3QTHA

Crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
172
structure length
172
Chain Sequence
GMLSRIDLYIKHRDIFLKHLELLHKLIEKVEDSSLNESELLNARLVDDMFPFNVQAKIATNFALRACCPLSGKEYKELEGDIDSFCGLKTYVVTAIDYINKLSEPTLEQLNLNVQDTAGFKEISMPASEYMSSFVLPNFFFHISMVYAIAKNNGVSVTKGDFDGIHQYPKGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a Hypothetical DinB-like protein (CPS_3021) from Colwellia psychrerythraea 34H at 2.20 A resolution
rcsb
source organism Colwellia psychrerythraea
molecule tags Unknown function
total genus 53
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09351 DUF1993 Domain of unknown function (DUF1993)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 3qthA00
5COMA 3CEXA 5COGA 2RD9A 2OU6A 2P1AA 3QTHA 2NSFA 2YQYA 2OQMA 3DI5A 2QE9A 2QNLA 2NSGA 2HKVA 3DKAA 2F22A 5CIVA 3GORA 1RXQA 4N6CA 5COFA
chains in the Genus database with same CATH superfamily
2H8AA 1FFTC 1FTSA 3EG9B 3LEOA 1JRAA 1JPNA 5L3QA 2R7QA 3RQFA 3HNJA 5COGA 3KMIA 2A68F 2EILC 2ETSA 4JJFA 1XZPA 3FVYA 3ZWIA 3K33A 3X1OA 3AG3C 3B0VC 4A2NB 5HSWA 2J9BA 2P61A 1WWPA 4XPWA 2HV6A 2C04A 4WGZA 2C03A 1TWHA 2G3VA 2XRHA 2CYDA 1NSGB 4EIYA 2BC5A 3FAJA 1QZXA 1VB5A 4IARA 3C63A 4N4WA 3W2VA 3C62A 4IAQA 1RMVA 1C17M 5CI9A 5EK0A 3G50A 3ZIBA 3EG9A 4O6MA 4EWCA 3DM5A 3S28A 5A6JA 4JEAA 5KYXA 1NLXA 2GWWA 3N0TA 3RW0A 5A6AA 4NTFA 2IBFA 2QUPA 1HY5A 2D5RB 2XLHA 1VMAA 5A6BA 1D1CA 1AUEA 1I4YA 1D0ZA 2R7OA 3L0IA 2HMZA 2LCHA 3SXKA 1LI5A 4K7BA 4IJJA 1OW7A 4XEKA 3SNHA 3SYNA 2Y3DA 1D0YA 2H7VC 3POVA 2R7TA 1H9GA 2CW0F 2Z15A 3TD7A 2XSEA 4MS2A 1E86A 5T1DB 1Z3IX 1T5OA 3QW1A 1GM5A 2DB4A 4EKWA 1TWGA 1K04A 5K0IA 1NBBA 2IOQA 1V55C 3QMKA 4HEAJ 3TQOA 3O39A 4U5DE 1I4ZA 4MVRA 1E83A 3U8VA 1RKEB 1ZU4A 3H2VA 2BL2A 4BJ6A 2OJQA 1Z7Qc 3S84A 4IGGA 5JRAA 4MVQA 2L7AA 2WL8A 1ZYRF 2QLAA 3CZ6A 2YLGA 1APCA 4R32A 2YVKA 3L8IA 5L0JA 4CS8C 2ZXRA 2OG2A 2Q00A 1C03A 3NDBB 1HMDA 1TFOB 4MVSA 1OR3A 4JURI 3EH1A 2XLOA 1ZHYA 2KJGA 2LFDA 2AU5A 3TJ5A 3WODF 3DJNB 2GAQA 3MX3A 3TK0A 3U5SA 4EBJA 2LD6A 5EGYA 1T01A 4E7SA 1SYQA 3ABLC 4KI2A 1NU7D 1Y6DA 4U5HA 1RJ9B 4BG0A 4CJGA 1RKEA 3I4UA 3LS1A 3K1HA 4C7OA 5T3TA 1LIHA 4DXWA 1K40A 4YT4A 4YT2A 4X0RA 2LP4A 4C3BA 3EGXB 4GYTA 1JAFA 3GODA 4JCZA 1H6GA 4KC9A 5HV9A 1HW2A 3ZQYA 3EGDA 3FOOA 2VASA 2YL7A 3F47A 4E0IA 2IM8A 4XPXA 3U0CA 2YLIA 4U9DA 3TJ6A 1KU2A 4L6RA 2WZGA 3RQEA 4J7YA 3U3FA 1ZHWA 2W4MA 1CPRA 1Z6AA 4UDVA 2R7VA 2PX3A 4AE4A 2J9WA 1MMDA 1PD0A 1T6IA 3A11A 4U5BE 3AGTA 4O6NA 4YL3A 4OINF 5JVEA 4JW1A 4QDLA 4E0HA 1G4US 2P1AA 3VM6A 4C3EA 5JLIA 2OOCA 3ITFA 2P0NA 2WVOA 3BRJA 4NCQA 4CSAC 2H7BA 2J7PD 4XWJA 1Q0KA 2XL4A 5AC4A 4GQHA 2ASRA 3HLZA 5A69A 3ZSUA 2LFFA 1IW7F 2V26A 2W4BA 4YT5A 2FGYA 3B0UX 1Q0GA 1GQAA 4G7OF 2MYSA 5CIVA 2OEXA 1V54C 4MQ9F 4O7GA 4JKVA 4LDQA 4E17A 1ZHTA 3K7DA 3NRHA 3UGPA 2LIGA 3S29A 2YRFA 3K6BA 3QW0A 4PFOA 2IXNA 3GM1A 3GEHA 1H7IA 1ZW3A 1OCOC 4CS9A 2OJED 1FAPB 1A7DA 2YKZA 4BPMA 4DRIB 3G4XA 3MYFA 3RKOF 1S05A 3X2QC 4P9FA 2XLVA 2Q9CA 4B6IA 4LERA 3FXHA 5F5FA 1AEPA 3JSZA 1SMYF 1GGQA 4Z9HA 3VAYA 3EHMA 2EPKX 4OD4A 2R7WA 4PJJA 3AJMA 3ZTMA 2R7UA 3DD7A 2W9YA 3C8GB 1FMVA 4J30B 1XZQA 5E3AA 2HJ3A 2UUIA 3VYWA 3NYLA 5FCLA 4QI2A 1EA8A 2KC3A 2LSEA 5DS5A 4I44A 1G5ZA 2NUPB 3IQ6A 3L8JA 5AC5A 4U5FE 2EPMX 1CGOA 2KGOA 3CQZA 4FAPB 1ORYA 4NTBA 2NG1A 2PF4E 1J8MF 2G62A 5JP7A 2Q7RA 2E87A 1GS9A 1WN0A 4DVZA 2RD9A 4HE8D 3V7OA 3LNMB 3V5YA 2J0XA 2IYLD 2XXAB 4XEVA 1CGME 1SZIA 4JJGA 3MLGA 1MNEA 1NG1A 1Y4CA 3QVYA 5BQHA 2R03A 4Z9IA 1K05A 3L1MA 4Z9JA 3ZG1A 4D4XA 2M64A 4XTKA 3N24A 4YK5A 3C8ZA 5DLJA 3RF3A 1YLMA 2HKVA 3TULA 3AOUA 4IRUA 1ZHZA 3W8IA 4EBBA 1OCCC 2JPUA 3U8PA 4Q5SF 5E3CA 3T6JA 3JT1A 4ANJA 2HMQA 1HE9A 2DI3A 1V4AA 3AG1C 1YA9A 4LLCA 4MVZA 4OIRF 4ZLCA 5KYYB 2MHRA 2KK1A 2YL3A 3RYLA 5B1BC 4OIOF 2XXAA 5CI8A 4NC3A 3EZIA 2XM4A 4DRJB 2Y39A 4JRZA 4IWBA 4BJ6C 3IQTA 4NY3A 2BE5F 2W45A 3Q6MA 5GPGB 4ULVA 4JTCB 4ZLDA 4MTOA 2L6GA 3R2PA 1OW8A 5L3VA 4XLPF 1A0BA 5F28E 3WAQA 1Z63A 1FNTc 3NKDA 1M57C 5EHHA 1U89A 1A7VA 3JCUQ 2AVKA 5B3SC 2EPLX 2NSGA 5KYYA 4FESA 4K0DA 4ONSA 4MW8A 3DKAA 1WOLA 1TWAA 3L34A 1LM3B 1OCZC 2EIJC 3SXZA 3DAFA 3W2WA 2R25A 3ATPA 2ZXOA 3ZTZA 4I1MA 2XLDA 1TQGA 2XL6A 3CAXA 1EKYA 2XS8A 1J8YF 4DBQA 1ST6A 2KW3C 4W8KA 4YT8A 4OIPF 4M63A 1M56C 4PJMA 3AG2C 2A0BA 3LLIA 2A6EF 3JRTA 4BJ1A 3LS0A 2OU6A 5FZTA 2J9VA 1YYXA 1OXBA 3GEEA 2KNHA 2Y3HA 2EINC 3T6GB 3GEIA 2HS5A 1QPUA 4RD9A 3DZAA 4YWQA 5BQGA 1CPQA 1CGNA 3NMIA 3PHF2 3OEOA 2J45A 3DMDA 3HJCA 3GM2A 1OXKA 2B0JA 3DE9A 3Q7GA 4CX9A 5L0DA 4O79A 2I8BA 4N6CA 256BA 3U3BA 3V5XA 1LE4A 5COFA 4A4AA 1ORJA 3KYIA 3W4YA 3C8GD 4EHPA 4C3DA 1JMWA 1DOVA 2ICWG 2Q9AA 1ZVZA 1PV3A 2PP4A 4CJOA 3ECSA 2OKUA 3U2LA 1RJ9A 1VYIA 4U5EE 5JUAA 3O6XA 3ZVRA 1VLTA 2J9UA 3SXYA 2G3KA 3GWNA 3MBGA 1M2OA 3RVYA 2JX0A 2P7VA 1EI7A 4P6IC 4PFPA 3UMIA 4AX2A 3EGXA 2D4UA 5L0FA 4JIOA 4XPYA 3DI5A 3SEOA 1N1CA 2YL1A 1BBHA 3ZDLA 4YL0A 1O3UA 4Q4ZF 5KYUB 1T6QA 1LKXA 1LS4A 3SXMA 2PFDA 3UGOA 1H9TA 5DVWA 2NUTB 4KNWA 3DJUB 4CS9C 4U5GA 2AWCA 4DBRA 1YDIA 1MMNA 1YARO 1F1MA 2PNOA 2X51A 3EFOB 3FMSA 1V74B 1YAUO 1M6TA 3B29A 1DOWA 3HTKC 4PK4A 3T6BA 1QQ3A 2JD3A 3AQCA 2WVNA 5IY5C 4DOZA 2VCAA 3EJNA 3NMJA 1BR1A 3M1CB 2UUHA 4WGYA 3ZC4A 4BJ5A 3IHUA 3UNGC 1NZEA 3GWLA 4PJNA 2RSEB 1LE2A 4JVSA 2CCYA 4BEMJ 2L9JA 3M15A 5A6BD 3K1IA 2EPNA 1M2VB 1YZCA 2VCCA 2OEVA 3Q6NA 2HSBA 2KSFA 4LDRA 5KYUA 3PMRA 3FHDA 1YA7O 1MNDA 3JSEO 2H7OA 1ZHXA 3AG4C 4K1OA 3M79A 3NKEA 2CGEA 3EFOA 1NFNA 3DM9B 1VLSA 4RDAA 3US6A 1WGWA 2XLEA 4I3MA 3IQCA 2AP3A 4HFFB 1T6UA 3WHNA 2ZXPA 4YJWA 1QLEC 1OCRC 1ZU5A 2CNWD 3GANA 3NG1A 1IZMA 3CEXA 5COMA 3T4RA 2PBEA 2IXMA 3VF0A 3S90A 3LESA 2XL8A 4EBKA 3G4ZA 2VC9A 3EH2A 2YL0A 3VRCA 2TMVP 2GDCA 3S0XA 2YHSA 1QKRA 1AVOB 3AGUA 3Q7LA 4JTAB 4LLEA 3O10A 4MW3A 4G0HA 3H2UA 1Z23A 2FFHA 2NSFA 3RIPA 4G7HF 2HFIA 2O9XA 3KL4A 1UFBA 2XM0A 2Y69C 3C8GA 3DXJF 3U9MA 1VK5A 4LACB 3LNRA 1L3PA 5AGFA 1HE1A 4FWVA 3C18A 4JE9A 3NYJA 4D4NA 2Q3TA 4NQFA 1E2XA 2NUPA 2L6FA 1YJGA 4H54A 2AWYA 1S7ZA 3RH3A 2R7XA 2QY9A 4OIQF 1Z5ZA 2R7SA 2OCCC 3M4CA 5A6KA 5KYXB 4KNVA 1ZZPA 1D1AA 2J8WA 2J7PA 1YYJA 2FAPB 3FDQA 3EQLF 1Q0DA 2QTVA 1MQVA 2ZPAA 4ER9A 3JZ0A 2LQGA 3HNLA 3S9OA 3B71A 4I1OB 3TOLA 1LI7A 3QTHA 2KQ9A 3E9VA 3O55A 5E2QA 4BEJA 3WG7C 4CS8A 2YWAA 4JCHA 3JRMO 1JOGA 4H4KC 2YLDA 2KYHA 1VTMP 5B3IA 1KTMA 1W2WA 1JPJA 2MWQA 1KNYA 3JYHA 2I15A 1YZAA 2VCBA 3V5ZA 3MYIA 4F4BA 4N6HA 3GM3A 3GORA 4Q7CA 1OQCA 1FMWA 2DYRC 4LDKA 2R02A 3IPMO 2NPUA 3LEVA 3R7CA 2EIKC 1VYKA 3AQBA 3MFNA 4WJ0A 3EZHA 1TFKB 3HKKA 4E7ZA 4NTAA 3QZCA 2HZ8A 1NFOA 1LPEA 4N06A 3UMHA 2YEVA 3LAYA 4FX5A 3SP1A 1HMOA 2Q4FA 1JR8A 3B0PA 3DE8A 4RBNA 3OA1A 1YVIA 5T3WA 1D1BA 1OKKD 3U9JA 3PCVA 1WASA 4HFKB 4BJTA 4EUKB 1FFHA 2OQMA 4P9TA 5JS5A 5L0CA 4CDAA 3LLKA 1PD1A 2QNLA 1U6HA 2CNWA 4ULWA 5KYNA 2HV7A 2XLWA 3NYMA 4MVMA 3ASOC 4C7OB 2EPOA 3K66A 1E85A 2F22A 2HSQA 4PACA 2L81A 5KYWB 2YZSA 4J32B 3JTLO 3CSKA 2EIMC 3EGDB 1TKNA 3N2ZB 2R9RB 2Y3GA 1HW1A 2ZXWC 3EHNA 4DJ9A 1WTYA 4U5CE 5F5HA 3I5QA 4CIPA 2VH3A 2DGJA 3RQGA 2IXOA 3UMKA 1O5HA 5D92A 3RFYA 2GA0A 4MVOA 2L6HA 4AE4B 2PX0A 5DS6A 2M4EA 2YQYA 1FR0A 3A9CA 3KH2A 4OD5A 1XWJA 1R4TA 1MMAA 3ASNC 4IB4A 3RVZA 3B9QA 2QE9A 1MMGA 4CDVA 1QSPA 4IAOA 4W8PA 5KYWA 1Q0FA 1I5NA 3LJBA 1ORSC 5L0HA 4GEHA 1LVKA 2J0WA 4WABA 4XEFA 1G8XA 4BJ5C 4AL0A 1L7CA 1BR4A 5DQZA 3J06A 1WATA 2LK4A 4CIHA 3H65A 2XS1A 3PDMP 3JYYA 3KPHA 3K1IC 4J7TA 4JEBA 5DS4A 2WZFA 5JT4A 3I5PA 1OR2A 4DRHB 2XLMA 4MNDA 1NU9C 5DQTA 3EPVA 2CDQA 3QVZA 1O87A 1U0BB 2A6HF 3F46A 2A69F 2B0HA 4U9EA 2DYSC 5D91A 5L0GA 3UR3C 4QI0A 1QVXA 3KYJA 1BDJB 3W8HA 5JSLA 2WZLA 1VOMA 2A1DD 4E18A 1BR2A 2NUTA 4AK9A 2VB6A 2J46A 1LS1A 3C7JA 4JZAA 4YL1A 3E70C 1SR2A 3HNIA 1R5ID 4PR9A 1OW6A 4CS7A 3ABMC 3TOMA 4DVYP 3IQ5A 1SF8A 4YN0B 3U2MA 2GFHA 3KKBA 2WVQA 2IXPA 4G78A 5BQIA 1RXQA 3BEHA 4JTDB 4CBEA 1PCXA 4CSAA 3OWTA 1OKKA 2A0UA 4CDYA 3SZRA 3S27A 1T9KA 1G4WR 5BUOA 1RCPA 1E84A 1UG7A 1TR2A 2R05A 2ZD9A 4MTFA 4G7ZF 1M2VA 1BZ4A 2X0CA 1TWCA 2Y3BA 3T9OA 2HJMA 3ABKC 3DWWA 5B1AC 3LUTB 1A7EA 3NMKA 5L0IA 2R7RA 2WB7A 1ZW2A 1C02A 3DAGA 4XLNF 3FOPA 4MTGA 1D0XA 4XQ1A 2Q9BA 3HNKA 3IEEA 4KBLA 3ZQVA 4MVUA 1A41A 2V3CC 1EQ1A 4AL1A 3M4BA 4JC7A 4PJLA 2HUJA 5E33A 3FAPB 2P6VA 1Q0MA 1B68A 1RKCA 4O6YA 5TJ5E
chains in the Genus database with same CATH topology
5COMA 3CEXA 5COGA 2RD9A 2OU6A 2P1AA 3QTHA 2NSFA 2YQYA 2OQMA 3DI5A 2QE9A 2QNLA 2NSGA 2HKVA 3DKAA 2F22A 5CIVA 3GORA 1RXQA 4N6CA 5COFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5COM A;  3CEX A;  5COG A;  2RD9 A;  2OU6 A;  2P1A A;  3QTH A;  2NSF A;  2YQY A;  2OQM A;  3DI5 A;  2QE9 A;  2QNL A;  2NSG A;  2HKV A;  3DKA A;  2F22 A;  5CIV A;  3GOR A;  1RXQ A;  4N6C A;  5COF A; 
#chains in the Genus database with same CATH topology
 2H8A A;  1FFT C;  1FTS A;  3EG9 B;  3LEO A;  1JRA A;  1JPN A;  5L3Q A;  2R7Q A;  3RQF A;  3HNJ A;  5COG A;  3KMI A;  2A68 F;  2EIL C;  2ETS A;  4JJF A;  1XZP A;  3FVY A;  3ZWI A;  3K33 A;  3X1O A;  3AG3 C;  3B0V C;  4A2N B;  5HSW A;  2J9B A;  2P61 A;  1WWP A;  4XPW A;  2HV6 A;  2C04 A;  4WGZ A;  2C03 A;  1TWH A;  2G3V A;  2XRH A;  2CYD A;  1NSG B;  4EIY A;  2BC5 A;  3FAJ A;  1QZX A;  1VB5 A;  4IAR A;  3C63 A;  4N4W A;  3W2V A;  3C62 A;  4IAQ A;  1RMV A;  1C17 M;  5CI9 A;  5EK0 A;  3G50 A;  3ZIB A;  3EG9 A;  4O6M A;  4EWC A;  3DM5 A;  3S28 A;  5A6J A;  4JEA A;  5KYX A;  1NLX A;  2GWW A;  3N0T A;  3RW0 A;  5A6A A;  4NTF A;  2IBF A;  2QUP A;  1HY5 A;  2D5R B;  2XLH A;  1VMA A;  5A6B A;  1D1C A;  1AUE A;  1I4Y A;  1D0Z A;  2R7O A;  3L0I A;  2HMZ A;  2LCH A;  3SXK A;  1LI5 A;  4K7B A;  4IJJ A;  1OW7 A;  4XEK A;  3SNH A;  3SYN A;  2Y3D A;  1D0Y A;  2H7V C;  3POV A;  2R7T A;  1H9G A;  2CW0 F;  2Z15 A;  3TD7 A;  2XSE A;  4MS2 A;  1E86 A;  5T1D B;  1Z3I X;  1T5O A;  3QW1 A;  1GM5 A;  2DB4 A;  4EKW A;  1TWG A;  1K04 A;  5K0I A;  1NBB A;  2IOQ A;  1V55 C;  3QMK A;  4HEA J;  3TQO A;  3O39 A;  4U5D E;  1I4Z A;  4MVR A;  1E83 A;  3U8V A;  1RKE B;  1ZU4 A;  3H2V A;  2BL2 A;  4BJ6 A;  2OJQ A;  1Z7Q c;  3S84 A;  4IGG A;  5JRA A;  4MVQ A;  2L7A A;  2WL8 A;  1ZYR F;  2QLA A;  3CZ6 A;  2YLG A;  1APC A;  4R32 A;  2YVK A;  3L8I A;  5L0J A;  4CS8 C;  2ZXR A;  2OG2 A;  2Q00 A;  1C03 A;  3NDB B;  1HMD A;  1TFO B;  4MVS A;  1OR3 A;  4JUR I;  3EH1 A;  2XLO A;  1ZHY A;  2KJG A;  2LFD A;  2AU5 A;  3TJ5 A;  3WOD F;  3DJN B;  2GAQ A;  3MX3 A;  3TK0 A;  3U5S A;  4EBJ A;  2LD6 A;  5EGY A;  1T01 A;  4E7S A;  1SYQ A;  3ABL C;  4KI2 A;  1NU7 D;  1Y6D A;  4U5H A;  1RJ9 B;  4BG0 A;  4CJG A;  1RKE A;  3I4U A;  3LS1 A;  3K1H A;  4C7O A;  5T3T A;  1LIH A;  4DXW A;  1K40 A;  4YT4 A;  4YT2 A;  4X0R A;  2LP4 A;  4C3B A;  3EGX B;  4GYT A;  1JAF A;  3GOD A;  4JCZ A;  1H6G A;  4KC9 A;  5HV9 A;  1HW2 A;  3ZQY A;  3EGD A;  3FOO A;  2VAS A;  2YL7 A;  3F47 A;  4E0I A;  2IM8 A;  4XPX A;  3U0C A;  2YLI A;  4U9D A;  3TJ6 A;  1KU2 A;  4L6R A;  2WZG A;  3RQE A;  4J7Y A;  3U3F A;  1ZHW A;  2W4M A;  1CPR A;  1Z6A A;  4UDV A;  2R7V A;  2PX3 A;  4AE4 A;  2J9W A;  1MMD A;  1PD0 A;  1T6I A;  3A11 A;  4U5B E;  3AGT A;  4O6N A;  4YL3 A;  4OIN F;  5JVE A;  4JW1 A;  4QDL A;  4E0H A;  1G4U S;  2P1A A;  3VM6 A;  4C3E A;  5JLI A;  2OOC A;  3ITF A;  2P0N A;  2WVO A;  3BRJ A;  4NCQ A;  4CSA C;  2H7B A;  2J7P D;  4XWJ A;  1Q0K A;  2XL4 A;  5AC4 A;  4GQH A;  2ASR A;  3HLZ A;  5A69 A;  3ZSU A;  2LFF A;  1IW7 F;  2V26 A;  2W4B A;  4YT5 A;  2FGY A;  3B0U X;  1Q0G A;  1GQA A;  4G7O F;  2MYS A;  5CIV A;  2OEX A;  1V54 C;  4MQ9 F;  4O7G A;  4JKV A;  4LDQ A;  4E17 A;  1ZHT A;  3K7D A;  3NRH A;  3UGP A;  2LIG A;  3S29 A;  2YRF A;  3K6B A;  3QW0 A;  4PFO A;  2IXN A;  3GM1 A;  3GEH A;  1H7I A;  1ZW3 A;  1OCO C;  4CS9 A;  2OJE D;  1FAP B;  1A7D A;  2YKZ A;  4BPM A;  4DRI B;  3G4X A;  3MYF A;  3RKO F;  1S05 A;  3X2Q C;  4P9F A;  2XLV A;  2Q9C A;  4B6I A;  4LER A;  3FXH A;  5F5F A;  1AEP A;  3JSZ A;  1SMY F;  1GGQ A;  4Z9H A;  3VAY A;  3EHM A;  2EPK X;  4OD4 A;  2R7W A;  4PJJ A;  3AJM A;  3ZTM A;  2R7U A;  3DD7 A;  2W9Y A;  3C8G B;  1FMV A;  4J30 B;  1XZQ A;  5E3A A;  2HJ3 A;  2UUI A;  3VYW A;  3NYL A;  5FCL A;  4QI2 A;  1EA8 A;  2KC3 A;  2LSE A;  5DS5 A;  4I44 A;  1G5Z A;  2NUP B;  3IQ6 A;  3L8J A;  5AC5 A;  4U5F E;  2EPM X;  1CGO A;  2KGO A;  3CQZ A;  4FAP B;  1ORY A;  4NTB A;  2NG1 A;  2PF4 E;  1J8M F;  2G62 A;  5JP7 A;  2Q7R A;  2E87 A;  1GS9 A;  1WN0 A;  4DVZ A;  2RD9 A;  4HE8 D;  3V7O A;  3LNM B;  3V5Y A;  2J0X A;  2IYL D;  2XXA B;  4XEV A;  1CGM E;  1SZI A;  4JJG A;  3MLG A;  1MNE A;  1NG1 A;  1Y4C A;  3QVY A;  5BQH A;  2R03 A;  4Z9I A;  1K05 A;  3L1M A;  4Z9J A;  3ZG1 A;  4D4X A;  2M64 A;  4XTK A;  3N24 A;  4YK5 A;  3C8Z A;  5DLJ A;  3RF3 A;  1YLM A;  2HKV A;  3TUL A;  3AOU A;  4IRU A;  1ZHZ A;  3W8I A;  4EBB A;  1OCC C;  2JPU A;  3U8P A;  4Q5S F;  5E3C A;  3T6J A;  3JT1 A;  4ANJ A;  2HMQ A;  1HE9 A;  2DI3 A;  1V4A A;  3AG1 C;  1YA9 A;  4LLC A;  4MVZ A;  4OIR F;  4ZLC A;  5KYY B;  2MHR A;  2KK1 A;  2YL3 A;  3RYL A;  5B1B C;  4OIO F;  2XXA A;  5CI8 A;  4NC3 A;  3EZI A;  2XM4 A;  4DRJ B;  2Y39 A;  4JRZ A;  4IWB A;  4BJ6 C;  3IQT A;  4NY3 A;  2BE5 F;  2W45 A;  3Q6M A;  5GPG B;  4ULV A;  4JTC B;  4ZLD A;  4MTO A;  2L6G A;  3R2P A;  1OW8 A;  5L3V A;  4XLP F;  1A0B A;  5F28 E;  3WAQ A;  1Z63 A;  1FNT c;  3NKD A;  1M57 C;  5EHH A;  1U89 A;  1A7V A;  3JCU Q;  2AVK A;  5B3S C;  2EPL X;  2NSG A;  5KYY A;  4FES A;  4K0D A;  4ONS A;  4MW8 A;  3DKA A;  1WOL A;  1TWA A;  3L34 A;  1LM3 B;  1OCZ C;  2EIJ C;  3SXZ A;  3DAF A;  3W2W A;  2R25 A;  3ATP A;  2ZXO A;  3ZTZ A;  4I1M A;  2XLD A;  1TQG A;  2XL6 A;  3CAX A;  1EKY A;  2XS8 A;  1J8Y F;  4DBQ A;  1ST6 A;  2KW3 C;  4W8K A;  4YT8 A;  4OIP F;  4M63 A;  1M56 C;  4PJM A;  3AG2 C;  2A0B A;  3LLI A;  2A6E F;  3JRT A;  4BJ1 A;  3LS0 A;  2OU6 A;  5FZT A;  2J9V A;  1YYX A;  1OXB A;  3GEE A;  2KNH A;  2Y3H A;  2EIN C;  3T6G B;  3GEI A;  2HS5 A;  1QPU A;  4RD9 A;  3DZA A;  4YWQ A;  5BQG A;  1CPQ A;  1CGN A;  3NMI A;  3PHF 2;  3OEO A;  2J45 A;  3DMD A;  3HJC A;  3GM2 A;  1OXK A;  2B0J A;  3DE9 A;  3Q7G A;  4CX9 A;  5L0D A;  4O79 A;  2I8B A;  4N6C A;  256B A;  3U3B A;  3V5X A;  1LE4 A;  5COF A;  4A4A A;  1ORJ A;  3KYI A;  3W4Y A;  3C8G D;  4EHP A;  4C3D A;  1JMW A;  1DOV A;  2ICW G;  2Q9A A;  1ZVZ A;  1PV3 A;  2PP4 A;  4CJO A;  3ECS A;  2OKU A;  3U2L A;  1RJ9 A;  1VYI A;  4U5E E;  5JUA A;  3O6X A;  3ZVR A;  1VLT A;  2J9U A;  3SXY A;  2G3K A;  3GWN A;  3MBG A;  1M2O A;  3RVY A;  2JX0 A;  2P7V A;  1EI7 A;  4P6I C;  4PFP A;  3UMI A;  4AX2 A;  3EGX A;  2D4U A;  5L0F A;  4JIO A;  4XPY A;  3DI5 A;  3SEO A;  1N1C A;  2YL1 A;  1BBH A;  3ZDL A;  4YL0 A;  1O3U A;  4Q4Z F;  5KYU B;  1T6Q A;  1LKX A;  1LS4 A;  3SXM A;  2PFD A;  3UGO A;  1H9T A;  5DVW A;  2NUT B;  4KNW A;  3DJU B;  4CS9 C;  4U5G A;  2AWC A;  4DBR A;  1YDI A;  1MMN A;  1YAR O;  1F1M A;  2PNO A;  2X51 A;  3EFO B;  3FMS A;  1V74 B;  1YAU O;  1M6T A;  3B29 A;  1DOW A;  3HTK C;  4PK4 A;  3T6B A;  1QQ3 A;  2JD3 A;  3AQC A;  2WVN A;  5IY5 C;  4DOZ A;  2VCA A;  3EJN A;  3NMJ A;  1BR1 A;  3M1C B;  2UUH A;  4WGY A;  3ZC4 A;  4BJ5 A;  3IHU A;  3UNG C;  1NZE A;  3GWL A;  4PJN A;  2RSE B;  1LE2 A;  4JVS A;  2CCY A;  4BEM J;  2L9J A;  3M15 A;  5A6B D;  3K1I A;  2EPN A;  1M2V B;  1YZC A;  2VCC A;  2OEV A;  3Q6N A;  2HSB A;  2KSF A;  4LDR A;  5KYU A;  3PMR A;  3FHD A;  1YA7 O;  1MND A;  3JSE O;  2H7O A;  1ZHX A;  3AG4 C;  4K1O A;  3M79 A;  3NKE A;  2CGE A;  3EFO A;  1NFN A;  3DM9 B;  1VLS A;  4RDA A;  3US6 A;  1WGW A;  2XLE A;  4I3M A;  3IQC A;  2AP3 A;  4HFF B;  1T6U A;  3WHN A;  2ZXP A;  4YJW A;  1QLE C;  1OCR C;  1ZU5 A;  2CNW D;  3GAN A;  3NG1 A;  1IZM A;  3CEX A;  5COM A;  3T4R A;  2PBE A;  2IXM A;  3VF0 A;  3S90 A;  3LES A;  2XL8 A;  4EBK A;  3G4Z A;  2VC9 A;  3EH2 A;  2YL0 A;  3VRC A;  2TMV P;  2GDC A;  3S0X A;  2YHS A;  1QKR A;  1AVO B;  3AGU A;  3Q7L A;  4JTA B;  4LLE A;  3O10 A;  4MW3 A;  4G0H A;  3H2U A;  1Z23 A;  2FFH A;  2NSF A;  3RIP A;  4G7H F;  2HFI A;  2O9X A;  3KL4 A;  1UFB A;  2XM0 A;  2Y69 C;  3C8G A;  3DXJ F;  3U9M A;  1VK5 A;  4LAC B;  3LNR A;  1L3P A;  5AGF A;  1HE1 A;  4FWV A;  3C18 A;  4JE9 A;  3NYJ A;  4D4N A;  2Q3T A;  4NQF A;  1E2X A;  2NUP A;  2L6F A;  1YJG A;  4H54 A;  2AWY A;  1S7Z A;  3RH3 A;  2R7X A;  2QY9 A;  4OIQ F;  1Z5Z A;  2R7S A;  2OCC C;  3M4C A;  5A6K A;  5KYX B;  4KNV A;  1ZZP A;  1D1A A;  2J8W A;  2J7P A;  1YYJ A;  2FAP B;  3FDQ A;  3EQL F;  1Q0D A;  2QTV A;  1MQV A;  2ZPA A;  4ER9 A;  3JZ0 A;  2LQG A;  3HNL A;  3S9O A;  3B71 A;  4I1O B;  3TOL A;  1LI7 A;  3QTH A;  2KQ9 A;  3E9V A;  3O55 A;  5E2Q A;  4BEJ A;  3WG7 C;  4CS8 A;  2YWA A;  4JCH A;  3JRM O;  1JOG A;  4H4K C;  2YLD A;  2KYH A;  1VTM P;  5B3I A;  1KTM A;  1W2W A;  1JPJ A;  2MWQ A;  1KNY A;  3JYH A;  2I15 A;  1YZA A;  2VCB A;  3V5Z A;  3MYI A;  4F4B A;  4N6H A;  3GM3 A;  3GOR A;  4Q7C A;  1OQC A;  1FMW A;  2DYR C;  4LDK A;  2R02 A;  3IPM O;  2NPU A;  3LEV A;  3R7C A;  2EIK C;  1VYK A;  3AQB A;  3MFN A;  4WJ0 A;  3EZH A;  1TFK B;  3HKK A;  4E7Z A;  4NTA A;  3QZC A;  2HZ8 A;  1NFO A;  1LPE A;  4N06 A;  3UMH A;  2YEV A;  3LAY A;  4FX5 A;  3SP1 A;  1HMO A;  2Q4F A;  1JR8 A;  3B0P A;  3DE8 A;  4RBN A;  3OA1 A;  1YVI A;  5T3W A;  1D1B A;  1OKK D;  3U9J A;  3PCV A;  1WAS A;  4HFK B;  4BJT A;  4EUK B;  1FFH A;  2OQM A;  4P9T A;  5JS5 A;  5L0C A;  4CDA A;  3LLK A;  1PD1 A;  2QNL A;  1U6H A;  2CNW A;  4ULW A;  5KYN A;  2HV7 A;  2XLW A;  3NYM A;  4MVM A;  3ASO C;  4C7O B;  2EPO A;  3K66 A;  1E85 A;  2F22 A;  2HSQ A;  4PAC A;  2L81 A;  5KYW B;  2YZS A;  4J32 B;  3JTL O;  3CSK A;  2EIM C;  3EGD B;  1TKN A;  3N2Z B;  2R9R B;  2Y3G A;  1HW1 A;  2ZXW C;  3EHN A;  4DJ9 A;  1WTY A;  4U5C E;  5F5H A;  3I5Q A;  4CIP A;  2VH3 A;  2DGJ A;  3RQG A;  2IXO A;  3UMK A;  1O5H A;  5D92 A;  3RFY A;  2GA0 A;  4MVO A;  2L6H A;  4AE4 B;  2PX0 A;  5DS6 A;  2M4E A;  2YQY A;  1FR0 A;  3A9C A;  3KH2 A;  4OD5 A;  1XWJ A;  1R4T A;  1MMA A;  3ASN C;  4IB4 A;  3RVZ A;  3B9Q A;  2QE9 A;  1MMG A;  4CDV A;  1QSP A;  4IAO A;  4W8P A;  5KYW A;  1Q0F A;  1I5N A;  3LJB A;  1ORS C;  5L0H A;  4GEH A;  1LVK A;  2J0W A;  4WAB A;  4XEF A;  1G8X A;  4BJ5 C;  4AL0 A;  1L7C A;  1BR4 A;  5DQZ A;  3J06 A;  1WAT A;  2LK4 A;  4CIH A;  3H65 A;  2XS1 A;  3PDM P;  3JYY A;  3KPH A;  3K1I C;  4J7T A;  4JEB A;  5DS4 A;  2WZF A;  5JT4 A;  3I5P A;  1OR2 A;  4DRH B;  2XLM A;  4MND A;  1NU9 C;  5DQT A;  3EPV A;  2CDQ A;  3QVZ A;  1O87 A;  1U0B B;  2A6H F;  3F46 A;  2A69 F;  2B0H A;  4U9E A;  2DYS C;  5D91 A;  5L0G A;  3UR3 C;  4QI0 A;  1QVX A;  3KYJ A;  1BDJ B;  3W8H A;  5JSL A;  2WZL A;  1VOM A;  2A1D D;  4E18 A;  1BR2 A;  2NUT A;  4AK9 A;  2VB6 A;  2J46 A;  1LS1 A;  3C7J A;  4JZA A;  4YL1 A;  3E70 C;  1SR2 A;  3HNI A;  1R5I D;  4PR9 A;  1OW6 A;  4CS7 A;  3ABM C;  3TOM A;  4DVY P;  3IQ5 A;  1SF8 A;  4YN0 B;  3U2M A;  2GFH A;  3KKB A;  2WVQ A;  2IXP A;  4G78 A;  5BQI A;  1RXQ A;  3BEH A;  4JTD B;  4CBE A;  1PCX A;  4CSA A;  3OWT A;  1OKK A;  2A0U A;  4CDY A;  3SZR A;  3S27 A;  1T9K A;  1G4W R;  5BUO A;  1RCP A;  1E84 A;  1UG7 A;  1TR2 A;  2R05 A;  2ZD9 A;  4MTF A;  4G7Z F;  1M2V A;  1BZ4 A;  2X0C A;  1TWC A;  2Y3B A;  3T9O A;  2HJM A;  3ABK C;  3DWW A;  5B1A C;  3LUT B;  1A7E A;  3NMK A;  5L0I A;  2R7R A;  2WB7 A;  1ZW2 A;  1C02 A;  3DAG A;  4XLN F;  3FOP A;  4MTG A;  1D0X A;  4XQ1 A;  2Q9B A;  3HNK A;  3IEE A;  4KBL A;  3ZQV A;  4MVU A;  1A41 A;  2V3C C;  1EQ1 A;  4AL1 A;  3M4B A;  4JC7 A;  4PJL A;  2HUJ A;  5E33 A;  3FAP B;  2P6V A;  1Q0M A;  1B68 A;  1RKC A;  4O6Y A;  5TJ5 E; 
#chains in the Genus database with same CATH homology
 5COM A;  3CEX A;  5COG A;  2RD9 A;  2OU6 A;  2P1A A;  3QTH A;  2NSF A;  2YQY A;  2OQM A;  3DI5 A;  2QE9 A;  2QNL A;  2NSG A;  2HKV A;  3DKA A;  2F22 A;  5CIV A;  3GOR A;  1RXQ A;  4N6C A;  5COF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...