3LJBA

Structural basis of oligomerisation in the mxa stalk
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
268
structure length
219
Chain Sequence
EDENEKMFFLIDKVNAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIENNFQEGHKILSRKIQKFENFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYSMEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interferon-induced GTP-binding protein Mx1
publication title Structural basis of oligomerization in the stalk region of dynamin-like MxA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antiviral protein
total genus 96
structure length 219
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1240 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ljbA00
4BEJA 3SZRA 3ZVRA 3SNHA 3LJBA 4X0RA
chains in the Genus database with same CATH superfamily
4WABA 4YL1A 4U5DE 3HKKA 1YA7O 2IXOA 2Q00A 3KYJA 1VTMP 4ULVA 1H7IA 3MYFA 3QVYA 2A6HF 3OWTA 4L6RA 3N0TA 1VB5A 5DVWA 1H9GA 3IQ6A 1WWPA 2PP4A 1OKKA 1ZHXA 2R7VA 3V5YA 3LESA 2XL8A 4AE4A 2IOQA 5BUOA 3US6A 2BC5A 3H2VA 2NPUA 3DKAA 1FTSA 2YL3A 3FAJA 2LCHA 4PK4A 3EZHA 1SMYF 1UG7A 1HE1A 2XLWA 5EHHA 2GAQA 5CI8A 2OG2A 1E83A 1PD0A 4U5FE 1Q0MA 1N1CA 4A2NB 4N4WA 3NYMA 3QVZA 4MTFA 2LSEA 1B68A 2J8WA 4XEKA 3ITFA 1TWAA 3TK0A 1BZ4A 2CNWA 2G62A 2Q9AA 4YL0A 3NKDA 5E3CA 2KNHA 4XLNF 3RIPA 3MYIA 4JRZA 3S84A 1FAPB 1NG1A 1S7ZA 3I5PA 4K7BA 3NKEA 3O10A 3EHNA 2GDCA 1L7CA 2NUTB 1M2OA 4JE9A 4EIYA 1V74B 3BEHA 2XLMA 1TFKB 1LI5A 4Z9IA 4Q4ZF 4DVZA 2WVQA 4NY3A 4XPWA 2NUPB 3G4XA 3K33A 2GWWA 1I4YA 1J8MF 1LVKA 1GM5A 3RQEA 4K1OA 2KYHA 2YHSA 1VYIA 2WL8A 3S27A 1BR2A 1QZXA 5JVEA 3S0XA 4MVOA 1D0XA 3JYHA 1BBHA 1AUEA 1O3UA 2CCYA 3CAXA 3UMHA 1FFTC 1CGNA 3M4CA 4G7HF 1CPQA 1K04A 2Y3DA 1W2WA 5DS5A 4YT4A 2OEVA 4N6CA 2P7VA 3LLKA 4MNDA 4MTGA 1JR8A 1U89A 4DOZA 1WGWA 1DOWA 1Q0GA 3TOMA 256BA 1ORJA 2XSEA 2OOCA 3ZDLA 1MMAA 3S90A 3B0UX 2WZFA 2ZXRA 3EGXA 4LLEA 1RMVA 3B71A 5JLIA 2WZGA 2H7OA 3EHMA 4PJLA 3T9OA 3U8PA 3DJUB 3VAYA 2LFFA 4NTBA 3RF3A 3ZWIA 4AL0A 4MVRA 5F5FA 1RXQA 1T6QA 2HJ3A 3G50A 3LS1A 1AEPA 3T6GB 2P6VA 1NZEA 4JTDB 4OIRF 4BEJA 2PFDA 3SXMA 3NYJA 3M15A 4QDLA 1H9TA 4G7OF 3MFNA 1JPNA 4YN0B 1ZVZA 2A69F 3ZQVA 2FFHA 3U0CA 2TMVP 2JPUA 5AC4A 1WTYA 4OIOF 3TJ5A 4AK9A 3QTHA 4N06A 1LM3B 3JRTA 1D1CA 2XM4A 3K7DA 4H4KC 4DRIB 1RJ9A 5JUAA 3K1HA 3LS0A 4PJMA 3TOLA 1TWGA 1Z6AA 2YRFA 3VF0A 4LERA 1F1MA 1YLMA 2IXMA 4JURI 1PCXA 3NYLA 1SR2A 4MW8A 2KGOA 1Y6DA 2LFDA 3KYIA 2XLDA 4MVZA 2R7QA 3IPMO 4CDYA 3ASOC 1KTMA 3Q6MA 2A68F 1Q0DA 3GWNA 4CIPA 4O6MA 4IWBA 3RQGA 4CS9C 4EUKB 3PMRA 4H54A 4YT8A 4I1MA 2HFIA 3JCUQ 3K66A 2J46A 3BRJA 3I5QA 1LI7A 2R25A 3EFOB 1JOGA 3CQZA 4O6YA 3DZAA 4PJNA 2NUTA 4C3DA 1O5HA 5KYYA 2ZPAA 3TQOA 1RKEB 1HW2A 3SEOA 2NUPA 3SXZA 4HE8D 3DI5A 5JT4A 4GEHA 3JTLO 4JJGA 4YWQA 4ZLCA 2J7PD 4FESA 1VK5A 3GM2A 4G78A 4KI2A 2YKZA 3C62A 4OINF 2EILC 3S29A 5D91A 3QW1A 2AP3A 2Y69C 2VCBA 4U5CE 2EIMC 1ZHZA 3B29A 4GYTA 2L6FA 2P61A 4LDRA 3H65A 4ONSA 4I3MA 1C17M 3AG4C 3G4ZA 2G3KA 4YL3A 3B0VC 1T9KA 4DRHB 1EQ1A 2VC9A 2B0JA 5DS4A 4EWCA 2FGYA 1U0BB 3AGUA 3ABMC 2XLVA 3K6BA 5K0IA 4ER9A 1NFNA 2B0HA 3HNLA 4P9FA 3DE8A 3LNMB 2ETSA 1MQVA 5IY5C 3UMKA 2H8AA 1JAFA 3C8GB 3NDBB 4G0HA 4FAPB 1LS1A 4FX5A 2Y3HA 1NBBA 5F5HA 2HMZA 4EBJA 3L0IA 4MVSA 4BJ5A 1Z63A 2XL6A 3DJNB 3SZRA 3GWLA 1OCZC 3HNKA 5KYUA 3ECSA 5L0DA 2EPMX 2D5RB 3AG3C 4JZAA 1QLEC 3C8GD 3FHDA 4JW1A 4O7GA 3IQCA 2XLHA 3JYYA 2L6GA 1TWCA 2NG1A 2ASRA 2KSFA 3LLIA 3W8IA 4CJGA 2G3VA 1Z5ZA 2IYLD 2YLDA 5DQTA 1MMDA 2W45A 3OEOA 2LQGA 4BPMA 5A6BA 2V3CC 2YL0A 3L34A 3VRCA 4LLCA 2KQ9A 1K05A 1MMNA 5T3TA 3ZSUA 3NMJA 2LIGA 4RBNA 1ZHWA 4CBEA 2KJGA 1LPEA 5L0HA 4RD9A 3EGDB 5COMA 2XXAB 4DBRA 3R2PA 4HEAJ 4C3EA 1TKNA 2OJQA 4O6NA 4P6IC 4OIQF 1WN0A 4EBKA 1G8XA 1JPJA 4JEBA 1G5ZA 2VCAA 1Z7Qc 5B1BC 1C02A 3TJ6A 2IBFA 4PJJA 4C7OB 1R4TA 3JSZA 2L7AA 4M63A 1A7VA 4RDAA 2XLEA 3JSEO 3NMKA 3LUTB 3SP1A 4JEAA 5COFA 5KYWA 1WATA 2YWAA 3U3FA 2J7PA 4CIHA 1ST6A 2ICWG 2WZLA 4WGZA 4CSAA 4CS8A 4OD4A 2HV7A 3L8JA 1D0YA 1RKEA 2A6EF 2UUHA 2R7TA 1ZHYA 3FVYA 4MVUA 3W8HA 4F4BA 2AU5A 4J7TA 2YQYA 4NCQA 3FDQA 3C18A 3NG1A 2R7SA 3U8VA 2PNOA 3B0PA 3UGOA 3HNJA 5BQGA 1YAUO 2HKVA 1ORYA 1SYQA 1XZQA 2D4UA 2YEVA 2PX0A 2Q7RA 3X2QC 4G7ZF 1YZAA 3QZCA 5L0CA 2VASA 4NTAA 5T1DB 5JRAA 1FR0A 1ZZPA 3VM6A 1YYXA 2M4EA 4DVYP 4XWJA 1M56C 2CDQA 3KL4A 4PFOA 1LS4A 1OR3A 1H6GA 1S05A 3CSKA 5E33A 1ZHTA 3S28A 4E7SA 3FOOA 5EK0A 1HW1A 4MVQA 3X1OA 3T6BA 2F22A 3PHF2 3PDMP 1UFBA 1V55C 2W4MA 5JSLA 2X51A 1YZCA 4YJWA 3H2UA 1MNDA 3J06A 3DAFA 3ABLC 1FNTc 4JVSA 1T6IA 2ZXPA 4JIOA 1KNYA 3C8ZA 3C8GA 4JCZA 4N6HA 4MTOA 5FZTA 1ZU5A 5AC5A 3M79A 3DM5A 2OEXA 1CPRA 4BJ6A 2ZXOA 1TQGA 5L0IA 5GPGB 2CGEA 2XS8A 1SF8A 4U5GA 5T3WA 3K1IA 2R7UA 4KNWA 4QI0A 4MW3A 1E2XA 4Z9HA 1HMOA 4JTCB 3GODA 4NQFA 2H7VC 2DYRC 3ASNC 3UR3C 3N24A 4J30B 4BG0A 4CDVA 4PFPA 1G4US 3V7OA 2XLOA 3E9VA 4W8KA 1VLTA 2XRHA 5HV9A 2KC3A 3FMSA 4KBLA 4MQ9F 2OKUA 2WB7A 3SNHA 4ULWA 3KMIA 2OJED 4C3BA 2XXAA 4BJTA 4JCHA 1WASA 3U3BA 5B1AC 4CJOA 3AQCA 1VYKA 3FXHA 3KKBA 1OR2A 2IXNA 4KC9A 3L8IA 3KPHA 4E18A 1OW6A 4FWVA 3AGTA 2A0UA 2AWYA 5EGYA 4C7OA 2VH3A 1YJGA 5CIVA 4J7YA 1YA9A 2YLIA 4O79A 1HE9A 1ORSC 4E17A 4ZLDA 1NFOA 2A0BA 3W2VA 3FOPA 1FFHA 4K0DA 2YL1A 3DM9B 1M2VB 2J9WA 2X0CA 2J9UA 3T6JA 5A6JA 5HSWA 2Y3BA 4ANJA 5L3QA 4GQHA 4LDKA 1Z3IX 2W9YA 3EG9B 3M4BA 3S9OA 1U6HA 3JZ0A 3SXKA 3ZIBA 1G4WR 1PD1A 1RKCA 1LIHA 1LE2A 3CZ6A 2XL4A 2QE9A 3WAQA 5DLJA 4UDVA 5AGFA 3L1MA 3VYWA 3EH1A 4D4XA 4QI2A 3ZTMA 2Q3TA 3HJCA 1CGOA 1ZYRF 2CW0F 2OCCC 4XPXA 3WHNA 1YYJA 3LEOA 3IHUA 4P9TA 4R32A 2EPNA 1RCPA 4JC7A 5BQHA 1WOLA 2EPOA 2HZ8A 2DI3A 1OXKA 3DWWA 3T4RA 4IJJA 3AQBA 4Q5SF 5JP7A 4B6IA 1C03A 2R7RA 5A6AA 5TJ5E 1I5NA 3RW0A 1A0BA 1OW7A 3UGPA 3FAPB 1OCRC 4JTAB 4Z9JA 5KYNA 1GGQA 3PCVA 3CEXA 2OQMA 2IM8A 1HY5A 2PX3A 2V26A 4DRJB 1OQCA 3AG2C 5CI9A 1RJ9B 3LNRA 2LK4A 1T6UA 4IGGA 2J9VA 4BEMJ 1O87A 1A41A 2J45A 2P1AA 3RKOF 3ZVRA 5A6KA 3POVA 1NU7D 4XEFA 2I8BA 2Q9BA 1ZW2A 2XS1A 4BJ1A 2Y3GA 2QLAA 1MMGA 3O6XA 1D0ZA 1QKRA 1GQAA 2M64A 4JKVA 4NTFA 4X0RA 2FAPB 4AL1A 3OA1A 1ZW3A 3EQLF 2HUJA 4IAOA 2WVNA 3I4UA 4U5EE 3U9JA 3ZTZA 5L0GA 5L0FA 1BR4A 4JJFA 1BR1A 2MYSA 1M6TA 1QPUA 2EIKC 5E3AA 5JS5A 2J0XA 3EFOA 4PACA 2NSGA 5L0JA 1D1BA 2HV6A 4A4AA 3A9CA 3DXJF 3RFYA 3KH2A 1ZU4A 3Q6NA 5KYYB 2VB6A 2QUPA 2MWQA 1QQ3A 2PBEA 2YLGA 4AX2A 5F28E 2HSBA 5BQIA 3B9QA 2BL2A 5FCLA 4YT5A 4U5HA 3A11A 1E84A 2CYDA 2I15A 1IZMA 2DYSC 3GEHA 2C04A 2DB4A 4BJ5C 3RH3A 2KK1A 2MHRA 5KYXB 3GEIA 4MVMA 3F47A 3R7CA 3F46A 3LAYA 3UNGC 4CS9A 3DMDA 1M2VA 4DJ9A 2EPLX 4EBBA 2PF4E 2HJMA 2XM0A 1KU2A 1QSPA 1QVXA 2HMQA 2R02A 4U5BE 3ZQYA 1T01A 2Y39A 3MLGA 4IAQA 3GANA 2Z15A 1BDJB 3EG9A 4PR9A 4LDQA 1V54C 4NC3A 4HFFB 3LEVA 1T5OA 4I1OB 2L9JA 3ZG1A 1LKXA 3RQFA 1EI7A 4XTKA 1A7DA 1J8YF 3EH2A 1I4ZA 5DS6A 5COGA 3WG7C 2R7OA 2R05A 3IEEA 2EINC 4U9EA 1IW7F 4YK5A 3C63A 3AG1C 3IQTA 1HMDA 2YL7A 3JT1A 1NSGB 4MS2A 4AE4B 4KNVA 2GFHA 2J9BA 3EPVA 4EHPA 2UUIA 5A69A 2LP4A 2JX0A 4IB4A 4WGYA 3WODF 5KYUB 2J0WA 3NRHA 1AVOB 1SZIA 1NU9C 4E7ZA 1XZPA 1TR2A 2RSEB 2VCCA 3U9MA 1TFOB 1OKKD 3V5XA 3GEEA 1XWJA 4E0IA 1Q0FA 3ZC4A 1GS9A 4W8PA 3EJNA 3AOUA 2JD3A 2IXPA 5E2QA 4CS8C 5B3SC 3TULA 4CSAC 4CDAA 4XEVA 1OCOC 2E87A 5D92A 3HNIA 2R7WA 2BE5F 3EGDA 3HLZA 3QMKA 3W2WA 2Q9CA 3V5ZA 4DXWA 1LE4A 2EPKX 2QNLA 4Q7CA 2ZXWC 3U5SA 3JRMO 2WVOA 4E0HA 1APCA 2L6HA 1EA8A 2CNWD 3GM3A 4J32B 2DGJA 2QTVA 1FMWA 3DAGA 4LACB 2EIJC 1VMAA 4HFKB 1JRAA 1V4AA 5A6BD 4OIPF 3LJBA 1CGME 3W4YA 2R7XA 1EKYA 2A1DD 4U9DA 4D4NA 1E85A 3U2LA 2R03A 3HTKC 1E86A 2L81A 3DD7A 1M57C 2HSQA 1OXBA 1R5ID 2O9XA 3M1CB 5KYWB 2LD6A 2HS5A 2YZSA 1D1AA 2ZD9A 3ABKC 3U2MA 4YT2A 2W4BA 3RYLA 3SXYA 1VOMA 1YVIA 3RVYA 3O39A 3TD7A 3Q7GA 1MNEA 5L3VA 5DQZA 4DBQA 1OCCC 3UMIA 3O55A 3IQ5A 3DE9A 3SYNA 2R9RB 3N2ZB 1DOVA 1TWHA 3GORA 1PV3A 3EZIA 3GM1A 4CX9A 1VLSA 1YDIA 3MBGA 2RD9A 3MX3A 4XPYA 3EGXB 2OU6A 4CS7A 3AJMA 4EKWA 4XLPF 4BJ6C 2YVKA 5KYXA 1OW8A 2KW3C 1Y4CA 2C03A 3QW0A 4XQ1A 4I44A 2QY9A 1JMWA 3NMIA 4IRUA 3RVZA 5B3IA 2P0NA 4WJ0A 1Z23A 3C7JA 4IARA 2NSFA 1K40A 3ATPA 2AWCA 3K1IC 2H7BA 2GA0A 1FMVA 3Q7LA 1L3PA 1NLXA 2AVKA 2Q4FA 4OD5A 3E70C 1Q0KA 1YARO 1A7EA
chains in the Genus database with same CATH topology
4U5DE 2IXOA 2A6HF 3OWTA 3N0TA 5DVWA 2PP4A 1OKKA 1ZHXA 2R7VA 3LESA 4AE4A 5BUOA 2IOQA 1FTSA 3FAJA 4PK4A 3EZHA 1SMYF 5EHHA 5CI8A 2OG2A 1PD0A 4U5FE 1N1CA 4A2NB 3NYMA 2LSEA 3ITFA 1TWAA 2G62A 2CNWA 2Q9AA 5E3CA 3NKDA 2KNHA 4XLNF 3RIPA 3I5PA 1NG1A 1S7ZA 4K7BA 3NKEA 3EHNA 2NUTB 1M2OA 4Q4ZF 4DVZA 2WVQA 4NY3A 2NUPB 3K33A 1J8MF 1LVKA 3S27A 3S0XA 2YHSA 1VYIA 2WL8A 1BR2A 1QZXA 1D0XA 3JYHA 3UMHA 1FFTC 4G7HF 2Y3DA 1W2WA 5DS5A 4YT4A 2P7VA 3LLKA 4MNDA 4DOZA 1WGWA 2XSEA 1MMAA 3B0UX 2WZFA 2ZXRA 3EGXA 4LLEA 2WZGA 2H7OA 3EHMA 4PJLA 3VAYA 4CS7A 3DJUB 5F5FA 3LS1A 2P6VA 1NZEA 4OIRF 4BEJA 2PFDA 3NYJA 4QDLA 4G7OF 1JPNA 4YN0B 2A69F 2FFHA 4OIOF 4AK9A 4N06A 3JRTA 1D1CA 4H4KC 3K7DA 1RJ9A 3K1HA 3LS0A 4PJMA 1TWGA 1Z6AA 4LERA 2IXMA 4JURI 1PCXA 3NYLA 2KGOA 2R7QA 3ASOC 3Q6MA 2A68F 4O6MA 4IWBA 4CS9C 3PMRA 4YT8A 4I1MA 3JCUQ 3K66A 2J46A 3I5QA 3EFOB 3CQZA 4O6YA 3DZAA 4PJNA 2NUTA 4C3DA 1O5HA 5KYYA 2ZPAA 3SEOA 2NUPA 4HE8D 4GEHA 4JJGA 4YWQA 4ZLCA 2J7PD 4FESA 1VK5A 4KI2A 4OINF 3S29A 2EILC 5D91A 2Y69C 4U5CE 2EIMC 1ZHZA 4GYTA 3H65A 4I3MA 3AG4C 2G3KA 2B0JA 5DS4A 4EWCA 2FGYA 3ABMC 3K6BA 5IY5C 3UMKA 3NDBB 4G0HA 1LS1A 4FX5A 2Y3HA 5F5HA 3L0IA 4BJ5A 1Z63A 3DJNB 3SZRA 1OCZC 5KYUA 3ECSA 2D5RB 3AG3C 4JZAA 1QLEC 3FHDA 4JW1A 4O7GA 3LLIA 3W8IA 1TWCA 2NG1A 2G3VA 1Z5ZA 2IYLD 5DQTA 1MMDA 2W45A 3OEOA 2V3CC 3L34A 4LLCA 2KQ9A 1MMNA 5T3TA 3ZSUA 4RBNA 1ZHWA 4CBEA 2KJGA 4RD9A 3EGDB 2XXAB 4DBRA 4C3EA 4HEAJ 1TKNA 4O6NA 4P6IC 4OIQF 1G8XA 1JPJA 5B1BC 4C7OB 4PJJA 3JSZA 4M63A 4RDAA 3SP1A 5KYWA 4CIHA 2J7PA 1ST6A 2WZLA 4CSAA 4CS8A 4OD4A 2HV7A 1D0YA 2A6EF 2R7TA 1ZHYA 3FVYA 3W8HA 4F4BA 3FDQA 3NG1A 2R7SA 3B0PA 3UGOA 2YEVA 3X2QC 4G7ZF 2PX0A 3QZCA 2VASA 5T1DB 2M4EA 4DVYP 4XWJA 1M56C 2CDQA 3KL4A 4PFOA 5E33A 3S28A 3CSKA 1ZHTA 4E7SA 3PHF2 3X1OA 3T6BA 1V55C 2W4MA 2X51A 4YJWA 1MNDA 3DAFA 3ABLC 4JVSA 2ZXPA 1ZU5A 3DM5A 4BJ6A 2ZXOA 2CGEA 4U5GA 1SF8A 5T3WA 2R7UA 4KNWA 4QI0A 3UR3C 3GODA 2H7VC 2DYRC 3ASNC 3N24A 4J30B 4BG0A 4PFPA 3V7OA 3E9VA 4W8KA 2XRHA 4KBLA 4MQ9F 2WB7A 3SNHA 4ULWA 3KMIA 4C3BA 2XXAA 4BJTA 4JCHA 5B1AC 3AQCA 1VYKA 3KKBA 4KC9A 2IXNA 4FWVA 5EGYA 4C7OA 2VH3A 4O79A 4ZLDA 3W2VA 1FFHA 4K0DA 3DM9B 1M2VB 2J9WA 2J9UA 3T6JA 5HSWA 2Y3BA 4ANJA 5L3QA 1Z3IX 2W9YA 3EG9B 3ZIBA 3B0VC 1PD1A 3CZ6A 2XL4A 5DLJA 4QI2A 3VYWA 3EH1A 2Q3TA 3HJCA 2CW0F 1ZYRF 2OCCC 3T4RA 4IJJA 3AQBA 4Q5SF 4B6IA 2R7RA 3UGPA 1OCRC 5KYNA 2PX3A 2V26A 3AG2C 5CI9A 1RJ9B 3LNRA 2J9VA 1O87A 3RKOF 2J45A 3ZVRA 3POVA 1NU7D 2I8BA 2Q9BA 4BJ1A 2Y3GA 1MMGA 3O6XA 1D0ZA 4X0RA 3OA1A 3EQLF 4IAOA 2WVNA 3I4UA 4U5EE 1BR4A 4JJFA 1BR1A 2MYSA 2EIKC 5E3AA 2J0XA 3EFOA 1D1BA 2HV6A 3DXJF 3RFYA 3KH2A 1ZU4A 3Q6NA 5KYYB 2VB6A 4AX2A 2MWQA 3B9QA 5FCLA 4YT5A 4U5HA 1IZMA 2DYSC 2C04A 4BJ5C 3RH3A 5KYXB 3F47A 3UNGC 3F46A 3LAYA 4CS9A 3DMDA 1M2VA 4EBBA 2PF4E 1KU2A 4U5BE 2Y39A 3MLGA 3GANA 2Z15A 3EG9A 1V54C 4HFFB 3LEVA 4I1OB 2L9JA 3ZG1A 1LKXA 4XTKA 1J8YF 3EH2A 5DS6A 3WG7C 2R7OA 3IEEA 2EINC 1IW7F 3AG1C 3JT1A 4AE4B 4KNVA 2GFHA 3EPVA 3WODF 5KYUB 2J0WA 3NRHA 1SZIA 1NU9C 4E7ZA 1TR2A 1OKKD 3ZC4A 3EJNA 4CSAC 2JD3A 2IXPA 5E2QA 4CS8C 5B3SC 1OCOC 2E87A 5D92A 2R7WA 2BE5F 3EGDA 3HLZA 3QMKA 3W2WA 2Q9CA 4Q7CA 2ZXWC 2WVOA 4J32B 2CNWD 2DGJA 2QTVA 1FMWA 3DAGA 4LACB 2EIJC 1VMAA 4HFKB 4OIPF 3LJBA 2R7XA 2A1DD 3HTKC 2L81A 3DD7A 1M57C 2O9XA 5KYWB 3M1CB 2YZSA 1D1AA 3ABKC 4YT2A 2W4BA 3RYLA 3TD7A 1VOMA 3O39A 3Q7GA 1MNEA 5L3VA 5DQZA 4DBQA 1OCCC 3UMIA 3SYNA 3N2ZB 1TWHA 3EZIA 3MX3A 3EGXB 4XLPF 4BJ6C 5KYXA 2KW3C 2C03A 4I44A 2QY9A 4IRUA 4WJ0A 1Z23A 3Q7LA 3K1IC 2H7BA 1FMVA 4OD5A 3E70C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BEJ A;  3SZR A;  3ZVR A;  3SNH A;  3LJB A;  4X0R A; 
#chains in the Genus database with same CATH topology
 4WAB A;  4YL1 A;  4U5D E;  3HKK A;  1YA7 O;  2IXO A;  2Q00 A;  3KYJ A;  1VTM P;  4ULV A;  1H7I A;  3MYF A;  3QVY A;  2A6H F;  3OWT A;  4L6R A;  3N0T A;  1VB5 A;  5DVW A;  1H9G A;  3IQ6 A;  1WWP A;  2PP4 A;  1OKK A;  1ZHX A;  2R7V A;  3V5Y A;  3LES A;  2XL8 A;  4AE4 A;  2IOQ A;  5BUO A;  3US6 A;  2BC5 A;  3H2V A;  2NPU A;  3DKA A;  1FTS A;  2YL3 A;  3FAJ A;  2LCH A;  4PK4 A;  3EZH A;  1SMY F;  1UG7 A;  1HE1 A;  2XLW A;  5EHH A;  2GAQ A;  5CI8 A;  2OG2 A;  1E83 A;  1PD0 A;  4U5F E;  1Q0M A;  1N1C A;  4A2N B;  4N4W A;  3NYM A;  3QVZ A;  4MTF A;  2LSE A;  1B68 A;  2J8W A;  4XEK A;  3ITF A;  1TWA A;  3TK0 A;  1BZ4 A;  2CNW A;  2G62 A;  2Q9A A;  4YL0 A;  3NKD A;  5E3C A;  2KNH A;  4XLN F;  3RIP A;  3MYI A;  4JRZ A;  3S84 A;  1FAP B;  1NG1 A;  1S7Z A;  3I5P A;  4K7B A;  3NKE A;  3O10 A;  3EHN A;  2GDC A;  1L7C A;  2NUT B;  1M2O A;  4JE9 A;  4EIY A;  1V74 B;  3BEH A;  2XLM A;  1TFK B;  1LI5 A;  4Z9I A;  4Q4Z F;  4DVZ A;  2WVQ A;  4NY3 A;  4XPW A;  2NUP B;  3G4X A;  3K33 A;  2GWW A;  1I4Y A;  1J8M F;  1LVK A;  1GM5 A;  3RQE A;  4K1O A;  2KYH A;  2YHS A;  1VYI A;  2WL8 A;  3S27 A;  1BR2 A;  1QZX A;  5JVE A;  3S0X A;  4MVO A;  1D0X A;  3JYH A;  1BBH A;  1AUE A;  1O3U A;  2CCY A;  3CAX A;  3UMH A;  1FFT C;  1CGN A;  3M4C A;  4G7H F;  1CPQ A;  1K04 A;  2Y3D A;  1W2W A;  5DS5 A;  4YT4 A;  2OEV A;  4N6C A;  2P7V A;  3LLK A;  4MND A;  4MTG A;  1JR8 A;  1U89 A;  4DOZ A;  1WGW A;  1DOW A;  1Q0G A;  3TOM A;  256B A;  1ORJ A;  2XSE A;  2OOC A;  3ZDL A;  1MMA A;  3S90 A;  3B0U X;  2WZF A;  2ZXR A;  3EGX A;  4LLE A;  1RMV A;  3B71 A;  5JLI A;  2WZG A;  2H7O A;  3EHM A;  4PJL A;  3T9O A;  3U8P A;  3DJU B;  3VAY A;  2LFF A;  4NTB A;  3RF3 A;  3ZWI A;  4AL0 A;  4MVR A;  5F5F A;  1RXQ A;  1T6Q A;  2HJ3 A;  3G50 A;  3LS1 A;  1AEP A;  3T6G B;  2P6V A;  1NZE A;  4JTD B;  4OIR F;  4BEJ A;  2PFD A;  3SXM A;  3NYJ A;  3M15 A;  4QDL A;  1H9T A;  4G7O F;  3MFN A;  1JPN A;  4YN0 B;  1ZVZ A;  2A69 F;  3ZQV A;  2FFH A;  3U0C A;  2TMV P;  2JPU A;  5AC4 A;  1WTY A;  4OIO F;  3TJ5 A;  4AK9 A;  3QTH A;  4N06 A;  1LM3 B;  3JRT A;  1D1C A;  2XM4 A;  3K7D A;  4H4K C;  4DRI B;  1RJ9 A;  5JUA A;  3K1H A;  3LS0 A;  4PJM A;  3TOL A;  1TWG A;  1Z6A A;  2YRF A;  3VF0 A;  4LER A;  1F1M A;  1YLM A;  2IXM A;  4JUR I;  1PCX A;  3NYL A;  1SR2 A;  4MW8 A;  2KGO A;  1Y6D A;  2LFD A;  3KYI A;  2XLD A;  4MVZ A;  2R7Q A;  3IPM O;  4CDY A;  3ASO C;  1KTM A;  3Q6M A;  2A68 F;  1Q0D A;  3GWN A;  4CIP A;  4O6M A;  4IWB A;  3RQG A;  4CS9 C;  4EUK B;  3PMR A;  4H54 A;  4YT8 A;  4I1M A;  2HFI A;  3JCU Q;  3K66 A;  2J46 A;  3BRJ A;  3I5Q A;  1LI7 A;  2R25 A;  3EFO B;  1JOG A;  3CQZ A;  4O6Y A;  3DZA A;  4PJN A;  2NUT A;  4C3D A;  1O5H A;  5KYY A;  2ZPA A;  3TQO A;  1RKE B;  1HW2 A;  3SEO A;  2NUP A;  3SXZ A;  4HE8 D;  3DI5 A;  5JT4 A;  4GEH A;  3JTL O;  4JJG A;  4YWQ A;  4ZLC A;  2J7P D;  4FES A;  1VK5 A;  3GM2 A;  4G78 A;  4KI2 A;  2YKZ A;  3C62 A;  4OIN F;  2EIL C;  3S29 A;  5D91 A;  3QW1 A;  2AP3 A;  2Y69 C;  2VCB A;  4U5C E;  2EIM C;  1ZHZ A;  3B29 A;  4GYT A;  2L6F A;  2P61 A;  4LDR A;  3H65 A;  4ONS A;  4I3M A;  1C17 M;  3AG4 C;  3G4Z A;  2G3K A;  4YL3 A;  3B0V C;  1T9K A;  4DRH B;  1EQ1 A;  2VC9 A;  2B0J A;  5DS4 A;  4EWC A;  2FGY A;  1U0B B;  3AGU A;  3ABM C;  2XLV A;  3K6B A;  5K0I A;  4ER9 A;  1NFN A;  2B0H A;  3HNL A;  4P9F A;  3DE8 A;  3LNM B;  2ETS A;  1MQV A;  5IY5 C;  3UMK A;  2H8A A;  1JAF A;  3C8G B;  3NDB B;  4G0H A;  4FAP B;  1LS1 A;  4FX5 A;  2Y3H A;  1NBB A;  5F5H A;  2HMZ A;  4EBJ A;  3L0I A;  4MVS A;  4BJ5 A;  1Z63 A;  2XL6 A;  3DJN B;  3SZR A;  3GWL A;  1OCZ C;  3HNK A;  5KYU A;  3ECS A;  5L0D A;  2EPM X;  2D5R B;  3AG3 C;  4JZA A;  1QLE C;  3C8G D;  3FHD A;  4JW1 A;  4O7G A;  3IQC A;  2XLH A;  3JYY A;  2L6G A;  1TWC A;  2NG1 A;  2ASR A;  2KSF A;  3LLI A;  3W8I A;  4CJG A;  2G3V A;  1Z5Z A;  2IYL D;  2YLD A;  5DQT A;  1MMD A;  2W45 A;  3OEO A;  2LQG A;  4BPM A;  5A6B A;  2V3C C;  2YL0 A;  3L34 A;  3VRC A;  4LLC A;  2KQ9 A;  1K05 A;  1MMN A;  5T3T A;  3ZSU A;  3NMJ A;  2LIG A;  4RBN A;  1ZHW A;  4CBE A;  2KJG A;  1LPE A;  5L0H A;  4RD9 A;  3EGD B;  5COM A;  2XXA B;  4DBR A;  3R2P A;  4HEA J;  4C3E A;  1TKN A;  2OJQ A;  4O6N A;  4P6I C;  4OIQ F;  1WN0 A;  4EBK A;  1G8X A;  1JPJ A;  4JEB A;  1G5Z A;  2VCA A;  1Z7Q c;  5B1B C;  1C02 A;  3TJ6 A;  2IBF A;  4PJJ A;  4C7O B;  1R4T A;  3JSZ A;  2L7A A;  4M63 A;  1A7V A;  4RDA A;  2XLE A;  3JSE O;  3NMK A;  3LUT B;  3SP1 A;  4JEA A;  5COF A;  5KYW A;  1WAT A;  2YWA A;  3U3F A;  2J7P A;  4CIH A;  1ST6 A;  2ICW G;  2WZL A;  4WGZ A;  4CSA A;  4CS8 A;  4OD4 A;  2HV7 A;  3L8J A;  1D0Y A;  1RKE A;  2A6E F;  2UUH A;  2R7T A;  1ZHY A;  3FVY A;  4MVU A;  3W8H A;  4F4B A;  2AU5 A;  4J7T A;  2YQY A;  4NCQ A;  3FDQ A;  3C18 A;  3NG1 A;  2R7S A;  3U8V A;  2PNO A;  3B0P A;  3UGO A;  3HNJ A;  5BQG A;  1YAU O;  2HKV A;  1ORY A;  1SYQ A;  1XZQ A;  2D4U A;  2YEV A;  2PX0 A;  2Q7R A;  3X2Q C;  4G7Z F;  1YZA A;  3QZC A;  5L0C A;  2VAS A;  4NTA A;  5T1D B;  5JRA A;  1FR0 A;  1ZZP A;  3VM6 A;  1YYX A;  2M4E A;  4DVY P;  4XWJ A;  1M56 C;  2CDQ A;  3KL4 A;  4PFO A;  1LS4 A;  1OR3 A;  1H6G A;  1S05 A;  3CSK A;  5E33 A;  1ZHT A;  3S28 A;  4E7S A;  3FOO A;  5EK0 A;  1HW1 A;  4MVQ A;  3X1O A;  3T6B A;  2F22 A;  3PHF 2;  3PDM P;  1UFB A;  1V55 C;  2W4M A;  5JSL A;  2X51 A;  1YZC A;  4YJW A;  3H2U A;  1MND A;  3J06 A;  3DAF A;  3ABL C;  1FNT c;  4JVS A;  1T6I A;  2ZXP A;  4JIO A;  1KNY A;  3C8Z A;  3C8G A;  4JCZ A;  4N6H A;  4MTO A;  5FZT A;  1ZU5 A;  5AC5 A;  3M79 A;  3DM5 A;  2OEX A;  1CPR A;  4BJ6 A;  2ZXO A;  1TQG A;  5L0I A;  5GPG B;  2CGE A;  2XS8 A;  1SF8 A;  4U5G A;  5T3W A;  3K1I A;  2R7U A;  4KNW A;  4QI0 A;  4MW3 A;  1E2X A;  4Z9H A;  1HMO A;  4JTC B;  3GOD A;  4NQF A;  2H7V C;  2DYR C;  3ASN C;  3UR3 C;  3N24 A;  4J30 B;  4BG0 A;  4CDV A;  4PFP A;  1G4U S;  3V7O A;  2XLO A;  3E9V A;  4W8K A;  1VLT A;  2XRH A;  5HV9 A;  2KC3 A;  3FMS A;  4KBL A;  4MQ9 F;  2OKU A;  2WB7 A;  3SNH A;  4ULW A;  3KMI A;  2OJE D;  4C3B A;  2XXA A;  4BJT A;  4JCH A;  1WAS A;  3U3B A;  5B1A C;  4CJO A;  3AQC A;  1VYK A;  3FXH A;  3KKB A;  1OR2 A;  2IXN A;  4KC9 A;  3L8I A;  3KPH A;  4E18 A;  1OW6 A;  4FWV A;  3AGT A;  2A0U A;  2AWY A;  5EGY A;  4C7O A;  2VH3 A;  1YJG A;  5CIV A;  4J7Y A;  1YA9 A;  2YLI A;  4O79 A;  1HE9 A;  1ORS C;  4E17 A;  4ZLD A;  1NFO A;  2A0B A;  3W2V A;  3FOP A;  1FFH A;  4K0D A;  2YL1 A;  3DM9 B;  1M2V B;  2J9W A;  2X0C A;  2J9U A;  3T6J A;  5A6J A;  5HSW A;  2Y3B A;  4ANJ A;  5L3Q A;  4GQH A;  4LDK A;  1Z3I X;  2W9Y A;  3EG9 B;  3M4B A;  3S9O A;  1U6H A;  3JZ0 A;  3SXK A;  3ZIB A;  1G4W R;  1PD1 A;  1RKC A;  1LIH A;  1LE2 A;  3CZ6 A;  2XL4 A;  2QE9 A;  3WAQ A;  5DLJ A;  4UDV A;  5AGF A;  3L1M A;  3VYW A;  3EH1 A;  4D4X A;  4QI2 A;  3ZTM A;  2Q3T A;  3HJC A;  1CGO A;  1ZYR F;  2CW0 F;  2OCC C;  4XPX A;  3WHN A;  1YYJ A;  3LEO A;  3IHU A;  4P9T A;  4R32 A;  2EPN A;  1RCP A;  4JC7 A;  5BQH A;  1WOL A;  2EPO A;  2HZ8 A;  2DI3 A;  1OXK A;  3DWW A;  3T4R A;  4IJJ A;  3AQB A;  4Q5S F;  5JP7 A;  4B6I A;  1C03 A;  2R7R A;  5A6A A;  5TJ5 E;  1I5N A;  3RW0 A;  1A0B A;  1OW7 A;  3UGP A;  3FAP B;  1OCR C;  4JTA B;  4Z9J A;  5KYN A;  1GGQ A;  3PCV A;  3CEX A;  2OQM A;  2IM8 A;  1HY5 A;  2PX3 A;  2V26 A;  4DRJ B;  1OQC A;  3AG2 C;  5CI9 A;  1RJ9 B;  3LNR A;  2LK4 A;  1T6U A;  4IGG A;  2J9V A;  4BEM J;  1O87 A;  1A41 A;  2J45 A;  2P1A A;  3RKO F;  3ZVR A;  5A6K A;  3POV A;  1NU7 D;  4XEF A;  2I8B A;  2Q9B A;  1ZW2 A;  2XS1 A;  4BJ1 A;  2Y3G A;  2QLA A;  1MMG A;  3O6X A;  1D0Z A;  1QKR A;  1GQA A;  2M64 A;  4JKV A;  4NTF A;  4X0R A;  2FAP B;  4AL1 A;  3OA1 A;  1ZW3 A;  3EQL F;  2HUJ A;  4IAO A;  2WVN A;  3I4U A;  4U5E E;  3U9J A;  3ZTZ A;  5L0G A;  5L0F A;  1BR4 A;  4JJF A;  1BR1 A;  2MYS A;  1M6T A;  1QPU A;  2EIK C;  5E3A A;  5JS5 A;  2J0X A;  3EFO A;  4PAC A;  2NSG A;  5L0J A;  1D1B A;  2HV6 A;  4A4A A;  3A9C A;  3DXJ F;  3RFY A;  3KH2 A;  1ZU4 A;  3Q6N A;  5KYY B;  2VB6 A;  2QUP A;  2MWQ A;  1QQ3 A;  2PBE A;  2YLG A;  4AX2 A;  5F28 E;  2HSB A;  5BQI A;  3B9Q A;  2BL2 A;  5FCL A;  4YT5 A;  4U5H A;  3A11 A;  1E84 A;  2CYD A;  2I15 A;  1IZM A;  2DYS C;  3GEH A;  2C04 A;  2DB4 A;  4BJ5 C;  3RH3 A;  2KK1 A;  2MHR A;  5KYX B;  3GEI A;  4MVM A;  3F47 A;  3R7C A;  3F46 A;  3LAY A;  3UNG C;  4CS9 A;  3DMD A;  1M2V A;  4DJ9 A;  2EPL X;  4EBB A;  2PF4 E;  2HJM A;  2XM0 A;  1KU2 A;  1QSP A;  1QVX A;  2HMQ A;  2R02 A;  4U5B E;  3ZQY A;  1T01 A;  2Y39 A;  3MLG A;  4IAQ A;  3GAN A;  2Z15 A;  1BDJ B;  3EG9 A;  4PR9 A;  4LDQ A;  1V54 C;  4NC3 A;  4HFF B;  3LEV A;  1T5O A;  4I1O B;  2L9J A;  3ZG1 A;  1LKX A;  3RQF A;  1EI7 A;  4XTK A;  1A7D A;  1J8Y F;  3EH2 A;  1I4Z A;  5DS6 A;  5COG A;  3WG7 C;  2R7O A;  2R05 A;  3IEE A;  2EIN C;  4U9E A;  1IW7 F;  4YK5 A;  3C63 A;  3AG1 C;  3IQT A;  1HMD A;  2YL7 A;  3JT1 A;  1NSG B;  4MS2 A;  4AE4 B;  4KNV A;  2GFH A;  2J9B A;  3EPV A;  4EHP A;  2UUI A;  5A69 A;  2LP4 A;  2JX0 A;  4IB4 A;  4WGY A;  3WOD F;  5KYU B;  2J0W A;  3NRH A;  1AVO B;  1SZI A;  1NU9 C;  4E7Z A;  1XZP A;  1TR2 A;  2RSE B;  2VCC A;  3U9M A;  1TFO B;  1OKK D;  3V5X A;  3GEE A;  1XWJ A;  4E0I A;  1Q0F A;  3ZC4 A;  1GS9 A;  4W8P A;  3EJN A;  3AOU A;  2JD3 A;  2IXP A;  5E2Q A;  4CS8 C;  5B3S C;  3TUL A;  4CSA C;  4CDA A;  4XEV A;  1OCO C;  2E87 A;  5D92 A;  3HNI A;  2R7W A;  2BE5 F;  3EGD A;  3HLZ A;  3QMK A;  3W2W A;  2Q9C A;  3V5Z A;  4DXW A;  1LE4 A;  2EPK X;  2QNL A;  4Q7C A;  2ZXW C;  3U5S A;  3JRM O;  2WVO A;  4E0H A;  1APC A;  2L6H A;  1EA8 A;  2CNW D;  3GM3 A;  4J32 B;  2DGJ A;  2QTV A;  1FMW A;  3DAG A;  4LAC B;  2EIJ C;  1VMA A;  4HFK B;  1JRA A;  1V4A A;  5A6B D;  4OIP F;  3LJB A;  1CGM E;  3W4Y A;  2R7X A;  1EKY A;  2A1D D;  4U9D A;  4D4N A;  1E85 A;  3U2L A;  2R03 A;  3HTK C;  1E86 A;  2L81 A;  3DD7 A;  1M57 C;  2HSQ A;  1OXB A;  1R5I D;  2O9X A;  3M1C B;  5KYW B;  2LD6 A;  2HS5 A;  2YZS A;  1D1A A;  2ZD9 A;  3ABK C;  3U2M A;  4YT2 A;  2W4B A;  3RYL A;  3SXY A;  1VOM A;  1YVI A;  3RVY A;  3O39 A;  3TD7 A;  3Q7G A;  1MNE A;  5L3V A;  5DQZ A;  4DBQ A;  1OCC C;  3UMI A;  3O55 A;  3IQ5 A;  3DE9 A;  3SYN A;  2R9R B;  3N2Z B;  1DOV A;  1TWH A;  3GOR A;  1PV3 A;  3EZI A;  3GM1 A;  4CX9 A;  1VLS A;  1YDI A;  3MBG A;  2RD9 A;  3MX3 A;  4XPY A;  3EGX B;  2OU6 A;  4CS7 A;  3AJM A;  4EKW A;  4XLP F;  4BJ6 C;  2YVK A;  5KYX A;  1OW8 A;  2KW3 C;  1Y4C A;  2C03 A;  3QW0 A;  4XQ1 A;  4I44 A;  2QY9 A;  1JMW A;  3NMI A;  4IRU A;  3RVZ A;  5B3I A;  2P0N A;  4WJ0 A;  1Z23 A;  3C7J A;  4IAR A;  2NSF A;  1K40 A;  3ATP A;  2AWC A;  3K1I C;  2H7B A;  2GA0 A;  1FMV A;  3Q7L A;  1L3P A;  1NLX A;  2AVK A;  2Q4F A;  4OD5 A;  3E70 C;  1Q0K A;  1YAR O;  1A7E A; 
#chains in the Genus database with same CATH homology
 4U5D E;  2IXO A;  2A6H F;  3OWT A;  3N0T A;  5DVW A;  2PP4 A;  1OKK A;  1ZHX A;  2R7V A;  3LES A;  4AE4 A;  5BUO A;  2IOQ A;  1FTS A;  3FAJ A;  4PK4 A;  3EZH A;  1SMY F;  5EHH A;  5CI8 A;  2OG2 A;  1PD0 A;  4U5F E;  1N1C A;  4A2N B;  3NYM A;  2LSE A;  3ITF A;  1TWA A;  2G62 A;  2CNW A;  2Q9A A;  5E3C A;  3NKD A;  2KNH A;  4XLN F;  3RIP A;  3I5P A;  1NG1 A;  1S7Z A;  4K7B A;  3NKE A;  3EHN A;  2NUT B;  1M2O A;  4Q4Z F;  4DVZ A;  2WVQ A;  4NY3 A;  2NUP B;  3K33 A;  1J8M F;  1LVK A;  3S27 A;  3S0X A;  2YHS A;  1VYI A;  2WL8 A;  1BR2 A;  1QZX A;  1D0X A;  3JYH A;  3UMH A;  1FFT C;  4G7H F;  2Y3D A;  1W2W A;  5DS5 A;  4YT4 A;  2P7V A;  3LLK A;  4MND A;  4DOZ A;  1WGW A;  2XSE A;  1MMA A;  3B0U X;  2WZF A;  2ZXR A;  3EGX A;  4LLE A;  2WZG A;  2H7O A;  3EHM A;  4PJL A;  3VAY A;  4CS7 A;  3DJU B;  5F5F A;  3LS1 A;  2P6V A;  1NZE A;  4OIR F;  4BEJ A;  2PFD A;  3NYJ A;  4QDL A;  4G7O F;  1JPN A;  4YN0 B;  2A69 F;  2FFH A;  4OIO F;  4AK9 A;  4N06 A;  3JRT A;  1D1C A;  4H4K C;  3K7D A;  1RJ9 A;  3K1H A;  3LS0 A;  4PJM A;  1TWG A;  1Z6A A;  4LER A;  2IXM A;  4JUR I;  1PCX A;  3NYL A;  2KGO A;  2R7Q A;  3ASO C;  3Q6M A;  2A68 F;  4O6M A;  4IWB A;  4CS9 C;  3PMR A;  4YT8 A;  4I1M A;  3JCU Q;  3K66 A;  2J46 A;  3I5Q A;  3EFO B;  3CQZ A;  4O6Y A;  3DZA A;  4PJN A;  2NUT A;  4C3D A;  1O5H A;  5KYY A;  2ZPA A;  3SEO A;  2NUP A;  4HE8 D;  4GEH A;  4JJG A;  4YWQ A;  4ZLC A;  2J7P D;  4FES A;  1VK5 A;  4KI2 A;  4OIN F;  3S29 A;  2EIL C;  5D91 A;  2Y69 C;  4U5C E;  2EIM C;  1ZHZ A;  4GYT A;  3H65 A;  4I3M A;  3AG4 C;  2G3K A;  2B0J A;  5DS4 A;  4EWC A;  2FGY A;  3ABM C;  3K6B A;  5IY5 C;  3UMK A;  3NDB B;  4G0H A;  1LS1 A;  4FX5 A;  2Y3H A;  5F5H A;  3L0I A;  4BJ5 A;  1Z63 A;  3DJN B;  3SZR A;  1OCZ C;  5KYU A;  3ECS A;  2D5R B;  3AG3 C;  4JZA A;  1QLE C;  3FHD A;  4JW1 A;  4O7G A;  3LLI A;  3W8I A;  1TWC A;  2NG1 A;  2G3V A;  1Z5Z A;  2IYL D;  5DQT A;  1MMD A;  2W45 A;  3OEO A;  2V3C C;  3L34 A;  4LLC A;  2KQ9 A;  1MMN A;  5T3T A;  3ZSU A;  4RBN A;  1ZHW A;  4CBE A;  2KJG A;  4RD9 A;  3EGD B;  2XXA B;  4DBR A;  4C3E A;  4HEA J;  1TKN A;  4O6N A;  4P6I C;  4OIQ F;  1G8X A;  1JPJ A;  5B1B C;  4C7O B;  4PJJ A;  3JSZ A;  4M63 A;  4RDA A;  3SP1 A;  5KYW A;  4CIH A;  2J7P A;  1ST6 A;  2WZL A;  4CSA A;  4CS8 A;  4OD4 A;  2HV7 A;  1D0Y A;  2A6E F;  2R7T A;  1ZHY A;  3FVY A;  3W8H A;  4F4B A;  3FDQ A;  3NG1 A;  2R7S A;  3B0P A;  3UGO A;  2YEV A;  3X2Q C;  4G7Z F;  2PX0 A;  3QZC A;  2VAS A;  5T1D B;  2M4E A;  4DVY P;  4XWJ A;  1M56 C;  2CDQ A;  3KL4 A;  4PFO A;  5E33 A;  3S28 A;  3CSK A;  1ZHT A;  4E7S A;  3PHF 2;  3X1O A;  3T6B A;  1V55 C;  2W4M A;  2X51 A;  4YJW A;  1MND A;  3DAF A;  3ABL C;  4JVS A;  2ZXP A;  1ZU5 A;  3DM5 A;  4BJ6 A;  2ZXO A;  2CGE A;  4U5G A;  1SF8 A;  5T3W A;  2R7U A;  4KNW A;  4QI0 A;  3UR3 C;  3GOD A;  2H7V C;  2DYR C;  3ASN C;  3N24 A;  4J30 B;  4BG0 A;  4PFP A;  3V7O A;  3E9V A;  4W8K A;  2XRH A;  4KBL A;  4MQ9 F;  2WB7 A;  3SNH A;  4ULW A;  3KMI A;  4C3B A;  2XXA A;  4BJT A;  4JCH A;  5B1A C;  3AQC A;  1VYK A;  3KKB A;  4KC9 A;  2IXN A;  4FWV A;  5EGY A;  4C7O A;  2VH3 A;  4O79 A;  4ZLD A;  3W2V A;  1FFH A;  4K0D A;  3DM9 B;  1M2V B;  2J9W A;  2J9U A;  3T6J A;  5HSW A;  2Y3B A;  4ANJ A;  5L3Q A;  1Z3I X;  2W9Y A;  3EG9 B;  3ZIB A;  3B0V C;  1PD1 A;  3CZ6 A;  2XL4 A;  5DLJ A;  4QI2 A;  3VYW A;  3EH1 A;  2Q3T A;  3HJC A;  2CW0 F;  1ZYR F;  2OCC C;  3T4R A;  4IJJ A;  3AQB A;  4Q5S F;  4B6I A;  2R7R A;  3UGP A;  1OCR C;  5KYN A;  2PX3 A;  2V26 A;  3AG2 C;  5CI9 A;  1RJ9 B;  3LNR A;  2J9V A;  1O87 A;  3RKO F;  2J45 A;  3ZVR A;  3POV A;  1NU7 D;  2I8B A;  2Q9B A;  4BJ1 A;  2Y3G A;  1MMG A;  3O6X A;  1D0Z A;  4X0R A;  3OA1 A;  3EQL F;  4IAO A;  2WVN A;  3I4U A;  4U5E E;  1BR4 A;  4JJF A;  1BR1 A;  2MYS A;  2EIK C;  5E3A A;  2J0X A;  3EFO A;  1D1B A;  2HV6 A;  3DXJ F;  3RFY A;  3KH2 A;  1ZU4 A;  3Q6N A;  5KYY B;  2VB6 A;  4AX2 A;  2MWQ A;  3B9Q A;  5FCL A;  4YT5 A;  4U5H A;  1IZM A;  2DYS C;  2C04 A;  4BJ5 C;  3RH3 A;  5KYX B;  3F47 A;  3UNG C;  3F46 A;  3LAY A;  4CS9 A;  3DMD A;  1M2V A;  4EBB A;  2PF4 E;  1KU2 A;  4U5B E;  2Y39 A;  3MLG A;  3GAN A;  2Z15 A;  3EG9 A;  1V54 C;  4HFF B;  3LEV A;  4I1O B;  2L9J A;  3ZG1 A;  1LKX A;  4XTK A;  1J8Y F;  3EH2 A;  5DS6 A;  3WG7 C;  2R7O A;  3IEE A;  2EIN C;  1IW7 F;  3AG1 C;  3JT1 A;  4AE4 B;  4KNV A;  2GFH A;  3EPV A;  3WOD F;  5KYU B;  2J0W A;  3NRH A;  1SZI A;  1NU9 C;  4E7Z A;  1TR2 A;  1OKK D;  3ZC4 A;  3EJN A;  4CSA C;  2JD3 A;  2IXP A;  5E2Q A;  4CS8 C;  5B3S C;  1OCO C;  2E87 A;  5D92 A;  2R7W A;  2BE5 F;  3EGD A;  3HLZ A;  3QMK A;  3W2W A;  2Q9C A;  4Q7C A;  2ZXW C;  2WVO A;  4J32 B;  2CNW D;  2DGJ A;  2QTV A;  1FMW A;  3DAG A;  4LAC B;  2EIJ C;  1VMA A;  4HFK B;  4OIP F;  3LJB A;  2R7X A;  2A1D D;  3HTK C;  2L81 A;  3DD7 A;  1M57 C;  2O9X A;  5KYW B;  3M1C B;  2YZS A;  1D1A A;  3ABK C;  4YT2 A;  2W4B A;  3RYL A;  3TD7 A;  1VOM A;  3O39 A;  3Q7G A;  1MNE A;  5L3V A;  5DQZ A;  4DBQ A;  1OCC C;  3UMI A;  3SYN A;  3N2Z B;  1TWH A;  3EZI A;  3MX3 A;  3EGX B;  4XLP F;  4BJ6 C;  5KYX A;  2KW3 C;  2C03 A;  4I44 A;  2QY9 A;  4IRU A;  4WJ0 A;  1Z23 A;  3Q7L A;  3K1I C;  2H7B A;  1FMV A;  4OD5 A;  3E70 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...