4GYTA

Crystal structure of lpg0076 protein from legionella pneumophila
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
177
structure length
177
Chain Sequence
SLHLPKYDDFVQSISVLALTMSGSELHGIMCGYLCAGADSQGEAYIRALLNNKKDEQSRNALLSMFSVFSISQQQMNNFDFEFEMLLPDDDESLVTRAQAFSEWCEGFTQGLTIAGVGMEQFYEEESQDALQHLMEFAELDCESLEVGEEDERALMEVSEYTRMAVLRLHSDLVLHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title Crystal structure of lpg0076 protein from Legionella pneumophila
rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Structural genomics, unknown function
total genus 70
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03695 UPF0149 Uncharacterised protein family (UPF0149)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.740 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4gytA00
1IZMA 4GYTA
chains in the Genus database with same CATH superfamily
2A69F 3UMKA 2XRHA 5T3TA 3RVYA 4CS9C 3C8GD 3LESA 3WG7C 3PDMP 3ZQVA 5DS4A 3MYIA 4J32B 4PJLA 1LI5A 1Z7Qc 4OD4A 2HFIA 2DGJA 2J9WA 1JMWA 4MQ9F 2G62A 2M64A 5JRAA 3JRMO 2R05A 3QMKA 4LDRA 1LS4A 1JAFA 4EWCA 4G7HF 1NSGB 1QLEC 2HSBA 3C8ZA 3LS0A 2OEVA 3L8JA 4MVZA 1RCPA 5L0GA 4BG0A 4OIRF 1JOGA 1Q0DA 4H4KC 4U9EA 2LSEA 4NC3A 2OJED 1WTYA 3KYIA 3W8IA 1YA7O 2D4UA 3EPVA 2IBFA 4JKVA 1M2OA 2J9BA 3KMIA 2YL0A 2Y3HA 3H2VA 1R4TA 1ZVZA 2QLAA 1L7CA 3DD7A 1YYJA 2P6VA 2KC3A 4U5DE 3SXZA 1D1AA 1OCOC 2YEVA 1OW6A 1Z23A 3ZSUA 2X0CA 3QW1A 2HS5A 4OIOF 5A6BD 3BRJA 1YJGA 2P0NA 4CIHA 3UR3C 3SZRA 2PNOA 2JPUA 1H7IA 3K1HA 2LFFA 4PJNA 2C04A 4JTCB 3LAYA 3VYWA 1LIHA 4ER9A 2A6EF 1D1BA 3WAQA 2H7OA 3S28A 3NRHA 4N06A 1I4ZA 4E17A 1KU2A 1QKRA 1EI7A 4XEKA 3JSZA 4XTKA 2G3KA 1NG1A 3TOMA 2GFHA 4XEVA 2C03A 2EPMX 1S7ZA 5IY5C 5HV9A 1NBBA 3AG2C 3NYJA 3NMIA 2RD9A 1ZHYA 3L34A 2YRFA 4JC7A 4JZAA 3O10A 2Q00A 1Z5ZA 5DS6A 1EKYA 4CS8C 1TKNA 2AVKA 2J9VA 4IGGA 4B6IA 3MLGA 2BL2A 3G4XA 3A9CA 3EGDB 1V55C 3HNLA 3HTKC 3GWNA 5D91A 1MNEA 5FCLA 3K1IA 4UDVA 1LPEA 2Y3BA 3HNJA 3MFNA 4OINF 5A69A 4OIQF 1YDIA 3OEOA 1HW2A 3G4ZA 1L3PA 1SMYF 5JP7A 1H9GA 1WOLA 2FAPB 1T6IA 2PBEA 3EZIA 3HJCA 4A2NB 4E0HA 1CPQA 1CGOA 2NUTA 4MVOA 1G4WR 2Y69C 3UMHA 1G5ZA 2ZXRA 4YT5A 3RIPA 4DOZA 2EILC 4WGYA 3E70C 4EBKA 1QZXA 4R32A 5KYYB 2YHSA 3IPMO 2UUHA 1MNDA 2ZXWC 3ZTMA 2B0JA 5JUAA 2XXAB 1EQ1A 3FXHA 4Z9IA 2EIKC 4E7ZA 4D4NA 1A41A 4J7TA 3N0TA 2XS8A 5B3SC 1ORYA 1VLTA 4JRZA 2QE9A 4JTDB 1M56C 2R03A 4FESA 2GA0A 1OCCC 4U5GA 1LS1A 2HJMA 4A4AA 1VOMA 2LQGA 2HSQA 1DOVA 4CX9A 3CQZA 4W8KA 4NY3A 2WZLA 4MW8A 3IQCA 3Q7GA 3T6GB 1GM5A 3KKBA 4I1MA 4Z9HA 2WZGA 4JJGA 3B0UX 1ZHWA 1T6UA 5L3QA 4CSAA 4JEAA 1O3UA 4RBNA 2CNWA 1H9TA 3PMRA 3I5QA 4C7OB 5AGFA 3NMJA 4ZLCA 3LUTB 4HE8D 5DLJA 2ZXOA 1FTSA 4YN0B 3T4RA 3VAYA 2R9RB 2XXAA 3EGXA 5BQGA 4AX2A 2RSEB 3GODA 3IQ6A 2J7PA 2OU6A 1T01A 3AG1C 3B71A 4IAQA 3U3BA 5GPGB 1OQCA 5K0IA 1PD0A 3C8GA 3EQLF 4XEFA 4JCHA 2P7VA 2QUPA 3AJMA 3EHMA 4MVSA 1VYIA 2Q9BA 5FZTA 4MNDA 2CCYA 2R7XA 4U9DA 1HE1A 1AEPA 1B68A 3KH2A 4U5EE 3UGOA 3LNRA 1ORSC 1TWCA 2Q7RA 4HFKB 4LERA 4O6NA 2KW3C 3U9JA 3W4YA 4YT2A 2OQMA 2IXNA 5A6AA 4JW1A 3VM6A 3NYLA 2B0HA 1A7EA 1TFKB 1KNYA 2EPNA 1SR2A 2VASA 3LLIA 2O9XA 4C7OA 2W4MA 2AWCA 4AK9A 4X0RA 2NPUA 5KYUA 2H7VC 3RVZA 3QZCA 4E18A 2XLMA 3CEXA 3NDBB 1ZHZA 3UNGC 2ZPAA 4J7YA 3POVA 1I5NA 1XZQA 2ASRA 2NSGA 2P61A 3EJNA 2HKVA 2IOQA 1MQVA 3HKKA 3JSEO 4JEBA 2J8WA 4ULWA 2R7UA 4MW3A 4XLPF 3K1IC 4ULVA 3B9QA 4IWBA 4PJJA 3ABLC 4WJ0A 1HMDA 3K66A 3I5PA 1OW8A 4PFOA 2BE5F 2L6FA 2I15A 2WVQA 1E83A 1TWAA 2VH3A 2Q4FA 3M79A 1OXKA 1OKKD 4EKWA 4RDAA 1MMGA 2KGOA 2YL3A 2FFHA 2L9JA 3O55A 4M63A 5L3VA 1PCXA 2FGYA 1Z63A 1WN0A 5JS5A 3R2PA 1MMNA 4IB4A 1T6QA 4PR9A 2Q9AA 1IW7F 1TWHA 2XS1A 3G50A 4W8PA 1PV3A 4QI0A 1GS9A 4NCQA 2M4EA 3S9OA 1YAUO 1RKCA 1Q0MA 2XM4A 3EFOA 2XL8A 4HFFB 4Z9JA 2NUTB 3GANA 2DYSC 3S29A 1OW7A 2CYDA 3JZ0A 3TQOA 1OCRC 1EA8A 3U8PA 2EPKX 2V26A 1A7DA 3ASOC 4LACB 2MYSA 5L0HA 2IXOA 4AL1A 3HLZA 4U5BE 3JT1A 4OD5A 1W2WA 4XPWA 3W8HA 2R7TA 3A11A 2R25A 3AOUA 1H6GA 2Q9CA 1BR1A 2A68F 3LLKA 1A7VA 1V74B 4YL3A 1Y4CA 3DI5A 4IRUA 1D1CA 2EIJC 3GORA 3IQ5A 5AC5A 4KNVA 3S27A 2PP4A 3U9MA 2XLEA 1I4YA 2XSEA 1CGNA 1RMVA 1RXQA 3SEOA 2F22A 1PD1A 2AU5A 3JRTA 3MX3A 4AL0A 4ZLDA 1N1CA 1VMAA 2ICWG 2LFDA 2XM0A 3KPHA 3RH3A 2PX3A 1VYKA 5CIVA 2KK1A 1HE9A 1VB5A 1LKXA 3JTLO 1OXBA 4P9TA 1MMDA 1JRAA 2EPOA 4PACA 4EIYA 1M57C 3GEEA 2A0BA 1BBHA 3Q7LA 5B1BC 4D4XA 4EHPA 2OJQA 1Z3IX 3EH2A 2XLHA 2DYRC 3DMDA 3DJUB 3ZWIA 1A0BA 1LE2A 2J0XA 4CS7A 3M4CA 3SXKA 4E7SA 2Y3DA 3N2ZB 4JJFA 3EGXB 2W4BA 3GEIA 3GM3A 5D92A 2HUJA 4MTFA 4ANJA 3FAJA 1VK5A 2WZFA 1NU9C 4K0DA 3C8GB 3DXJF 4BJ5A 2W45A 3QW0A 4Q5SF 3R7CA 2L81A 4BJ6A 3K6BA 1K05A 4LDKA 5EHHA 3H2UA 2KJGA 4YL1A 2LD6A 1VLSA 2J45A 2XL4A 4C3DA 2AP3A 1CPRA 5COMA 3ZTZA 1WATA 3IEEA 5BQIA 3CSKA 4RD9A 3RQFA 4WGZA 5BUOA 1E86A 2OEXA 3GM1A 3B0PA 2MWQA 1LVKA 2CGEA 2XLWA 3HNKA 2HMQA 2I8BA 3WODF 4CDYA 5KYWA 1Z6AA 2A6HF 3AGUA 4G7OF 1Q0KA 3ECSA 4JIOA 3ZVRA 3SXYA 3U2LA 2OKUA 2WB7A 1DOWA 3MYFA 3O6XA 3FOOA 1S05A 2X51A 3LJBA 1ZW3A 5KYUB 1HY5A 4Q7CA 3X1OA 2CW0F 1XWJA 2VCAA 2A0UA 3KYJA 3DKAA 3ABMC 4XQ1A 1O87A 4DRJB 3T9OA 4K1OA 4XPYA 3DE9A 5B3IA 3HNIA 3U5SA 2H8AA 3NG1A 1HW1A 2AWYA 5E2QA 4EBBA 4C3BA 5T3WA 3DZAA 2KYHA 2R7OA 2HV6A 4CS8A 3AG3C 1YARO 1V4AA 3DE8A 5COFA 2CDQA 4CJGA 5DVWA 2R7WA 4HEAJ 5A6JA 4IAOA 1TFOB 2Z15A 1XZPA 4PK4A 1Q0GA 2JX0A 4G0HA 1QPUA 4U5HA 1BDJB 1C03A 4ONSA 2ZD9A 1NFNA 5E3AA 4DBRA 1SF8A 2YLIA 2VCBA 3K33A 2NUPA 1VTMP 2JD3A 3ZDLA 3EFOB 3GM2A 4J30B 5L0IA 5A6BA 4IARA 1JPNA 2J46A 2Y3GA 4YWQA 3EZHA 2IXMA 4I44A 1M6TA 1TR2A 4N6HA 4AE4A 3TK0A 4Q4ZF 4MVMA 2QY9A 4DRIB 4CIPA 2R7VA 2OOCA 3U8VA 1C02A 2LP4A 4P9FA 5CI9A 4XLNF 2EIMC 1Q0FA 4EBJA 5AC4A 1D0ZA 1M2VA 3Q6NA 4KI2A 4DBQA 1FR0A 4XPXA 4YL0A 4YT4A 4GYTA 5E3CA 1ORJA 3I4UA 1U0BB 3O39A 3F46A 1TQGA 3V5YA 2ETSA 4DJ9A 4DXWA 4MVUA 1V54C 1C17M 5COGA 1AUEA 3LNMB 3ZG1A 2QTVA 4IJJA 1ZHXA 1GQAA 1RKEA 4KNWA 2Q3TA 2KSFA 2WVOA 3FMSA 3QVZA 2GDCA 2L6HA 2YLDA 5JLIA 1U6HA 3RW0A 2YLGA 5L0JA 5KYXB 1K04A 2G3VA 5HSWA 1RJ9B 1E2XA 3N24A 4JCZA 1FMVA 2IYLD 3MBGA 4U5FE 3B0VC 5F5FA 2XLOA 1GGQA 2E87A 2P1AA 1D0YA 4BJ5C 1YYXA 3JCUQ 4BJ6C 4EUKB 4JURI 5JVEA 3CAXA 3JYHA 4DVYP 1ZYRF 1MMAA 2NSFA 5A6KA 1OR2A 3S84A 4G7ZF 3AQCA 1E85A 2TMVP 1J8YF 3AGTA 1BZ4A 3PCVA 4XWJA 1HMOA 5L0DA 3NMKA 4P6IC 2XLDA 2VCCA 1TWGA 3TD7A 2YWAA 3FHDA 3EG9A 3RQGA 1WWPA 3NYMA 3US6A 4CSAC 1QVXA 4FX5A 2YKZA 4MS2A 4BPMA 3C62A 2YQYA 2XL6A 1K40A 2HZ8A 4LLEA 2GWWA 5DS5A 1U89A 3OWTA 3VF0A 3Q6MA 3JYYA 4N4WA 5EGYA 4MVQA 3SNHA 1QSPA 4FAPB 3UMIA 5KYWB 2WVNA 1YLMA 1ZW2A 1FAPB 2IXPA 3U3FA 1JPJA 5KYXA 1RJ9A 4JE9A 2IM8A 1LM3B 4PFPA 1FFHA 3DAGA 3LS1A 4DVZA 1AVOB 2HV7A 1CGME 2YL1A 3V5XA 2OG2A 3M4BA 5DQZA 3F47A 4CS9A 4OIPF 4WABA 3X2QC 3M1CB 2PF4E 5E33A 3V7OA 2KQ9A 2R7QA 1YZCA 4I1OB 2LCHA 5F28E 1O5HA 4BEMJ 3PHF2 1ZHTA 5L0CA 4MTGA 1SYQA 3SXMA 3TULA 2HJ3A 2LIGA 1F1MA 2D5RB 4CDAA 3GEHA 5B1AC 4G78A 4F4BA 4O7GA 1ZU4A 3BEHA 2PFDA 3B29A 3WHNA 3ZQYA 5JT4A 1WASA 3FAPB 3C63A 4K7BA 1NU7D 3IHUA 3ZIBA 4CDVA 3DAFA 3J06A 3DM5A 5CI8A 3IQTA 2PX0A 1BR2A 4LLCA 3AG4C 2XLVA 5L0FA 2W9YA 3U0CA 5T1DB 3W2VA 3EHNA 3TJ6A 5KYNA 1T9KA 3SP1A 3S0XA 3OA1A 4NQFA 2ZXPA 4LDQA 1QQ3A 1J8MF 3RFYA 4MVRA 2NUPB 1ZZPA 3SYNA 1KTMA 3QVYA 4KC9A 5DQTA 4QI2A 3E9VA 1LI7A 2A1DD 3AQBA 3ATPA 4O6MA 4C3EA 1YA9A 256BA 3RKOF 4AE4B 2H7BA 3ABKC 4YT8A 2R02A 1FNTc 1FFTC 3ASNC 1FMWA 3EGDA 4YK5A 2EPLX 1APCA 3GWLA 3QTHA 2DI3A 3EH1A 4DRHB 1JR8A 2R7SA 1SZIA 3KL4A 4JVSA 3ITFA 4NTFA 4U5CE 3NKEA 2J9UA 1OCZC 1M2VB 3K7DA 3NKDA 4L6RA 3VRCA 2GAQA 4BJ1A 2J0WA 3UGPA 5F5HA 1UFBA 3RYLA 1E84A 5EK0A 1YVIA 4H54A 5JSLA 2QNLA 1IZMA 5KYYA 1ZU5A 3M15A 1RKEB 3FVYA 1Y6DA 2LK4A 1G4US 1OKKA 1NLXA 1UG7A 3RF3A 3S90A 2DB4A 1T5OA 5TJ5E 2YZSA 4O79A 3DM9B 2L7AA 3DJNB 1LE4A 3W2WA 1NFOA 2WL8A 2V3CC 4PJMA 4I3MA 2YVKA 4GEHA 4BEJA 3C18A 1ST6A 3RQEA 1YZAA 2HMZA 2VC9A 4CJOA 4NTAA 3FDQA 1WGWA 3CZ6A 2CNWD 3ZC4A 4E0IA 3L8IA 4QDLA 3LEVA 3H65A 3U2MA 3FOPA 5BQHA 2NG1A 2YL7A 2KNHA 3C7JA 3EG9B 4KBLA 4MTOA 4NTBA 3L0IA 4CBEA 4GQHA 4BJTA 2UUIA 1NZEA 4N6CA 4O6YA 3V5ZA 2VB6A 3LEOA 2R7RA 4FWVA 2Y39A 1D0XA 3T6JA 1G8XA 3L1MA 4JTAB 3TJ5A 2BC5A 2MHRA 3DWWA 3T6BA 1BR4A 1R5ID 2EINC 1OR3A 2OCCC 4YJWA 2L6GA 2J7PD 3TOLA
chains in the Genus database with same CATH topology
2A69F 3UMKA 2XRHA 5T3TA 4CS9C 3LESA 3WG7C 5DS4A 4J32B 4PJLA 4OD4A 2DGJA 2J9WA 4MQ9F 2G62A 3QMKA 4EWCA 4G7HF 1QLEC 3LS0A 4BG0A 4OIRF 4H4KC 2LSEA 3W8IA 3EPVA 1M2OA 3KMIA 2Y3HA 3DD7A 4U5DE 2P6VA 1D1AA 1OCOC 2YEVA 1Z23A 3ZSUA 4OIOF 4CIHA 3UR3C 3SZRA 3K1HA 4PJNA 2C04A 3LAYA 3VYWA 2A6EF 1D1BA 2H7OA 3S28A 3NRHA 4N06A 1KU2A 3JSZA 4XTKA 2G3KA 1NG1A 2GFHA 2C03A 1S7ZA 5IY5C 3AG2C 3NYJA 3L34A 1ZHYA 4JZAA 1Z5ZA 5DS6A 4CS8C 1TKNA 2J9VA 4B6IA 3MLGA 3EGDB 5FCLA 1V55C 3HTKC 5D91A 1MNEA 2Y3BA 4OINF 4OIQF 3OEOA 1SMYF 4A2NB 3HJCA 3EZIA 2NUTA 2Y69C 3UMHA 2ZXRA 4YT5A 3RIPA 4DOZA 2EILC 3E70C 1QZXA 5KYYB 2YHSA 1MNDA 2ZXWC 2XXAB 2B0JA 2EIKC 4E7ZA 3N0TA 5B3SC 1M56C 4FESA 4U5GA 1OCCC 1LS1A 1VOMA 3CQZA 4W8KA 4NY3A 2WZLA 3Q7GA 3KKBA 4I1MA 2WZGA 4JJGA 1ZHWA 4CSAA 5L3QA 4RBNA 2CNWA 3PMRA 3I5QA 4C7OB 4ZLCA 4HE8D 5DLJA 2ZXOA 1FTSA 4YN0B 3T4RA 3VAYA 2XXAA 3EGXA 4AX2A 3GODA 2J7PA 3AG1C 1PD0A 3EQLF 4JCHA 2P7VA 3EHMA 1VYIA 2Q9BA 4MNDA 2R7XA 3UGOA 3KH2A 4U5EE 3LNRA 1TWCA 4HFKB 4LERA 4O6NA 2KW3C 4YT2A 2IXNA 4JW1A 3NYLA 3LLIA 2VASA 2O9XA 4C7OA 2W4MA 4AK9A 4X0RA 5KYUA 2H7VC 3QZCA 3NDBB 1ZHZA 3UNGC 2ZPAA 3POVA 3EJNA 2IOQA 4ULWA 2R7UA 3K1IC 3B9QA 4IWBA 4PJJA 3ABLC 4WJ0A 3K66A 3I5PA 4PFOA 2BE5F 2WVQA 1TWAA 2VH3A 1OKKD 4RDAA 1MMGA 2KGOA 2FFHA 2L9JA 4M63A 1Z63A 5L3VA 1PCXA 2FGYA 1MMNA 2Q9AA 1IW7F 1TWHA 4QI0A 2M4EA 3EFOA 4HFFB 2NUTB 3GANA 2DYSC 3S29A 1OCRC 2V26A 3ASOC 4LACB 2MYSA 2IXOA 3HLZA 4U5BE 3JT1A 4OD5A 1W2WA 3W8HA 2R7TA 2Q9CA 1BR1A 2A68F 3LLKA 4IRUA 1D1CA 2EIJC 4KNVA 3S27A 2PP4A 2XSEA 3SEOA 1PD1A 3JRTA 3MX3A 1N1CA 1VMAA 3RH3A 2PX3A 1VYKA 1LKXA 1MMDA 1M57C 3Q7LA 5B1BC 1Z3IX 3EH2A 2DYRC 3DMDA 3DJUB 2J0XA 4CS7A 4E7SA 2Y3DA 3N2ZB 4JJFA 3EGXB 2W4BA 5D92A 4ANJA 3FAJA 1VK5A 2WZFA 1NU9C 4K0DA 3DXJF 4BJ5A 2W45A 4Q5SF 2L81A 4BJ6A 3K6BA 5EHHA 2KJGA 2J45A 2XL4A 4C3DA 3IEEA 3CSKA 4RD9A 5BUOA 3B0PA 2MWQA 1LVKA 2CGEA 3WODF 5KYWA 2I8BA 1Z6AA 2A6HF 4G7OF 3ZVRA 3ECSA 2WB7A 3O6XA 2X51A 3LJBA 5KYUB 4Q7CA 3X1OA 2CW0F 3ABMC 1O87A 3NG1A 5E2QA 4EBBA 4C3BA 5T3WA 3DZAA 2R7OA 2HV6A 4CS8A 3AG3C 2CDQA 5DVWA 2R7WA 4HEAJ 4IAOA 2Z15A 4PK4A 4G0HA 4U5HA 5E3AA 4DBRA 1SF8A 3K33A 2NUPA 2JD3A 3EFOB 4J30B 1JPNA 2J46A 2Y3GA 4YWQA 3EZHA 2IXMA 4I44A 1TR2A 4AE4A 4Q4ZF 2QY9A 2R7VA 5CI9A 4XLNF 2EIMC 1D0ZA 1M2VA 3Q6NA 4KI2A 4DBQA 4YT4A 4GYTA 5E3CA 3I4UA 3O39A 3F46A 1V54C 3ZG1A 2QTVA 4IJJA 1ZHXA 4KNWA 2Q3TA 2WVOA 5KYXB 2G3VA 5HSWA 1RJ9B 3N24A 1FMVA 2IYLD 4U5FE 3B0VC 5F5FA 2E87A 1D0YA 4BJ5C 3JCUQ 4BJ6C 4JURI 3JYHA 4DVYP 1ZYRF 1MMAA 4G7ZF 3AQCA 1J8YF 4XWJA 4P6IC 1TWGA 3TD7A 3FHDA 3EG9A 3NYMA 4CSAC 4FX5A 5DS5A 4LLEA 3OWTA 3Q6MA 5EGYA 3SNHA 3UMIA 5KYWB 2WVNA 2IXPA 5KYXA 1JPJA 1RJ9A 4PFPA 1FFHA 3DAGA 3LS1A 4DVZA 2HV7A 2OG2A 5DQZA 3F47A 4CS9A 4OIPF 3X2QC 3M1CB 2PF4E 5E33A 3V7OA 2KQ9A 2R7QA 4I1OB 1O5HA 3PHF2 1ZHTA 4F4BA 2D5RB 5B1AC 4O7GA 1ZU4A 2PFDA 4K7BA 1NU7D 3ZIBA 3DAFA 3DM5A 5CI8A 2PX0A 1BR2A 4LLCA 3AG4C 2W9YA 5T1DB 3W2VA 3EHNA 5KYNA 3SP1A 3S0XA 3OA1A 2ZXPA 1J8MF 3RFYA 2NUPB 3SYNA 4QI2A 4KC9A 5DQTA 3E9VA 2A1DD 3AQBA 4O6MA 4C3EA 3RKOF 4AE4B 4YT8A 2H7BA 3ABKC 1FFTC 3ASNC 1FMWA 3EGDA 4ZLDA 3EH1A 2R7SA 1SZIA 3KL4A 4JVSA 3ITFA 4U5CE 3NKEA 2J9UA 1OCZC 1M2VB 3K7DA 3NKDA 4BJ1A 2J0WA 3UGPA 5F5HA 3RYLA 1IZMA 5KYYA 1ZU5A 3FVYA 1OKKA 2YZSA 4O79A 3DM9B 3DJNB 3W2WA 2WL8A 2V3CC 4PJMA 4I3MA 4GEHA 4BEJA 1ST6A 3FDQA 1WGWA 3CZ6A 2CNWD 3ZC4A 4QDLA 3LEVA 3H65A 2NG1A 2KNHA 3EG9B 4KBLA 4CBEA 3B0UX 3L0IA 4XLPF 4BJTA 1NZEA 4O6YA 2R7RA 2VB6A 4FWVA 2Y39A 1D0XA 3T6JA 1G8XA 3T6BA 1BR4A 2EINC 2OCCC 4YJWA 2J7PD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IZM A;  4GYT A; 
#chains in the Genus database with same CATH topology
 2A69 F;  3UMK A;  2XRH A;  5T3T A;  3RVY A;  4CS9 C;  3C8G D;  3LES A;  3WG7 C;  3PDM P;  3ZQV A;  5DS4 A;  3MYI A;  4J32 B;  4PJL A;  1LI5 A;  1Z7Q c;  4OD4 A;  2HFI A;  2DGJ A;  2J9W A;  1JMW A;  4MQ9 F;  2G62 A;  2M64 A;  5JRA A;  3JRM O;  2R05 A;  3QMK A;  4LDR A;  1LS4 A;  1JAF A;  4EWC A;  4G7H F;  1NSG B;  1QLE C;  2HSB A;  3C8Z A;  3LS0 A;  2OEV A;  3L8J A;  4MVZ A;  1RCP A;  5L0G A;  4BG0 A;  4OIR F;  1JOG A;  1Q0D A;  4H4K C;  4U9E A;  2LSE A;  4NC3 A;  2OJE D;  1WTY A;  3KYI A;  3W8I A;  1YA7 O;  2D4U A;  3EPV A;  2IBF A;  4JKV A;  1M2O A;  2J9B A;  3KMI A;  2YL0 A;  2Y3H A;  3H2V A;  1R4T A;  1ZVZ A;  2QLA A;  1L7C A;  3DD7 A;  1YYJ A;  2P6V A;  2KC3 A;  4U5D E;  3SXZ A;  1D1A A;  1OCO C;  2YEV A;  1OW6 A;  1Z23 A;  3ZSU A;  2X0C A;  3QW1 A;  2HS5 A;  4OIO F;  5A6B D;  3BRJ A;  1YJG A;  2P0N A;  4CIH A;  3UR3 C;  3SZR A;  2PNO A;  2JPU A;  1H7I A;  3K1H A;  2LFF A;  4PJN A;  2C04 A;  4JTC B;  3LAY A;  3VYW A;  1LIH A;  4ER9 A;  2A6E F;  1D1B A;  3WAQ A;  2H7O A;  3S28 A;  3NRH A;  4N06 A;  1I4Z A;  4E17 A;  1KU2 A;  1QKR A;  1EI7 A;  4XEK A;  3JSZ A;  4XTK A;  2G3K A;  1NG1 A;  3TOM A;  2GFH A;  4XEV A;  2C03 A;  2EPM X;  1S7Z A;  5IY5 C;  5HV9 A;  1NBB A;  3AG2 C;  3NYJ A;  3NMI A;  2RD9 A;  1ZHY A;  3L34 A;  2YRF A;  4JC7 A;  4JZA A;  3O10 A;  2Q00 A;  1Z5Z A;  5DS6 A;  1EKY A;  4CS8 C;  1TKN A;  2AVK A;  2J9V A;  4IGG A;  4B6I A;  3MLG A;  2BL2 A;  3G4X A;  3A9C A;  3EGD B;  1V55 C;  3HNL A;  3HTK C;  3GWN A;  5D91 A;  1MNE A;  5FCL A;  3K1I A;  4UDV A;  1LPE A;  2Y3B A;  3HNJ A;  3MFN A;  4OIN F;  5A69 A;  4OIQ F;  1YDI A;  3OEO A;  1HW2 A;  3G4Z A;  1L3P A;  1SMY F;  5JP7 A;  1H9G A;  1WOL A;  2FAP B;  1T6I A;  2PBE A;  3EZI A;  3HJC A;  4A2N B;  4E0H A;  1CPQ A;  1CGO A;  2NUT A;  4MVO A;  1G4W R;  2Y69 C;  3UMH A;  1G5Z A;  2ZXR A;  4YT5 A;  3RIP A;  4DOZ A;  2EIL C;  4WGY A;  3E70 C;  4EBK A;  1QZX A;  4R32 A;  5KYY B;  2YHS A;  3IPM O;  2UUH A;  1MND A;  2ZXW C;  3ZTM A;  2B0J A;  5JUA A;  2XXA B;  1EQ1 A;  3FXH A;  4Z9I A;  2EIK C;  4E7Z A;  4D4N A;  1A41 A;  4J7T A;  3N0T A;  2XS8 A;  5B3S C;  1ORY A;  1VLT A;  4JRZ A;  2QE9 A;  4JTD B;  1M56 C;  2R03 A;  4FES A;  2GA0 A;  1OCC C;  4U5G A;  1LS1 A;  2HJM A;  4A4A A;  1VOM A;  2LQG A;  2HSQ A;  1DOV A;  4CX9 A;  3CQZ A;  4W8K A;  4NY3 A;  2WZL A;  4MW8 A;  3IQC A;  3Q7G A;  3T6G B;  1GM5 A;  3KKB A;  4I1M A;  4Z9H A;  2WZG A;  4JJG A;  3B0U X;  1ZHW A;  1T6U A;  5L3Q A;  4CSA A;  4JEA A;  1O3U A;  4RBN A;  2CNW A;  1H9T A;  3PMR A;  3I5Q A;  4C7O B;  5AGF A;  3NMJ A;  4ZLC A;  3LUT B;  4HE8 D;  5DLJ A;  2ZXO A;  1FTS A;  4YN0 B;  3T4R A;  3VAY A;  2R9R B;  2XXA A;  3EGX A;  5BQG A;  4AX2 A;  2RSE B;  3GOD A;  3IQ6 A;  2J7P A;  2OU6 A;  1T01 A;  3AG1 C;  3B71 A;  4IAQ A;  3U3B A;  5GPG B;  1OQC A;  5K0I A;  1PD0 A;  3C8G A;  3EQL F;  4XEF A;  4JCH A;  2P7V A;  2QUP A;  3AJM A;  3EHM A;  4MVS A;  1VYI A;  2Q9B A;  5FZT A;  4MND A;  2CCY A;  2R7X A;  4U9D A;  1HE1 A;  1AEP A;  1B68 A;  3KH2 A;  4U5E E;  3UGO A;  3LNR A;  1ORS C;  1TWC A;  2Q7R A;  4HFK B;  4LER A;  4O6N A;  2KW3 C;  3U9J A;  3W4Y A;  4YT2 A;  2OQM A;  2IXN A;  5A6A A;  4JW1 A;  3VM6 A;  3NYL A;  2B0H A;  1A7E A;  1TFK B;  1KNY A;  2EPN A;  1SR2 A;  2VAS A;  3LLI A;  2O9X A;  4C7O A;  2W4M A;  2AWC A;  4AK9 A;  4X0R A;  2NPU A;  5KYU A;  2H7V C;  3RVZ A;  3QZC A;  4E18 A;  2XLM A;  3CEX A;  3NDB B;  1ZHZ A;  3UNG C;  2ZPA A;  4J7Y A;  3POV A;  1I5N A;  1XZQ A;  2ASR A;  2NSG A;  2P61 A;  3EJN A;  2HKV A;  2IOQ A;  1MQV A;  3HKK A;  3JSE O;  4JEB A;  2J8W A;  4ULW A;  2R7U A;  4MW3 A;  4XLP F;  3K1I C;  4ULV A;  3B9Q A;  4IWB A;  4PJJ A;  3ABL C;  4WJ0 A;  1HMD A;  3K66 A;  3I5P A;  1OW8 A;  4PFO A;  2BE5 F;  2L6F A;  2I15 A;  2WVQ A;  1E83 A;  1TWA A;  2VH3 A;  2Q4F A;  3M79 A;  1OXK A;  1OKK D;  4EKW A;  4RDA A;  1MMG A;  2KGO A;  2YL3 A;  2FFH A;  2L9J A;  3O55 A;  4M63 A;  5L3V A;  1PCX A;  2FGY A;  1Z63 A;  1WN0 A;  5JS5 A;  3R2P A;  1MMN A;  4IB4 A;  1T6Q A;  4PR9 A;  2Q9A A;  1IW7 F;  1TWH A;  2XS1 A;  3G50 A;  4W8P A;  1PV3 A;  4QI0 A;  1GS9 A;  4NCQ A;  2M4E A;  3S9O A;  1YAU O;  1RKC A;  1Q0M A;  2XM4 A;  3EFO A;  2XL8 A;  4HFF B;  4Z9J A;  2NUT B;  3GAN A;  2DYS C;  3S29 A;  1OW7 A;  2CYD A;  3JZ0 A;  3TQO A;  1OCR C;  1EA8 A;  3U8P A;  2EPK X;  2V26 A;  1A7D A;  3ASO C;  4LAC B;  2MYS A;  5L0H A;  2IXO A;  4AL1 A;  3HLZ A;  4U5B E;  3JT1 A;  4OD5 A;  1W2W A;  4XPW A;  3W8H A;  2R7T A;  3A11 A;  2R25 A;  3AOU A;  1H6G A;  2Q9C A;  1BR1 A;  2A68 F;  3LLK A;  1A7V A;  1V74 B;  4YL3 A;  1Y4C A;  3DI5 A;  4IRU A;  1D1C A;  2EIJ C;  3GOR A;  3IQ5 A;  5AC5 A;  4KNV A;  3S27 A;  2PP4 A;  3U9M A;  2XLE A;  1I4Y A;  2XSE A;  1CGN A;  1RMV A;  1RXQ A;  3SEO A;  2F22 A;  1PD1 A;  2AU5 A;  3JRT A;  3MX3 A;  4AL0 A;  4ZLD A;  1N1C A;  1VMA A;  2ICW G;  2LFD A;  2XM0 A;  3KPH A;  3RH3 A;  2PX3 A;  1VYK A;  5CIV A;  2KK1 A;  1HE9 A;  1VB5 A;  1LKX A;  3JTL O;  1OXB A;  4P9T A;  1MMD A;  1JRA A;  2EPO A;  4PAC A;  4EIY A;  1M57 C;  3GEE A;  2A0B A;  1BBH A;  3Q7L A;  5B1B C;  4D4X A;  4EHP A;  2OJQ A;  1Z3I X;  3EH2 A;  2XLH A;  2DYR C;  3DMD A;  3DJU B;  3ZWI A;  1A0B A;  1LE2 A;  2J0X A;  4CS7 A;  3M4C A;  3SXK A;  4E7S A;  2Y3D A;  3N2Z B;  4JJF A;  3EGX B;  2W4B A;  3GEI A;  3GM3 A;  5D92 A;  2HUJ A;  4MTF A;  4ANJ A;  3FAJ A;  1VK5 A;  2WZF A;  1NU9 C;  4K0D A;  3C8G B;  3DXJ F;  4BJ5 A;  2W45 A;  3QW0 A;  4Q5S F;  3R7C A;  2L81 A;  4BJ6 A;  3K6B A;  1K05 A;  4LDK A;  5EHH A;  3H2U A;  2KJG A;  4YL1 A;  2LD6 A;  1VLS A;  2J45 A;  2XL4 A;  4C3D A;  2AP3 A;  1CPR A;  5COM A;  3ZTZ A;  1WAT A;  3IEE A;  5BQI A;  3CSK A;  4RD9 A;  3RQF A;  4WGZ A;  5BUO A;  1E86 A;  2OEX A;  3GM1 A;  3B0P A;  2MWQ A;  1LVK A;  2CGE A;  2XLW A;  3HNK A;  2HMQ A;  2I8B A;  3WOD F;  4CDY A;  5KYW A;  1Z6A A;  2A6H F;  3AGU A;  4G7O F;  1Q0K A;  3ECS A;  4JIO A;  3ZVR A;  3SXY A;  3U2L A;  2OKU A;  2WB7 A;  1DOW A;  3MYF A;  3O6X A;  3FOO A;  1S05 A;  2X51 A;  3LJB A;  1ZW3 A;  5KYU B;  1HY5 A;  4Q7C A;  3X1O A;  2CW0 F;  1XWJ A;  2VCA A;  2A0U A;  3KYJ A;  3DKA A;  3ABM C;  4XQ1 A;  1O87 A;  4DRJ B;  3T9O A;  4K1O A;  4XPY A;  3DE9 A;  5B3I A;  3HNI A;  3U5S A;  2H8A A;  3NG1 A;  1HW1 A;  2AWY A;  5E2Q A;  4EBB A;  4C3B A;  5T3W A;  3DZA A;  2KYH A;  2R7O A;  2HV6 A;  4CS8 A;  3AG3 C;  1YAR O;  1V4A A;  3DE8 A;  5COF A;  2CDQ A;  4CJG A;  5DVW A;  2R7W A;  4HEA J;  5A6J A;  4IAO A;  1TFO B;  2Z15 A;  1XZP A;  4PK4 A;  1Q0G A;  2JX0 A;  4G0H A;  1QPU A;  4U5H A;  1BDJ B;  1C03 A;  4ONS A;  2ZD9 A;  1NFN A;  5E3A A;  4DBR A;  1SF8 A;  2YLI A;  2VCB A;  3K33 A;  2NUP A;  1VTM P;  2JD3 A;  3ZDL A;  3EFO B;  3GM2 A;  4J30 B;  5L0I A;  5A6B A;  4IAR A;  1JPN A;  2J46 A;  2Y3G A;  4YWQ A;  3EZH A;  2IXM A;  4I44 A;  1M6T A;  1TR2 A;  4N6H A;  4AE4 A;  3TK0 A;  4Q4Z F;  4MVM A;  2QY9 A;  4DRI B;  4CIP A;  2R7V A;  2OOC A;  3U8V A;  1C02 A;  2LP4 A;  4P9F A;  5CI9 A;  4XLN F;  2EIM C;  1Q0F A;  4EBJ A;  5AC4 A;  1D0Z A;  1M2V A;  3Q6N A;  4KI2 A;  4DBQ A;  1FR0 A;  4XPX A;  4YL0 A;  4YT4 A;  4GYT A;  5E3C A;  1ORJ A;  3I4U A;  1U0B B;  3O39 A;  3F46 A;  1TQG A;  3V5Y A;  2ETS A;  4DJ9 A;  4DXW A;  4MVU A;  1V54 C;  1C17 M;  5COG A;  1AUE A;  3LNM B;  3ZG1 A;  2QTV A;  4IJJ A;  1ZHX A;  1GQA A;  1RKE A;  4KNW A;  2Q3T A;  2KSF A;  2WVO A;  3FMS A;  3QVZ A;  2GDC A;  2L6H A;  2YLD A;  5JLI A;  1U6H A;  3RW0 A;  2YLG A;  5L0J A;  5KYX B;  1K04 A;  2G3V A;  5HSW A;  1RJ9 B;  1E2X A;  3N24 A;  4JCZ A;  1FMV A;  2IYL D;  3MBG A;  4U5F E;  3B0V C;  5F5F A;  2XLO A;  1GGQ A;  2E87 A;  2P1A A;  1D0Y A;  4BJ5 C;  1YYX A;  3JCU Q;  4BJ6 C;  4EUK B;  4JUR I;  5JVE A;  3CAX A;  3JYH A;  4DVY P;  1ZYR F;  1MMA A;  2NSF A;  5A6K A;  1OR2 A;  3S84 A;  4G7Z F;  3AQC A;  1E85 A;  2TMV P;  1J8Y F;  3AGT A;  1BZ4 A;  3PCV A;  4XWJ A;  1HMO A;  5L0D A;  3NMK A;  4P6I C;  2XLD A;  2VCC A;  1TWG A;  3TD7 A;  2YWA A;  3FHD A;  3EG9 A;  3RQG A;  1WWP A;  3NYM A;  3US6 A;  4CSA C;  1QVX A;  4FX5 A;  2YKZ A;  4MS2 A;  4BPM A;  3C62 A;  2YQY A;  2XL6 A;  1K40 A;  2HZ8 A;  4LLE A;  2GWW A;  5DS5 A;  1U89 A;  3OWT A;  3VF0 A;  3Q6M A;  3JYY A;  4N4W A;  5EGY A;  4MVQ A;  3SNH A;  1QSP A;  4FAP B;  3UMI A;  5KYW B;  2WVN A;  1YLM A;  1ZW2 A;  1FAP B;  2IXP A;  3U3F A;  1JPJ A;  5KYX A;  1RJ9 A;  4JE9 A;  2IM8 A;  1LM3 B;  4PFP A;  1FFH A;  3DAG A;  3LS1 A;  4DVZ A;  1AVO B;  2HV7 A;  1CGM E;  2YL1 A;  3V5X A;  2OG2 A;  3M4B A;  5DQZ A;  3F47 A;  4CS9 A;  4OIP F;  4WAB A;  3X2Q C;  3M1C B;  2PF4 E;  5E33 A;  3V7O A;  2KQ9 A;  2R7Q A;  1YZC A;  4I1O B;  2LCH A;  5F28 E;  1O5H A;  4BEM J;  3PHF 2;  1ZHT A;  5L0C A;  4MTG A;  1SYQ A;  3SXM A;  3TUL A;  2HJ3 A;  2LIG A;  1F1M A;  2D5R B;  4CDA A;  3GEH A;  5B1A C;  4G78 A;  4F4B A;  4O7G A;  1ZU4 A;  3BEH A;  2PFD A;  3B29 A;  3WHN A;  3ZQY A;  5JT4 A;  1WAS A;  3FAP B;  3C63 A;  4K7B A;  1NU7 D;  3IHU A;  3ZIB A;  4CDV A;  3DAF A;  3J06 A;  3DM5 A;  5CI8 A;  3IQT A;  2PX0 A;  1BR2 A;  4LLC A;  3AG4 C;  2XLV A;  5L0F A;  2W9Y A;  3U0C A;  5T1D B;  3W2V A;  3EHN A;  3TJ6 A;  5KYN A;  1T9K A;  3SP1 A;  3S0X A;  3OA1 A;  4NQF A;  2ZXP A;  4LDQ A;  1QQ3 A;  1J8M F;  3RFY A;  4MVR A;  2NUP B;  1ZZP A;  3SYN A;  1KTM A;  3QVY A;  4KC9 A;  5DQT A;  4QI2 A;  3E9V A;  1LI7 A;  2A1D D;  3AQB A;  3ATP A;  4O6M A;  4C3E A;  1YA9 A;  256B A;  3RKO F;  4AE4 B;  2H7B A;  3ABK C;  4YT8 A;  2R02 A;  1FNT c;  1FFT C;  3ASN C;  1FMW A;  3EGD A;  4YK5 A;  2EPL X;  1APC A;  3GWL A;  3QTH A;  2DI3 A;  3EH1 A;  4DRH B;  1JR8 A;  2R7S A;  1SZI A;  3KL4 A;  4JVS A;  3ITF A;  4NTF A;  4U5C E;  3NKE A;  2J9U A;  1OCZ C;  1M2V B;  3K7D A;  3NKD A;  4L6R A;  3VRC A;  2GAQ A;  4BJ1 A;  2J0W A;  3UGP A;  5F5H A;  1UFB A;  3RYL A;  1E84 A;  5EK0 A;  1YVI A;  4H54 A;  5JSL A;  2QNL A;  1IZM A;  5KYY A;  1ZU5 A;  3M15 A;  1RKE B;  3FVY A;  1Y6D A;  2LK4 A;  1G4U S;  1OKK A;  1NLX A;  1UG7 A;  3RF3 A;  3S90 A;  2DB4 A;  1T5O A;  5TJ5 E;  2YZS A;  4O79 A;  3DM9 B;  2L7A A;  3DJN B;  1LE4 A;  3W2W A;  1NFO A;  2WL8 A;  2V3C C;  4PJM A;  4I3M A;  2YVK A;  4GEH A;  4BEJ A;  3C18 A;  1ST6 A;  3RQE A;  1YZA A;  2HMZ A;  2VC9 A;  4CJO A;  4NTA A;  3FDQ A;  1WGW A;  3CZ6 A;  2CNW D;  3ZC4 A;  4E0I A;  3L8I A;  4QDL A;  3LEV A;  3H65 A;  3U2M A;  3FOP A;  5BQH A;  2NG1 A;  2YL7 A;  2KNH A;  3C7J A;  3EG9 B;  4KBL A;  4MTO A;  4NTB A;  3L0I A;  4CBE A;  4GQH A;  4BJT A;  2UUI A;  1NZE A;  4N6C A;  4O6Y A;  3V5Z A;  2VB6 A;  3LEO A;  2R7R A;  4FWV A;  2Y39 A;  1D0X A;  3T6J A;  1G8X A;  3L1M A;  4JTA B;  3TJ5 A;  2BC5 A;  2MHR A;  3DWW A;  3T6B A;  1BR4 A;  1R5I D;  2EIN C;  1OR3 A;  2OCC C;  4YJW A;  2L6G A;  2J7P D;  3TOL A; 
#chains in the Genus database with same CATH homology
 2A69 F;  3UMK A;  2XRH A;  5T3T A;  4CS9 C;  3LES A;  3WG7 C;  5DS4 A;  4J32 B;  4PJL A;  4OD4 A;  2DGJ A;  2J9W A;  4MQ9 F;  2G62 A;  3QMK A;  4EWC A;  4G7H F;  1QLE C;  3LS0 A;  4BG0 A;  4OIR F;  4H4K C;  2LSE A;  3W8I A;  3EPV A;  1M2O A;  3KMI A;  2Y3H A;  3DD7 A;  4U5D E;  2P6V A;  1D1A A;  1OCO C;  2YEV A;  1Z23 A;  3ZSU A;  4OIO F;  4CIH A;  3UR3 C;  3SZR A;  3K1H A;  4PJN A;  2C04 A;  3LAY A;  3VYW A;  2A6E F;  1D1B A;  2H7O A;  3S28 A;  3NRH A;  4N06 A;  1KU2 A;  3JSZ A;  4XTK A;  2G3K A;  1NG1 A;  2GFH A;  2C03 A;  1S7Z A;  5IY5 C;  3AG2 C;  3NYJ A;  3L34 A;  1ZHY A;  4JZA A;  1Z5Z A;  5DS6 A;  4CS8 C;  1TKN A;  2J9V A;  4B6I A;  3MLG A;  3EGD B;  5FCL A;  1V55 C;  3HTK C;  5D91 A;  1MNE A;  2Y3B A;  4OIN F;  4OIQ F;  3OEO A;  1SMY F;  4A2N B;  3HJC A;  3EZI A;  2NUT A;  2Y69 C;  3UMH A;  2ZXR A;  4YT5 A;  3RIP A;  4DOZ A;  2EIL C;  3E70 C;  1QZX A;  5KYY B;  2YHS A;  1MND A;  2ZXW C;  2XXA B;  2B0J A;  2EIK C;  4E7Z A;  3N0T A;  5B3S C;  1M56 C;  4FES A;  4U5G A;  1OCC C;  1LS1 A;  1VOM A;  3CQZ A;  4W8K A;  4NY3 A;  2WZL A;  3Q7G A;  3KKB A;  4I1M A;  2WZG A;  4JJG A;  1ZHW A;  4CSA A;  5L3Q A;  4RBN A;  2CNW A;  3PMR A;  3I5Q A;  4C7O B;  4ZLC A;  4HE8 D;  5DLJ A;  2ZXO A;  1FTS A;  4YN0 B;  3T4R A;  3VAY A;  2XXA A;  3EGX A;  4AX2 A;  3GOD A;  2J7P A;  3AG1 C;  1PD0 A;  3EQL F;  4JCH A;  2P7V A;  3EHM A;  1VYI A;  2Q9B A;  4MND A;  2R7X A;  3UGO A;  3KH2 A;  4U5E E;  3LNR A;  1TWC A;  4HFK B;  4LER A;  4O6N A;  2KW3 C;  4YT2 A;  2IXN A;  4JW1 A;  3NYL A;  3LLI A;  2VAS A;  2O9X A;  4C7O A;  2W4M A;  4AK9 A;  4X0R A;  5KYU A;  2H7V C;  3QZC A;  3NDB B;  1ZHZ A;  3UNG C;  2ZPA A;  3POV A;  3EJN A;  2IOQ A;  4ULW A;  2R7U A;  3K1I C;  3B9Q A;  4IWB A;  4PJJ A;  3ABL C;  4WJ0 A;  3K66 A;  3I5P A;  4PFO A;  2BE5 F;  2WVQ A;  1TWA A;  2VH3 A;  1OKK D;  4RDA A;  1MMG A;  2KGO A;  2FFH A;  2L9J A;  4M63 A;  1Z63 A;  5L3V A;  1PCX A;  2FGY A;  1MMN A;  2Q9A A;  1IW7 F;  1TWH A;  4QI0 A;  2M4E A;  3EFO A;  4HFF B;  2NUT B;  3GAN A;  2DYS C;  3S29 A;  1OCR C;  2V26 A;  3ASO C;  4LAC B;  2MYS A;  2IXO A;  3HLZ A;  4U5B E;  3JT1 A;  4OD5 A;  1W2W A;  3W8H A;  2R7T A;  2Q9C A;  1BR1 A;  2A68 F;  3LLK A;  4IRU A;  1D1C A;  2EIJ C;  4KNV A;  3S27 A;  2PP4 A;  2XSE A;  3SEO A;  1PD1 A;  3JRT A;  3MX3 A;  1N1C A;  1VMA A;  3RH3 A;  2PX3 A;  1VYK A;  1LKX A;  1MMD A;  1M57 C;  3Q7L A;  5B1B C;  1Z3I X;  3EH2 A;  2DYR C;  3DMD A;  3DJU B;  2J0X A;  4CS7 A;  4E7S A;  2Y3D A;  3N2Z B;  4JJF A;  3EGX B;  2W4B A;  5D92 A;  4ANJ A;  3FAJ A;  1VK5 A;  2WZF A;  1NU9 C;  4K0D A;  3DXJ F;  4BJ5 A;  2W45 A;  4Q5S F;  2L81 A;  4BJ6 A;  3K6B A;  5EHH A;  2KJG A;  2J45 A;  2XL4 A;  4C3D A;  3IEE A;  3CSK A;  4RD9 A;  5BUO A;  3B0P A;  2MWQ A;  1LVK A;  2CGE A;  3WOD F;  5KYW A;  2I8B A;  1Z6A A;  2A6H F;  4G7O F;  3ZVR A;  3ECS A;  2WB7 A;  3O6X A;  2X51 A;  3LJB A;  5KYU B;  4Q7C A;  3X1O A;  2CW0 F;  3ABM C;  1O87 A;  3NG1 A;  5E2Q A;  4EBB A;  4C3B A;  5T3W A;  3DZA A;  2R7O A;  2HV6 A;  4CS8 A;  3AG3 C;  2CDQ A;  5DVW A;  2R7W A;  4HEA J;  4IAO A;  2Z15 A;  4PK4 A;  4G0H A;  4U5H A;  5E3A A;  4DBR A;  1SF8 A;  3K33 A;  2NUP A;  2JD3 A;  3EFO B;  4J30 B;  1JPN A;  2J46 A;  2Y3G A;  4YWQ A;  3EZH A;  2IXM A;  4I44 A;  1TR2 A;  4AE4 A;  4Q4Z F;  2QY9 A;  2R7V A;  5CI9 A;  4XLN F;  2EIM C;  1D0Z A;  1M2V A;  3Q6N A;  4KI2 A;  4DBQ A;  4YT4 A;  4GYT A;  5E3C A;  3I4U A;  3O39 A;  3F46 A;  1V54 C;  3ZG1 A;  2QTV A;  4IJJ A;  1ZHX A;  4KNW A;  2Q3T A;  2WVO A;  5KYX B;  2G3V A;  5HSW A;  1RJ9 B;  3N24 A;  1FMV A;  2IYL D;  4U5F E;  3B0V C;  5F5F A;  2E87 A;  1D0Y A;  4BJ5 C;  3JCU Q;  4BJ6 C;  4JUR I;  3JYH A;  4DVY P;  1ZYR F;  1MMA A;  4G7Z F;  3AQC A;  1J8Y F;  4XWJ A;  4P6I C;  1TWG A;  3TD7 A;  3FHD A;  3EG9 A;  3NYM A;  4CSA C;  4FX5 A;  5DS5 A;  4LLE A;  3OWT A;  3Q6M A;  5EGY A;  3SNH A;  3UMI A;  5KYW B;  2WVN A;  2IXP A;  5KYX A;  1JPJ A;  1RJ9 A;  4PFP A;  1FFH A;  3DAG A;  3LS1 A;  4DVZ A;  2HV7 A;  2OG2 A;  5DQZ A;  3F47 A;  4CS9 A;  4OIP F;  3X2Q C;  3M1C B;  2PF4 E;  5E33 A;  3V7O A;  2KQ9 A;  2R7Q A;  4I1O B;  1O5H A;  3PHF 2;  1ZHT A;  4F4B A;  2D5R B;  5B1A C;  4O7G A;  1ZU4 A;  2PFD A;  4K7B A;  1NU7 D;  3ZIB A;  3DAF A;  3DM5 A;  5CI8 A;  2PX0 A;  1BR2 A;  4LLC A;  3AG4 C;  2W9Y A;  5T1D B;  3W2V A;  3EHN A;  5KYN A;  3SP1 A;  3S0X A;  3OA1 A;  2ZXP A;  1J8M F;  3RFY A;  2NUP B;  3SYN A;  4QI2 A;  4KC9 A;  5DQT A;  3E9V A;  2A1D D;  3AQB A;  4O6M A;  4C3E A;  3RKO F;  4AE4 B;  4YT8 A;  2H7B A;  3ABK C;  1FFT C;  3ASN C;  1FMW A;  3EGD A;  4ZLD A;  3EH1 A;  2R7S A;  1SZI A;  3KL4 A;  4JVS A;  3ITF A;  4U5C E;  3NKE A;  2J9U A;  1OCZ C;  1M2V B;  3K7D A;  3NKD A;  4BJ1 A;  2J0W A;  3UGP A;  5F5H A;  3RYL A;  1IZM A;  5KYY A;  1ZU5 A;  3FVY A;  1OKK A;  2YZS A;  4O79 A;  3DM9 B;  3DJN B;  3W2W A;  2WL8 A;  2V3C C;  4PJM A;  4I3M A;  4GEH A;  4BEJ A;  1ST6 A;  3FDQ A;  1WGW A;  3CZ6 A;  2CNW D;  3ZC4 A;  4QDL A;  3LEV A;  3H65 A;  2NG1 A;  2KNH A;  3EG9 B;  4KBL A;  4CBE A;  3B0U X;  3L0I A;  4XLP F;  4BJT A;  1NZE A;  4O6Y A;  2R7R A;  2VB6 A;  4FWV A;  2Y39 A;  1D0X A;  3T6J A;  1G8X A;  3T6B A;  1BR4 A;  2EIN C;  2OCC C;  4YJW A;  2J7P D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...