3LJBA

Structural basis of oligomerisation in the mxa stalk
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
268
structure length
219
Chain Sequence
EDENEKMFFLIDKVNAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIENNFQEGHKILSRKIQKFENFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYSMEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Antiviral protein
molecule keywords Interferon-induced GTP-binding protein Mx1
publication title Structural basis of oligomerization in the stalk region of dynamin-like MxA.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 219
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1240 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ljbA00
3ZVRA 4X0RA 3SZRA 4BEJA 3LJBA 3SNHA
chains in the Genus database with same CATH superfamily
3NKEA 4EIYA 4CDVA 2J7PD 4O6YA 4OIQF 3N2ZB 4JC7A 4JURI 2A0UA 3K1HA 2R7RA 1JAFA 3TOLA 3U3BA 3OA1A 2HSQA 3K6BA 4NTAA 3C8ZA 2GDCA 3H65A 1OW7A 4IAOA 2YHSA 5T3TA 4MVOA 4BJ1A 3DM9B 2X51A 3N24A 1FTSA 4N4WA 2XLOA 2FFHA 1GGQA 1R4TA 3EQLF 3LUTB 2KC3A 3L34A 4RBNA 1TWCA 2HMZA 4ULWA 1D0ZA 2AWCA 3SXKA 4A4AA 3FOPA 2X0CA 4AX2A 2XM4A 3LNMB 1H9GA 3EHNA 3DAGA 1RXQA 4C7OA 1FFTC 2HJ3A 2W4BA 1OQCA 2Y3BA 3CAXA 5DVWA 2XL6A 2CYDA 1E83A 2YRFA 3GANA 2V26A 4DVZA 3JRMO 5KYYA 4E7ZA 3B0PA 4E7SA 1QKRA 3GM1A 3S0XA 4CIPA 4ZLDA 4Z9IA 3HTKC 1KU2A 2CNWA 1BR1A 5JP7A 5DQZA 5K0IA 1CGME 2TMVP 3QW0A 2IXNA 3C8GD 3C7JA 3HKKA 3PHF2 1E84A 1PCXA 1JRAA 4X0RA 2GA0A 1I4YA 4JEBA 2P1AA 3AOUA 4LDQA 3JCUQ 5JLIA 4DJ9A 2XS1A 4XWJA 2NSFA 4MQ9F 3EGDB 4PJNA 4AE4B 3EHMA 3TD7A 4OD4A 1ZHZA 3G50A 3ITFA 3LESA 1B68A 3O6XA 3QW1A 1NZEA 3B29A 4FX5A 1W2WA 5A6KA 5L0FA 3S90A 2WVQA 3LEVA 1VTMP 3GORA 1VLTA 5IY5C 4EBJA 4CS7A 4M63A 5B1AC 5B1BC 3SNHA 3GEHA 4EKWA 4DBRA 4CDAA 5A6JA 3AJMA 3NKDA 3W2VA 1QZXA 4WABA 2YWAA 2J9VA 3EFOA 5E33A 2R7UA 2ASRA 2KGOA 3M4BA 3T4RA 1MNEA 1YAUO 1WGWA 2VCCA 1Z5ZA 4MVMA 1R5ID 2XXAB 3T6GB 2Q7RA 2L6HA 4W8PA 3TK0A 3B0VC 4U5BE 1SF8A 2QTVA 4JW1A 3HJCA 2D4UA 3JTLO 4N6HA 3V5ZA 2XLVA 4DVYP 4LERA 2PNOA 4MVUA 5D92A 1RJ9B 1ZZPA 4MVRA 4E17A 1CGOA 2HUJA 2XXAA 2ZPAA 1O5HA 2WL8A 3CEXA 1OCRC 1LS1A 3V5YA 5AC4A 2IM8A 1T9KA 4E0HA 2NUTB 4O6NA 3AGUA 3RVYA 3L8JA 1BZ4A 1NFOA 4MVSA 3TQOA 1BR2A 3NYLA 3VM6A 3ZQVA 1OKKA 1BBHA 1OCZC 1OXBA 5D91A 1SZIA 2J9BA 3JSEO 2W4MA 1ZYRF 2WB7A 2YLGA 1L3PA 3CZ6A 1PV3A 5DS6A 4XQ1A 3IQCA 2NUPB 2NUTA 3DAFA 3AQCA 3O55A 4PJMA 3VF0A 2G62A 4LLEA 4G7ZF 1ZHTA 3WODF 5AGFA 4GEHA 4BJ5A 2H8AA 3HNJA 1FMVA 1Z23A 2YL3A 2Q3TA 2Y3HA 2VH3A 3C8GB 5B3SC 3U2MA 1I4ZA 1Z6AA 2NUPA 3V5XA 1HW1A 2A6HF 1LS4A 1YYXA 3ABKC 2A0BA 2XS8A 3RQEA 4K1OA 3ZIBA 1A41A 1HE1A 1TR2A 4Q4ZF 1D0YA 3TJ5A 1ZHXA 2LP4A 2H7OA 3K1IC 3TJ6A 1ORSC 1V4AA 2FGYA 4K0DA 4JZAA 3FDQA 2R03A 2IXOA 2XL8A 2J46A 3QVYA 1Q0GA 4MW8A 2Z15A 3U5SA 1ZU4A 3EG9B 2OJQA 4ANJA 4U9EA 1VB5A 2ZXPA 2C04A 4LLCA 2R7XA 4U5EE 3U9JA 2LFFA 1T01A 2AU5A 4R32A 5COFA 1GQAA 1HW2A 1YLMA 1Y4CA 3ECSA 1G5ZA 3JSZA 3UMKA 3ZQYA 2DYRC 4MTFA 3SP1A 4AL0A 2JPUA 1G8XA 1OR2A 5EGYA 1E2XA 1LVKA 3UGPA 3DXJF 3R7CA 1IZMA 4D4NA 1SMYF 3ZG1A 1WWPA 2WZGA 2YQYA 3HNIA 3AQBA 1WASA 3DZAA 2OG2A 4G7HF 1H6GA 1M2OA 5JT4A 3W2WA 2D5RB 2JX0A 3IQ5A 1QQ3A 2A6EF 3ZDLA 1HY5A 2H7VC 2B0JA 3NDBB 2QNLA 5L0JA 4PR9A 3FAPB 3GM3A 4EHPA 4P9TA 1N1CA 3KKBA 1IW7F 2YL0A 2XRHA 1AUEA 1YARO 5BQHA 2EIJC 5F5HA 2V3CC 1F1MA 3ASNC 1M56C 3DI5A 1Q0FA 1YZCA 4JTCB 4W8KA 1NLXA 4MVQA 2Q00A 4KBLA 3UMHA 1EI7A 1RKCA 2EPLX 5CI8A 1XWJA 4Z9JA 1A7DA 4LDKA 4IRUA 3FMSA 4PK4A 5JSLA 3SXYA 3ZTMA 2EPOA 2P6VA 2O9XA 2ZXWC 3A9CA 1VMAA 2PX0A 1GM5A 3FAJA 1VLSA 2R02A 4U9DA 4C3DA 5CIVA 3E9VA 2KK1A 2NSGA 2LFDA 3K1IA 2XLEA 4PACA 4YN0B 1M2VB 1CPQA 1Q0KA 4CX9A 1I5NA 1AEPA 2PBEA 2G3VA 1O87A 5L0GA 4JIOA 4NTBA 2H7BA 4IWBA 1V54C 5TJ5E 4OIOF 4IJJA 1OKKD 4YL3A 1FR0A 4NTFA 3ZSUA 3Q7LA 4U5HA 2B0HA 3A11A 2DGJA 2CDQA 3UGOA 256BA 4CSAA 3PCVA 2VCBA 2HV7A 5EK0A 1VOMA 1QLEC 4BJ5C 4H54A 4LDRA 2HSBA 1WATA 3C63A 3DD7A 2ZD9A 3EH1A 3SEOA 3Q6NA 4WGZA 5DS4A 3DWWA 4F4BA 2R7WA 3CQZA 3K66A 3NMJA 3ABLC 3ZC4A 4CS8C 4JJFA 4UDVA 1ZW3A 2QUPA 1RMVA 3EGDA 4AE4A 3LNRA 2PX3A 3T6JA 2MHRA 2JD3A 1T6QA 3DJUB 1K05A 2A69F 3C62A 3O39A 4RD9A 1U6HA 2W9YA 3H2UA 2NG1A 2DB4A 5E2QA 4YT2A 1D1AA 4OIPF 3U8VA 1ZHWA 2RD9A 1MMDA 1Q0MA 3T9OA 4FESA 5DS5A 4MS2A 4C3BA 1MNDA 3JYYA 1QPUA 4JE9A 4U5GA 4XEKA 2OJED 3RVZA 3U9MA 5L0DA 1Z63A 4EUKB 2J7PA 4YL0A 1TWHA 2GFHA 1MMGA 2EPKX 2EILC 2VB6A 3O10A 2KYHA 1APCA 3F46A 1H7IA 2Q9AA 4GYTA 2EIKC 2YL7A 3NRHA 3VYWA 5KYUB 4H4KC 1LE4A 3DMDA 3NMKA 4O79A 4BEMJ 4YT5A 2AVKA 1LPEA 1KNYA 2VCAA 3I5PA 5BUOA 4XEFA 2R25A 1M57C 3AG1C 3G4XA 3HNLA 4A2NB 2LSEA 1FAPB 4E0IA 1RJ9A 5KYUA 4ZLCA 3IPMO 5FZTA 3JZ0A 4CIHA 5BQGA 1EQ1A 4JRZA 3V7OA 3POVA 2Y69C 3VRCA 2KNHA 5KYXB 1EKYA 1VYIA 3M1CB 3KYIA 3F47A 2AP3A 3KH2A 3MYFA 4G78A 2J45A 2L6FA 3BEHA 3L8IA 3B0UX 2YLIA 5JUAA 4D4XA 4BEJA 3B71A 1NSGB 4RDAA 2OEXA 3FOOA 1DOWA 5KYWB 2IXMA 1TWGA 2EINC 3JRTA 1T6IA 3ZTZA 1TWAA 2I8BA 4JTAB 3ATPA 4CS8A 4PJJA 1D1BA 4I1OB 2EIMC 3S84A 1TFOB 1JPJA 2Y3DA 5KYWA 5DLJA 2HV6A 3K7DA 1E86A 2LK4A 2R7TA 3C8GA 5A6AA 5CI9A 4YWQA 4YK5A 2LD6A 3SZRA 1RCPA 1SYQA 2L7AA 2R05A 3NMIA 4BJ6A 4FAPB 3S28A 5A6BA 3ZWIA 3M4CA 2WVOA 3US6A 2P61A 2XL4A 4GQHA 3GWNA 2CNWD 2KJGA 3OWTA 2R9RB 2Y3GA 3X2QC 5FCLA 1D1CA 1NU7D 4I44A 2BL2A 3IQ6A 4MTOA 1OCOC 4HE8D 4OINF 2L6GA 4XPYA 4BJTA 1OCCC 3RF3A 2OCCC 3EG9A 3Q6MA 4HFFB 1VK5A 4CSAC 4JJGA 2WZLA 3DM5A 1A7VA 1OXKA 1PD1A 5E3CA 5L3VA 3H2VA 2L81A 4XPXA 4HEAJ 5T3WA 1U89A 3W8HA 4Q7CA 2LCHA 2IOQA 3UMIA 2L9JA 2RSEB 3W4YA 5T1DB 3SXZA 1Y6DA 2QY9A 1UFBA 4CDYA 4MVZA 2OQMA 2J8WA 1JMWA 4Z9HA 4U5CE 3EGXB 4ONSA 1YJGA 2G3KA 2YKZA 2OOCA 3QZCA 3RKOF 5HSWA 4LACB 2EPMX 3DJNB 4KNWA 4NQFA 4ULVA 3RYLA 4IARA 3J06A 2J0XA 5EHHA 3PDMP 1OW6A 2HS5A 4ER9A 2PP4A 3EGXA 3FXHA 4J32B 4EWCA 3GEIA 5B3IA 4BPMA 3U0CA 3AGTA 1C03A 2YZSA 2MWQA 4JEAA 1Z7Qc 3RIPA 1FNTc 1L7CA 3OEOA 2IBFA 1ZU5A 3KMIA 3LLKA 2R7VA 2J9UA 3GODA 4OIRF 1HMDA 1TFKB 2KW3C 4YJWA 4JTDB 3S9OA 3GWLA 2GAQA 3IEEA 3JT1A 3QVZA 4E18A 1LM3B 3K33A 3W8IA 1H9TA 4NY3A 1ZVZA 3ZVRA 2DYSC 1LI7A 3B9QA 2AWYA 4K7BA 1M6TA 4MNDA 1NU9C 1M2VA 1LE2A 3HLZA 3NG1A 3EPVA 2XSEA 4MW3A 1LI5A 3AG2C 2VC9A 3LJBA 4NCQA 5AC5A 4C7OB 5L3QA 2WZFA 1TQGA 1QVXA 4JVSA 4CS9C 3NYJA 2LIGA 1VYKA 1UG7A 3JYHA 2E87A 5KYYB 2YEVA 2CCYA 1K04A 1YDIA 3EH2A 4BG0A 2J0WA 3AG4C 3U3FA 2CGEA 4DRJB 1T6UA 1MMAA 2R7QA 3LLIA 2IXPA 2F22A 3EZIA 3EZHA 1BR4A 4DXWA 1LKXA 1WTYA 2KQ9A 2PFDA 1BDJB 3WAQA 3MFNA 4N06A 3SXMA 1YYJA 4C3EA 1Q0DA 2A1DD 4JKVA 1A0BA 3MYIA 1T5OA 2P7VA 3WHNA 1S05A 4B6IA 2QE9A 1G4WR 1ZHYA 1J8YF 1EA8A 1DOVA 4WJ0A 5BQIA 3KL4A 3GEEA 4Q5SF 5F28E 3DE9A 2HFIA 5A6BD 4BJ6C 5JRAA 1CPRA 5A69A 1JPNA 1ORJA 1ZW2A 3Q7GA 1ORYA 4FWVA 1MQVA 2HKVA 4JCHA 3UNGC 2BE5F 4AK9A 3U8PA 4G7OF 3QTHA 4J7YA 4HFKB 5JS5A 4QI2A 2DI3A 1TKNA 3EFOB 4XPWA 2XLMA 3M15A 2ETSA 1ST6A 1SR2A 5HV9A 2CW0F 1NG1A 4DBQA 2R7SA 1FFHA 4KNVA 1C17M 4O6MA 4QDLA 3LEOA 2R7OA 2I15A 3RQGA 3RW0A 2OEVA 4QI0A 1RKEB 1KTMA 4YT8A 4J7TA 4U5DE 3TULA 1D0XA 1XZPA 4CS9A 2YLDA 3N0TA 5E3AA 2HJMA 5F5FA 3C18A 3L1MA 3S27A 2Q9BA 1CGNA 4I1MA 4U5FE 2XM0A 1RKEA 3AG3C 1PD0A 4XEVA 4DRIB 5L0IA 3ABMC 1YA9A 3TOMA 2LQGA 4KI2A 4J30B 3S29A 2IYLD 5GPGB 5L0HA 1Z3IX 2W45A 2YL1A 1V55C 1OR3A 3L0IA 3LAYA 3R2PA 4I3MA 2EPNA 1NFNA 2OKUA 4YT4A 5KYXA 3RQFA 4OD5A 2BC5A 3FVYA 2Q9CA 2ZXRA 4JCZA 4XLPF 2ICWG 2GWWA 3ASOC 2A68F 4WGYA 5KYNA 5DQTA 3EJNA 2QLAA 3MLGA 2M64A 4EBKA 3KPHA 2XLWA 2C03A 3G4ZA 4XTKA 3LS1A 3MBGA 3LS0A 1HMOA 2PF4E 3FHDA 2P0NA 1FMWA 4IGGA 1G4US 5L0CA 2HMQA 1WN0A 2NPUA 3DE8A 3KYJA 1JOGA 1NBBA 1O3UA 4DRHB 4L6RA 3RFYA 4XLNF 3I5QA 3IQTA 3IHUA 1U0BB 4G0HA 2FAPB 4CJOA 3X1OA 3GM2A 4O7GA 1OW8A 3VAYA 4P9FA 1K40A 2J9WA 3I4UA 1MMNA 2KSFA 4DOZA 4KC9A 1YVIA 2VASA 3QMKA 3RH3A 3DKAA 1QSPA 2Q4FA 4CJGA 4IAQA 1J8MF 2UUIA 2ZXOA 4NC3A 2Y39A 5COGA 5JVEA 1S7ZA 1V74B 2M4EA 4PFOA 4AL1A 3NYMA 1GS9A 1XZQA 2HZ8A 2XLDA 1JR8A 4MTGA 3E70C 4PFPA 2YVKA 3CSKA 3SYNA 2WVNA 4IB4A 3T6BA 3HNKA 4P6IC 3UR3C 4EBBA 1C02A 1YA7O 3BRJA 1E85A 2XLHA 5COMA 1AVOB 1A7EA 2UUHA 3M79A 4YL1A 4CBEA 1LIHA 1WOLA 4N6CA 3U2LA 3MX3A 3PMRA 1HE9A 2MYSA 4PJLA 2OU6A 1YZAA 3WG7C
chains in the Genus database with same CATH topology
3NKEA 2J7PD 4O6YA 4OIQF 3N2ZB 4JURI 2R7RA 3K1HA 3OA1A 3K6BA 3H65A 4IAOA 2YHSA 5T3TA 4BJ1A 3DM9B 2X51A 3N24A 1FTSA 2FFHA 3EQLF 3L34A 4RBNA 1TWCA 4ULWA 1D0ZA 4AX2A 3EHNA 3DAGA 4C7OA 1FFTC 2W4BA 2Y3BA 5DVWA 3GANA 2V26A 4DVZA 5KYYA 4E7ZA 3B0PA 3S0XA 4ZLDA 3HTKC 1KU2A 2CNWA 1BR1A 5DQZA 2IXNA 3PHF2 1PCXA 4X0RA 3JCUQ 4XWJA 4MQ9F 3EGDB 4PJNA 4AE4B 3EHMA 3TD7A 4OD4A 1ZHZA 3LESA 3ITFA 3O6XA 1NZEA 4FX5A 1W2WA 2WVQA 3LEVA 5IY5C 4DBRA 4CS7A 4M63A 5B1AC 5B1BC 3SNHA 3NKDA 3W2VA 1QZXA 2J9VA 3EFOA 5E33A 2R7UA 2KGOA 3T4RA 1MNEA 1WGWA 1Z5ZA 2XXAB 3B0VC 4U5BE 1SF8A 2QTVA 4JW1A 3HJCA 4DVYP 4LERA 5D92A 1RJ9B 2XXAA 2ZPAA 1O5HA 2WL8A 1OCRC 1LS1A 2NUTB 4O6NA 1BR2A 3NYLA 1OKKA 1OCZC 5D91A 1SZIA 2W4MA 1ZYRF 2WB7A 3CZ6A 5DS6A 2NUPB 2NUTA 3DAFA 3AQCA 4PJMA 2G62A 4LLEA 4G7ZF 1ZHTA 3WODF 4BJ5A 4GEHA 1FMVA 1Z23A 2Q3TA 2Y3HA 2VH3A 1Z6AA 2NUPA 2A6HF 3ABKC 4Q4ZF 3ZIBA 1TR2A 1D0YA 1ZHXA 3K1IC 2H7OA 2FGYA 4K0DA 4JZAA 3FDQA 2IXOA 2J46A 2Z15A 1ZU4A 3EG9B 4ANJA 2ZXPA 2C04A 4LLCA 2R7XA 4U5EE 4OIOF 3ECSA 3JSZA 3UMKA 4C3DA 5EGYA 2DYRC 3SP1A 1G8XA 1LVKA 3UGPA 3DXJF 1IZMA 1SMYF 3ZG1A 2WZGA 3AQBA 3DZAA 4G7HF 2OG2A 1M2OA 3W2WA 2D5RB 2A6EF 2H7VC 2B0JA 3NDBB 1N1CA 3KKBA 1IW7F 2XRHA 2EIJC 5F5HA 2V3CC 3ASNC 1M56C 4W8KA 4KBLA 3UMHA 5CI8A 4PK4A 4IRUA 2P6VA 2O9XA 2ZXWC 1VMAA 2PX0A 3FAJA 3E9VA 4YN0B 1M2VB 2G3VA 1O87A 2H7BA 4IWBA 1V54C 4IJJA 1OKKD 3ZSUA 3Q7LA 4U5HA 2DGJA 2CDQA 3UGOA 4CSAA 2HV7A 1VOMA 1QLEC 4BJ5C 5DS4A 3DD7A 3EH1A 3SEOA 3Q6NA 2R7WA 4F4BA 3CQZA 3K66A 3ABLC 3ZC4A 4CS8C 4JJFA 3EGDA 4AE4A 3LNRA 2PX3A 3T6JA 2JD3A 3DJUB 2A69F 3O39A 4RD9A 2W9YA 2NG1A 5E2QA 4YT2A 1D1AA 4OIPF 1ZHWA 1MMDA 5DS5A 4FESA 4C3BA 1MNDA 4U5GA 1Z63A 2J7PA 1TWHA 2GFHA 1MMGA 2EILC 2VB6A 3F46A 2Q9AA 4GYTA 2EIKC 3NRHA 3VYWA 5KYUB 4H4KC 3DMDA 4O79A 4YT5A 3I5PA 5BUOA 1M57C 3AG1C 4A2NB 2LSEA 1RJ9A 5KYUA 4ZLCA 4CIHA 3POVA 3V7OA 2Y69C 5KYXB 2KNHA 1VYIA 3M1CB 3F47A 3KH2A 3B0UX 2J45A 4BEJA 4RDAA 5KYWB 2IXMA 1TWGA 2EINC 3JRTA 1TWAA 2I8BA 4CS8A 4PJJA 1D1BA 4I1OB 2EIMC 1JPJA 2Y3DA 5KYWA 5DLJA 2HV6A 3K7DA 2R7TA 5CI9A 4YWQA 3SZRA 4BJ6A 3S28A 2WVOA 2XL4A 2CNWD 2KJGA 3OWTA 3X2QC 2Y3GA 5FCLA 1D1CA 1NU7D 4I44A 1OCOC 4HE8D 4OINF 4BJTA 1OCCC 2OCCC 3EG9A 3Q6MA 4HFFB 1VK5A 4CSAC 4JJGA 2WZLA 3DM5A 5E3CA 1PD1A 5L3VA 2L81A 3W8HA 4HEAJ 5T3WA 4Q7CA 2IOQA 3UMIA 2L9JA 5T1DB 2QY9A 4U5CE 3EGXB 2G3KA 3RKOF 5HSWA 3QZCA 4LACB 3DJNB 4KNWA 3RYLA 2J0XA 5EHHA 2PP4A 3EGXA 4J32B 4EWCA 2YZSA 3RIPA 2MWQA 3OEOA 1ZU5A 3KMIA 3LLKA 2R7VA 2J9UA 3GODA 4OIRF 2KW3C 4YJWA 3JT1A 3IEEA 3K33A 3W8IA 4NY3A 3ZVRA 2DYSC 3B9QA 4K7BA 4MNDA 1NU9C 1M2VA 3HLZA 3NG1A 4E7SA 3EPVA 2XSEA 5B3SC 4C7OB 3AG2C 3LJBA 4Q5SF 5L3QA 2WZFA 4JVSA 4CS9C 3NYJA 1VYKA 3JYHA 2E87A 5KYYB 2YEVA 3EH2A 4BG0A 2J0WA 3AG4C 2CGEA 1MMAA 2R7QA 3LLIA 2IXPA 3EZIA 3EZHA 1BR4A 1LKXA 2KQ9A 2PFDA 4N06A 4C3EA 2A1DD 2P7VA 4B6IA 1ZHYA 1J8YF 4WJ0A 3KL4A 4BJ6C 1JPNA 3Q7GA 4FWVA 3UNGC 4JCHA 4AK9A 2BE5F 4G7OF 4HFKB 4QI2A 1TKNA 3EFOB 1ST6A 2CW0F 1NG1A 4DBQA 2R7SA 1FFHA 4KNVA 4O6MA 4QDLA 2R7OA 4QI0A 4YT8A 4U5DE 1D0XA 4CS9A 3N0TA 5E3AA 5F5FA 3S27A 2Q9BA 4U5FE 4I1MA 3AG3C 1PD0A 3ABMC 4KI2A 4J30B 3S29A 2IYLD 1Z3IX 2W45A 4I3MA 1V55C 3LAYA 3L0IA 5KYXA 4YT4A 4OD5A 3FVYA 2Q9CA 2ZXRA 4XLPF 3ASOC 2A68F 5KYNA 5DQTA 3EJNA 3MLGA 2C03A 4XTKA 3LS1A 3LS0A 2PF4E 3FHDA 1FMWA 3RFYA 4XLNF 3I5QA 4G0HA 3X1OA 4O7GA 3VAYA 2J9WA 3I4UA 1MMNA 4DOZA 4KC9A 2VASA 3QMKA 3RH3A 1J8MF 2ZXOA 2Y39A 1S7ZA 2M4EA 4PFOA 3NYMA 4PFPA 3E70C 3CSKA 3SYNA 2WVNA 3T6BA 4P6IC 3UR3C 4EBBA 4CBEA 3MX3A 3PMRA 2MYSA 4PJLA 3WG7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZVR A;  4X0R A;  3SZR A;  4BEJ A;  3LJB A;  3SNH A; 
#chains in the Genus database with same CATH topology
 3NKE A;  4EIY A;  4CDV A;  2J7P D;  4O6Y A;  4OIQ F;  3N2Z B;  4JC7 A;  4JUR I;  2A0U A;  3K1H A;  2R7R A;  1JAF A;  3TOL A;  3U3B A;  3OA1 A;  2HSQ A;  3K6B A;  4NTA A;  3C8Z A;  2GDC A;  3H65 A;  1OW7 A;  4IAO A;  2YHS A;  5T3T A;  4MVO A;  4BJ1 A;  3DM9 B;  2X51 A;  3N24 A;  1FTS A;  4N4W A;  2XLO A;  2FFH A;  1GGQ A;  1R4T A;  3EQL F;  3LUT B;  2KC3 A;  3L34 A;  4RBN A;  1TWC A;  2HMZ A;  4ULW A;  1D0Z A;  2AWC A;  3SXK A;  4A4A A;  3FOP A;  2X0C A;  4AX2 A;  2XM4 A;  3LNM B;  1H9G A;  3EHN A;  3DAG A;  1RXQ A;  4C7O A;  1FFT C;  2HJ3 A;  2W4B A;  1OQC A;  2Y3B A;  3CAX A;  5DVW A;  2XL6 A;  2CYD A;  1E83 A;  2YRF A;  3GAN A;  2V26 A;  4DVZ A;  3JRM O;  5KYY A;  4E7Z A;  3B0P A;  4E7S A;  1QKR A;  3GM1 A;  3S0X A;  4CIP A;  4ZLD A;  4Z9I A;  3HTK C;  1KU2 A;  2CNW A;  1BR1 A;  5JP7 A;  5DQZ A;  5K0I A;  1CGM E;  2TMV P;  3QW0 A;  2IXN A;  3C8G D;  3C7J A;  3HKK A;  3PHF 2;  1E84 A;  1PCX A;  1JRA A;  4X0R A;  2GA0 A;  1I4Y A;  4JEB A;  2P1A A;  3AOU A;  4LDQ A;  3JCU Q;  5JLI A;  4DJ9 A;  2XS1 A;  4XWJ A;  2NSF A;  4MQ9 F;  3EGD B;  4PJN A;  4AE4 B;  3EHM A;  3TD7 A;  4OD4 A;  1ZHZ A;  3G50 A;  3ITF A;  3LES A;  1B68 A;  3O6X A;  3QW1 A;  1NZE A;  3B29 A;  4FX5 A;  1W2W A;  5A6K A;  5L0F A;  3S90 A;  2WVQ A;  3LEV A;  1VTM P;  3GOR A;  1VLT A;  5IY5 C;  4EBJ A;  4CS7 A;  4M63 A;  5B1A C;  5B1B C;  3SNH A;  3GEH A;  4EKW A;  4DBR A;  4CDA A;  5A6J A;  3AJM A;  3NKD A;  3W2V A;  1QZX A;  4WAB A;  2YWA A;  2J9V A;  3EFO A;  5E33 A;  2R7U A;  2ASR A;  2KGO A;  3M4B A;  3T4R A;  1MNE A;  1YAU O;  1WGW A;  2VCC A;  1Z5Z A;  4MVM A;  1R5I D;  2XXA B;  3T6G B;  2Q7R A;  2L6H A;  4W8P A;  3TK0 A;  3B0V C;  4U5B E;  1SF8 A;  2QTV A;  4JW1 A;  3HJC A;  2D4U A;  3JTL O;  4N6H A;  3V5Z A;  2XLV A;  4DVY P;  4LER A;  2PNO A;  4MVU A;  5D92 A;  1RJ9 B;  1ZZP A;  4MVR A;  4E17 A;  1CGO A;  2HUJ A;  2XXA A;  2ZPA A;  1O5H A;  2WL8 A;  3CEX A;  1OCR C;  1LS1 A;  3V5Y A;  5AC4 A;  2IM8 A;  1T9K A;  4E0H A;  2NUT B;  4O6N A;  3AGU A;  3RVY A;  3L8J A;  1BZ4 A;  1NFO A;  4MVS A;  3TQO A;  1BR2 A;  3NYL A;  3VM6 A;  3ZQV A;  1OKK A;  1BBH A;  1OCZ C;  1OXB A;  5D91 A;  1SZI A;  2J9B A;  3JSE O;  2W4M A;  1ZYR F;  2WB7 A;  2YLG A;  1L3P A;  3CZ6 A;  1PV3 A;  5DS6 A;  4XQ1 A;  3IQC A;  2NUP B;  2NUT A;  3DAF A;  3AQC A;  3O55 A;  4PJM A;  3VF0 A;  2G62 A;  4LLE A;  4G7Z F;  1ZHT A;  3WOD F;  5AGF A;  4GEH A;  4BJ5 A;  2H8A A;  3HNJ A;  1FMV A;  1Z23 A;  2YL3 A;  2Q3T A;  2Y3H A;  2VH3 A;  3C8G B;  5B3S C;  3U2M A;  1I4Z A;  1Z6A A;  2NUP A;  3V5X A;  1HW1 A;  2A6H F;  1LS4 A;  1YYX A;  3ABK C;  2A0B A;  2XS8 A;  3RQE A;  4K1O A;  3ZIB A;  1A41 A;  1HE1 A;  1TR2 A;  4Q4Z F;  1D0Y A;  3TJ5 A;  1ZHX A;  2LP4 A;  2H7O A;  3K1I C;  3TJ6 A;  1ORS C;  1V4A A;  2FGY A;  4K0D A;  4JZA A;  3FDQ A;  2R03 A;  2IXO A;  2XL8 A;  2J46 A;  3QVY A;  1Q0G A;  4MW8 A;  2Z15 A;  3U5S A;  1ZU4 A;  3EG9 B;  2OJQ A;  4ANJ A;  4U9E A;  1VB5 A;  2ZXP A;  2C04 A;  4LLC A;  2R7X A;  4U5E E;  3U9J A;  2LFF A;  1T01 A;  2AU5 A;  4R32 A;  5COF A;  1GQA A;  1HW2 A;  1YLM A;  1Y4C A;  3ECS A;  1G5Z A;  3JSZ A;  3UMK A;  3ZQY A;  2DYR C;  4MTF A;  3SP1 A;  4AL0 A;  2JPU A;  1G8X A;  1OR2 A;  5EGY A;  1E2X A;  1LVK A;  3UGP A;  3DXJ F;  3R7C A;  1IZM A;  4D4N A;  1SMY F;  3ZG1 A;  1WWP A;  2WZG A;  2YQY A;  3HNI A;  3AQB A;  1WAS A;  3DZA A;  2OG2 A;  4G7H F;  1H6G A;  1M2O A;  5JT4 A;  3W2W A;  2D5R B;  2JX0 A;  3IQ5 A;  1QQ3 A;  2A6E F;  3ZDL A;  1HY5 A;  2H7V C;  2B0J A;  3NDB B;  2QNL A;  5L0J A;  4PR9 A;  3FAP B;  3GM3 A;  4EHP A;  4P9T A;  1N1C A;  3KKB A;  1IW7 F;  2YL0 A;  2XRH A;  1AUE A;  1YAR O;  5BQH A;  2EIJ C;  5F5H A;  2V3C C;  1F1M A;  3ASN C;  1M56 C;  3DI5 A;  1Q0F A;  1YZC A;  4JTC B;  4W8K A;  1NLX A;  4MVQ A;  2Q00 A;  4KBL A;  3UMH A;  1EI7 A;  1RKC A;  2EPL X;  5CI8 A;  1XWJ A;  4Z9J A;  1A7D A;  4LDK A;  4IRU A;  3FMS A;  4PK4 A;  5JSL A;  3SXY A;  3ZTM A;  2EPO A;  2P6V A;  2O9X A;  2ZXW C;  3A9C A;  1VMA A;  2PX0 A;  1GM5 A;  3FAJ A;  1VLS A;  2R02 A;  4U9D A;  4C3D A;  5CIV A;  3E9V A;  2KK1 A;  2NSG A;  2LFD A;  3K1I A;  2XLE A;  4PAC A;  4YN0 B;  1M2V B;  1CPQ A;  1Q0K A;  4CX9 A;  1I5N A;  1AEP A;  2PBE A;  2G3V A;  1O87 A;  5L0G A;  4JIO A;  4NTB A;  2H7B A;  4IWB A;  1V54 C;  5TJ5 E;  4OIO F;  4IJJ A;  1OKK D;  4YL3 A;  1FR0 A;  4NTF A;  3ZSU A;  3Q7L A;  4U5H A;  2B0H A;  3A11 A;  2DGJ A;  2CDQ A;  3UGO A;  256B A;  4CSA A;  3PCV A;  2VCB A;  2HV7 A;  5EK0 A;  1VOM A;  1QLE C;  4BJ5 C;  4H54 A;  4LDR A;  2HSB A;  1WAT A;  3C63 A;  3DD7 A;  2ZD9 A;  3EH1 A;  3SEO A;  3Q6N A;  4WGZ A;  5DS4 A;  3DWW A;  4F4B A;  2R7W A;  3CQZ A;  3K66 A;  3NMJ A;  3ABL C;  3ZC4 A;  4CS8 C;  4JJF A;  4UDV A;  1ZW3 A;  2QUP A;  1RMV A;  3EGD A;  4AE4 A;  3LNR A;  2PX3 A;  3T6J A;  2MHR A;  2JD3 A;  1T6Q A;  3DJU B;  1K05 A;  2A69 F;  3C62 A;  3O39 A;  4RD9 A;  1U6H A;  2W9Y A;  3H2U A;  2NG1 A;  2DB4 A;  5E2Q A;  4YT2 A;  1D1A A;  4OIP F;  3U8V A;  1ZHW A;  2RD9 A;  1MMD A;  1Q0M A;  3T9O A;  4FES A;  5DS5 A;  4MS2 A;  4C3B A;  1MND A;  3JYY A;  1QPU A;  4JE9 A;  4U5G A;  4XEK A;  2OJE D;  3RVZ A;  3U9M A;  5L0D A;  1Z63 A;  4EUK B;  2J7P A;  4YL0 A;  1TWH A;  2GFH A;  1MMG A;  2EPK X;  2EIL C;  2VB6 A;  3O10 A;  2KYH A;  1APC A;  3F46 A;  1H7I A;  2Q9A A;  4GYT A;  2EIK C;  2YL7 A;  3NRH A;  3VYW A;  5KYU B;  4H4K C;  1LE4 A;  3DMD A;  3NMK A;  4O79 A;  4BEM J;  4YT5 A;  2AVK A;  1LPE A;  1KNY A;  2VCA A;  3I5P A;  5BUO A;  4XEF A;  2R25 A;  1M57 C;  3AG1 C;  3G4X A;  3HNL A;  4A2N B;  2LSE A;  1FAP B;  4E0I A;  1RJ9 A;  5KYU A;  4ZLC A;  3IPM O;  5FZT A;  3JZ0 A;  4CIH A;  5BQG A;  1EQ1 A;  4JRZ A;  3V7O A;  3POV A;  2Y69 C;  3VRC A;  2KNH A;  5KYX B;  1EKY A;  1VYI A;  3M1C B;  3KYI A;  3F47 A;  2AP3 A;  3KH2 A;  3MYF A;  4G78 A;  2J45 A;  2L6F A;  3BEH A;  3L8I A;  3B0U X;  2YLI A;  5JUA A;  4D4X A;  4BEJ A;  3B71 A;  1NSG B;  4RDA A;  2OEX A;  3FOO A;  1DOW A;  5KYW B;  2IXM A;  1TWG A;  2EIN C;  3JRT A;  1T6I A;  3ZTZ A;  1TWA A;  2I8B A;  4JTA B;  3ATP A;  4CS8 A;  4PJJ A;  1D1B A;  4I1O B;  2EIM C;  3S84 A;  1TFO B;  1JPJ A;  2Y3D A;  5KYW A;  5DLJ A;  2HV6 A;  3K7D A;  1E86 A;  2LK4 A;  2R7T A;  3C8G A;  5A6A A;  5CI9 A;  4YWQ A;  4YK5 A;  2LD6 A;  3SZR A;  1RCP A;  1SYQ A;  2L7A A;  2R05 A;  3NMI A;  4BJ6 A;  4FAP B;  3S28 A;  5A6B A;  3ZWI A;  3M4C A;  2WVO A;  3US6 A;  2P61 A;  2XL4 A;  4GQH A;  3GWN A;  2CNW D;  2KJG A;  3OWT A;  2R9R B;  2Y3G A;  3X2Q C;  5FCL A;  1D1C A;  1NU7 D;  4I44 A;  2BL2 A;  3IQ6 A;  4MTO A;  1OCO C;  4HE8 D;  4OIN F;  2L6G A;  4XPY A;  4BJT A;  1OCC C;  3RF3 A;  2OCC C;  3EG9 A;  3Q6M A;  4HFF B;  1VK5 A;  4CSA C;  4JJG A;  2WZL A;  3DM5 A;  1A7V A;  1OXK A;  1PD1 A;  5E3C A;  5L3V A;  3H2V A;  2L81 A;  4XPX A;  4HEA J;  5T3W A;  1U89 A;  3W8H A;  4Q7C A;  2LCH A;  2IOQ A;  3UMI A;  2L9J A;  2RSE B;  3W4Y A;  5T1D B;  3SXZ A;  1Y6D A;  2QY9 A;  1UFB A;  4CDY A;  4MVZ A;  2OQM A;  2J8W A;  1JMW A;  4Z9H A;  4U5C E;  3EGX B;  4ONS A;  1YJG A;  2G3K A;  2YKZ A;  2OOC A;  3QZC A;  3RKO F;  5HSW A;  4LAC B;  2EPM X;  3DJN B;  4KNW A;  4NQF A;  4ULV A;  3RYL A;  4IAR A;  3J06 A;  2J0X A;  5EHH A;  3PDM P;  1OW6 A;  2HS5 A;  4ER9 A;  2PP4 A;  3EGX A;  3FXH A;  4J32 B;  4EWC A;  3GEI A;  5B3I A;  4BPM A;  3U0C A;  3AGT A;  1C03 A;  2YZS A;  2MWQ A;  4JEA A;  1Z7Q c;  3RIP A;  1FNT c;  1L7C A;  3OEO A;  2IBF A;  1ZU5 A;  3KMI A;  3LLK A;  2R7V A;  2J9U A;  3GOD A;  4OIR F;  1HMD A;  1TFK B;  2KW3 C;  4YJW A;  4JTD B;  3S9O A;  3GWL A;  2GAQ A;  3IEE A;  3JT1 A;  3QVZ A;  4E18 A;  1LM3 B;  3K33 A;  3W8I A;  1H9T A;  4NY3 A;  1ZVZ A;  3ZVR A;  2DYS C;  1LI7 A;  3B9Q A;  2AWY A;  4K7B A;  1M6T A;  4MND A;  1NU9 C;  1M2V A;  1LE2 A;  3HLZ A;  3NG1 A;  3EPV A;  2XSE A;  4MW3 A;  1LI5 A;  3AG2 C;  2VC9 A;  3LJB A;  4NCQ A;  5AC5 A;  4C7O B;  5L3Q A;  2WZF A;  1TQG A;  1QVX A;  4JVS A;  4CS9 C;  3NYJ A;  2LIG A;  1VYK A;  1UG7 A;  3JYH A;  2E87 A;  5KYY B;  2YEV A;  2CCY A;  1K04 A;  1YDI A;  3EH2 A;  4BG0 A;  2J0W A;  3AG4 C;  3U3F A;  2CGE A;  4DRJ B;  1T6U A;  1MMA A;  2R7Q A;  3LLI A;  2IXP A;  2F22 A;  3EZI A;  3EZH A;  1BR4 A;  4DXW A;  1LKX A;  1WTY A;  2KQ9 A;  2PFD A;  1BDJ B;  3WAQ A;  3MFN A;  4N06 A;  3SXM A;  1YYJ A;  4C3E A;  1Q0D A;  2A1D D;  4JKV A;  1A0B A;  3MYI A;  1T5O A;  2P7V A;  3WHN A;  1S05 A;  4B6I A;  2QE9 A;  1G4W R;  1ZHY A;  1J8Y F;  1EA8 A;  1DOV A;  4WJ0 A;  5BQI A;  3KL4 A;  3GEE A;  4Q5S F;  5F28 E;  3DE9 A;  2HFI A;  5A6B D;  4BJ6 C;  5JRA A;  1CPR A;  5A69 A;  1JPN A;  1ORJ A;  1ZW2 A;  3Q7G A;  1ORY A;  4FWV A;  1MQV A;  2HKV A;  4JCH A;  3UNG C;  2BE5 F;  4AK9 A;  3U8P A;  4G7O F;  3QTH A;  4J7Y A;  4HFK B;  5JS5 A;  4QI2 A;  2DI3 A;  1TKN A;  3EFO B;  4XPW A;  2XLM A;  3M15 A;  2ETS A;  1ST6 A;  1SR2 A;  5HV9 A;  2CW0 F;  1NG1 A;  4DBQ A;  2R7S A;  1FFH A;  4KNV A;  1C17 M;  4O6M A;  4QDL A;  3LEO A;  2R7O A;  2I15 A;  3RQG A;  3RW0 A;  2OEV A;  4QI0 A;  1RKE B;  1KTM A;  4YT8 A;  4J7T A;  4U5D E;  3TUL A;  1D0X A;  1XZP A;  4CS9 A;  2YLD A;  3N0T A;  5E3A A;  2HJM A;  5F5F A;  3C18 A;  3L1M A;  3S27 A;  2Q9B A;  1CGN A;  4I1M A;  4U5F E;  2XM0 A;  1RKE A;  3AG3 C;  1PD0 A;  4XEV A;  4DRI B;  5L0I A;  3ABM C;  1YA9 A;  3TOM A;  2LQG A;  4KI2 A;  4J30 B;  3S29 A;  2IYL D;  5GPG B;  5L0H A;  1Z3I X;  2W45 A;  2YL1 A;  1V55 C;  1OR3 A;  3L0I A;  3LAY A;  3R2P A;  4I3M A;  2EPN A;  1NFN A;  2OKU A;  4YT4 A;  5KYX A;  3RQF A;  4OD5 A;  2BC5 A;  3FVY A;  2Q9C A;  2ZXR A;  4JCZ A;  4XLP F;  2ICW G;  2GWW A;  3ASO C;  2A68 F;  4WGY A;  5KYN A;  5DQT A;  3EJN A;  2QLA A;  3MLG A;  2M64 A;  4EBK A;  3KPH A;  2XLW A;  2C03 A;  3G4Z A;  4XTK A;  3LS1 A;  3MBG A;  3LS0 A;  1HMO A;  2PF4 E;  3FHD A;  2P0N A;  1FMW A;  4IGG A;  1G4U S;  5L0C A;  2HMQ A;  1WN0 A;  2NPU A;  3DE8 A;  3KYJ A;  1JOG A;  1NBB A;  1O3U A;  4DRH B;  4L6R A;  3RFY A;  4XLN F;  3I5Q A;  3IQT A;  3IHU A;  1U0B B;  4G0H A;  2FAP B;  4CJO A;  3X1O A;  3GM2 A;  4O7G A;  1OW8 A;  3VAY A;  4P9F A;  1K40 A;  2J9W A;  3I4U A;  1MMN A;  2KSF A;  4DOZ A;  4KC9 A;  1YVI A;  2VAS A;  3QMK A;  3RH3 A;  3DKA A;  1QSP A;  2Q4F A;  4CJG A;  4IAQ A;  1J8M F;  2UUI A;  2ZXO A;  4NC3 A;  2Y39 A;  5COG A;  5JVE A;  1S7Z A;  1V74 B;  2M4E A;  4PFO A;  4AL1 A;  3NYM A;  1GS9 A;  1XZQ A;  2HZ8 A;  2XLD A;  1JR8 A;  4MTG A;  3E70 C;  4PFP A;  2YVK A;  3CSK A;  3SYN A;  2WVN A;  4IB4 A;  3T6B A;  3HNK A;  4P6I C;  3UR3 C;  4EBB A;  1C02 A;  1YA7 O;  3BRJ A;  1E85 A;  2XLH A;  5COM A;  1AVO B;  1A7E A;  2UUH A;  3M79 A;  4YL1 A;  4CBE A;  1LIH A;  1WOL A;  4N6C A;  3U2L A;  3MX3 A;  3PMR A;  1HE9 A;  2MYS A;  4PJL A;  2OU6 A;  1YZA A;  3WG7 C; 
#chains in the Genus database with same CATH homology
 3NKE A;  2J7P D;  4O6Y A;  4OIQ F;  3N2Z B;  4JUR I;  2R7R A;  3K1H A;  3OA1 A;  3K6B A;  3H65 A;  4IAO A;  2YHS A;  5T3T A;  4BJ1 A;  3DM9 B;  2X51 A;  3N24 A;  1FTS A;  2FFH A;  3EQL F;  3L34 A;  4RBN A;  1TWC A;  4ULW A;  1D0Z A;  4AX2 A;  3EHN A;  3DAG A;  4C7O A;  1FFT C;  2W4B A;  2Y3B A;  5DVW A;  3GAN A;  2V26 A;  4DVZ A;  5KYY A;  4E7Z A;  3B0P A;  3S0X A;  4ZLD A;  3HTK C;  1KU2 A;  2CNW A;  1BR1 A;  5DQZ A;  2IXN A;  3PHF 2;  1PCX A;  4X0R A;  3JCU Q;  4XWJ A;  4MQ9 F;  3EGD B;  4PJN A;  4AE4 B;  3EHM A;  3TD7 A;  4OD4 A;  1ZHZ A;  3LES A;  3ITF A;  3O6X A;  1NZE A;  4FX5 A;  1W2W A;  2WVQ A;  3LEV A;  5IY5 C;  4DBR A;  4CS7 A;  4M63 A;  5B1A C;  5B1B C;  3SNH A;  3NKD A;  3W2V A;  1QZX A;  2J9V A;  3EFO A;  5E33 A;  2R7U A;  2KGO A;  3T4R A;  1MNE A;  1WGW A;  1Z5Z A;  2XXA B;  3B0V C;  4U5B E;  1SF8 A;  2QTV A;  4JW1 A;  3HJC A;  4DVY P;  4LER A;  5D92 A;  1RJ9 B;  2XXA A;  2ZPA A;  1O5H A;  2WL8 A;  1OCR C;  1LS1 A;  2NUT B;  4O6N A;  1BR2 A;  3NYL A;  1OKK A;  1OCZ C;  5D91 A;  1SZI A;  2W4M A;  1ZYR F;  2WB7 A;  3CZ6 A;  5DS6 A;  2NUP B;  2NUT A;  3DAF A;  3AQC A;  4PJM A;  2G62 A;  4LLE A;  4G7Z F;  1ZHT A;  3WOD F;  4BJ5 A;  4GEH A;  1FMV A;  1Z23 A;  2Q3T A;  2Y3H A;  2VH3 A;  1Z6A A;  2NUP A;  2A6H F;  3ABK C;  4Q4Z F;  3ZIB A;  1TR2 A;  1D0Y A;  1ZHX A;  3K1I C;  2H7O A;  2FGY A;  4K0D A;  4JZA A;  3FDQ A;  2IXO A;  2J46 A;  2Z15 A;  1ZU4 A;  3EG9 B;  4ANJ A;  2ZXP A;  2C04 A;  4LLC A;  2R7X A;  4U5E E;  4OIO F;  3ECS A;  3JSZ A;  3UMK A;  4C3D A;  5EGY A;  2DYR C;  3SP1 A;  1G8X A;  1LVK A;  3UGP A;  3DXJ F;  1IZM A;  1SMY F;  3ZG1 A;  2WZG A;  3AQB A;  3DZA A;  4G7H F;  2OG2 A;  1M2O A;  3W2W A;  2D5R B;  2A6E F;  2H7V C;  2B0J A;  3NDB B;  1N1C A;  3KKB A;  1IW7 F;  2XRH A;  2EIJ C;  5F5H A;  2V3C C;  3ASN C;  1M56 C;  4W8K A;  4KBL A;  3UMH A;  5CI8 A;  4PK4 A;  4IRU A;  2P6V A;  2O9X A;  2ZXW C;  1VMA A;  2PX0 A;  3FAJ A;  3E9V A;  4YN0 B;  1M2V B;  2G3V A;  1O87 A;  2H7B A;  4IWB A;  1V54 C;  4IJJ A;  1OKK D;  3ZSU A;  3Q7L A;  4U5H A;  2DGJ A;  2CDQ A;  3UGO A;  4CSA A;  2HV7 A;  1VOM A;  1QLE C;  4BJ5 C;  5DS4 A;  3DD7 A;  3EH1 A;  3SEO A;  3Q6N A;  2R7W A;  4F4B A;  3CQZ A;  3K66 A;  3ABL C;  3ZC4 A;  4CS8 C;  4JJF A;  3EGD A;  4AE4 A;  3LNR A;  2PX3 A;  3T6J A;  2JD3 A;  3DJU B;  2A69 F;  3O39 A;  4RD9 A;  2W9Y A;  2NG1 A;  5E2Q A;  4YT2 A;  1D1A A;  4OIP F;  1ZHW A;  1MMD A;  5DS5 A;  4FES A;  4C3B A;  1MND A;  4U5G A;  1Z63 A;  2J7P A;  1TWH A;  2GFH A;  1MMG A;  2EIL C;  2VB6 A;  3F46 A;  2Q9A A;  4GYT A;  2EIK C;  3NRH A;  3VYW A;  5KYU B;  4H4K C;  3DMD A;  4O79 A;  4YT5 A;  3I5P A;  5BUO A;  1M57 C;  3AG1 C;  4A2N B;  2LSE A;  1RJ9 A;  5KYU A;  4ZLC A;  4CIH A;  3POV A;  3V7O A;  2Y69 C;  5KYX B;  2KNH A;  1VYI A;  3M1C B;  3F47 A;  3KH2 A;  3B0U X;  2J45 A;  4BEJ A;  4RDA A;  5KYW B;  2IXM A;  1TWG A;  2EIN C;  3JRT A;  1TWA A;  2I8B A;  4CS8 A;  4PJJ A;  1D1B A;  4I1O B;  2EIM C;  1JPJ A;  2Y3D A;  5KYW A;  5DLJ A;  2HV6 A;  3K7D A;  2R7T A;  5CI9 A;  4YWQ A;  3SZR A;  4BJ6 A;  3S28 A;  2WVO A;  2XL4 A;  2CNW D;  2KJG A;  3OWT A;  3X2Q C;  2Y3G A;  5FCL A;  1D1C A;  1NU7 D;  4I44 A;  1OCO C;  4HE8 D;  4OIN F;  4BJT A;  1OCC C;  2OCC C;  3EG9 A;  3Q6M A;  4HFF B;  1VK5 A;  4CSA C;  4JJG A;  2WZL A;  3DM5 A;  5E3C A;  1PD1 A;  5L3V A;  2L81 A;  3W8H A;  4HEA J;  5T3W A;  4Q7C A;  2IOQ A;  3UMI A;  2L9J A;  5T1D B;  2QY9 A;  4U5C E;  3EGX B;  2G3K A;  3RKO F;  5HSW A;  3QZC A;  4LAC B;  3DJN B;  4KNW A;  3RYL A;  2J0X A;  5EHH A;  2PP4 A;  3EGX A;  4J32 B;  4EWC A;  2YZS A;  3RIP A;  2MWQ A;  3OEO A;  1ZU5 A;  3KMI A;  3LLK A;  2R7V A;  2J9U A;  3GOD A;  4OIR F;  2KW3 C;  4YJW A;  3JT1 A;  3IEE A;  3K33 A;  3W8I A;  4NY3 A;  3ZVR A;  2DYS C;  3B9Q A;  4K7B A;  4MND A;  1NU9 C;  1M2V A;  3HLZ A;  3NG1 A;  4E7S A;  3EPV A;  2XSE A;  5B3S C;  4C7O B;  3AG2 C;  3LJB A;  4Q5S F;  5L3Q A;  2WZF A;  4JVS A;  4CS9 C;  3NYJ A;  1VYK A;  3JYH A;  2E87 A;  5KYY B;  2YEV A;  3EH2 A;  4BG0 A;  2J0W A;  3AG4 C;  2CGE A;  1MMA A;  2R7Q A;  3LLI A;  2IXP A;  3EZI A;  3EZH A;  1BR4 A;  1LKX A;  2KQ9 A;  2PFD A;  4N06 A;  4C3E A;  2A1D D;  2P7V A;  4B6I A;  1ZHY A;  1J8Y F;  4WJ0 A;  3KL4 A;  4BJ6 C;  1JPN A;  3Q7G A;  4FWV A;  3UNG C;  4JCH A;  4AK9 A;  2BE5 F;  4G7O F;  4HFK B;  4QI2 A;  1TKN A;  3EFO B;  1ST6 A;  2CW0 F;  1NG1 A;  4DBQ A;  2R7S A;  1FFH A;  4KNV A;  4O6M A;  4QDL A;  2R7O A;  4QI0 A;  4YT8 A;  4U5D E;  1D0X A;  4CS9 A;  3N0T A;  5E3A A;  5F5F A;  3S27 A;  2Q9B A;  4U5F E;  4I1M A;  3AG3 C;  1PD0 A;  3ABM C;  4KI2 A;  4J30 B;  3S29 A;  2IYL D;  1Z3I X;  2W45 A;  4I3M A;  1V55 C;  3LAY A;  3L0I A;  5KYX A;  4YT4 A;  4OD5 A;  3FVY A;  2Q9C A;  2ZXR A;  4XLP F;  3ASO C;  2A68 F;  5KYN A;  5DQT A;  3EJN A;  3MLG A;  2C03 A;  4XTK A;  3LS1 A;  3LS0 A;  2PF4 E;  3FHD A;  1FMW A;  3RFY A;  4XLN F;  3I5Q A;  4G0H A;  3X1O A;  4O7G A;  3VAY A;  2J9W A;  3I4U A;  1MMN A;  4DOZ A;  4KC9 A;  2VAS A;  3QMK A;  3RH3 A;  1J8M F;  2ZXO A;  2Y39 A;  1S7Z A;  2M4E A;  4PFO A;  3NYM A;  4PFP A;  3E70 C;  3CSK A;  3SYN A;  2WVN A;  3T6B A;  4P6I C;  3UR3 C;  4EBB A;  4CBE A;  3MX3 A;  3PMR A;  2MYS A;  4PJL A;  3WG7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...