3LJBA

Structural basis of oligomerisation in the mxa stalk
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
268
structure length
219
Chain Sequence
EDENEKMFFLIDKVNAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIENNFQEGHKILSRKIQKFENFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYSMEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of oligomerization in the stalk region of dynamin-like MxA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antiviral protein
molecule keywords Interferon-induced GTP-binding protein Mx1
total genus 96
structure length 219
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1240 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ljbA00
3SNHA 4BEJA 3ZVRA 3SZRA 4X0RA 3LJBA
chains in the Genus database with same CATH superfamily
3EQLF 3S90A 1H9TA 1O5HA 3K6BA 3K7DA 3W8HA 5L3VA 1QVXA 1D0XA 4MVZA 1BR1A 4EHPA 2R7WA 4HEAJ 4QDLA 1D1BA 3LS0A 5KYUA 4C3BA 1TWAA 1R5ID 2KQ9A 1ORYA 3DM5A 4PJJA 4XWJA 2R7VA 5CI9A 2FAPB 1H9GA 4MVUA 1G8XA 4LDQA 2R7RA 2DYSC 3EH1A 5CI8A 1HE9A 5KYYA 4J7TA 1T6UA 3KMIA 3SYNA 1K40A 1M2OA 5JT4A 5A6JA 3FAPB 1LE4A 4YL0A 5BQIA 3IHUA 4N6HA 2YLGA 4YT5A 2LQGA 3NMKA 1TWCA 3U9MA 3DD7A 1QPUA 1GGQA 4JKVA 1ORJA 2EPOA 5L0JA 4Q4ZF 1FFHA 1LS1A 1NG1A 1ZHZA 3ECSA 1BDJB 3U8VA 3UNGC 5DS6A 4N6CA 1ZHYA 1O3UA 2KYHA 3PMRA 3U8PA 4U5GA 1YVIA 1M57C 2XXAA 4MTFA 3ABMC 2PX0A 2DI3A 3C7JA 4CDAA 5EHHA 2YL0A 2X0CA 5AC4A 4XQ1A 2Y3BA 1C02A 1Z6AA 3JYYA 4AK9A 2LFFA 4CJGA 1ZU4A 3QVYA 4PFPA 4FESA 2AWYA 3GWNA 3Q7GA 4JVSA 2JD3A 2H7BA 1JRAA 2IYLD 3IQTA 1ST6A 1G5ZA 1T5OA 3B9QA 2XL6A 2VCBA 3ABLC 2M64A 3R7CA 2FFHA 1F1MA 2KC3A 2P7VA 4EKWA 3H2UA 4AE4B 4HE8D 3ASOC 5IY5C 1KNYA 2LIGA 4IGGA 2XS1A 2VH3A 1ZHXA 3RFYA 1BBHA 5T3WA 1VLTA 1Q0KA 2Q9AA 5KYUB 2GFHA 2XLEA 3GORA 3HNIA 1OR3A 4RBNA 4Z9IA 3DJUB 2HS5A 3U5SA 4IWBA 1PD1A 2J7PD 1O87A 2WZGA 2Y39A 1S7ZA 1MNDA 4MS2A 4OINF 1OKKA 1A0BA 4XEKA 2YLDA 1QQ3A 3JRTA 3MYIA 3V7OA 3ZTZA 3DE9A 4DRIB 2OEXA 5FCLA 5T1DB 2WVNA 4ZLCA 4A4AA 5DS5A 4JRZA 4PJNA 4BJ1A 4O6MA 1D1CA 2R7XA 3PHF2 4C3DA 4CS8C 3DAGA 3S27A 2HMZA 4RD9A 1YA7O 2A69F 3JT1A 4BJ5C 4DBQA 4PK4A 3IPMO 1OXBA 1NU9C 1IZMA 1ZW3A 4DRHB 5HV9A 3NMJA 3ZVRA 2YEVA 1Q0FA 4BJ6A 2A6HF 1I4YA 4W8KA 2GDCA 3DE8A 1TWHA 4KBLA 3JZ0A 3M4BA 4YN0B 4YL3A 3AJMA 3DI5A 4E7SA 1E83A 2LSEA 2WL8A 4JZAA 2PP4A 2A0UA 1YYJA 1MMAA 1C03A 2AU5A 1HY5A 2OG2A 2IOQA 2QLAA 2YWAA 3C8ZA 4E17A 2OEVA 3IQ6A 3SZRA 1B68A 5JRAA 3TQOA 4JW1A 2YL3A 4C7OA 3EG9B 2HSBA 2R02A 2J8WA 2XRHA 4LLCA 4DJ9A 2E87A 2KNHA 2TMVP 2YL7A 1HMOA 3ATPA 3EGXB 4MVOA 3T9OA 1OCCC 4CDYA 3JRMO 5GPGB 1WWPA 3RW0A 3RVZA 4BJTA 4CSAC 2L9JA 5DS4A 3QZCA 1PD0A 1CPQA 2XLWA 5TJ5E 2Q4FA 1WGWA 4AE4A 1VYKA 3EGDA 3SXYA 3S9OA 4B6IA 5BQHA 3AG3C 1OR2A 3B0PA 4W8PA 4GYTA 4OIRF 2PNOA 1NFOA 1G4WR 1Q0MA 4JCZA 4LACB 5A6BA 4U9DA 4O6NA 4Z9HA 1M2VB 2HKVA 3LEOA 1TKNA 2XLOA 1XZQA 2GA0A 2OQMA 4PJMA 2LFDA 3IEEA 1MQVA 2PF4E 3PDMP 4ZLDA 3X1OA 4A2NB 3SP1A 4CBEA 4E0IA 4NY3A 1KU2A 1KTMA 2IXPA 2HZ8A 5FZTA 3LESA 1FTSA 1SF8A 2IXNA 5EGYA 3UGPA 2AP3A 1D0YA 3DAFA 2ICWG 2NUPB 5JLIA 5KYWA 3TULA 1CPRA 2WZFA 4EWCA 3T6GB 3W8IA 4JTDB 5DLJA 4H4KC 2NUTA 1HW1A 2Y69C 3NMIA 1WTYA 3TK0A 1Z7Qc 1VB5A 3HJCA 4CX9A 1UFBA 2R7QA 4EBKA 3KYIA 2ASRA 2LD6A 4D4XA 2WZLA 3NG1A 3N0TA 1GS9A 3HLZA 4JURI 5BQGA 2MHRA 1V55C 2VC9A 2NPUA 4K0DA 2HJ3A 2XLMA 3EG9A 3NKDA 4YWQA 2Z15A 2HJMA 3MYFA 3AOUA 1XZPA 2XL8A 1NZEA 1FMWA 2J9UA 1MMNA 2ZXWC 3NYJA 1WN0A 3DJNB 4ULVA 3VRCA 4E18A 3K33A 3DMDA 3ZG1A 3BRJA 2YVKA 3EFOB 2Q9CA 1R4TA 1VLSA 4IAOA 4O6YA 1FMVA 3UGOA 1OW6A 1CGNA 1T01A 2XL4A 2O9XA 4JCHA 5E3CA 2VCAA 4Q5SF 3A11A 4P6IC 2AWCA 2DGJA 5B1AC 1Q0DA 3ASNC 4KC9A 2ZXRA 1PV3A 4PACA 2Y3HA 1Q0GA 2CNWD 2P0NA 1MMDA 4J30B 2LK4A 1LIHA 3FHDA 2KK1A 4JEAA 1YLMA 1OQCA 3U2MA 4JJFA 3MLGA 4CS8A 5KYYB 3GM2A 3L8JA 2J9WA 1V4AA 5KYNA 2XS8A 4ER9A 4XLNF 4J32B 4CDVA 3KPHA 3NDBB 1YJGA 2R7UA 3K66A 4DRJB 1VYIA 3AQBA 2J9BA 2NSGA 3KKBA 3EFOA 4NTAA 4P9FA 5T3TA 3OA1A 2F22A 1EKYA 3GM3A 1ZHWA 3U0CA 4BJ5A 5JVEA 2VB6A 3KH2A 2VCCA 5COFA 5L0DA 3B0VC 4FX5A 2NUTB 5D91A 4LERA 3JSEO 2WVOA 3S0XA 3I4UA 1YZCA 4NC3A 1EA8A 2OJED 4UDVA 4Q7CA 2EPKX 3A9CA 1YAUO 4OIPF 1U0BB 4XEFA 1AUEA 3F47A 2R25A 1RCPA 5L0CA 3ZTMA 4IB4A 4I3MA 1V54C 3SXMA 2J0XA 2HSQA 4C3EA 5KYXA 2B0JA 4LDRA 3K1IA 1SYQA 4OIQF 4BEJA 2EIJC 4U5DE 5A6BD 3FXHA 2UUHA 3T6JA 1PCXA 1SZIA 1T6IA 5KYWB 1TR2A 3ZSUA 1M2VA 1Z5ZA 4FWVA 2R05A 4IJJA 3QVZA 2EPLX 3SNHA 2ZD9A 5F5HA 3UMHA 3UMIA 4CJOA 1NU7D 2IXOA 2WB7A 4G78A 4N06A 3J06A 4JTCB 5A6AA 2AVKA 3Q6MA 3N2ZB 1D0ZA 1AEPA 2QUPA 1LM3B 3AGUA 3EHMA 4LLEA 4MNDA 4XPYA 3UR3C 4CIPA 5L0IA 3RQFA 4BG0A 2XLDA 3M79A 4R32A 1ZVZA 2CDQA 1HMDA 2RSEB 3RQEA 4ANJA 2QTVA 2DB4A 3C63A 3ZIBA 1OCRC 1RJ9B 1U6HA 1J8MF 4CS7A 3DZAA 4XLPF 3RH3A 4O7GA 3IQCA 1LI7A 2P61A 5A69A 3U9JA 4XEVA 2EIKC 4MTOA 3U3FA 4BEMJ 3POVA 4U5EE 4KNWA 3U2LA 2OCCC 5F5FA 2EPMX 3VM6A 1A7VA 2HMQA 1JMWA 3C62A 3MBGA 3F46A 4U5CE 2PX3A 1JPNA 4WGZA 3RIPA 1VTMP 1XWJA 3LS1A 4AX2A 3EPVA 2V26A 3JCUQ 4WABA 2J9VA 1RXQA 3ABKC 3B29A 3LNRA 1BR4A 1D1AA 5D92A 4EBJA 1GM5A 3B0UX 4IARA 3NKEA 1FR0A 1CGOA 2YKZA 1RKEA 1W2WA 4G7OF 3R2PA 2VASA 3DKAA 1Z63A 4U5FE 5CIVA 4JEBA 3KYJA 1S05A 1WASA 1ZYRF 2R9RB 2XLHA 3H2VA 3LUTB 3W4YA 4WJ0A 5E2QA 3L8IA 4HFKB 3CSKA 4HFFB 4G7HF 1VOMA 2H8AA 1LPEA 2B0HA 4CS9A 4NCQA 3ZC4A 1APCA 3AG1C 2CNWA 3JSZA 1OXKA 3LLKA 3TOMA 1OCZC 1VMAA 3M1CB 2YQYA 3CZ6A 3FVYA 1T9KA 2L6FA 2P1AA 4YK5A 3I5PA 3LNMB 5F28E 3SXKA 3OEOA 1J8YF 1TFKB 2WVQA 3C8GA 2FGYA 5E3AA 1E86A 4JC7A 2YHSA 2IXMA 2KGOA 2W45A 3S84A 4M63A 3OWTA 3T6BA 2LCHA 1NLXA 3AG2C 1YARO 2IBFA 4GQHA 4YT2A 1Z3IX 1HE1A 2XM0A 2LP4A 3EZIA 3RF3A 3BEHA 2OOCA 4L6RA 2J46A 2W9YA 3B71A 5AGFA 5DQZA 1DOWA 1T6QA 3AG4C 2GWWA 4Z9JA 3S28A 1TFOB 3NYMA 3RVYA 5B3IA 3O6XA 5EK0A 2BE5F 4MVRA 5DQTA 4AL0A 4QI2A 2MWQA 4C7OB 4JJGA 4YT8A 3H65A 3U3BA 4AL1A 4OD4A 3TJ6A 4G7ZF 3RKOF 5JS5A 1RMVA 2YLIA 1H6GA 3M15A 3KL4A 2R7TA 1A41A 1C17M 3US6A 3ITFA 4OD5A 4JIOA 3O39A 2HFIA 1JR8A 3UMKA 4MW8A 3I5QA 4MVSA 3W2WA 4E0HA 2J7PA 3G4ZA 5L0HA 2A0BA 2GAQA 3QW1A 1LKXA 2IM8A 1FFTC 1OKKD 2JPUA 3CAXA 4LDKA 4K7BA 3HNJA 2DYRC 3LAYA 5KYXB 4MQ9F 3NYLA 4E7ZA 3LLIA 3X2QC 3VF0A 4PJLA 4G0HA 3NRHA 3MFNA 4KNVA 3WG7C 1JOGA 5B3SC 2L81A 2QY9A 2EINC 1VK5A 4DBRA 4U5HA 1RKEB 2Q9BA 4JE9A 4U5BE 2JX0A 3HTKC 3ZWIA 3GM1A 2R03A 3JYHA 2XXAB 1M56C 2OU6A 4NTBA 4BJ6C 1DOVA 1FAPB 2OKUA 2Y3DA 4NQFA 4P9TA 3WHNA 3ZDLA 2ZPAA 2NSFA 3SXZA 1ORSC 2C03A 4XPXA 4ONSA 2XM4A 1JPJA 1L7CA 3EJNA 1OW7A 2ETSA 1I4ZA 3QTHA 5L3QA 3Q6NA 3QMKA 1IW7F 2BL2A 1A7DA 3S29A 1K05A 4CS9C 5AC5A 4KI2A 1V74B 2EPNA 2R7OA 3AGTA 1BZ4A 2MYSA 3GWLA 3WODF 5JUAA 3IQ5A 1K04A 4OIOF 1GQAA 4GEHA 4YJWA 3M4CA 4CIHA 1HW2A 3CEXA 3TOLA 3L0IA 2X51A 4H54A 1Z23A 4DXWA 1YA9A 2C04A 2YZSA 3G50A 4FAPB 3VYWA 5COGA 4DOZA 1YDIA 4DVYP 4QI0A 2Q00A 2NG1A 3L34A 1OCOC 3E9VA 5L0GA 3K1IC 1ZW2A 4PR9A 3FOPA 3GEHA 3L1MA 3FDQA 3TJ5A 4PFOA 5E33A 1JAFA 1YYXA 2KSFA 2KJGA 3G4XA 3O55A 1LS4A 3Q7LA 1Y6DA 4DVZA 5HSWA 2A68F 4O79A 2PFDA 2CW0F 4MVQA 3MX3A 1ZHTA 1TQGA 3DM9B 3AQCA 3EH2A 3C8GD 1BR2A 3K1HA 3TD7A 4MTGA 4BPMA 2W4MA 4EUKB 1EI7A 1E84A 2V3CC 2G3KA 1UG7A 2G3VA 4MVMA 3E70C 2ZXPA 3EGDB 3LEVA 3HNKA 3GODA 2YRFA 1TWGA 3VAYA 2D4UA 3FOOA 3GEIA 2H7VC 4NTFA 4YL1A 1NBBA 1CGME 2PBEA 2ZXOA 3RYLA 2I15A 1FNTc 1E85A 1AVOB 2XLVA 1Y4CA 4D4NA 2CGEA 3WAQA 1RJ9A 1ZZPA 4ULWA 3C8GB 3CQZA 2M4EA 1LE2A 1M6TA 1YZAA 3V5ZA 3EHNA 4X0RA 1MMGA 5JSLA 4IAQA 3PCVA 2Q7RA 2CCYA 2Q3TA 3DXJF 3FMSA 2BC5A 3EGXA 5A6KA 1RKCA 1ZU5A 1OW8A 2XSEA 3C18A 3DWWA 3HKKA 4I1MA 1WOLA 4I1OB 4N4WA 1L3PA 2QE9A 3GANA 3QW0A 2HV7A 5DVWA 4CSAA 1LI5A 1A7EA 3LJBA 5JP7A 4U9EA 2L7AA 2A1DD 4RDAA 5COMA 1QKRA 4F4BA 2L6GA 1NFNA 2UUIA 3V5XA 4EIYA 3T4RA 2J0WA 2Y3GA 3EZHA 1I5NA 3SEOA 2A6EF 1EQ1A 2YL1A 2J45A 4IRUA 1QSPA 5B1BC 1H7IA 5BUOA 1U89A 2EILC 1G4US 1SR2A 2W4BA 3HNLA 3JTLO 3GEEA 1LVKA 2QNLA 2I8BA 3N24A 4XTKA 3RQGA 1SMYF 4JTAB 4WGYA 4XPWA 2R7SA 2RD9A 2HV6A 4EBBA 1NSGB 4J7YA 256BA 4MW3A 4K1OA 3ZQVA 4YT4A 3V5YA 2NUPA 2OJQA 1QLEC 2HUJA 1WATA 2P6VA 3O10A 5K0IA 5L0FA 3W2VA 1N1CA 2D5RB 2G62A 2L6HA 3FAJA 4I44A 1E2XA 2EIMC 2H7OA 2KW3C 1QZXA 2CYDA 3ZQYA 1MNEA
chains in the Genus database with same CATH topology
3EQLF 1O5HA 3K6BA 3K7DA 3W8HA 5L3VA 1D0XA 1BR1A 2R7WA 4HEAJ 4QDLA 1D1BA 3LS0A 5KYUA 4C3BA 1TWAA 2KQ9A 3DM5A 4PJJA 4XWJA 2R7VA 5CI9A 1G8XA 2R7RA 2DYSC 3EH1A 5CI8A 5KYYA 3SYNA 3KMIA 1M2OA 4YT5A 1TWCA 3DD7A 4Q4ZF 1FFHA 1LS1A 1NG1A 1ZHZA 3ECSA 3UNGC 5DS6A 1ZHYA 3PMRA 4U5GA 1M57C 2XXAA 3ABMC 2PX0A 5EHHA 2Y3BA 1Z6AA 4AK9A 1ZU4A 4PFPA 4FESA 3Q7GA 4JVSA 2JD3A 2H7BA 2IYLD 1ST6A 3B9QA 3ABLC 2FFHA 2P7VA 4AE4B 4HE8D 3ASOC 5IY5C 2VH3A 1ZHXA 3RFYA 2Q9AA 5KYUB 2GFHA 4RBNA 3DJUB 4IWBA 1PD1A 2J7PD 1O87A 2WZGA 2Y39A 1S7ZA 1MNDA 4OINF 1OKKA 3V7OA 3JRTA 5T1DB 2WVNA 4ZLCA 5DS5A 4PJNA 4BJ1A 4O6MA 1D1CA 2R7XA 3PHF2 4C3DA 4CS8C 3DAGA 3S27A 4RD9A 2A69F 3JT1A 4BJ5C 4DBQA 5FCLA 4PK4A 1NU9C 1IZMA 3ZVRA 2YEVA 4BJ6A 2A6HF 4W8KA 1TWHA 4KBLA 4YN0B 4E7SA 2LSEA 2WL8A 4JZAA 2PP4A 1MMAA 2OG2A 2IOQA 3SZRA 4JW1A 4C7OA 3EG9B 2XRHA 4LLCA 2E87A 2KNHA 3EGXB 1OCCC 4BJTA 4CSAC 2L9JA 5DS4A 3QZCA 1PD0A 1WGWA 4AE4A 1VYKA 3EGDA 4B6IA 3AG3C 3B0PA 4GYTA 4OIRF 4LACB 4O6NA 1M2VB 1TKNA 4PJMA 3IEEA 2PF4E 4ZLDA 3X1OA 4A2NB 3SP1A 4CBEA 4NY3A 1KU2A 2IXPA 3LESA 1FTSA 1SF8A 2IXNA 5EGYA 3UGPA 1D0YA 3DAFA 2NUPB 5KYWA 2WZFA 4EWCA 3W8IA 5DLJA 4H4KC 2NUTA 2Y69C 3HJCA 2R7QA 2WZLA 3NG1A 3N0TA 3HLZA 4JURI 1V55C 4K0DA 4YWQA 3EG9A 3NKDA 2Z15A 3NYJA 1NZEA 1FMWA 2J9UA 1MMNA 2ZXWC 3DJNB 3K33A 3DMDA 3ZG1A 3EFOB 2Q9CA 4IAOA 4O6YA 1FMVA 3UGOA 2XL4A 2O9XA 4JCHA 5E3CA 4Q5SF 4P6IC 2DGJA 5B1AC 3ASNC 4KC9A 2ZXRA 2Y3HA 2CNWD 1MMDA 4J30B 3FHDA 4CS8A 4JJFA 3MLGA 5KYYB 2J9WA 5KYNA 4XLNF 4J32B 3NDBB 2R7UA 3K66A 1VYIA 3AQBA 3KKBA 5T3TA 3EFOA 3OA1A 1ZHWA 4BJ5A 2VB6A 3KH2A 3B0VC 4FX5A 2NUTB 5D91A 4LERA 2WVOA 3S0XA 3I4UA 4OIPF 4Q7CA 3F47A 4I3MA 1V54C 2J0XA 4C3EA 5KYXA 2B0JA 4OIQF 4BEJA 2EIJC 4U5DE 5KYWB 3T6JA 1PCXA 1SZIA 1TR2A 3ZSUA 1M2VA 1Z5ZA 4FWVA 4IJJA 5F5HA 3SNHA 3UMHA 3UMIA 1NU7D 2IXOA 2WB7A 4N06A 3Q6MA 3N2ZB 1D0ZA 4LLEA 3EHMA 4MNDA 3UR3C 4BG0A 2CDQA 4ANJA 2QTVA 3ZIBA 1OCRC 1RJ9B 1J8MF 4CS7A 3DZAA 4XLPF 3RH3A 4O7GA 2EIKC 5F5FA 3POVA 4U5EE 4KNWA 2OCCC 3F46A 4U5CE 2PX3A 1JPNA 3RIPA 3LS1A 4AX2A 3EPVA 2V26A 3JCUQ 2J9VA 3ABKC 3LNRA 1BR4A 1D1AA 5D92A 3B0UX 3NKEA 4G7OF 1W2WA 2VASA 1Z63A 4U5FE 1ZYRF 4WJ0A 5E2QA 4HFKB 3CSKA 4HFFB 4G7HF 1VOMA 4CS9A 3ZC4A 3LLKA 3JSZA 2CNWA 3AG1C 1OCZC 1VMAA 3M1CB 3CZ6A 3FVYA 3I5PA 3OEOA 1J8YF 2WVQA 5E3AA 2FGYA 2YHSA 2IXMA 2KGOA 2W45A 4M63A 3OWTA 3T6BA 3AG2C 4YT2A 1Z3IX 3EZIA 2J46A 2W9YA 5DQZA 3S28A 3AG4C 3NYMA 3O6XA 4QI2A 2BE5F 5DQTA 2MWQA 4C7OB 4JJGA 4YT8A 3H65A 4G7ZF 4OD4A 3RKOF 3KL4A 2R7TA 3ITFA 4OD5A 3O39A 3UMKA 3I5QA 3W2WA 2J7PA 1LKXA 1FFTC 1OKKD 4K7BA 3LAYA 2DYRC 5KYXB 4MQ9F 3NYLA 4E7ZA 3LLIA 3X2QC 4PJLA 4G0HA 3NRHA 4KNVA 3WG7C 5B3SC 2L81A 2QY9A 2EINC 1VK5A 4DBRA 4U5HA 2Q9BA 4U5BE 3HTKC 3JYHA 2XXAB 1M56C 4BJ6C 2Y3DA 2ZPAA 2C03A 1JPJA 3EJNA 5L3QA 3Q6NA 3QMKA 1IW7F 3S29A 4CS9C 4KI2A 2R7OA 2MYSA 3WODF 4OIOF 4GEHA 4YJWA 4CIHA 3L0IA 2X51A 1Z23A 2C04A 2YZSA 3VYWA 4DOZA 4DVYP 4QI0A 2NG1A 3L34A 1OCOC 3E9VA 3K1IC 3FDQA 4PFOA 5E33A 2KJGA 3Q7LA 4DVZA 5HSWA 2A68F 4O79A 2PFDA 2CW0F 3MX3A 1ZHTA 3DM9B 3AQCA 3EH2A 1BR2A 3K1HA 3TD7A 2V3CC 2W4MA 2G3KA 2G3VA 3E70C 2ZXPA 3EGDB 3LEVA 3GODA 1TWGA 3VAYA 2H7VC 2ZXOA 3RYLA 2CGEA 1RJ9A 4ULWA 3CQZA 2M4EA 3EHNA 4X0RA 1MMGA 2Q3TA 3DXJF 5BUOA 3EGXA 1ZU5A 2XSEA 4I1MA 4I1OB 5T3WA 3T4RA 4CSAA 3GANA 2HV7A 5DVWA 3LJBA 2A1DD 4RDAA 4F4BA 2J0WA 2Y3GA 3EZHA 3SEOA 2A6EF 2J45A 4IRUA 5B1BC 2EILC 2W4BA 1LVKA 2I8BA 3N24A 4XTKA 1SMYF 2R7SA 2HV6A 4EBBA 4YT4A 2NUPA 1QLEC 2P6VA 3W2VA 1N1CA 2D5RB 2G62A 3FAJA 4I44A 2EIMC 2H7OA 2KW3C 1QZXA 1MNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SNH A;  4BEJ A;  3ZVR A;  3SZR A;  4X0R A;  3LJB A; 
#chains in the Genus database with same CATH topology
 3EQL F;  3S90 A;  1H9T A;  1O5H A;  3K6B A;  3K7D A;  3W8H A;  5L3V A;  1QVX A;  1D0X A;  4MVZ A;  1BR1 A;  4EHP A;  2R7W A;  4HEA J;  4QDL A;  1D1B A;  3LS0 A;  5KYU A;  4C3B A;  1TWA A;  1R5I D;  2KQ9 A;  1ORY A;  3DM5 A;  4PJJ A;  4XWJ A;  2R7V A;  5CI9 A;  2FAP B;  1H9G A;  4MVU A;  1G8X A;  4LDQ A;  2R7R A;  2DYS C;  3EH1 A;  5CI8 A;  1HE9 A;  5KYY A;  4J7T A;  1T6U A;  3KMI A;  3SYN A;  1K40 A;  1M2O A;  5JT4 A;  5A6J A;  3FAP B;  1LE4 A;  4YL0 A;  5BQI A;  3IHU A;  4N6H A;  2YLG A;  4YT5 A;  2LQG A;  3NMK A;  1TWC A;  3U9M A;  3DD7 A;  1QPU A;  1GGQ A;  4JKV A;  1ORJ A;  2EPO A;  5L0J A;  4Q4Z F;  1FFH A;  1LS1 A;  1NG1 A;  1ZHZ A;  3ECS A;  1BDJ B;  3U8V A;  3UNG C;  5DS6 A;  4N6C A;  1ZHY A;  1O3U A;  2KYH A;  3PMR A;  3U8P A;  4U5G A;  1YVI A;  1M57 C;  2XXA A;  4MTF A;  3ABM C;  2PX0 A;  2DI3 A;  3C7J A;  4CDA A;  5EHH A;  2YL0 A;  2X0C A;  5AC4 A;  4XQ1 A;  2Y3B A;  1C02 A;  1Z6A A;  3JYY A;  4AK9 A;  2LFF A;  4CJG A;  1ZU4 A;  3QVY A;  4PFP A;  4FES A;  2AWY A;  3GWN A;  3Q7G A;  4JVS A;  2JD3 A;  2H7B A;  1JRA A;  2IYL D;  3IQT A;  1ST6 A;  1G5Z A;  1T5O A;  3B9Q A;  2XL6 A;  2VCB A;  3ABL C;  2M64 A;  3R7C A;  2FFH A;  1F1M A;  2KC3 A;  2P7V A;  4EKW A;  3H2U A;  4AE4 B;  4HE8 D;  3ASO C;  5IY5 C;  1KNY A;  2LIG A;  4IGG A;  2XS1 A;  2VH3 A;  1ZHX A;  3RFY A;  1BBH A;  5T3W A;  1VLT A;  1Q0K A;  2Q9A A;  5KYU B;  2GFH A;  2XLE A;  3GOR A;  3HNI A;  1OR3 A;  4RBN A;  4Z9I A;  3DJU B;  2HS5 A;  3U5S A;  4IWB A;  1PD1 A;  2J7P D;  1O87 A;  2WZG A;  2Y39 A;  1S7Z A;  1MND A;  4MS2 A;  4OIN F;  1OKK A;  1A0B A;  4XEK A;  2YLD A;  1QQ3 A;  3JRT A;  3MYI A;  3V7O A;  3ZTZ A;  3DE9 A;  4DRI B;  2OEX A;  5FCL A;  5T1D B;  2WVN A;  4ZLC A;  4A4A A;  5DS5 A;  4JRZ A;  4PJN A;  4BJ1 A;  4O6M A;  1D1C A;  2R7X A;  3PHF 2;  4C3D A;  4CS8 C;  3DAG A;  3S27 A;  2HMZ A;  4RD9 A;  1YA7 O;  2A69 F;  3JT1 A;  4BJ5 C;  4DBQ A;  4PK4 A;  3IPM O;  1OXB A;  1NU9 C;  1IZM A;  1ZW3 A;  4DRH B;  5HV9 A;  3NMJ A;  3ZVR A;  2YEV A;  1Q0F A;  4BJ6 A;  2A6H F;  1I4Y A;  4W8K A;  2GDC A;  3DE8 A;  1TWH A;  4KBL A;  3JZ0 A;  3M4B A;  4YN0 B;  4YL3 A;  3AJM A;  3DI5 A;  4E7S A;  1E83 A;  2LSE A;  2WL8 A;  4JZA A;  2PP4 A;  2A0U A;  1YYJ A;  1MMA A;  1C03 A;  2AU5 A;  1HY5 A;  2OG2 A;  2IOQ A;  2QLA A;  2YWA A;  3C8Z A;  4E17 A;  2OEV A;  3IQ6 A;  3SZR A;  1B68 A;  5JRA A;  3TQO A;  4JW1 A;  2YL3 A;  4C7O A;  3EG9 B;  2HSB A;  2R02 A;  2J8W A;  2XRH A;  4LLC A;  4DJ9 A;  2E87 A;  2KNH A;  2TMV P;  2YL7 A;  1HMO A;  3ATP A;  3EGX B;  4MVO A;  3T9O A;  1OCC C;  4CDY A;  3JRM O;  5GPG B;  1WWP A;  3RW0 A;  3RVZ A;  4BJT A;  4CSA C;  2L9J A;  5DS4 A;  3QZC A;  1PD0 A;  1CPQ A;  2XLW A;  5TJ5 E;  2Q4F A;  1WGW A;  4AE4 A;  1VYK A;  3EGD A;  3SXY A;  3S9O A;  4B6I A;  5BQH A;  3AG3 C;  1OR2 A;  3B0P A;  4W8P A;  4GYT A;  4OIR F;  2PNO A;  1NFO A;  1G4W R;  1Q0M A;  4JCZ A;  4LAC B;  5A6B A;  4U9D A;  4O6N A;  4Z9H A;  1M2V B;  2HKV A;  3LEO A;  1TKN A;  2XLO A;  1XZQ A;  2GA0 A;  2OQM A;  4PJM A;  2LFD A;  3IEE A;  1MQV A;  2PF4 E;  3PDM P;  4ZLD A;  3X1O A;  4A2N B;  3SP1 A;  4CBE A;  4E0I A;  4NY3 A;  1KU2 A;  1KTM A;  2IXP A;  2HZ8 A;  5FZT A;  3LES A;  1FTS A;  1SF8 A;  2IXN A;  5EGY A;  3UGP A;  2AP3 A;  1D0Y A;  3DAF A;  2ICW G;  2NUP B;  5JLI A;  5KYW A;  3TUL A;  1CPR A;  2WZF A;  4EWC A;  3T6G B;  3W8I A;  4JTD B;  5DLJ A;  4H4K C;  2NUT A;  1HW1 A;  2Y69 C;  3NMI A;  1WTY A;  3TK0 A;  1Z7Q c;  1VB5 A;  3HJC A;  4CX9 A;  1UFB A;  2R7Q A;  4EBK A;  3KYI A;  2ASR A;  2LD6 A;  4D4X A;  2WZL A;  3NG1 A;  3N0T A;  1GS9 A;  3HLZ A;  4JUR I;  5BQG A;  2MHR A;  1V55 C;  2VC9 A;  2NPU A;  4K0D A;  2HJ3 A;  2XLM A;  3EG9 A;  3NKD A;  4YWQ A;  2Z15 A;  2HJM A;  3MYF A;  3AOU A;  1XZP A;  2XL8 A;  1NZE A;  1FMW A;  2J9U A;  1MMN A;  2ZXW C;  3NYJ A;  1WN0 A;  3DJN B;  4ULV A;  3VRC A;  4E18 A;  3K33 A;  3DMD A;  3ZG1 A;  3BRJ A;  2YVK A;  3EFO B;  2Q9C A;  1R4T A;  1VLS A;  4IAO A;  4O6Y A;  1FMV A;  3UGO A;  1OW6 A;  1CGN A;  1T01 A;  2XL4 A;  2O9X A;  4JCH A;  5E3C A;  2VCA A;  4Q5S F;  3A11 A;  4P6I C;  2AWC A;  2DGJ A;  5B1A C;  1Q0D A;  3ASN C;  4KC9 A;  2ZXR A;  1PV3 A;  4PAC A;  2Y3H A;  1Q0G A;  2CNW D;  2P0N A;  1MMD A;  4J30 B;  2LK4 A;  1LIH A;  3FHD A;  2KK1 A;  4JEA A;  1YLM A;  1OQC A;  3U2M A;  4JJF A;  3MLG A;  4CS8 A;  5KYY B;  3GM2 A;  3L8J A;  2J9W A;  1V4A A;  5KYN A;  2XS8 A;  4ER9 A;  4XLN F;  4J32 B;  4CDV A;  3KPH A;  3NDB B;  1YJG A;  2R7U A;  3K66 A;  4DRJ B;  1VYI A;  3AQB A;  2J9B A;  2NSG A;  3KKB A;  3EFO A;  4NTA A;  4P9F A;  5T3T A;  3OA1 A;  2F22 A;  1EKY A;  3GM3 A;  1ZHW A;  3U0C A;  4BJ5 A;  5JVE A;  2VB6 A;  3KH2 A;  2VCC A;  5COF A;  5L0D A;  3B0V C;  4FX5 A;  2NUT B;  5D91 A;  4LER A;  3JSE O;  2WVO A;  3S0X A;  3I4U A;  1YZC A;  4NC3 A;  1EA8 A;  2OJE D;  4UDV A;  4Q7C A;  2EPK X;  3A9C A;  1YAU O;  4OIP F;  1U0B B;  4XEF A;  1AUE A;  3F47 A;  2R25 A;  1RCP A;  5L0C A;  3ZTM A;  4IB4 A;  4I3M A;  1V54 C;  3SXM A;  2J0X A;  2HSQ A;  4C3E A;  5KYX A;  2B0J A;  4LDR A;  3K1I A;  1SYQ A;  4OIQ F;  4BEJ A;  2EIJ C;  4U5D E;  5A6B D;  3FXH A;  2UUH A;  3T6J A;  1PCX A;  1SZI A;  1T6I A;  5KYW B;  1TR2 A;  3ZSU A;  1M2V A;  1Z5Z A;  4FWV A;  2R05 A;  4IJJ A;  3QVZ A;  2EPL X;  3SNH A;  2ZD9 A;  5F5H A;  3UMH A;  3UMI A;  4CJO A;  1NU7 D;  2IXO A;  2WB7 A;  4G78 A;  4N06 A;  3J06 A;  4JTC B;  5A6A A;  2AVK A;  3Q6M A;  3N2Z B;  1D0Z A;  1AEP A;  2QUP A;  1LM3 B;  3AGU A;  3EHM A;  4LLE A;  4MND A;  4XPY A;  3UR3 C;  4CIP A;  5L0I A;  3RQF A;  4BG0 A;  2XLD A;  3M79 A;  4R32 A;  1ZVZ A;  2CDQ A;  1HMD A;  2RSE B;  3RQE A;  4ANJ A;  2QTV A;  2DB4 A;  3C63 A;  3ZIB A;  1OCR C;  1RJ9 B;  1U6H A;  1J8M F;  4CS7 A;  3DZA A;  4XLP F;  3RH3 A;  4O7G A;  3IQC A;  1LI7 A;  2P61 A;  5A69 A;  3U9J A;  4XEV A;  2EIK C;  4MTO A;  3U3F A;  4BEM J;  3POV A;  4U5E E;  4KNW A;  3U2L A;  2OCC C;  5F5F A;  2EPM X;  3VM6 A;  1A7V A;  2HMQ A;  1JMW A;  3C62 A;  3MBG A;  3F46 A;  4U5C E;  2PX3 A;  1JPN A;  4WGZ A;  3RIP A;  1VTM P;  1XWJ A;  3LS1 A;  4AX2 A;  3EPV A;  2V26 A;  3JCU Q;  4WAB A;  2J9V A;  1RXQ A;  3ABK C;  3B29 A;  3LNR A;  1BR4 A;  1D1A A;  5D92 A;  4EBJ A;  1GM5 A;  3B0U X;  4IAR A;  3NKE A;  1FR0 A;  1CGO A;  2YKZ A;  1RKE A;  1W2W A;  4G7O F;  3R2P A;  2VAS A;  3DKA A;  1Z63 A;  4U5F E;  5CIV A;  4JEB A;  3KYJ A;  1S05 A;  1WAS A;  1ZYR F;  2R9R B;  2XLH A;  3H2V A;  3LUT B;  3W4Y A;  4WJ0 A;  5E2Q A;  3L8I A;  4HFK B;  3CSK A;  4HFF B;  4G7H F;  1VOM A;  2H8A A;  1LPE A;  2B0H A;  4CS9 A;  4NCQ A;  3ZC4 A;  1APC A;  3AG1 C;  2CNW A;  3JSZ A;  1OXK A;  3LLK A;  3TOM A;  1OCZ C;  1VMA A;  3M1C B;  2YQY A;  3CZ6 A;  3FVY A;  1T9K A;  2L6F A;  2P1A A;  4YK5 A;  3I5P A;  3LNM B;  5F28 E;  3SXK A;  3OEO A;  1J8Y F;  1TFK B;  2WVQ A;  3C8G A;  2FGY A;  5E3A A;  1E86 A;  4JC7 A;  2YHS A;  2IXM A;  2KGO A;  2W45 A;  3S84 A;  4M63 A;  3OWT A;  3T6B A;  2LCH A;  1NLX A;  3AG2 C;  1YAR O;  2IBF A;  4GQH A;  4YT2 A;  1Z3I X;  1HE1 A;  2XM0 A;  2LP4 A;  3EZI A;  3RF3 A;  3BEH A;  2OOC A;  4L6R A;  2J46 A;  2W9Y A;  3B71 A;  5AGF A;  5DQZ A;  1DOW A;  1T6Q A;  3AG4 C;  2GWW A;  4Z9J A;  3S28 A;  1TFO B;  3NYM A;  3RVY A;  5B3I A;  3O6X A;  5EK0 A;  2BE5 F;  4MVR A;  5DQT A;  4AL0 A;  4QI2 A;  2MWQ A;  4C7O B;  4JJG A;  4YT8 A;  3H65 A;  3U3B A;  4AL1 A;  4OD4 A;  3TJ6 A;  4G7Z F;  3RKO F;  5JS5 A;  1RMV A;  2YLI A;  1H6G A;  3M15 A;  3KL4 A;  2R7T A;  1A41 A;  1C17 M;  3US6 A;  3ITF A;  4OD5 A;  4JIO A;  3O39 A;  2HFI A;  1JR8 A;  3UMK A;  4MW8 A;  3I5Q A;  4MVS A;  3W2W A;  4E0H A;  2J7P A;  3G4Z A;  5L0H A;  2A0B A;  2GAQ A;  3QW1 A;  1LKX A;  2IM8 A;  1FFT C;  1OKK D;  2JPU A;  3CAX A;  4LDK A;  4K7B A;  3HNJ A;  2DYR C;  3LAY A;  5KYX B;  4MQ9 F;  3NYL A;  4E7Z A;  3LLI A;  3X2Q C;  3VF0 A;  4PJL A;  4G0H A;  3NRH A;  3MFN A;  4KNV A;  3WG7 C;  1JOG A;  5B3S C;  2L81 A;  2QY9 A;  2EIN C;  1VK5 A;  4DBR A;  4U5H A;  1RKE B;  2Q9B A;  4JE9 A;  4U5B E;  2JX0 A;  3HTK C;  3ZWI A;  3GM1 A;  2R03 A;  3JYH A;  2XXA B;  1M56 C;  2OU6 A;  4NTB A;  4BJ6 C;  1DOV A;  1FAP B;  2OKU A;  2Y3D A;  4NQF A;  4P9T A;  3WHN A;  3ZDL A;  2ZPA A;  2NSF A;  3SXZ A;  1ORS C;  2C03 A;  4XPX A;  4ONS A;  2XM4 A;  1JPJ A;  1L7C A;  3EJN A;  1OW7 A;  2ETS A;  1I4Z A;  3QTH A;  5L3Q A;  3Q6N A;  3QMK A;  1IW7 F;  2BL2 A;  1A7D A;  3S29 A;  1K05 A;  4CS9 C;  5AC5 A;  4KI2 A;  1V74 B;  2EPN A;  2R7O A;  3AGT A;  1BZ4 A;  2MYS A;  3GWL A;  3WOD F;  5JUA A;  3IQ5 A;  1K04 A;  4OIO F;  1GQA A;  4GEH A;  4YJW A;  3M4C A;  4CIH A;  1HW2 A;  3CEX A;  3TOL A;  3L0I A;  2X51 A;  4H54 A;  1Z23 A;  4DXW A;  1YA9 A;  2C04 A;  2YZS A;  3G50 A;  4FAP B;  3VYW A;  5COG A;  4DOZ A;  1YDI A;  4DVY P;  4QI0 A;  2Q00 A;  2NG1 A;  3L34 A;  1OCO C;  3E9V A;  5L0G A;  3K1I C;  1ZW2 A;  4PR9 A;  3FOP A;  3GEH A;  3L1M A;  3FDQ A;  3TJ5 A;  4PFO A;  5E33 A;  1JAF A;  1YYX A;  2KSF A;  2KJG A;  3G4X A;  3O55 A;  1LS4 A;  3Q7L A;  1Y6D A;  4DVZ A;  5HSW A;  2A68 F;  4O79 A;  2PFD A;  2CW0 F;  4MVQ A;  3MX3 A;  1ZHT A;  1TQG A;  3DM9 B;  3AQC A;  3EH2 A;  3C8G D;  1BR2 A;  3K1H A;  3TD7 A;  4MTG A;  4BPM A;  2W4M A;  4EUK B;  1EI7 A;  1E84 A;  2V3C C;  2G3K A;  1UG7 A;  2G3V A;  4MVM A;  3E70 C;  2ZXP A;  3EGD B;  3LEV A;  3HNK A;  3GOD A;  2YRF A;  1TWG A;  3VAY A;  2D4U A;  3FOO A;  3GEI A;  2H7V C;  4NTF A;  4YL1 A;  1NBB A;  1CGM E;  2PBE A;  2ZXO A;  3RYL A;  2I15 A;  1FNT c;  1E85 A;  1AVO B;  2XLV A;  1Y4C A;  4D4N A;  2CGE A;  3WAQ A;  1RJ9 A;  1ZZP A;  4ULW A;  3C8G B;  3CQZ A;  2M4E A;  1LE2 A;  1M6T A;  1YZA A;  3V5Z A;  3EHN A;  4X0R A;  1MMG A;  5JSL A;  4IAQ A;  3PCV A;  2Q7R A;  2CCY A;  2Q3T A;  3DXJ F;  3FMS A;  2BC5 A;  3EGX A;  5A6K A;  1RKC A;  1ZU5 A;  1OW8 A;  2XSE A;  3C18 A;  3DWW A;  3HKK A;  4I1M A;  1WOL A;  4I1O B;  4N4W A;  1L3P A;  2QE9 A;  3GAN A;  3QW0 A;  2HV7 A;  5DVW A;  4CSA A;  1LI5 A;  1A7E A;  3LJB A;  5JP7 A;  4U9E A;  2L7A A;  2A1D D;  4RDA A;  5COM A;  1QKR A;  4F4B A;  2L6G A;  1NFN A;  2UUI A;  3V5X A;  4EIY A;  3T4R A;  2J0W A;  2Y3G A;  3EZH A;  1I5N A;  3SEO A;  2A6E F;  1EQ1 A;  2YL1 A;  2J45 A;  4IRU A;  1QSP A;  5B1B C;  1H7I A;  5BUO A;  1U89 A;  2EIL C;  1G4U S;  1SR2 A;  2W4B A;  3HNL A;  3JTL O;  3GEE A;  1LVK A;  2QNL A;  2I8B A;  3N24 A;  4XTK A;  3RQG A;  1SMY F;  4JTA B;  4WGY A;  4XPW A;  2R7S A;  2RD9 A;  2HV6 A;  4EBB A;  1NSG B;  4J7Y A;  256B A;  4MW3 A;  4K1O A;  3ZQV A;  4YT4 A;  3V5Y A;  2NUP A;  2OJQ A;  1QLE C;  2HUJ A;  1WAT A;  2P6V A;  3O10 A;  5K0I A;  5L0F A;  3W2V A;  1N1C A;  2D5R B;  2G62 A;  2L6H A;  3FAJ A;  4I44 A;  1E2X A;  2EIM C;  2H7O A;  2KW3 C;  1QZX A;  2CYD A;  3ZQY A;  1MNE A; 
#chains in the Genus database with same CATH homology
 3EQL F;  1O5H A;  3K6B A;  3K7D A;  3W8H A;  5L3V A;  1D0X A;  1BR1 A;  2R7W A;  4HEA J;  4QDL A;  1D1B A;  3LS0 A;  5KYU A;  4C3B A;  1TWA A;  2KQ9 A;  3DM5 A;  4PJJ A;  4XWJ A;  2R7V A;  5CI9 A;  1G8X A;  2R7R A;  2DYS C;  3EH1 A;  5CI8 A;  5KYY A;  3SYN A;  3KMI A;  1M2O A;  4YT5 A;  1TWC A;  3DD7 A;  4Q4Z F;  1FFH A;  1LS1 A;  1NG1 A;  1ZHZ A;  3ECS A;  3UNG C;  5DS6 A;  1ZHY A;  3PMR A;  4U5G A;  1M57 C;  2XXA A;  3ABM C;  2PX0 A;  5EHH A;  2Y3B A;  1Z6A A;  4AK9 A;  1ZU4 A;  4PFP A;  4FES A;  3Q7G A;  4JVS A;  2JD3 A;  2H7B A;  2IYL D;  1ST6 A;  3B9Q A;  3ABL C;  2FFH A;  2P7V A;  4AE4 B;  4HE8 D;  3ASO C;  5IY5 C;  2VH3 A;  1ZHX A;  3RFY A;  2Q9A A;  5KYU B;  2GFH A;  4RBN A;  3DJU B;  4IWB A;  1PD1 A;  2J7P D;  1O87 A;  2WZG A;  2Y39 A;  1S7Z A;  1MND A;  4OIN F;  1OKK A;  3V7O A;  3JRT A;  5T1D B;  2WVN A;  4ZLC A;  5DS5 A;  4PJN A;  4BJ1 A;  4O6M A;  1D1C A;  2R7X A;  3PHF 2;  4C3D A;  4CS8 C;  3DAG A;  3S27 A;  4RD9 A;  2A69 F;  3JT1 A;  4BJ5 C;  4DBQ A;  5FCL A;  4PK4 A;  1NU9 C;  1IZM A;  3ZVR A;  2YEV A;  4BJ6 A;  2A6H F;  4W8K A;  1TWH A;  4KBL A;  4YN0 B;  4E7S A;  2LSE A;  2WL8 A;  4JZA A;  2PP4 A;  1MMA A;  2OG2 A;  2IOQ A;  3SZR A;  4JW1 A;  4C7O A;  3EG9 B;  2XRH A;  4LLC A;  2E87 A;  2KNH A;  3EGX B;  1OCC C;  4BJT A;  4CSA C;  2L9J A;  5DS4 A;  3QZC A;  1PD0 A;  1WGW A;  4AE4 A;  1VYK A;  3EGD A;  4B6I A;  3AG3 C;  3B0P A;  4GYT A;  4OIR F;  4LAC B;  4O6N A;  1M2V B;  1TKN A;  4PJM A;  3IEE A;  2PF4 E;  4ZLD A;  3X1O A;  4A2N B;  3SP1 A;  4CBE A;  4NY3 A;  1KU2 A;  2IXP A;  3LES A;  1FTS A;  1SF8 A;  2IXN A;  5EGY A;  3UGP A;  1D0Y A;  3DAF A;  2NUP B;  5KYW A;  2WZF A;  4EWC A;  3W8I A;  5DLJ A;  4H4K C;  2NUT A;  2Y69 C;  3HJC A;  2R7Q A;  2WZL A;  3NG1 A;  3N0T A;  3HLZ A;  4JUR I;  1V55 C;  4K0D A;  4YWQ A;  3EG9 A;  3NKD A;  2Z15 A;  3NYJ A;  1NZE A;  1FMW A;  2J9U A;  1MMN A;  2ZXW C;  3DJN B;  3K33 A;  3DMD A;  3ZG1 A;  3EFO B;  2Q9C A;  4IAO A;  4O6Y A;  1FMV A;  3UGO A;  2XL4 A;  2O9X A;  4JCH A;  5E3C A;  4Q5S F;  4P6I C;  2DGJ A;  5B1A C;  3ASN C;  4KC9 A;  2ZXR A;  2Y3H A;  2CNW D;  1MMD A;  4J30 B;  3FHD A;  4CS8 A;  4JJF A;  3MLG A;  5KYY B;  2J9W A;  5KYN A;  4XLN F;  4J32 B;  3NDB B;  2R7U A;  3K66 A;  1VYI A;  3AQB A;  3KKB A;  5T3T A;  3EFO A;  3OA1 A;  1ZHW A;  4BJ5 A;  2VB6 A;  3KH2 A;  3B0V C;  4FX5 A;  2NUT B;  5D91 A;  4LER A;  2WVO A;  3S0X A;  3I4U A;  4OIP F;  4Q7C A;  3F47 A;  4I3M A;  1V54 C;  2J0X A;  4C3E A;  5KYX A;  2B0J A;  4OIQ F;  4BEJ A;  2EIJ C;  4U5D E;  5KYW B;  3T6J A;  1PCX A;  1SZI A;  1TR2 A;  3ZSU A;  1M2V A;  1Z5Z A;  4FWV A;  4IJJ A;  5F5H A;  3SNH A;  3UMH A;  3UMI A;  1NU7 D;  2IXO A;  2WB7 A;  4N06 A;  3Q6M A;  3N2Z B;  1D0Z A;  4LLE A;  3EHM A;  4MND A;  3UR3 C;  4BG0 A;  2CDQ A;  4ANJ A;  2QTV A;  3ZIB A;  1OCR C;  1RJ9 B;  1J8M F;  4CS7 A;  3DZA A;  4XLP F;  3RH3 A;  4O7G A;  2EIK C;  5F5F A;  3POV A;  4U5E E;  4KNW A;  2OCC C;  3F46 A;  4U5C E;  2PX3 A;  1JPN A;  3RIP A;  3LS1 A;  4AX2 A;  3EPV A;  2V26 A;  3JCU Q;  2J9V A;  3ABK C;  3LNR A;  1BR4 A;  1D1A A;  5D92 A;  3B0U X;  3NKE A;  4G7O F;  1W2W A;  2VAS A;  1Z63 A;  4U5F E;  1ZYR F;  4WJ0 A;  5E2Q A;  4HFK B;  3CSK A;  4HFF B;  4G7H F;  1VOM A;  4CS9 A;  3ZC4 A;  3LLK A;  3JSZ A;  2CNW A;  3AG1 C;  1OCZ C;  1VMA A;  3M1C B;  3CZ6 A;  3FVY A;  3I5P A;  3OEO A;  1J8Y F;  2WVQ A;  5E3A A;  2FGY A;  2YHS A;  2IXM A;  2KGO A;  2W45 A;  4M63 A;  3OWT A;  3T6B A;  3AG2 C;  4YT2 A;  1Z3I X;  3EZI A;  2J46 A;  2W9Y A;  5DQZ A;  3S28 A;  3AG4 C;  3NYM A;  3O6X A;  4QI2 A;  2BE5 F;  5DQT A;  2MWQ A;  4C7O B;  4JJG A;  4YT8 A;  3H65 A;  4G7Z F;  4OD4 A;  3RKO F;  3KL4 A;  2R7T A;  3ITF A;  4OD5 A;  3O39 A;  3UMK A;  3I5Q A;  3W2W A;  2J7P A;  1LKX A;  1FFT C;  1OKK D;  4K7B A;  3LAY A;  2DYR C;  5KYX B;  4MQ9 F;  3NYL A;  4E7Z A;  3LLI A;  3X2Q C;  4PJL A;  4G0H A;  3NRH A;  4KNV A;  3WG7 C;  5B3S C;  2L81 A;  2QY9 A;  2EIN C;  1VK5 A;  4DBR A;  4U5H A;  2Q9B A;  4U5B E;  3HTK C;  3JYH A;  2XXA B;  1M56 C;  4BJ6 C;  2Y3D A;  2ZPA A;  2C03 A;  1JPJ A;  3EJN A;  5L3Q A;  3Q6N A;  3QMK A;  1IW7 F;  3S29 A;  4CS9 C;  4KI2 A;  2R7O A;  2MYS A;  3WOD F;  4OIO F;  4GEH A;  4YJW A;  4CIH A;  3L0I A;  2X51 A;  1Z23 A;  2C04 A;  2YZS A;  3VYW A;  4DOZ A;  4DVY P;  4QI0 A;  2NG1 A;  3L34 A;  1OCO C;  3E9V A;  3K1I C;  3FDQ A;  4PFO A;  5E33 A;  2KJG A;  3Q7L A;  4DVZ A;  5HSW A;  2A68 F;  4O79 A;  2PFD A;  2CW0 F;  3MX3 A;  1ZHT A;  3DM9 B;  3AQC A;  3EH2 A;  1BR2 A;  3K1H A;  3TD7 A;  2V3C C;  2W4M A;  2G3K A;  2G3V A;  3E70 C;  2ZXP A;  3EGD B;  3LEV A;  3GOD A;  1TWG A;  3VAY A;  2H7V C;  2ZXO A;  3RYL A;  2CGE A;  1RJ9 A;  4ULW A;  3CQZ A;  2M4E A;  3EHN A;  4X0R A;  1MMG A;  2Q3T A;  3DXJ F;  5BUO A;  3EGX A;  1ZU5 A;  2XSE A;  4I1M A;  4I1O B;  5T3W A;  3T4R A;  4CSA A;  3GAN A;  2HV7 A;  5DVW A;  3LJB A;  2A1D D;  4RDA A;  4F4B A;  2J0W A;  2Y3G A;  3EZH A;  3SEO A;  2A6E F;  2J45 A;  4IRU A;  5B1B C;  2EIL C;  2W4B A;  1LVK A;  2I8B A;  3N24 A;  4XTK A;  1SMY F;  2R7S A;  2HV6 A;  4EBB A;  4YT4 A;  2NUP A;  1QLE C;  2P6V A;  3W2V A;  1N1C A;  2D5R B;  2G62 A;  3FAJ A;  4I44 A;  2EIM C;  2H7O A;  2KW3 C;  1QZX A;  1MNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...