3QTHA

Crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
172
structure length
172
Chain Sequence
GMLSRIDLYIKHRDIFLKHLELLHKLIEKVEDSSLNESELLNARLVDDMFPFNVQAKIATNFALRACCPLSGKEYKELEGDIDSFCGLKTYVVTAIDYINKLSEPTLEQLNLNVQDTAGFKEISMPASEYMSSFVLPNFFFHISMVYAIAKNNGVSVTKGDFDGIHQYPKGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Hypothetical DinB-like protein (CPS_3021) from Colwellia psychrerythraea 34H at 2.20 A resolution
rcsb
source organism Colwellia psychrerythraea
molecule tags Unknown function
molecule keywords Uncharacterized protein
total genus 53
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09351 DUF1993 Domain of unknown function (DUF1993)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 3qthA00
1RXQA 2F22A 3GORA 5COGA 5CIVA 2QE9A 5COMA 3CEXA 2RD9A 2HKVA 3DI5A 3QTHA 2NSGA 2QNLA 2OU6A 4N6CA 3DKAA 2NSFA 2P1AA 5COFA 2YQYA 2OQMA
chains in the Genus database with same CATH superfamily
3B0VC 3EPVA 2O9XA 3JSEO 1WN0A 1MNEA 4I1MA 2J46A 5B1BC 3ZTMA 2EILC 4CS9A 2R02A 2C04A 3TD7A 2IYLD 3GM1A 2H7BA 3U2LA 5JUAA 4P9FA 2YLIA 3HNKA 3I5QA 4U5FE 5D92A 3UMHA 4O79A 5COMA 1OKKD 256BA 1A7VA 1G4WR 5T1DB 2RD9A 2GA0A 2NUTA 1V74B 3U8PA 4DOZA 4IRUA 4LDKA 4XLNF 2NUTB 3LUTB 5L0CA 2P0NA 4C3EA 1QLEC 4E18A 4EBJA 3RF3A 2HMQA 1BDJB 1OR3A 1B68A 1D1CA 2J7PD 3AG1C 3K66A 2PX0A 4Q7CA 4L6RA 2XS1A 2JD3A 2HZ8A 3ABMC 2A6HF 1OCZC 3EZIA 4FX5A 4MW8A 3JRTA 1RXQA 1O87A 3ATPA 4EBKA 4P6IC 4JEBA 5B1AC 4MVOA 4EKWA 4BPMA 2X0CA 3FXHA 1M2VB 3UMIA 4CS8A 4XWJA 2HSQA 2WB7A 3ZIBA 3S29A 2PP4A 2ZXWC 5CI9A 3A11A 1JR8A 2VASA 4U5DE 3GEHA 3V5ZA 1YDIA 3KYJA 5DS6A 2W45A 3NMKA 4OD4A 1TFOB 1T6UA 4KNVA 1LI5A 1YYJA 3DM5A 1E85A 3O6XA 4HE8D 1ORYA 3LNRA 1E86A 1LVKA 1Q0DA 1U6HA 1RJ9A 2VCAA 3CAXA 1ZU5A 4RDAA 4OIQF 3HJCA 2HFIA 1HMOA 2ZD9A 4EIYA 3PCVA 4JZAA 3AG4C 3H65A 3NYLA 1OW7A 2Y39A 1CGME 4G0HA 3EHNA 2A0UA 3HTKC 3W8IA 3Q6NA 1W2WA 5T3TA 5L3QA 2IXPA 3K7DA 2LK4A 5A6AA 5F28E 3UR3C 4CSAC 3G50A 1JRAA 1T6QA 4MVMA 5CI8A 5T3WA 3N2ZB 3QW0A 3M4CA 2YZSA 1MNDA 2CCYA 3ASOC 3DD7A 3CQZA 5EHHA 3W2VA 1VYIA 2C03A 4PK4A 2R7VA 4IARA 3LLIA 4N6CA 1G5ZA 3GODA 3B0UX 3L8JA 4KNWA 2L81A 3ABKC 4C3BA 2XLVA 2R7OA 1GQAA 2XM0A 1H6GA 4YL3A 5KYYA 1ZU4A 3FMSA 5KYUB 4B6IA 1A41A 3NYJA 2YRFA 1HE1A 1A7EA 4GQHA 4JTAB 3X1OA 3N24A 4PJMA 4XEKA 4BEMJ 4A4AA 1U0BB 1NLXA 3N0TA 3HKKA 3LJBA 3MYFA 3GORA 4XTKA 4O6NA 3S28A 1BR4A 4Z9JA 1I4YA 1JAFA 4U5BE 3SNHA 5EK0A 3JYYA 4PFPA 1GM5A 2J9UA 1EQ1A 4BEJA 1EI7A 1NZEA 4G7HF 3EH1A 1QQ3A 2LQGA 2AP3A 3RYLA 1H9TA 5F5FA 1QZXA 2ETSA 3K1IC 4IJJA 4PACA 4YL0A 1UFBA 3US6A 4UDVA 2ZXPA 3C7JA 3E9VA 4ZLCA 5L0DA 1RKEB 2D4UA 1G4US 2QY9A 4LACB 3VF0A 2LCHA 4CS9C 5DLJA 1YLMA 5HSWA 3MFNA 1NSGB 3QZCA 4NC3A 4CS8C 2Q7RA 2CGEA 2CW0F 4CJOA 2WZGA 2YL7A 1C02A 4D4NA 1AUEA 2Y3DA 3Q7GA 3VYWA 4H54A 4QI0A 1I4ZA 1LKXA 3QVYA 2A68F 3U3BA 2NG1A 5E33A 1FNTc 2OEXA 4NCQA 2FGYA 1YYXA 3DAGA 3KH2A 3NKDA 1OCOC 4U5CE 3C8GD 2Q4FA 3JTLO 1SZIA 3EZHA 3KMIA 2A0BA 4AE4A 2IXOA 3QVZA 4BG0A 2GAQA 3L34A 1TWCA 5KYNA 4ZLDA 4Z9IA 1HE9A 4NY3A 4CDAA 2XRHA 4EWCA 1Q0FA 4U5EE 4ER9A 2EPKX 1MMGA 5HV9A 1VYKA 3B9QA 2GWWA 3BEHA 2LP4A 3FVYA 1HW2A 2XL6A 2H7VC 4AK9A 3IHUA 4JTCB 3C63A 4I44A 4FESA 2R7XA 3ZTZA 2L6HA 2IBFA 1JPNA 3MYIA 1Z63A 5COFA 3DWWA 2OKUA 4XPWA 4JJGA 1OCCC 2A69F 3SXYA 1ZHXA 1RCPA 2GDCA 1VLSA 1OXBA 1T9KA 3W8HA 2Q9BA 3OEOA 3RVZA 1TWGA 1AVOB 3UNGC 1Z23A 1QKRA 3GANA 2XLHA 4MVQA 1LS1A 2UUIA 5A6BA 4O6MA 1YZCA 4I1OB 3S9OA 3ZQVA 2W4MA 4JJFA 2LFFA 2NSGA 2OU6A 3EG9B 3VAYA 4BJ6A 1Q0MA 2Q3TA 3O10A 2IXMA 3T4RA 2HV6A 5DS4A 4YK5A 1WGWA 2WZFA 1BR1A 4P9TA 2HUJA 1D1BA 3WHNA 1Z6AA 2J9BA 3LEOA 4AX2A 1TR2A 3O39A 3DXJF 1WTYA 3RH3A 2X51A 2KW3C 4N6HA 4QDLA 1RMVA 3EFOB 4G78A 1RKEA 3AOUA 2E87A 4CX9A 4U9DA 2Y3BA 2XLMA 4ULWA 2OJQA 4GEHA 3SXKA 1IW7F 2XS8A 3GM2A 1S05A 1D1AA 1CPQA 2EPMX 4E0IA 4WGYA 2QE9A 1Y4CA 2DB4A 3C18A 2QLAA 4NTAA 1UG7A 3O55A 5A69A 4U5GA 5JSLA 3EGDA 1OKKA 2KNHA 2EIKC 5DQZA 3EGDB 1VLTA 3CSKA 1CGOA 1XZPA 2P7VA 3T6JA 1OCRC 2Y69C 1BBHA 3POVA 5AC4A 3LS0A 3F47A 3AJMA 1ZHYA 2HMZA 1YZAA 5KYUA 3AG2C 1YVIA 2MWQA 4NQFA 3M79A 4PJNA 3DJNB 2IOQA 2A6EF 3UMKA 1OXKA 1V55C 1XZQA 2IXNA 1CPRA 3VRCA 4CBEA 4DBQA 2A1DD 2CDQA 3NG1A 4BJTA 1LPEA 3Q6MA 3T9OA 3NYMA 2F22A 3JSZA 1M2VA 3JYHA 5KYWB 2P61A 3T6GB 3GEEA 4JCZA 5KYXB 3FAPB 1K04A 1KU2A 2Z15A 4DJ9A 1QSPA 1G8XA 2PX3A 3DI5A 2OEVA 3DM9B 3JZ0A 3AG3C 4NTBA 1PD1A 4G7OF 4YT5A 5BQIA 4XPYA 2EINC 3NMJA 2Y3HA 3V5XA 5JS5A 3I4UA 4IAQA 3IEEA 2H7OA 2VC9A 4JKVA 4FAPB 2G3VA 4LLEA 1RKCA 1FAPB 2LIGA 3BRJA 1V54C 1CGNA 1LE2A 2M4EA 2KGOA 1Y6DA 3GEIA 3K1IA 4IB4A 1NG1A 2OOCA 2YVKA 4U9EA 3EHMA 4N06A 4CIHA 1Z7Qc 2KSFA 2R7QA 4DVYP 2R7WA 4WGZA 2XL4A 2XLOA 5CIVA 1Q0KA 2L9JA 1SF8A 2VCCA 3ZQYA 2L7AA 1DOVA 3FOOA 3L0IA 4MVRA 5E3CA 3SEOA 1VTMP 3GWNA 3K33A 3GM3A 1FTSA 1FMVA 3J06A 2VH3A 1I5NA 4MVSA 5E3AA 5GPGB 1K40A 3RQFA 3DAFA 3T6BA 1APCA 1YA9A 2FAPB 3TULA 4XEVA 1Z5ZA 4JC7A 3SZRA 2XLDA 4CS7A 3GWLA 4KI2A 1EA8A 2NSFA 2R7UA 1SYQA 3X2QC 3HNIA 1NU9C 3OA1A 4ULVA 4HFKB 2G62A 2J45A 2KK1A 4NTFA 5AC5A 4YT2A 2KC3A 2R25A 3NKEA 2CYDA 1SR2A 5L0GA 1NFNA 3ITFA 4DRHB 2JX0A 2ZPAA 4GYTA 4D4XA 2NUPB 3JT1A 3U3FA 3PHF2 1KNYA 1TWAA 2YL0A 4HEAJ 4CDVA 3DE8A 5L0IA 2HJ3A 3LS1A 5B3IA 2J9WA 5A6JA 5JLIA 3E70C 1D0YA 5DVWA 1O3UA 5JT4A 4OINF 1MMAA 3SXZA 3TOMA 4LDRA 4CJGA 1KTMA 4YT8A 1FFTC 1TFKB 3C8ZA 3EGXB 3SXMA 3U5SA 2W4BA 1VK5A 3OWTA 5L0JA 3HNJA 4WABA 2ICWG 2YL1A 5K0IA 1OQCA 2P1AA 2PBEA 1FFHA 3C62A 4RD9A 1ZZPA 2VCBA 2PNOA 3LNMB 4XPXA 1M6TA 4WJ0A 3U9MA 1IZMA 5L0FA 4YT4A 3EG9A 3KL4A 3QMKA 1T6IA 3R2PA 4J7TA 3ASNC 4JCHA 3DE9A 2AVKA 1QVXA 2R05A 5A6BD 2AWCA 2DI3A 1JOGA 1D0XA 2L6GA 1FMWA 1TWHA 1M56C 2J0XA 3ABLC 3ZDLA 4ONSA 4E17A 4IGGA 2PFDA 1ZHZA 2Q00A 3M4BA 4IAOA 5L3VA 2AU5A 3TQOA 1VMAA 2H8AA 4MQ9F 5F5HA 3IQCA 3S90A 3TK0A 3DMDA 1ZYRF 2NUPA 3G4ZA 3RKOF 2DYSC 2LSEA 3EJNA 4JTDB 4DRJB 3L8IA 4M63A 1LS4A 2R7SA 2UUHA 4MW3A 1NFOA 1AEPA 3UGPA 1ZW3A 3AQBA 3LESA 1LIHA 3KPHA 4JW1A 2YKZA 5D91A 2XLWA 3IQ6A 4PJLA 3ZC4A 4E7SA 3U8VA 1M57C 5EGYA 2KJGA 1L7CA 4OD5A 3RFYA 1E84A 1D0ZA 3JRMO 1MMNA 1O5HA 3EGXA 4O7GA 2WL8A 5E2QA 4PJJA 5DS5A 4I3MA 4AL1A 3VM6A 4AE4B 4DBRA 5B3SC 3S84A 2HKVA 1YJGA 5JVEA 3K6BA 1C03A 1NU7D 2EIJC 3SYNA 5A6KA 2Y3GA 2I15A 3IQTA 4PFOA 4R32A 1GGQA 4EHPA 2R7RA 3MLGA 3NMIA 2P6VA 2V26A 3L1MA 1PD0A 3LEVA 4MTOA 3TJ6A 3C8GA 1J8MF 1WATA 1HY5A 3IPMO 1VB5A 1PV3A 4OIPF 4Q5SF 3CZ6A 1MQVA 2CNWA 2WZLA 2YQYA 3ZWIA 2BC5A 4A2NB 3AGUA 2BE5F 1YARO 1ZHTA 2EPNA 3NDBB 1OW8A 1PCXA 2HJMA 4H4KC 3KYIA 2M64A 4MVZA 4O6YA 4E7ZA 3A9CA 2J7PA 4YJWA 2YLGA 2EPOA 3AQCA 3V5YA 3ECSA 4YWQA 3WODF 3FHDA 2GFHA 3U0CA 1J8YF 2MHRA 3LLKA 3V7OA 1H9GA 1R5ID 2QNLA 4PR9A 4W8PA 3DJUB 4JIOA 1FR0A 4N4WA 2XLEA 3C8GB 2HS5A 3EQLF 1T5OA 2R9RB 1M2OA 1N1CA 2D5RB 3FOPA 2G3KA 2XM4A 3I5PA 1LM3B 2YL3A 4IWBA 4K1OA 4K7BA 1H7IA 2XXAB 2R7TA 2ZXRA 4DVZA 1TQGA 3U9JA 2JPUA 3S27A 4FWVA 1WOLA 1ORJA 1ORSC 2YWAA 4JE9A 2HV7A 4LERA 3PMRA 1LE4A 3RVYA 2B0JA 3B29A 5COGA 3B71A 4LLCA 1YAUO 4MTGA 4Z9HA 5BQHA 2OJED 2BL2A 4BJ5A 1E2XA 1K05A 2QTVA 1ST6A 4J30B 2YHSA 3MBGA 1DOWA 1U89A 2EIMC 2MYSA 4G7ZF 3Q7LA 5FZTA 5KYYB 1OW6A 2YLDA 5JRAA 3JCUQ 4ANJA 3RW0A 3UGOA 3TOLA 2VB6A 4XQ1A 4K0DA 4CIPA 1QPUA 2OG2A 3PDMP 2DYRC 5IY5C 1Q0GA 1SMYF 1JPJA 4BJ1A 2NPUA 3H2UA 2XSEA 3F46A 4BJ5C 1EKYA 4AL0A 3M1CB 2L6FA 4JEAA 4W8KA 2WVNA 4DRIB 3EH2A 2ASRA 2PF4E 2CNWD 2WVOA 3ZSUA 5DQTA 2OQMA 5BUOA 1L3PA 4JVSA 1NBBA 3ZVRA 1ZHWA 4QI2A 2FFHA 4MVUA 1A0BA 5KYWA 1C17M 1MMDA 4MNDA 5AGFA 1ZW2A 1F1MA 2LD6A 3U2MA 3S0XA 4KC9A 4DXWA 3FDQA 5KYXA 3EFOA 1JMWA 3TJ5A 3QTHA 2AWYA 2DGJA 1OR2A 3M15A 1ZVZA 1XWJA 1BR2A 3NRHA 2Q9AA 3K1HA 4X0RA 2J9VA 3HLZA 4XLPF 5L0HA 2I8BA 3WAQA 4OIOF 4RBNA 4XEFA 1GS9A 3LAYA 3DKAA 4J32B 5JP7A 2TMVP 4CSAA 3HNLA 3RQEA 4C7OB 4EBBA 3G4XA 4C7OA 2KYHA 3QW1A 4YN0B 1T01A 3DZAA 3RQGA 1WASA 4U5HA 3R7CA 4C3DA 3ZG1A 2OCCC 2KQ9A 1Z3IX 4CDYA 2WVQA 4MS2A 4OIRF 2W9YA 3AGTA 4JURI 5FCLA 1E83A 3W2WA 2QUPA 3B0PA 1S7ZA 1TKNA 1HMDA 2J0WA 4KBLA 3CEXA 2IM8A 1WWPA 2XL8A 1HW1A 1VOMA 2HSBA 3H2VA 5TJ5E 4HFFB 3RIPA 1RJ9B 3SP1A 4JRZA 5BQGA 2EPLX 1V4AA 2Q9CA 2B0HA 4YL1A 4BJ6C 4Q4ZF 1YA7O 1A7DA 1R4TA 2J8WA 3FAJA 2RSEB 3W4YA 3WG7C 3IQ5A 2YEVA 2V3CC 4E0HA 2XXAA 4MTFA 2ZXOA 4LDQA 4J7YA 1LI7A 3KKBA 4F4BA 1BZ4A 3MX3A 2LFDA 4EUKB 2R03A
chains in the Genus database with same CATH topology
1RXQA 2F22A 3GORA 5COGA 5CIVA 2QE9A 5COMA 3CEXA 2RD9A 2HKVA 3DI5A 3QTHA 2NSGA 2QNLA 2OU6A 4N6CA 3DKAA 2NSFA 2P1AA 5COFA 2YQYA 2OQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RXQ A;  2F22 A;  3GOR A;  5COG A;  5CIV A;  2QE9 A;  5COM A;  3CEX A;  2RD9 A;  2HKV A;  3DI5 A;  3QTH A;  2NSG A;  2QNL A;  2OU6 A;  4N6C A;  3DKA A;  2NSF A;  2P1A A;  5COF A;  2YQY A;  2OQM A; 
#chains in the Genus database with same CATH topology
 3B0V C;  3EPV A;  2O9X A;  3JSE O;  1WN0 A;  1MNE A;  4I1M A;  2J46 A;  5B1B C;  3ZTM A;  2EIL C;  4CS9 A;  2R02 A;  2C04 A;  3TD7 A;  2IYL D;  3GM1 A;  2H7B A;  3U2L A;  5JUA A;  4P9F A;  2YLI A;  3HNK A;  3I5Q A;  4U5F E;  5D92 A;  3UMH A;  4O79 A;  5COM A;  1OKK D;  256B A;  1A7V A;  1G4W R;  5T1D B;  2RD9 A;  2GA0 A;  2NUT A;  1V74 B;  3U8P A;  4DOZ A;  4IRU A;  4LDK A;  4XLN F;  2NUT B;  3LUT B;  5L0C A;  2P0N A;  4C3E A;  1QLE C;  4E18 A;  4EBJ A;  3RF3 A;  2HMQ A;  1BDJ B;  1OR3 A;  1B68 A;  1D1C A;  2J7P D;  3AG1 C;  3K66 A;  2PX0 A;  4Q7C A;  4L6R A;  2XS1 A;  2JD3 A;  2HZ8 A;  3ABM C;  2A6H F;  1OCZ C;  3EZI A;  4FX5 A;  4MW8 A;  3JRT A;  1RXQ A;  1O87 A;  3ATP A;  4EBK A;  4P6I C;  4JEB A;  5B1A C;  4MVO A;  4EKW A;  4BPM A;  2X0C A;  3FXH A;  1M2V B;  3UMI A;  4CS8 A;  4XWJ A;  2HSQ A;  2WB7 A;  3ZIB A;  3S29 A;  2PP4 A;  2ZXW C;  5CI9 A;  3A11 A;  1JR8 A;  2VAS A;  4U5D E;  3GEH A;  3V5Z A;  1YDI A;  3KYJ A;  5DS6 A;  2W45 A;  3NMK A;  4OD4 A;  1TFO B;  1T6U A;  4KNV A;  1LI5 A;  1YYJ A;  3DM5 A;  1E85 A;  3O6X A;  4HE8 D;  1ORY A;  3LNR A;  1E86 A;  1LVK A;  1Q0D A;  1U6H A;  1RJ9 A;  2VCA A;  3CAX A;  1ZU5 A;  4RDA A;  4OIQ F;  3HJC A;  2HFI A;  1HMO A;  2ZD9 A;  4EIY A;  3PCV A;  4JZA A;  3AG4 C;  3H65 A;  3NYL A;  1OW7 A;  2Y39 A;  1CGM E;  4G0H A;  3EHN A;  2A0U A;  3HTK C;  3W8I A;  3Q6N A;  1W2W A;  5T3T A;  5L3Q A;  2IXP A;  3K7D A;  2LK4 A;  5A6A A;  5F28 E;  3UR3 C;  4CSA C;  3G50 A;  1JRA A;  1T6Q A;  4MVM A;  5CI8 A;  5T3W A;  3N2Z B;  3QW0 A;  3M4C A;  2YZS A;  1MND A;  2CCY A;  3ASO C;  3DD7 A;  3CQZ A;  5EHH A;  3W2V A;  1VYI A;  2C03 A;  4PK4 A;  2R7V A;  4IAR A;  3LLI A;  4N6C A;  1G5Z A;  3GOD A;  3B0U X;  3L8J A;  4KNW A;  2L81 A;  3ABK C;  4C3B A;  2XLV A;  2R7O A;  1GQA A;  2XM0 A;  1H6G A;  4YL3 A;  5KYY A;  1ZU4 A;  3FMS A;  5KYU B;  4B6I A;  1A41 A;  3NYJ A;  2YRF A;  1HE1 A;  1A7E A;  4GQH A;  4JTA B;  3X1O A;  3N24 A;  4PJM A;  4XEK A;  4BEM J;  4A4A A;  1U0B B;  1NLX A;  3N0T A;  3HKK A;  3LJB A;  3MYF A;  3GOR A;  4XTK A;  4O6N A;  3S28 A;  1BR4 A;  4Z9J A;  1I4Y A;  1JAF A;  4U5B E;  3SNH A;  5EK0 A;  3JYY A;  4PFP A;  1GM5 A;  2J9U A;  1EQ1 A;  4BEJ A;  1EI7 A;  1NZE A;  4G7H F;  3EH1 A;  1QQ3 A;  2LQG A;  2AP3 A;  3RYL A;  1H9T A;  5F5F A;  1QZX A;  2ETS A;  3K1I C;  4IJJ A;  4PAC A;  4YL0 A;  1UFB A;  3US6 A;  4UDV A;  2ZXP A;  3C7J A;  3E9V A;  4ZLC A;  5L0D A;  1RKE B;  2D4U A;  1G4U S;  2QY9 A;  4LAC B;  3VF0 A;  2LCH A;  4CS9 C;  5DLJ A;  1YLM A;  5HSW A;  3MFN A;  1NSG B;  3QZC A;  4NC3 A;  4CS8 C;  2Q7R A;  2CGE A;  2CW0 F;  4CJO A;  2WZG A;  2YL7 A;  1C02 A;  4D4N A;  1AUE A;  2Y3D A;  3Q7G A;  3VYW A;  4H54 A;  4QI0 A;  1I4Z A;  1LKX A;  3QVY A;  2A68 F;  3U3B A;  2NG1 A;  5E33 A;  1FNT c;  2OEX A;  4NCQ A;  2FGY A;  1YYX A;  3DAG A;  3KH2 A;  3NKD A;  1OCO C;  4U5C E;  3C8G D;  2Q4F A;  3JTL O;  1SZI A;  3EZH A;  3KMI A;  2A0B A;  4AE4 A;  2IXO A;  3QVZ A;  4BG0 A;  2GAQ A;  3L34 A;  1TWC A;  5KYN A;  4ZLD A;  4Z9I A;  1HE9 A;  4NY3 A;  4CDA A;  2XRH A;  4EWC A;  1Q0F A;  4U5E E;  4ER9 A;  2EPK X;  1MMG A;  5HV9 A;  1VYK A;  3B9Q A;  2GWW A;  3BEH A;  2LP4 A;  3FVY A;  1HW2 A;  2XL6 A;  2H7V C;  4AK9 A;  3IHU A;  4JTC B;  3C63 A;  4I44 A;  4FES A;  2R7X A;  3ZTZ A;  2L6H A;  2IBF A;  1JPN A;  3MYI A;  1Z63 A;  5COF A;  3DWW A;  2OKU A;  4XPW A;  4JJG A;  1OCC C;  2A69 F;  3SXY A;  1ZHX A;  1RCP A;  2GDC A;  1VLS A;  1OXB A;  1T9K A;  3W8H A;  2Q9B A;  3OEO A;  3RVZ A;  1TWG A;  1AVO B;  3UNG C;  1Z23 A;  1QKR A;  3GAN A;  2XLH A;  4MVQ A;  1LS1 A;  2UUI A;  5A6B A;  4O6M A;  1YZC A;  4I1O B;  3S9O A;  3ZQV A;  2W4M A;  4JJF A;  2LFF A;  2NSG A;  2OU6 A;  3EG9 B;  3VAY A;  4BJ6 A;  1Q0M A;  2Q3T A;  3O10 A;  2IXM A;  3T4R A;  2HV6 A;  5DS4 A;  4YK5 A;  1WGW A;  2WZF A;  1BR1 A;  4P9T A;  2HUJ A;  1D1B A;  3WHN A;  1Z6A A;  2J9B A;  3LEO A;  4AX2 A;  1TR2 A;  3O39 A;  3DXJ F;  1WTY A;  3RH3 A;  2X51 A;  2KW3 C;  4N6H A;  4QDL A;  1RMV A;  3EFO B;  4G78 A;  1RKE A;  3AOU A;  2E87 A;  4CX9 A;  4U9D A;  2Y3B A;  2XLM A;  4ULW A;  2OJQ A;  4GEH A;  3SXK A;  1IW7 F;  2XS8 A;  3GM2 A;  1S05 A;  1D1A A;  1CPQ A;  2EPM X;  4E0I A;  4WGY A;  2QE9 A;  1Y4C A;  2DB4 A;  3C18 A;  2QLA A;  4NTA A;  1UG7 A;  3O55 A;  5A69 A;  4U5G A;  5JSL A;  3EGD A;  1OKK A;  2KNH A;  2EIK C;  5DQZ A;  3EGD B;  1VLT A;  3CSK A;  1CGO A;  1XZP A;  2P7V A;  3T6J A;  1OCR C;  2Y69 C;  1BBH A;  3POV A;  5AC4 A;  3LS0 A;  3F47 A;  3AJM A;  1ZHY A;  2HMZ A;  1YZA A;  5KYU A;  3AG2 C;  1YVI A;  2MWQ A;  4NQF A;  3M79 A;  4PJN A;  3DJN B;  2IOQ A;  2A6E F;  3UMK A;  1OXK A;  1V55 C;  1XZQ A;  2IXN A;  1CPR A;  3VRC A;  4CBE A;  4DBQ A;  2A1D D;  2CDQ A;  3NG1 A;  4BJT A;  1LPE A;  3Q6M A;  3T9O A;  3NYM A;  2F22 A;  3JSZ A;  1M2V A;  3JYH A;  5KYW B;  2P61 A;  3T6G B;  3GEE A;  4JCZ A;  5KYX B;  3FAP B;  1K04 A;  1KU2 A;  2Z15 A;  4DJ9 A;  1QSP A;  1G8X A;  2PX3 A;  3DI5 A;  2OEV A;  3DM9 B;  3JZ0 A;  3AG3 C;  4NTB A;  1PD1 A;  4G7O F;  4YT5 A;  5BQI A;  4XPY A;  2EIN C;  3NMJ A;  2Y3H A;  3V5X A;  5JS5 A;  3I4U A;  4IAQ A;  3IEE A;  2H7O A;  2VC9 A;  4JKV A;  4FAP B;  2G3V A;  4LLE A;  1RKC A;  1FAP B;  2LIG A;  3BRJ A;  1V54 C;  1CGN A;  1LE2 A;  2M4E A;  2KGO A;  1Y6D A;  3GEI A;  3K1I A;  4IB4 A;  1NG1 A;  2OOC A;  2YVK A;  4U9E A;  3EHM A;  4N06 A;  4CIH A;  1Z7Q c;  2KSF A;  2R7Q A;  4DVY P;  2R7W A;  4WGZ A;  2XL4 A;  2XLO A;  5CIV A;  1Q0K A;  2L9J A;  1SF8 A;  2VCC A;  3ZQY A;  2L7A A;  1DOV A;  3FOO A;  3L0I A;  4MVR A;  5E3C A;  3SEO A;  1VTM P;  3GWN A;  3K33 A;  3GM3 A;  1FTS A;  1FMV A;  3J06 A;  2VH3 A;  1I5N A;  4MVS A;  5E3A A;  5GPG B;  1K40 A;  3RQF A;  3DAF A;  3T6B A;  1APC A;  1YA9 A;  2FAP B;  3TUL A;  4XEV A;  1Z5Z A;  4JC7 A;  3SZR A;  2XLD A;  4CS7 A;  3GWL A;  4KI2 A;  1EA8 A;  2NSF A;  2R7U A;  1SYQ A;  3X2Q C;  3HNI A;  1NU9 C;  3OA1 A;  4ULV A;  4HFK B;  2G62 A;  2J45 A;  2KK1 A;  4NTF A;  5AC5 A;  4YT2 A;  2KC3 A;  2R25 A;  3NKE A;  2CYD A;  1SR2 A;  5L0G A;  1NFN A;  3ITF A;  4DRH B;  2JX0 A;  2ZPA A;  4GYT A;  4D4X A;  2NUP B;  3JT1 A;  3U3F A;  3PHF 2;  1KNY A;  1TWA A;  2YL0 A;  4HEA J;  4CDV A;  3DE8 A;  5L0I A;  2HJ3 A;  3LS1 A;  5B3I A;  2J9W A;  5A6J A;  5JLI A;  3E70 C;  1D0Y A;  5DVW A;  1O3U A;  5JT4 A;  4OIN F;  1MMA A;  3SXZ A;  3TOM A;  4LDR A;  4CJG A;  1KTM A;  4YT8 A;  1FFT C;  1TFK B;  3C8Z A;  3EGX B;  3SXM A;  3U5S A;  2W4B A;  1VK5 A;  3OWT A;  5L0J A;  3HNJ A;  4WAB A;  2ICW G;  2YL1 A;  5K0I A;  1OQC A;  2P1A A;  2PBE A;  1FFH A;  3C62 A;  4RD9 A;  1ZZP A;  2VCB A;  2PNO A;  3LNM B;  4XPX A;  1M6T A;  4WJ0 A;  3U9M A;  1IZM A;  5L0F A;  4YT4 A;  3EG9 A;  3KL4 A;  3QMK A;  1T6I A;  3R2P A;  4J7T A;  3ASN C;  4JCH A;  3DE9 A;  2AVK A;  1QVX A;  2R05 A;  5A6B D;  2AWC A;  2DI3 A;  1JOG A;  1D0X A;  2L6G A;  1FMW A;  1TWH A;  1M56 C;  2J0X A;  3ABL C;  3ZDL A;  4ONS A;  4E17 A;  4IGG A;  2PFD A;  1ZHZ A;  2Q00 A;  3M4B A;  4IAO A;  5L3V A;  2AU5 A;  3TQO A;  1VMA A;  2H8A A;  4MQ9 F;  5F5H A;  3IQC A;  3S90 A;  3TK0 A;  3DMD A;  1ZYR F;  2NUP A;  3G4Z A;  3RKO F;  2DYS C;  2LSE A;  3EJN A;  4JTD B;  4DRJ B;  3L8I A;  4M63 A;  1LS4 A;  2R7S A;  2UUH A;  4MW3 A;  1NFO A;  1AEP A;  3UGP A;  1ZW3 A;  3AQB A;  3LES A;  1LIH A;  3KPH A;  4JW1 A;  2YKZ A;  5D91 A;  2XLW A;  3IQ6 A;  4PJL A;  3ZC4 A;  4E7S A;  3U8V A;  1M57 C;  5EGY A;  2KJG A;  1L7C A;  4OD5 A;  3RFY A;  1E84 A;  1D0Z A;  3JRM O;  1MMN A;  1O5H A;  3EGX A;  4O7G A;  2WL8 A;  5E2Q A;  4PJJ A;  5DS5 A;  4I3M A;  4AL1 A;  3VM6 A;  4AE4 B;  4DBR A;  5B3S C;  3S84 A;  2HKV A;  1YJG A;  5JVE A;  3K6B A;  1C03 A;  1NU7 D;  2EIJ C;  3SYN A;  5A6K A;  2Y3G A;  2I15 A;  3IQT A;  4PFO A;  4R32 A;  1GGQ A;  4EHP A;  2R7R A;  3MLG A;  3NMI A;  2P6V A;  2V26 A;  3L1M A;  1PD0 A;  3LEV A;  4MTO A;  3TJ6 A;  3C8G A;  1J8M F;  1WAT A;  1HY5 A;  3IPM O;  1VB5 A;  1PV3 A;  4OIP F;  4Q5S F;  3CZ6 A;  1MQV A;  2CNW A;  2WZL A;  2YQY A;  3ZWI A;  2BC5 A;  4A2N B;  3AGU A;  2BE5 F;  1YAR O;  1ZHT A;  2EPN A;  3NDB B;  1OW8 A;  1PCX A;  2HJM A;  4H4K C;  3KYI A;  2M64 A;  4MVZ A;  4O6Y A;  4E7Z A;  3A9C A;  2J7P A;  4YJW A;  2YLG A;  2EPO A;  3AQC A;  3V5Y A;  3ECS A;  4YWQ A;  3WOD F;  3FHD A;  2GFH A;  3U0C A;  1J8Y F;  2MHR A;  3LLK A;  3V7O A;  1H9G A;  1R5I D;  2QNL A;  4PR9 A;  4W8P A;  3DJU B;  4JIO A;  1FR0 A;  4N4W A;  2XLE A;  3C8G B;  2HS5 A;  3EQL F;  1T5O A;  2R9R B;  1M2O A;  1N1C A;  2D5R B;  3FOP A;  2G3K A;  2XM4 A;  3I5P A;  1LM3 B;  2YL3 A;  4IWB A;  4K1O A;  4K7B A;  1H7I A;  2XXA B;  2R7T A;  2ZXR A;  4DVZ A;  1TQG A;  3U9J A;  2JPU A;  3S27 A;  4FWV A;  1WOL A;  1ORJ A;  1ORS C;  2YWA A;  4JE9 A;  2HV7 A;  4LER A;  3PMR A;  1LE4 A;  3RVY A;  2B0J A;  3B29 A;  5COG A;  3B71 A;  4LLC A;  1YAU O;  4MTG A;  4Z9H A;  5BQH A;  2OJE D;  2BL2 A;  4BJ5 A;  1E2X A;  1K05 A;  2QTV A;  1ST6 A;  4J30 B;  2YHS A;  3MBG A;  1DOW A;  1U89 A;  2EIM C;  2MYS A;  4G7Z F;  3Q7L A;  5FZT A;  5KYY B;  1OW6 A;  2YLD A;  5JRA A;  3JCU Q;  4ANJ A;  3RW0 A;  3UGO A;  3TOL A;  2VB6 A;  4XQ1 A;  4K0D A;  4CIP A;  1QPU A;  2OG2 A;  3PDM P;  2DYR C;  5IY5 C;  1Q0G A;  1SMY F;  1JPJ A;  4BJ1 A;  2NPU A;  3H2U A;  2XSE A;  3F46 A;  4BJ5 C;  1EKY A;  4AL0 A;  3M1C B;  2L6F A;  4JEA A;  4W8K A;  2WVN A;  4DRI B;  3EH2 A;  2ASR A;  2PF4 E;  2CNW D;  2WVO A;  3ZSU A;  5DQT A;  2OQM A;  5BUO A;  1L3P A;  4JVS A;  1NBB A;  3ZVR A;  1ZHW A;  4QI2 A;  2FFH A;  4MVU A;  1A0B A;  5KYW A;  1C17 M;  1MMD A;  4MND A;  5AGF A;  1ZW2 A;  1F1M A;  2LD6 A;  3U2M A;  3S0X A;  4KC9 A;  4DXW A;  3FDQ A;  5KYX A;  3EFO A;  1JMW A;  3TJ5 A;  3QTH A;  2AWY A;  2DGJ A;  1OR2 A;  3M15 A;  1ZVZ A;  1XWJ A;  1BR2 A;  3NRH A;  2Q9A A;  3K1H A;  4X0R A;  2J9V A;  3HLZ A;  4XLP F;  5L0H A;  2I8B A;  3WAQ A;  4OIO F;  4RBN A;  4XEF A;  1GS9 A;  3LAY A;  3DKA A;  4J32 B;  5JP7 A;  2TMV P;  4CSA A;  3HNL A;  3RQE A;  4C7O B;  4EBB A;  3G4X A;  4C7O A;  2KYH A;  3QW1 A;  4YN0 B;  1T01 A;  3DZA A;  3RQG A;  1WAS A;  4U5H A;  3R7C A;  4C3D A;  3ZG1 A;  2OCC C;  2KQ9 A;  1Z3I X;  4CDY A;  2WVQ A;  4MS2 A;  4OIR F;  2W9Y A;  3AGT A;  4JUR I;  5FCL A;  1E83 A;  3W2W A;  2QUP A;  3B0P A;  1S7Z A;  1TKN A;  1HMD A;  2J0W A;  4KBL A;  3CEX A;  2IM8 A;  1WWP A;  2XL8 A;  1HW1 A;  1VOM A;  2HSB A;  3H2V A;  5TJ5 E;  4HFF B;  3RIP A;  1RJ9 B;  3SP1 A;  4JRZ A;  5BQG A;  2EPL X;  1V4A A;  2Q9C A;  2B0H A;  4YL1 A;  4BJ6 C;  4Q4Z F;  1YA7 O;  1A7D A;  1R4T A;  2J8W A;  3FAJ A;  2RSE B;  3W4Y A;  3WG7 C;  3IQ5 A;  2YEV A;  2V3C C;  4E0H A;  2XXA A;  4MTF A;  2ZXO A;  4LDQ A;  4J7Y A;  1LI7 A;  3KKB A;  4F4B A;  1BZ4 A;  3MX3 A;  2LFD A;  4EUK B;  2R03 A; 
#chains in the Genus database with same CATH homology
 1RXQ A;  2F22 A;  3GOR A;  5COG A;  5CIV A;  2QE9 A;  5COM A;  3CEX A;  2RD9 A;  2HKV A;  3DI5 A;  3QTH A;  2NSG A;  2QNL A;  2OU6 A;  4N6C A;  3DKA A;  2NSF A;  2P1A A;  5COF A;  2YQY A;  2OQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...