3QTHA

Crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
172
structure length
172
Chain Sequence
GMLSRIDLYIKHRDIFLKHLELLHKLIEKVEDSSLNESELLNARLVDDMFPFNVQAKIATNFALRACCPLSGKEYKELEGDIDSFCGLKTYVVTAIDYINKLSEPTLEQLNLNVQDTAGFKEISMPASEYMSSFVLPNFFFHISMVYAIAKNNGVSVTKGDFDGIHQYPKGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a Hypothetical DinB-like protein (CPS_3021) from Colwellia psychrerythraea 34H at 2.20 A resolution
rcsb
source organism Colwellia psychrerythraea
molecule tags Unknown function
total genus 53
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09351 DUF1993 Domain of unknown function (DUF1993)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 3qthA00
2P1AA 5COFA 2NSGA 5COMA 1RXQA 2OQMA 4N6CA 3DKAA 2F22A 2RD9A 3DI5A 5CIVA 2YQYA 2QNLA 2HKVA 3QTHA 2NSFA 3CEXA 2OU6A 5COGA 3GORA 2QE9A
chains in the Genus database with same CATH superfamily
1H7IA 5E3CA 1S05A 3SNHA 2XL6A 4CIPA 2G62A 2ZXWC 4JVSA 5COMA 1QPUA 4DBRA 4HFKB 3MYIA 4PK4A 1YYJA 1MNDA 4Q4ZF 1FMVA 1EI7A 1RKEB 2P61A 4FESA 5KYWA 2AVKA 1ZZPA 3MYFA 3H65A 2XLWA 2LIGA 3U2MA 2XLDA 3SEOA 4A2NB 1M2OA 1OCOC 1HE9A 3CSKA 3NYMA 2LFDA 4MQ9F 4J32B 4EWCA 3DM5A 5DQZA 2IXNA 3J06A 3O55A 1BR4A 3N0TA 3UMKA 2BC5A 1U0BB 1RKEA 3GEHA 1CPQA 3LLKA 1VB5A 1KU2A 2Y3GA 4KBLA 3CZ6A 1JR8A 4JE9A 4YT5A 5B1AC 4G7HF 2H8AA 1E86A 1GGQA 4J7YA 1OW6A 1G5ZA 1C17M 1JMWA 2ZXOA 3FAJA 1T6QA 3IHUA 3DJNB 1H9GA 2NUTA 4LLCA 1NFOA 3ZWIA 3JYHA 3TOLA 3RQGA 3JSEO 4N6CA 4G0HA 5FCLA 1Y6DA 1NU7D 4ZLDA 1VLTA 3NMJA 2OJED 2KYHA 4DRHB 3K1IC 2J9BA 2G3KA 1OXBA 4XWJA 1EKYA 4MVUA 2CW0F 4KC9A 1OW7A 2R05A 4CBEA 2YHSA 2A0UA 4KNVA 3ZG1A 2DI3A 1KTMA 4IRUA 3EHMA 2KGOA 4JIOA 1QSPA 2HFIA 2NPUA 3L8JA 3N24A 3UMHA 2BL2A 4I1OB 1T01A 2Y3DA 1ORSC 3CAXA 3M4CA 3VYWA 5AC5A 2QTVA 3KMIA 1NG1A 4XPWA 3GORA 1E83A 4BJ6C 3LS0A 1FMWA 1M57C 2HS5A 3AQBA 4W8PA 3UNGC 5AC4A 1O87A 1YA9A 1Z6AA 3DAFA 1T6UA 3IQ5A 4J7TA 5K0IA 1E85A 3L0IA 5KYXB 4U5DE 2R7TA 2R03A 2YKZA 3QZCA 2R7VA 2AP3A 5DS5A 1YJGA 4NCQA 2W9YA 3DJUB 3EPVA 3MLGA 5F5FA 1CGME 3S90A 2NUPB 1QVXA 2AWCA 3KH2A 4I1MA 3SXYA 1QKRA 2KSFA 3M15A 2V26A 3T6GB 5DS6A 1SMYF 2XL4A 2Y69C 3PDMP 3NYLA 1CPRA 3NRHA 1MQVA 5KYXA 4CSAC 1SF8A 2R7SA 2VB6A 5L3QA 3EJNA 3FOOA 1D1AA 2QY9A 2A6HF 3ATPA 3B29A 3DAGA 4DRJB 3U0CA 4NTAA 3OEOA 3EH2A 1LS4A 3GEEA 4HEAJ 1Z23A 1L7CA 5F28E 3RIPA 3O10A 2XXAA 4MNDA 4EKWA 1R4TA 3GWNA 5A6KA 4U5BE 5DQTA 3EGXB 1OW8A 1RCPA 4JCHA 1ZHWA 2R7RA 1RMVA 4XEVA 2OJQA 3U3BA 1AEPA 3ITFA 1APCA 2PX3A 3EZIA 4JEBA 4E0IA 1DOVA 3C62A 4ER9A 1SYQA 3QMKA 4MVQA 4PR9A 5JSLA 3TJ6A 3EGDB 1QQ3A 5A6AA 3H2VA 4YT2A 3EGXA 3AG3C 1V54C 4U5GA 1IZMA 1YZAA 4IAQA 3ZIBA 1U89A 3LEOA 256BA 4LDRA 3C8GB 3HNIA 2OEVA 2EPKX 2VCBA 2HZ8A 3QVZA 2HMQA 2Y3BA 3LNRA 5COFA 4XEKA 2GDCA 3AG4C 3RQFA 5DS4A 3DZAA 4A4AA 1ST6A 3EHNA 4O6YA 2WZGA 3POVA 1HW2A 5DVWA 4MW8A 3U2LA 4JKVA 3GWLA 2C03A 4E17A 2HSBA 3JT1A 3W2WA 1LS1A 3AG2C 1YA7O 3FMSA 3C8GA 2PX0A 5T1DB 3FAPB 3K1IA 3TK0A 3ZC4A 2X51A 3B9QA 1VMAA 2Q00A 4JCZA 2NSFA 2VC9A 3S27A 2DYSC 4JRZA 3VF0A 1Z5ZA 4OIOF 2EPLX 3GANA 3VM6A 4U9DA 2PFDA 2QE9A 5JS5A 1E84A 2YL1A 1OQCA 2P1AA 3AGUA 2E87A 2AWYA 4BJ6A 2ZXRA 3HNKA 4BJ5A 3WG7C 2J9WA 3JYYA 2GFHA 5BQGA 4B6IA 4E7ZA 1YZCA 3DE8A 4OD5A 3T6BA 1FAPB 1WN0A 1NSGB 2CYDA 4YN0B 4DVYP 2HUJA 4PACA 4RBNA 3RKOF 3T4RA 3LAYA 2A68F 5JRAA 3NG1A 1Q0MA 2LQGA 4QI0A 5EHHA 4CJOA 1YLMA 4EUKB 1M6TA 3LNMB 2QNLA 4J30B 1OKKA 3ABKC 3EG9B 4BEMJ 3B0VC 1AVOB 1O5HA 2NUTB 3IQTA 1D1BA 3U9JA 3KKBA 1V74B 3R2PA 4YL0A 1XZPA 1LI7A 4O79A 3IPMO 3CEXA 4WABA 2D4UA 2WZLA 3H2UA 1ZHXA 3RVZA 1K04A 2P6VA 1HMDA 1Q0DA 2BE5F 3E70C 4IGGA 3G50A 4ANJA 5L0JA 3EG9A 2XRHA 4G78A 1J8MF 3DE9A 4O6NA 4WJ0A 1H9TA 4H4KC 4CDAA 1BBHA 1B68A 2R7OA 4K0DA 2PP4A 4XLNF 2QUPA 2KJGA 1V55C 1PD0A 4O7GA 2HV6A 2YWAA 1YVIA 3A9CA 2IXPA 4LERA 3DM9B 3UR3C 4KI2A 2LK4A 2L6FA 4GQHA 4MVOA 3RVYA 4E18A 2LCHA 2XS1A 4N06A 5JT4A 3JRTA 4N6HA 4PFPA 4M63A 1YDIA 3ASNC 4FAPB 3S84A 1C03A 2Q4FA 4ULVA 5HSWA 2VCCA 2L81A 3AOUA 2FFHA 3ABLC 2PNOA 2H7VC 4YJWA 2FGYA 4C3DA 3SXZA 2Q3TA 4F4BA 3C18A 4AE4B 1PV3A 2ASRA 2HMZA 2J0XA 3T9OA 1V4AA 3AG1C 2A69F 2TMVP 4RDAA 1Z63A 1UFBA 1VYIA 2JD3A 2J7PA 4CS8C 4K7BA 2H7OA 4EBKA 4MTGA 3L1MA 4WGYA 3TD7A 1JPJA 1QLEC 3O39A 5JUAA 1OCZC 3RQEA 1D0XA 1NBBA 2PBEA 1FTSA 2IOQA 1ZHTA 4AL0A 2LP4A 2MHRA 5TJ5E 1ZYRF 3US6A 4BJTA 4YWQA 2XXAB 3UGPA 3PCVA 1M56C 3U5SA 5D91A 2YL3A 5T3WA 3RFYA 2HJ3A 1JAFA 4PJNA 3Q6MA 4RD9A 3JRMO 1WASA 4JW1A 1HW1A 1EQ1A 1OR3A 3ABMC 3MFNA 3SP1A 1I5NA 4XLPF 3EQLF 4YT8A 1WATA 4IB4A 1KNYA 3R7CA 2EIJC 1TR2A 2JX0A 2R7XA 2KQ9A 4D4NA 3FHDA 1PD1A 2GWWA 3I5QA 1UG7A 4ULWA 1W2WA 1N1CA 1BR1A 3S9OA 3WODF 2EILC 1OKKD 3FXHA 5JVEA 2ICWG 3B71A 3GODA 5HV9A 5L0HA 2Q9CA 4JTCB 1G8XA 4MTOA 3ECSA 1K05A 3MX3A 5KYWB 4L6RA 4DVZA 4XEFA 1A41A 3IQCA 2R02A 4Z9HA 4JURI 1WWPA 2J9UA 2CDQA 2DB4A 1HE1A 3TQOA 4XTKA 5JLIA 1FR0A 3U8VA 1YARO 2R25A 4XQ1A 3FVYA 1Z7Qc 5KYUA 2H7BA 2XLOA 3V5XA 4CJGA 4X0RA 5L0IA 1GQAA 2J0WA 2NG1A 1ZU4A 2LSEA 2OEXA 3I4UA 4LACB 1WGWA 1OCCC 1M2VA 2KC3A 2I8BA 5L0DA 3F47A 3K1HA 1U6HA 3C8ZA 3BEHA 3S28A 1TFKB 4C7OB 3DXJF 3O6XA 3V7OA 4AE4A 1TWCA 4BPMA 3T6JA 3LESA 1VTMP 1WOLA 3C63A 1ORYA 3LEVA 4DOZA 3NMIA 4KNWA 3LLIA 3KPHA 4YL1A 3X2QC 3ZVRA 1ORJA 2IXMA 4XPXA 3LS1A 4U5EE 3TJ5A 3A11A 4K1OA 3QW0A 1JPNA 4C7OA 1ZU5A 1D1CA 3ASOC 2IM8A 3B0PA 4WGZA 4JTAB 1JRAA 2W4MA 4D4XA 3W4YA 2RSEB 3I5PA 4MW3A 2J7PD 1LVKA 4G7ZF 3N2ZB 1R5ID 2DYRC 1YAUO 2VCAA 3LJBA 4Z9IA 2XLMA 1L3PA 3SZRA 3SYNA 3Q7LA 4U5FE 3FDQA 1Q0KA 5FZTA 2WVOA 2J9VA 2W45A 2G3VA 3W8IA 3W2VA 3WHNA 2FAPB 2HV7A 3B0UX 4AL1A 1VLSA 4IAOA 5IY5C 1ZW2A 1MMDA 2ETSA 4I3MA 4CS8A 1VOMA 2VH3A 3DMDA 3NMKA 1BR2A 4U5HA 2CNWA 1CGOA 2B0HA 1O3UA 1MNEA 1T5OA 3K66A 2EIKC 3GM1A 3AJMA 3DWWA 2WVQA 3U8PA 1LPEA 1BZ4A 2W4BA 3RYLA 1I4YA 2CGEA 3MBGA 3S29A 5KYNA 5AGFA 4CSAA 2JPUA 1FFTC 3BRJA 1IW7F 5COGA 3S0XA 5F5HA 1PCXA 4YK5A 4CX9A 1OCRC 1VYKA 1LE4A 3DD7A 2QLAA 3NKEA 4CS9C 2P7VA 2YLDA 3JZ0A 4EHPA 4MVSA 1Y4CA 4U5CE 1D0YA 5D92A 1RXQA 1LE2A 3L34A 2P0NA 3Q6NA 4PJLA 1LIHA 1MMNA 1A7EA 2C04A 2XM0A 2V3CC 3HJCA 1XWJA 2M64A 2WB7A 1J8YF 2I15A 1MMGA 4OIQF 3IEEA 2XLVA 2D5RB 2OG2A 3HNLA 1A7VA 1LM3B 4Q7CA 1ZHYA 4FX5A 4BG0A 3ZQYA 2HJMA 4JJGA 4GEHA 3JTLO 1AUEA 2HKVA 3LUTB 3EZHA 4G7OF 3L8IA 1TQGA 4JEAA 1RJ9B 4MVMA 4ZLCA 1Z3IX 3ZTZA 3FOPA 4XPYA 3KL4A 4GYTA 1G4WR 4DJ9A 2YL0A 2KNHA 4C3BA 4CS7A 2MWQA 5L3VA 1LKXA 3U9MA 4QDLA 5B3SC 4U9EA 3G4ZA 2IYLD 1CGNA 5L0CA 4EBJA 1QZXA 5GPGB 1JOGA 2Z15A 1GS9A 3AQCA 3C8GD 3PMRA 1ZW3A 4ONSA 4NY3A 4BJ1A 2OQMA 4EIYA 1RJ9A 5CI9A 4Q5SF 5A6BD 2B0JA 3ZSUA 5KYYB 3KYIA 1YYXA 3M4BA 4JTDB 2RD9A 3HNJA 4R32A 5T3TA 4OIPF 4OINF 4MS2A 1FNTc 1Q0FA 1VK5A 2A1DD 2ZXPA 4OIRF 1BDJB 1SR2A 2WVNA 3QTHA 4YL3A 4AK9A 3M1CB 3TULA 3QW1A 3NKDA 4EBBA 1RKCA 5KYYA 4JZAA 2OU6A 4CIHA 1HY5A 3IQ6A 4NC3A 4BJ5C 4DXWA 2IXOA 2OOCA 1T6IA 3PHF2 1OR2A 1TWAA 4HFFB 1MMAA 3JCUQ 3ZDLA 1OXKA 1A0BA 2MYSA 2UUIA 4DRIB 2NSGA 5A69A 4MVZA 5CI8A 1GM5A 3KYJA 2XLEA 2L7AA 2LFFA 3K33A 5E3AA 3GEIA 2CNWD 3SXMA 3TOMA 2ZPAA 5L0GA 2R7UA 1H6GA 1SZIA 4AX2A 2KW3C 2AU5A 2XL8A 2F22A 5KYUB 4P9FA 5BQIA 4MTFA 3V5ZA 2XM4A 2XS8A 5E33A 1M2VB 3W8HA 2PF4E 2R7QA 3VAYA 2OKUA 2UUHA 3E9VA 4CDYA 3C7JA 1TKNA 3GM2A 4MVRA 4NQFA 4UDVA 4OD4A 5BQHA 5EK0A 2ZD9A 2EPNA 2X0CA 1Q0GA 2Q9BA 2L6GA 2WZFA 4IARA 3OWTA 3HKKA 4IJJA 3UGOA 3RF3A 2NUPA 5JP7A 4IWBA 1LI5A 3ZQVA 1FFHA 2GA0A 3QVYA 1TFOB 2R7WA 2YVKA 3EFOB 3G4XA 4BEJA 4CS9A 2YRFA 1XZQA 4FWVA 2LD6A 1ZVZA 3V5YA 4YT4A 1NU9C 4N4WA 4P6IC 4QI2A 2XSEA 3ZTMA 2L6HA 3DI5A 3EH1A 2HSQA 2YQYA 2GAQA 4JJFA 5E2QA 2Y3HA 2J46A 2Q9AA 2VASA 2YL7A 1NFNA 3EFOA 1EA8A 1T9KA 4PFOA 5EGYA 3NDBB 1E2XA 3CQZA 4NTBA 4LLEA 4PJJA 1HMOA 4W8KA 1G4US 4E7SA 3OA1A 2M4EA 5L0FA 4LDQA 2YLIA 3F46A 3GM3A 4LDKA 4Z9JA 3X1OA 2OCCC 4HE8D 3Q7GA 4H54A 4O6MA 3RW0A 3K6BA 4JC7A 3EGDA 5BUOA 2EIMC 1F1MA 1S7ZA 2EPOA 2WL8A 2YEVA 3JSZA 5B1BC 4CDVA 2XLHA 3DKAA 1NLXA 2EPMX 1D0ZA 1WTYA 1TWHA 2CCYA 1ZHZA 2Y39A 3M79A 4I44A 4P9TA 4DBQA 5B3IA 1I4ZA 3AGTA 1TWGA 3VRCA 4NTFA 2A0BA 5CIVA 3HLZA 2YLGA 2EINC 2J8WA 2L9JA 3HTKC 3U3FA 3WAQA 3SXKA 2O9XA 3UMIA 2KK1A 1C02A 1DOWA 2Q7RA 3RH3A 1NZEA 3K7DA 2YZSA 4C3EA 5DLJA 2DGJA 2J45A 4E0HA 1A7DA 3NYJA 4PJMA 5A6BA 2IBFA 2R9RB 1K40A 5A6JA 2A6EF
chains in the Genus database with same CATH topology
2P1AA 5COFA 2NSGA 5COMA 1RXQA 2OQMA 4N6CA 3DKAA 2F22A 2RD9A 3DI5A 5CIVA 2YQYA 2QNLA 2HKVA 3QTHA 2NSFA 3CEXA 2OU6A 5COGA 3GORA 2QE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P1A A;  5COF A;  2NSG A;  5COM A;  1RXQ A;  2OQM A;  4N6C A;  3DKA A;  2F22 A;  2RD9 A;  3DI5 A;  5CIV A;  2YQY A;  2QNL A;  2HKV A;  3QTH A;  2NSF A;  3CEX A;  2OU6 A;  5COG A;  3GOR A;  2QE9 A; 
#chains in the Genus database with same CATH topology
 1H7I A;  5E3C A;  1S05 A;  3SNH A;  2XL6 A;  4CIP A;  2G62 A;  2ZXW C;  4JVS A;  5COM A;  1QPU A;  4DBR A;  4HFK B;  3MYI A;  4PK4 A;  1YYJ A;  1MND A;  4Q4Z F;  1FMV A;  1EI7 A;  1RKE B;  2P61 A;  4FES A;  5KYW A;  2AVK A;  1ZZP A;  3MYF A;  3H65 A;  2XLW A;  2LIG A;  3U2M A;  2XLD A;  3SEO A;  4A2N B;  1M2O A;  1OCO C;  1HE9 A;  3CSK A;  3NYM A;  2LFD A;  4MQ9 F;  4J32 B;  4EWC A;  3DM5 A;  5DQZ A;  2IXN A;  3J06 A;  3O55 A;  1BR4 A;  3N0T A;  3UMK A;  2BC5 A;  1U0B B;  1RKE A;  3GEH A;  1CPQ A;  3LLK A;  1VB5 A;  1KU2 A;  2Y3G A;  4KBL A;  3CZ6 A;  1JR8 A;  4JE9 A;  4YT5 A;  5B1A C;  4G7H F;  2H8A A;  1E86 A;  1GGQ A;  4J7Y A;  1OW6 A;  1G5Z A;  1C17 M;  1JMW A;  2ZXO A;  3FAJ A;  1T6Q A;  3IHU A;  3DJN B;  1H9G A;  2NUT A;  4LLC A;  1NFO A;  3ZWI A;  3JYH A;  3TOL A;  3RQG A;  3JSE O;  4N6C A;  4G0H A;  5FCL A;  1Y6D A;  1NU7 D;  4ZLD A;  1VLT A;  3NMJ A;  2OJE D;  2KYH A;  4DRH B;  3K1I C;  2J9B A;  2G3K A;  1OXB A;  4XWJ A;  1EKY A;  4MVU A;  2CW0 F;  4KC9 A;  1OW7 A;  2R05 A;  4CBE A;  2YHS A;  2A0U A;  4KNV A;  3ZG1 A;  2DI3 A;  1KTM A;  4IRU A;  3EHM A;  2KGO A;  4JIO A;  1QSP A;  2HFI A;  2NPU A;  3L8J A;  3N24 A;  3UMH A;  2BL2 A;  4I1O B;  1T01 A;  2Y3D A;  1ORS C;  3CAX A;  3M4C A;  3VYW A;  5AC5 A;  2QTV A;  3KMI A;  1NG1 A;  4XPW A;  3GOR A;  1E83 A;  4BJ6 C;  3LS0 A;  1FMW A;  1M57 C;  2HS5 A;  3AQB A;  4W8P A;  3UNG C;  5AC4 A;  1O87 A;  1YA9 A;  1Z6A A;  3DAF A;  1T6U A;  3IQ5 A;  4J7T A;  5K0I A;  1E85 A;  3L0I A;  5KYX B;  4U5D E;  2R7T A;  2R03 A;  2YKZ A;  3QZC A;  2R7V A;  2AP3 A;  5DS5 A;  1YJG A;  4NCQ A;  2W9Y A;  3DJU B;  3EPV A;  3MLG A;  5F5F A;  1CGM E;  3S90 A;  2NUP B;  1QVX A;  2AWC A;  3KH2 A;  4I1M A;  3SXY A;  1QKR A;  2KSF A;  3M15 A;  2V26 A;  3T6G B;  5DS6 A;  1SMY F;  2XL4 A;  2Y69 C;  3PDM P;  3NYL A;  1CPR A;  3NRH A;  1MQV A;  5KYX A;  4CSA C;  1SF8 A;  2R7S A;  2VB6 A;  5L3Q A;  3EJN A;  3FOO A;  1D1A A;  2QY9 A;  2A6H F;  3ATP A;  3B29 A;  3DAG A;  4DRJ B;  3U0C A;  4NTA A;  3OEO A;  3EH2 A;  1LS4 A;  3GEE A;  4HEA J;  1Z23 A;  1L7C A;  5F28 E;  3RIP A;  3O10 A;  2XXA A;  4MND A;  4EKW A;  1R4T A;  3GWN A;  5A6K A;  4U5B E;  5DQT A;  3EGX B;  1OW8 A;  1RCP A;  4JCH A;  1ZHW A;  2R7R A;  1RMV A;  4XEV A;  2OJQ A;  3U3B A;  1AEP A;  3ITF A;  1APC A;  2PX3 A;  3EZI A;  4JEB A;  4E0I A;  1DOV A;  3C62 A;  4ER9 A;  1SYQ A;  3QMK A;  4MVQ A;  4PR9 A;  5JSL A;  3TJ6 A;  3EGD B;  1QQ3 A;  5A6A A;  3H2V A;  4YT2 A;  3EGX A;  3AG3 C;  1V54 C;  4U5G A;  1IZM A;  1YZA A;  4IAQ A;  3ZIB A;  1U89 A;  3LEO A;  256B A;  4LDR A;  3C8G B;  3HNI A;  2OEV A;  2EPK X;  2VCB A;  2HZ8 A;  3QVZ A;  2HMQ A;  2Y3B A;  3LNR A;  5COF A;  4XEK A;  2GDC A;  3AG4 C;  3RQF A;  5DS4 A;  3DZA A;  4A4A A;  1ST6 A;  3EHN A;  4O6Y A;  2WZG A;  3POV A;  1HW2 A;  5DVW A;  4MW8 A;  3U2L A;  4JKV A;  3GWL A;  2C03 A;  4E17 A;  2HSB A;  3JT1 A;  3W2W A;  1LS1 A;  3AG2 C;  1YA7 O;  3FMS A;  3C8G A;  2PX0 A;  5T1D B;  3FAP B;  3K1I A;  3TK0 A;  3ZC4 A;  2X51 A;  3B9Q A;  1VMA A;  2Q00 A;  4JCZ A;  2NSF A;  2VC9 A;  3S27 A;  2DYS C;  4JRZ A;  3VF0 A;  1Z5Z A;  4OIO F;  2EPL X;  3GAN A;  3VM6 A;  4U9D A;  2PFD A;  2QE9 A;  5JS5 A;  1E84 A;  2YL1 A;  1OQC A;  2P1A A;  3AGU A;  2E87 A;  2AWY A;  4BJ6 A;  2ZXR A;  3HNK A;  4BJ5 A;  3WG7 C;  2J9W A;  3JYY A;  2GFH A;  5BQG A;  4B6I A;  4E7Z A;  1YZC A;  3DE8 A;  4OD5 A;  3T6B A;  1FAP B;  1WN0 A;  1NSG B;  2CYD A;  4YN0 B;  4DVY P;  2HUJ A;  4PAC A;  4RBN A;  3RKO F;  3T4R A;  3LAY A;  2A68 F;  5JRA A;  3NG1 A;  1Q0M A;  2LQG A;  4QI0 A;  5EHH A;  4CJO A;  1YLM A;  4EUK B;  1M6T A;  3LNM B;  2QNL A;  4J30 B;  1OKK A;  3ABK C;  3EG9 B;  4BEM J;  3B0V C;  1AVO B;  1O5H A;  2NUT B;  3IQT A;  1D1B A;  3U9J A;  3KKB A;  1V74 B;  3R2P A;  4YL0 A;  1XZP A;  1LI7 A;  4O79 A;  3IPM O;  3CEX A;  4WAB A;  2D4U A;  2WZL A;  3H2U A;  1ZHX A;  3RVZ A;  1K04 A;  2P6V A;  1HMD A;  1Q0D A;  2BE5 F;  3E70 C;  4IGG A;  3G50 A;  4ANJ A;  5L0J A;  3EG9 A;  2XRH A;  4G78 A;  1J8M F;  3DE9 A;  4O6N A;  4WJ0 A;  1H9T A;  4H4K C;  4CDA A;  1BBH A;  1B68 A;  2R7O A;  4K0D A;  2PP4 A;  4XLN F;  2QUP A;  2KJG A;  1V55 C;  1PD0 A;  4O7G A;  2HV6 A;  2YWA A;  1YVI A;  3A9C A;  2IXP A;  4LER A;  3DM9 B;  3UR3 C;  4KI2 A;  2LK4 A;  2L6F A;  4GQH A;  4MVO A;  3RVY A;  4E18 A;  2LCH A;  2XS1 A;  4N06 A;  5JT4 A;  3JRT A;  4N6H A;  4PFP A;  4M63 A;  1YDI A;  3ASN C;  4FAP B;  3S84 A;  1C03 A;  2Q4F A;  4ULV A;  5HSW A;  2VCC A;  2L81 A;  3AOU A;  2FFH A;  3ABL C;  2PNO A;  2H7V C;  4YJW A;  2FGY A;  4C3D A;  3SXZ A;  2Q3T A;  4F4B A;  3C18 A;  4AE4 B;  1PV3 A;  2ASR A;  2HMZ A;  2J0X A;  3T9O A;  1V4A A;  3AG1 C;  2A69 F;  2TMV P;  4RDA A;  1Z63 A;  1UFB A;  1VYI A;  2JD3 A;  2J7P A;  4CS8 C;  4K7B A;  2H7O A;  4EBK A;  4MTG A;  3L1M A;  4WGY A;  3TD7 A;  1JPJ A;  1QLE C;  3O39 A;  5JUA A;  1OCZ C;  3RQE A;  1D0X A;  1NBB A;  2PBE A;  1FTS A;  2IOQ A;  1ZHT A;  4AL0 A;  2LP4 A;  2MHR A;  5TJ5 E;  1ZYR F;  3US6 A;  4BJT A;  4YWQ A;  2XXA B;  3UGP A;  3PCV A;  1M56 C;  3U5S A;  5D91 A;  2YL3 A;  5T3W A;  3RFY A;  2HJ3 A;  1JAF A;  4PJN A;  3Q6M A;  4RD9 A;  3JRM O;  1WAS A;  4JW1 A;  1HW1 A;  1EQ1 A;  1OR3 A;  3ABM C;  3MFN A;  3SP1 A;  1I5N A;  4XLP F;  3EQL F;  4YT8 A;  1WAT A;  4IB4 A;  1KNY A;  3R7C A;  2EIJ C;  1TR2 A;  2JX0 A;  2R7X A;  2KQ9 A;  4D4N A;  3FHD A;  1PD1 A;  2GWW A;  3I5Q A;  1UG7 A;  4ULW A;  1W2W A;  1N1C A;  1BR1 A;  3S9O A;  3WOD F;  2EIL C;  1OKK D;  3FXH A;  5JVE A;  2ICW G;  3B71 A;  3GOD A;  5HV9 A;  5L0H A;  2Q9C A;  4JTC B;  1G8X A;  4MTO A;  3ECS A;  1K05 A;  3MX3 A;  5KYW B;  4L6R A;  4DVZ A;  4XEF A;  1A41 A;  3IQC A;  2R02 A;  4Z9H A;  4JUR I;  1WWP A;  2J9U A;  2CDQ A;  2DB4 A;  1HE1 A;  3TQO A;  4XTK A;  5JLI A;  1FR0 A;  3U8V A;  1YAR O;  2R25 A;  4XQ1 A;  3FVY A;  1Z7Q c;  5KYU A;  2H7B A;  2XLO A;  3V5X A;  4CJG A;  4X0R A;  5L0I A;  1GQA A;  2J0W A;  2NG1 A;  1ZU4 A;  2LSE A;  2OEX A;  3I4U A;  4LAC B;  1WGW A;  1OCC C;  1M2V A;  2KC3 A;  2I8B A;  5L0D A;  3F47 A;  3K1H A;  1U6H A;  3C8Z A;  3BEH A;  3S28 A;  1TFK B;  4C7O B;  3DXJ F;  3O6X A;  3V7O A;  4AE4 A;  1TWC A;  4BPM A;  3T6J A;  3LES A;  1VTM P;  1WOL A;  3C63 A;  1ORY A;  3LEV A;  4DOZ A;  3NMI A;  4KNW A;  3LLI A;  3KPH A;  4YL1 A;  3X2Q C;  3ZVR A;  1ORJ A;  2IXM A;  4XPX A;  3LS1 A;  4U5E E;  3TJ5 A;  3A11 A;  4K1O A;  3QW0 A;  1JPN A;  4C7O A;  1ZU5 A;  1D1C A;  3ASO C;  2IM8 A;  3B0P A;  4WGZ A;  4JTA B;  1JRA A;  2W4M A;  4D4X A;  3W4Y A;  2RSE B;  3I5P A;  4MW3 A;  2J7P D;  1LVK A;  4G7Z F;  3N2Z B;  1R5I D;  2DYR C;  1YAU O;  2VCA A;  3LJB A;  4Z9I A;  2XLM A;  1L3P A;  3SZR A;  3SYN A;  3Q7L A;  4U5F E;  3FDQ A;  1Q0K A;  5FZT A;  2WVO A;  2J9V A;  2W45 A;  2G3V A;  3W8I A;  3W2V A;  3WHN A;  2FAP B;  2HV7 A;  3B0U X;  4AL1 A;  1VLS A;  4IAO A;  5IY5 C;  1ZW2 A;  1MMD A;  2ETS A;  4I3M A;  4CS8 A;  1VOM A;  2VH3 A;  3DMD A;  3NMK A;  1BR2 A;  4U5H A;  2CNW A;  1CGO A;  2B0H A;  1O3U A;  1MNE A;  1T5O A;  3K66 A;  2EIK C;  3GM1 A;  3AJM A;  3DWW A;  2WVQ A;  3U8P A;  1LPE A;  1BZ4 A;  2W4B A;  3RYL A;  1I4Y A;  2CGE A;  3MBG A;  3S29 A;  5KYN A;  5AGF A;  4CSA A;  2JPU A;  1FFT C;  3BRJ A;  1IW7 F;  5COG A;  3S0X A;  5F5H A;  1PCX A;  4YK5 A;  4CX9 A;  1OCR C;  1VYK A;  1LE4 A;  3DD7 A;  2QLA A;  3NKE A;  4CS9 C;  2P7V A;  2YLD A;  3JZ0 A;  4EHP A;  4MVS A;  1Y4C A;  4U5C E;  1D0Y A;  5D92 A;  1RXQ A;  1LE2 A;  3L34 A;  2P0N A;  3Q6N A;  4PJL A;  1LIH A;  1MMN A;  1A7E A;  2C04 A;  2XM0 A;  2V3C C;  3HJC A;  1XWJ A;  2M64 A;  2WB7 A;  1J8Y F;  2I15 A;  1MMG A;  4OIQ F;  3IEE A;  2XLV A;  2D5R B;  2OG2 A;  3HNL A;  1A7V A;  1LM3 B;  4Q7C A;  1ZHY A;  4FX5 A;  4BG0 A;  3ZQY A;  2HJM A;  4JJG A;  4GEH A;  3JTL O;  1AUE A;  2HKV A;  3LUT B;  3EZH A;  4G7O F;  3L8I A;  1TQG A;  4JEA A;  1RJ9 B;  4MVM A;  4ZLC A;  1Z3I X;  3ZTZ A;  3FOP A;  4XPY A;  3KL4 A;  4GYT A;  1G4W R;  4DJ9 A;  2YL0 A;  2KNH A;  4C3B A;  4CS7 A;  2MWQ A;  5L3V A;  1LKX A;  3U9M A;  4QDL A;  5B3S C;  4U9E A;  3G4Z A;  2IYL D;  1CGN A;  5L0C A;  4EBJ A;  1QZX A;  5GPG B;  1JOG A;  2Z15 A;  1GS9 A;  3AQC A;  3C8G D;  3PMR A;  1ZW3 A;  4ONS A;  4NY3 A;  4BJ1 A;  2OQM A;  4EIY A;  1RJ9 A;  5CI9 A;  4Q5S F;  5A6B D;  2B0J A;  3ZSU A;  5KYY B;  3KYI A;  1YYX A;  3M4B A;  4JTD B;  2RD9 A;  3HNJ A;  4R32 A;  5T3T A;  4OIP F;  4OIN F;  4MS2 A;  1FNT c;  1Q0F A;  1VK5 A;  2A1D D;  2ZXP A;  4OIR F;  1BDJ B;  1SR2 A;  2WVN A;  3QTH A;  4YL3 A;  4AK9 A;  3M1C B;  3TUL A;  3QW1 A;  3NKD A;  4EBB A;  1RKC A;  5KYY A;  4JZA A;  2OU6 A;  4CIH A;  1HY5 A;  3IQ6 A;  4NC3 A;  4BJ5 C;  4DXW A;  2IXO A;  2OOC A;  1T6I A;  3PHF 2;  1OR2 A;  1TWA A;  4HFF B;  1MMA A;  3JCU Q;  3ZDL A;  1OXK A;  1A0B A;  2MYS A;  2UUI A;  4DRI B;  2NSG A;  5A69 A;  4MVZ A;  5CI8 A;  1GM5 A;  3KYJ A;  2XLE A;  2L7A A;  2LFF A;  3K33 A;  5E3A A;  3GEI A;  2CNW D;  3SXM A;  3TOM A;  2ZPA A;  5L0G A;  2R7U A;  1H6G A;  1SZI A;  4AX2 A;  2KW3 C;  2AU5 A;  2XL8 A;  2F22 A;  5KYU B;  4P9F A;  5BQI A;  4MTF A;  3V5Z A;  2XM4 A;  2XS8 A;  5E33 A;  1M2V B;  3W8H A;  2PF4 E;  2R7Q A;  3VAY A;  2OKU A;  2UUH A;  3E9V A;  4CDY A;  3C7J A;  1TKN A;  3GM2 A;  4MVR A;  4NQF A;  4UDV A;  4OD4 A;  5BQH A;  5EK0 A;  2ZD9 A;  2EPN A;  2X0C A;  1Q0G A;  2Q9B A;  2L6G A;  2WZF A;  4IAR A;  3OWT A;  3HKK A;  4IJJ A;  3UGO A;  3RF3 A;  2NUP A;  5JP7 A;  4IWB A;  1LI5 A;  3ZQV A;  1FFH A;  2GA0 A;  3QVY A;  1TFO B;  2R7W A;  2YVK A;  3EFO B;  3G4X A;  4BEJ A;  4CS9 A;  2YRF A;  1XZQ A;  4FWV A;  2LD6 A;  1ZVZ A;  3V5Y A;  4YT4 A;  1NU9 C;  4N4W A;  4P6I C;  4QI2 A;  2XSE A;  3ZTM A;  2L6H A;  3DI5 A;  3EH1 A;  2HSQ A;  2YQY A;  2GAQ A;  4JJF A;  5E2Q A;  2Y3H A;  2J46 A;  2Q9A A;  2VAS A;  2YL7 A;  1NFN A;  3EFO A;  1EA8 A;  1T9K A;  4PFO A;  5EGY A;  3NDB B;  1E2X A;  3CQZ A;  4NTB A;  4LLE A;  4PJJ A;  1HMO A;  4W8K A;  1G4U S;  4E7S A;  3OA1 A;  2M4E A;  5L0F A;  4LDQ A;  2YLI A;  3F46 A;  3GM3 A;  4LDK A;  4Z9J A;  3X1O A;  2OCC C;  4HE8 D;  3Q7G A;  4H54 A;  4O6M A;  3RW0 A;  3K6B A;  4JC7 A;  3EGD A;  5BUO A;  2EIM C;  1F1M A;  1S7Z A;  2EPO A;  2WL8 A;  2YEV A;  3JSZ A;  5B1B C;  4CDV A;  2XLH A;  3DKA A;  1NLX A;  2EPM X;  1D0Z A;  1WTY A;  1TWH A;  2CCY A;  1ZHZ A;  2Y39 A;  3M79 A;  4I44 A;  4P9T A;  4DBQ A;  5B3I A;  1I4Z A;  3AGT A;  1TWG A;  3VRC A;  4NTF A;  2A0B A;  5CIV A;  3HLZ A;  2YLG A;  2EIN C;  2J8W A;  2L9J A;  3HTK C;  3U3F A;  3WAQ A;  3SXK A;  2O9X A;  3UMI A;  2KK1 A;  1C02 A;  1DOW A;  2Q7R A;  3RH3 A;  1NZE A;  3K7D A;  2YZS A;  4C3E A;  5DLJ A;  2DGJ A;  2J45 A;  4E0H A;  1A7D A;  3NYJ A;  4PJM A;  5A6B A;  2IBF A;  2R9R B;  1K40 A;  5A6J A;  2A6E F; 
#chains in the Genus database with same CATH homology
 2P1A A;  5COF A;  2NSG A;  5COM A;  1RXQ A;  2OQM A;  4N6C A;  3DKA A;  2F22 A;  2RD9 A;  3DI5 A;  5CIV A;  2YQY A;  2QNL A;  2HKV A;  3QTH A;  2NSF A;  3CEX A;  2OU6 A;  5COG A;  3GOR A;  2QE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...