFF B;  3RF3 A;  2CW0 F;  3EGX B;  2R9R B;  1R4T A;  2YQY A;  4OIR F;  1YDI A;  2J9B A;  2QE9 A;  4KNW A;  1YZA A;  1BR2 A;  1KNY A;  2XL4 A;  1OW6 A;  3CSK A;  3IQ6 A;  1D1C A;  3ZVR A;  5B1A C;  2EIM C;  3RVY A;  4FWV A;  2J8W A;  4JTA B;  4EKW A;  1APC A;  1MMD A;  1NU7 D;  1RKE B;  2J46 A;  2LCH A;  2NSG A;  1TWC A;  2OG2 A;  1C03 A;  2R02 A;  3GM3 A;  4BJ1 A;  4DRJ B;  3SP1 A;  2XXA B;  1V54 C;  3BEH A;  2IYL D;  1LE2 A;  1RJ9 B;  3DMD A;  3FMS A;  3JRM O;  3QMK A;  3L34 A;  3ZWI A;  3C8G D;  1CGN A;  4O79 A;  4U5H A;  3PDM P;  2CNW A;  2P6V A;  3CEX A;  3RQF A;  4CIH A;  1HY5 A;  1QSP A;  1AEP A;  4CJO A;  5KYY B;  3WHN A;  2IOQ A;  3ZTM A;  2WVN A;  4XEK A;  1PV3 A;  4P9F A;  4N4W A;  3U2L A;  3KH2 A;  4J30 B;  1N1C A;  5L0D A; 
#chains in the Genus database with same CATH homology
 2P1A A;  5COG A;  3GOR A;  2QNL A;  1RXQ A;  3DI5 A;  5COF A;  2NSG A;  2OU6 A;  2NSF A;  4N6C A;  2HKV A;  5CIV A;  2F22 A;  3CEX A;  3QTH A;  2RD9 A;  5COM A;  3DKA A;  2YQY A;  2QE9 A;  2OQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...