4E0IA

Crystal structure of the c30s/c133s mutant of erv1 from saccharomyces cerevisiae
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
152
Chain Sequence
b'EGLSGRKIIYDEDGKPSRSCNTLLDFQYVTGKISELMPGSRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPCNWSAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDGWD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial FAD-linked sulfhydryl oxidase ERV1
publication title Structure of yeast sulfhydryl oxidase erv1 reveals electron transfer of the disulfide relay system in the mitochondrial intermembrane space
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 40
structure length 152
sequence length 175
chains with identical sequence B, C
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2012-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 4e0iA02
1JRAA 3U2LA 4E0IA 3O55A 3GWNA 4E0HA 3LLKA 3U5SA 2HJ3A 3GWLA 3W4YA 3R7CA 3LLIA 3U2MA 1OQCA 3TK0A 3TD7A 3MBGA 1JR8A 4LDKA
chains in the Genus database with same CATH superfamily
3HTKC 2CGEA 1HW1A 2G3KA 3LUTB 2PNOA 3M4BA 3M15A 3OEOA 4C3EA 5FCLA 2J0WA 3QTHA 4LLCA 1OW8A 5T3TA 3GWNA 2Y3HA 2I8BA 4GQHA 3K6BA 4LDRA 4MTGA 3RQGA 3GEIA 2Y69C 4I3MA 2J9BA 5KYUB 2R7QA 3AOUA 3ZTZA 1Z23A 1FFHA 3KH2A 2A1DD 2X0CA 5L0FA 4HFKB 1H6GA 2Q9AA 2YL7A 3V5YA 1ZHYA 2XS8A 1V74B 1ZHTA 2DYRC 4Z9HA 1VLSA 3NMKA 2WZLA 2YHSA 2XXAB 3PMRA 3ZVRA 1C03A 4BJ5A 4AK9A 1QZXA 1FMVA 1J8MF 3SEOA 3T4RA 1WWPA 1D1BA 2AP3A 3C18A 2J0XA 1L3PA 2XLWA 1VK5A 2PP4A 2Y39A 2HSBA 2W9YA 2J9VA 3NRHA 4FX5A 4KC9A 1GQAA 1ZHWA 4M63A 3CEXA 4PACA 2NG1A 1OKKA 5A6AA 5JRAA 2XLHA 2R03A 3LNMB 4G78A 5JVEA 3DWWA 1JPJA 2H8AA 3HNLA 4O6YA 1MNDA 1OKKD 1RCPA 2WVOA 3IEEA 4C3DA 5CIVA 1I5NA 3G50A 2Q00A 3AQBA 5L0GA 4DJ9A 3GM2A 2YRFA 2XS1A 4QI0A 4EKWA 4MTOA 1WN0A 5D92A 1NBBA 1QSPA 3EZHA 1UFBA 4ZLDA 5GPGB 5B1AC 1TFOB 4CDYA 2BE5F 4FAPB 3JZ0A 3TJ5A 2KW3C 4DRHB 5A6JA 5L0HA 2EIMC 2OJED 4U5GA 1YLMA 2KGOA 2OOCA 3Q6NA 2KK1A 2OCCC 4JCZA 2VB6A 4PJMA 5B3IA 5KYNA 4E18A 3B0PA 3ABKC 5KYWA 3I5QA 3RW0A 5KYWB 1A41A 3EG9A 4I1MA 3EG9B 4PJLA 3FAJA 3RH3A 1K04A 1Q0KA 2OG2A 2LFDA 3RVZA 5JUAA 5JP7A 1TR2A 1N1CA 3E9VA 1LIHA 1I4YA 3ABLC 1T6IA 2VC9A 2ZXOA 1R4TA 1G8XA 4HEAJ 1Z3IX 3C62A 3H2UA 2AU5A 4QI2A 3PDMP 3T9OA 3LLIA 4CSAA 3SXMA 256BA 2FGYA 1F1MA 3Q6MA 3W2VA 5E33A 3GM3A 3FVYA 4G7HF 1LE4A 3H65A 3M4CA 3GANA 4PFPA 3ASOC 3S9OA 3SXKA 5AC4A 1YA7O 4CS8C 1D0YA 4XPXA 2ETSA 1TWAA 2NSGA 4A2NB 4W8PA 1VYIA 2JD3A 4UDVA 3B0UX 2HV6A 4N06A 2X51A 4U9DA 2A68F 5B1BC 1T5OA 1NLXA 1RXQA 2UUHA 2FFHA 4JCHA 4WGYA 5T3WA 2W4MA 4JTCB 2L6GA 3JSZA 4BEMJ 1ORSC 1E86A 3IPMO 2H7VC 3H2VA 1CGNA 2YWAA 2DI3A 3UMIA 3RF3A 3C7JA 2GA0A 2L7AA 2P7VA 5HSWA 1M2VA 3KPHA 4YT5A 1M2VB 3ZQVA 2HS5A 4WJ0A 1EA8A 2Q3TA 4B6IA 4JE9A 1UG7A 3KMIA 3NMIA 1HE9A 1ST6A 2CDQA 4HE8D 3NKEA 2WZFA 3NKDA 2G3VA 2GFHA 2LK4A 5AGFA 3FDQA 3O6XA 4XEKA 2LQGA 1TFKB 1WATA 3FXHA 2P6VA 1JMWA 5T1DB 4BEJA 2P0NA 2EILC 3TQOA 4NCQA 4HFFB 1GGQA 2GWWA 4JVSA 3SXYA 4E0HA 2R7VA 4XTKA 3TOLA 2B0JA 3GEEA 4A4AA 3K1IC 3ZSUA 3VM6A 1IW7F 5JLIA 2H7OA 3ZWIA 1ZHXA 2DGJA 2VH3A 3B9QA 3QW1A 4IB4A 3POVA 3B71A 3RVYA 1CPQA 3ZQYA 1BR1A 3U9MA 3T6GB 2XLOA 2ZXWC 4MS2A 4DXWA 1LS4A 4JW1A 1E84A 1WOLA 2J9WA 1FFTC 4YL1A 3ZG1A 3GEHA 1E2XA 1A0BA 4XPYA 1HE1A 3DZAA 2RSEB 1AUEA 3LNRA 3AQCA 2EPMX 1OR2A 3EH2A 1E85A 1GM5A 1ORYA 4U5FE 4MTFA 1ZYRF 5DQZA 2FAPB 5DS6A 1HW2A 1CGOA 1U0BB 1BZ4A 3GWLA 1KTMA 1H7IA 3DXJF 3O10A 5KYUA 1C17M 1NG1A 3LESA 4CIPA 3AG3C 1OCRC 1M6TA 3M79A 4FWVA 3V5ZA 5K0IA 4CJOA 4JKVA 3SXZA 2J46A 3JYHA 3T6JA 4RBNA 2XLDA 1G4US 4KNVA 4DBQA 2XXAA 2C04A 1VB5A 2QY9A 3F47A 2OQMA 1JR8A 1MMAA 3FOPA 2PFDA 3R2PA 1Q0DA 3K33A 1DOVA 3ABMC 3EHNA 4RDAA 1VLTA 4PJJA 4P6IC 2Y3GA 3IQTA 3W2WA 3IQ6A 4OIRF 4L6RA 3FHDA 1Q0FA 4ULVA 5L0DA 4YN0B 1QVXA 1V54C 4J7TA 5COFA 4OIOF 1T6UA 2A69F 2HJMA 3G4XA 2IYLD 2OEVA 2R7WA 3R7CA 4IRUA 1MMNA 3A11A 5L0JA 4ER9A 4ZLCA 2QTVA 2AVKA 1PCXA 4MW8A 4XQ1A 2M64A 1OQCA 2PF4E 3QVYA 3OWTA 3U0CA 3DJNB 1D0ZA 1YYJA 1ZW2A 2A6HF 2CYDA 3RKOF 1PV3A 4CS9A 3AGTA 3JSEO 2W45A 2OU6A 2PBEA 3CSKA 1BBHA 3KKBA 5E3AA 3NYJA 3VF0A 4E0IA 1NSGB 2LD6A 3DKAA 4YJWA 4BJ5C 3Q7GA 1YVIA 3EH1A 2GDCA 2QNLA 3NG1A 4P9TA 3US6A 5L3QA 1WGWA 4EIYA 1BR4A 4O6NA 3N24A 1JOGA 2LIGA 3W4YA 4EHPA 1K40A 4PJNA 3FAPB 1TWHA 4U5BE 1Z7Qc 3HNIA 4BJ6A 1LE2A 3ATPA 2G62A 1Z63A 4MVZA 1LVKA 3LJBA 4E7ZA 2Q9CA 4JZAA 2Q7RA 2DB4A 2L6HA 4ANJA 3DE9A 3JRMO 1LKXA 1YAUO 3E70C 4X0RA 4AE4A 3EGXA 5E2QA 4AE4B 3CAXA 3EGXB 1VTMP 3OA1A 1HY5A 5EHHA 2OKUA 4WGZA 4JJFA 4PR9A 3AGUA 5JS5A 1QKRA 1O5HA 4F4BA 3EFOA 2KSFA 4XLPF 2ASRA 1MMGA 2KC3A 3ECSA 3EFOB 4JIOA 1PD0A 2I15A 5L3VA 5KYXA 4CS9C 4J30B 4U5HA 5KYXB 3EQLF 1D1AA 2R7UA 3O55A 4OIPF 1M56C 2M4EA 2NUPA 2NUPB 2YL3A 3VYWA 4WABA 1ZU4A 2W4BA 3B29A 5L0CA 1YYXA 1TWGA 1ZHZA 4CBEA 1W2WA 2QLAA 2LP4A 4QDLA 2XLVA 2EIKC 3DM5A 3EGDA 3MLGA 3EGDB 4H54A 2J45A 2ZD9A 3ZTMA 2V26A 3FOOA 3DE8A 3NYLA 4IJJA 4LLEA 1FAPB 5D91A 4EWCA 3S90A 2P61A 1EKYA 1H9GA 4XLNF 1FR0A 4PK4A 4JEAA 1TWCA 2YEVA 1MQVA 3JTLO 2E87A 4MVSA 4OD5A 3EZIA 3TK0A 3X2QC 2YKZA 3JT1A 5EK0A 3IQCA 4CSAC 2R7SA 2KJGA 2A6EF 3KL4A 1SR2A 4MW3A 1JRAA 2XM0A 2QUPA 3J06A 2EPNA 1I4ZA 3MFNA 3MYIA 1S7ZA 4K0DA 1FTSA 2IBFA 4BJ1A 4AL0A 3AG4C 1OXBA 4GYTA 4NTBA 2Y3DA 2VASA 1XWJA 2BC5A 3EHMA 5HV9A 3SYNA 4YT4A 1EQ1A 5CI8A 1G4WR 1TQGA 1YDIA 5EGYA 3ZIBA 2EPLX 3DJUB 3S29A 5KYYA 5KYYB 1RJ9A 4NY3A 2EIJC 1RJ9B 1O87A 2EINC 3L34A 3RQFA 3DI5A 5DS4A 4G0HA 1QQ3A 2XL8A 1HMOA 3I4UA 3LAYA 4IAQA 4MVOA 2R9RB 4Z9IA 4AX2A 4IARA 5BQGA 4AL1A 2YZSA 2LSEA 1YARO 1NFNA 3DM9B 2KNHA 2Y3BA 3BRJA 4RD9A 3WAQA 1BDJB 5B3SC 3MBGA 4KNWA 4LDKA 1IZMA 1O3UA 3T6BA 2TMVP 1GS9A 2HV7A 2LCHA 4JC7A 4XEFA 4CJGA 2CNWD 2J7PD 4U5DE 4JURI 2IXMA 3UR3C 3SNHA 1VYKA 3V5XA 5DQTA 3DAFA 2Q9BA 4CDAA 1D1CA 1A7DA 2ICWG 1CPRA 1M57C 4YL0A 5A6KA 2DYSC 3I5PA 4D4NA 1WASA 3LEOA 2RD9A 2D4UA 4IWBA 2R7OA 2JX0A 3U2MA 3K1HA 4I1OB 4K7BA 4N6HA 4YK5A 3U8PA 3WG7C 5A6BA 1QPUA 3ZDLA 5A69A 2A0BA 1OCCC 4DRJB 3TD7A 2XL6A 2YQYA 5A6BD 1T6QA 1R5ID 3L1MA 2MHRA 4P9FA 2XLEA 3HJCA 4DBRA 2CW0F 2HSQA 2WZGA 3SP1A 2Q4FA 2R02A 3W8HA 3QW0A 1FNTc 3PHF2 1CGME 1NFOA 4E17A 3S27A 4E7SA 5FZTA 3GM1A 3O39A 3SZRA 3X1OA 3JCUQ 2ZXRA 1ORJA 3U5SA 1ZU5A 2YL0A 1MNEA 3HNJA 3AG2C 4JEBA 5F28E 2R7RA 4YT8A 3DAGA 3LS1A 3IHUA 3M1CB 4JRZA 2Z15A 3RYLA 3WODF 4CS7A 2NSFA 3AG1C 3U3FA 5DS5A 3QZCA 2KQ9A 4GEHA 4R32A 4NTFA 3W8IA 4C7OA 3U3BA 1C02A 4C7OB 4Q5SF 1Y6DA 4LACB 2J8WA 1E83A 2L9JA 3RQEA 2F22A 2IXOA 3N2ZB 3ASNC 2EPKX 2OEXA 4LDQA 3WHNA 3L0IA 4JJGA 1T01A 3TJ6A 4O79A 2HKVA 4BJTA 1AVOB 2WB7A 4YWQA 1Q0MA 4N4WA 2XLMA 4CIHA 3LLKA 4PFOA 5TJ5E 2R25A 4ONSA 2ZXPA 3EPVA 4IAOA 5DVWA 3RIPA 1Z5ZA 2O9XA 2PX3A 4CDVA 4OINF 2PX0A 3B0VC 1APCA 2VCAA 1T9KA 2L81A 3G4ZA 4I44A 2YVKA 4CS8A 4DOZA 4U5EE 4EBKA 5BQHA 4MNDA 5CI9A 2JPUA 3IQ5A 2H7BA 1YZAA 5IY5C 5L0IA 3N0TA 3GORA 4NC3A 1A7EA 2IM8A 4Q7CA 3S28A 1EI7A 1LS1A 2IOQA 2XSEA 1G5ZA 2CCYA 2UUIA 3KYJA 1OW6A 3C63A 3C8GA 3QMKA 4KI2A 3C8GB 3K66A 2LFFA 3U2LA 4YT2A 3NDBB 1PD1A 2R7XA 1U6HA 3C8GD 1YA9A 1Y4CA 4CX9A 5JSLA 2A0UA 3Q7LA 3UMKA 1ZW3A 2YLGA 3ITFA 3ZC4A 4H4KC 2VCCA 1LM3B 1H9TA 3FMSA 4O7GA 4XEVA 1OCOC 4Q4ZF 2YLIA 3JRTA 4W8KA 1ZVZA 1NU7D 4DVZA 2V3CC 1XZPA 4N6CA 1Q0GA 4NTAA 2NUTA 2VCBA 2NUTB 2WVQA 4U9EA 4OD4A 1LPEA 1LI5A 3K7DA 2ZPAA 3QVZA 2OJQA 3CQZA 1A7VA 1RKCA 1V4AA 2EPOA 2QE9A 1TKNA 2IXPA 4J7YA 4U5CE 2XRHA 1MMDA 3U9JA 4BJ6C 2MWQA 3UMHA 2KYHA 3EJNA 3F46A 4XWJA 3MX3A 2HFIA 1D0XA 2YLDA 4YL3A 1K05A 2HZ8A 2HMQA 1S05A 3K1IA 4Z9JA 3LS0A 1Z6AA 1YJGA 5F5HA 5COGA 1WTYA 4KBLA 4G7OF 1KU2A 2WVNA 3UNGC 3S0XA 2R05A 3NYMA 3DD7A 2HJ3A 1U89A 3UGPA 4OIQF 1RMVA 2C03A 3S84A 4D4XA 5E3CA 1SMYF 4JTAB 4BPMA 4EBBA 1VMAA 2R7TA 1L7CA 3GODA 2HMZA 1XZQA 1ZZPA 5COMA 1OR3A 4MQ9F 3RFYA 1FMWA 1JPNA 2XM4A 3DMDA 1NZEA 4ULWA 3NMJA 5JT4A 1RKEA 2WL8A 3A9CA 1RKEB 4NQFA 5BUOA 3HNKA 5AC5A 2J9UA 3HLZA 2CNWA 2J7PA 2B0HA 3L8JA 1V55C 3JYYA 4C3BA 2L6FA 4K1OA 2HUJA 3LEVA 4MVQA 3CZ6A 5DLJA 4EBJA 2BL2A 3TOMA 5F5FA 1B68A 1SZIA 2P1AA 3UGOA 2YL1A 2D5RB 1HMDA 3U8VA 1OXKA 4MVUA 3VAYA 2IXNA 3PCVA 3HKKA 4J32B 5BQIA 1VOMA 1DOWA 1OW7A 4XPWA 2MYSA 4FESA 1SYQA 3TULA 1AEPA 4LERA 1SF8A 2XL4A 4BG0A 1KNYA 3MYFA 3AJMA 3VRCA 3V7OA 4DRIB 1NU9C 1YZCA 3BEHA 2AWCA 4JTDB 3C8ZA 4DVYP 3KYIA 1QLEC 1OCZC 2AWYA 4MVMA 4G7ZF 2GAQA 4O6MA 1LI7A 1J8YF 3L8IA 1M2OA 1JAFA 4IGGA 2NPUA 4MVRA 1BR2A 4EUKB
chains in the Genus database with same CATH topology
1JRAA 3U2LA 4E0IA 3O55A 3GWNA 4E0HA 3LLKA 3U5SA 2HJ3A 3GWLA 3W4YA 3R7CA 3LLIA 3U2MA 1OQCA 3TK0A 3TD7A 3MBGA 1JR8A 4LDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRA A;  3U2L A;  4E0I A;  3O55 A;  3GWN A;  4E0H A;  3LLK A;  3U5S A;  2HJ3 A;  3GWL A;  3W4Y A;  3R7C A;  3LLI A;  3U2M A;  1OQC A;  3TK0 A;  3TD7 A;  3MBG A;  1JR8 A;  4LDK A; 
#chains in the Genus database with same CATH topology
 3HTK C;  2CGE A;  1HW1 A;  2G3K A;  3LUT B;  2PNO A;  3M4B A;  3M15 A;  3OEO A;  4C3E A;  5FCL A;  2J0W A;  3QTH A;  4LLC A;  1OW8 A;  5T3T A;  3GWN A;  2Y3H A;  2I8B A;  4GQH A;  3K6B A;  4LDR A;  4MTG A;  3RQG A;  3GEI A;  2Y69 C;  4I3M A;  2J9B A;  5KYU B;  2R7Q A;  3AOU A;  3ZTZ A;  1Z23 A;  1FFH A;  3KH2 A;  2A1D D;  2X0C A;  5L0F A;  4HFK B;  1H6G A;  2Q9A A;  2YL7 A;  3V5Y A;  1ZHY A;  2XS8 A;  1V74 B;  1ZHT A;  2DYR C;  4Z9H A;  1VLS A;  3NMK A;  2WZL A;  2YHS A;  2XXA B;  3PMR A;  3ZVR A;  1C03 A;  4BJ5 A;  4AK9 A;  1QZX A;  1FMV A;  1J8M F;  3SEO A;  3T4R A;  1WWP A;  1D1B A;  2AP3 A;  3C18 A;  2J0X A;  1L3P A;  2XLW A;  1VK5 A;  2PP4 A;  2Y39 A;  2HSB A;  2W9Y A;  2J9V A;  3NRH A;  4FX5 A;  4KC9 A;  1GQA A;  1ZHW A;  4M63 A;  3CEX A;  4PAC A;  2NG1 A;  1OKK A;  5A6A A;  5JRA A;  2XLH A;  2R03 A;  3LNM B;  4G78 A;  5JVE A;  3DWW A;  1JPJ A;  2H8A A;  3HNL A;  4O6Y A;  1MND A;  1OKK D;  1RCP A;  2WVO A;  3IEE A;  4C3D A;  5CIV A;  1I5N A;  3G50 A;  2Q00 A;  3AQB A;  5L0G A;  4DJ9 A;  3GM2 A;  2YRF A;  2XS1 A;  4QI0 A;  4EKW A;  4MTO A;  1WN0 A;  5D92 A;  1NBB A;  1QSP A;  3EZH A;  1UFB A;  4ZLD A;  5GPG B;  5B1A C;  1TFO B;  4CDY A;  2BE5 F;  4FAP B;  3JZ0 A;  3TJ5 A;  2KW3 C;  4DRH B;  5A6J A;  5L0H A;  2EIM C;  2OJE D;  4U5G A;  1YLM A;  2KGO A;  2OOC A;  3Q6N A;  2KK1 A;  2OCC C;  4JCZ A;  2VB6 A;  4PJM A;  5B3I A;  5KYN A;  4E18 A;  3B0P A;  3ABK C;  5KYW A;  3I5Q A;  3RW0 A;  5KYW B;  1A41 A;  3EG9 A;  4I1M A;  3EG9 B;  4PJL A;  3FAJ A;  3RH3 A;  1K04 A;  1Q0K A;  2OG2 A;  2LFD A;  3RVZ A;  5JUA A;  5JP7 A;  1TR2 A;  1N1C A;  3E9V A;  1LIH A;  1I4Y A;  3ABL C;  1T6I A;  2VC9 A;  2ZXO A;  1R4T A;  1G8X A;  4HEA J;  1Z3I X;  3C62 A;  3H2U A;  2AU5 A;  4QI2 A;  3PDM P;  3T9O A;  3LLI A;  4CSA A;  3SXM A;  256B A;  2FGY A;  1F1M A;  3Q6M A;  3W2V A;  5E33 A;  3GM3 A;  3FVY A;  4G7H F;  1LE4 A;  3H65 A;  3M4C A;  3GAN A;  4PFP A;  3ASO C;  3S9O A;  3SXK A;  5AC4 A;  1YA7 O;  4CS8 C;  1D0Y A;  4XPX A;  2ETS A;  1TWA A;  2NSG A;  4A2N B;  4W8P A;  1VYI A;  2JD3 A;  4UDV A;  3B0U X;  2HV6 A;  4N06 A;  2X51 A;  4U9D A;  2A68 F;  5B1B C;  1T5O A;  1NLX A;  1RXQ A;  2UUH A;  2FFH A;  4JCH A;  4WGY A;  5T3W A;  2W4M A;  4JTC B;  2L6G A;  3JSZ A;  4BEM J;  1ORS C;  1E86 A;  3IPM O;  2H7V C;  3H2V A;  1CGN A;  2YWA A;  2DI3 A;  3UMI A;  3RF3 A;  3C7J A;  2GA0 A;  2L7A A;  2P7V A;  5HSW A;  1M2V A;  3KPH A;  4YT5 A;  1M2V B;  3ZQV A;  2HS5 A;  4WJ0 A;  1EA8 A;  2Q3T A;  4B6I A;  4JE9 A;  1UG7 A;  3KMI A;  3NMI A;  1HE9 A;  1ST6 A;  2CDQ A;  4HE8 D;  3NKE A;  2WZF A;  3NKD A;  2G3V A;  2GFH A;  2LK4 A;  5AGF A;  3FDQ A;  3O6X A;  4XEK A;  2LQG A;  1TFK B;  1WAT A;  3FXH A;  2P6V A;  1JMW A;  5T1D B;  4BEJ A;  2P0N A;  2EIL C;  3TQO A;  4NCQ A;  4HFF B;  1GGQ A;  2GWW A;  4JVS A;  3SXY A;  4E0H A;  2R7V A;  4XTK A;  3TOL A;  2B0J A;  3GEE A;  4A4A A;  3K1I C;  3ZSU A;  3VM6 A;  1IW7 F;  5JLI A;  2H7O A;  3ZWI A;  1ZHX A;  2DGJ A;  2VH3 A;  3B9Q A;  3QW1 A;  4IB4 A;  3POV A;  3B71 A;  3RVY A;  1CPQ A;  3ZQY A;  1BR1 A;  3U9M A;  3T6G B;  2XLO A;  2ZXW C;  4MS2 A;  4DXW A;  1LS4 A;  4JW1 A;  1E84 A;  1WOL A;  2J9W A;  1FFT C;  4YL1 A;  3ZG1 A;  3GEH A;  1E2X A;  1A0B A;  4XPY A;  1HE1 A;  3DZA A;  2RSE B;  1AUE A;  3LNR A;  3AQC A;  2EPM X;  1OR2 A;  3EH2 A;  1E85 A;  1GM5 A;  1ORY A;  4U5F E;  4MTF A;  1ZYR F;  5DQZ A;  2FAP B;  5DS6 A;  1HW2 A;  1CGO A;  1U0B B;  1BZ4 A;  3GWL A;  1KTM A;  1H7I A;  3DXJ F;  3O10 A;  5KYU A;  1C17 M;  1NG1 A;  3LES A;  4CIP A;  3AG3 C;  1OCR C;  1M6T A;  3M79 A;  4FWV A;  3V5Z A;  5K0I A;  4CJO A;  4JKV A;  3SXZ A;  2J46 A;  3JYH A;  3T6J A;  4RBN A;  2XLD A;  1G4U S;  4KNV A;  4DBQ A;  2XXA A;  2C04 A;  1VB5 A;  2QY9 A;  3F47 A;  2OQM A;  1JR8 A;  1MMA A;  3FOP A;  2PFD A;  3R2P A;  1Q0D A;  3K33 A;  1DOV A;  3ABM C;  3EHN A;  4RDA A;  1VLT A;  4PJJ A;  4P6I C;  2Y3G A;  3IQT A;  3W2W A;  3IQ6 A;  4OIR F;  4L6R A;  3FHD A;  1Q0F A;  4ULV A;  5L0D A;  4YN0 B;  1QVX A;  1V54 C;  4J7T A;  5COF A;  4OIO F;  1T6U A;  2A69 F;  2HJM A;  3G4X A;  2IYL D;  2OEV A;  2R7W A;  3R7C A;  4IRU A;  1MMN A;  3A11 A;  5L0J A;  4ER9 A;  4ZLC A;  2QTV A;  2AVK A;  1PCX A;  4MW8 A;  4XQ1 A;  2M64 A;  1OQC A;  2PF4 E;  3QVY A;  3OWT A;  3U0C A;  3DJN B;  1D0Z A;  1YYJ A;  1ZW2 A;  2A6H F;  2CYD A;  3RKO F;  1PV3 A;  4CS9 A;  3AGT A;  3JSE O;  2W45 A;  2OU6 A;  2PBE A;  3CSK A;  1BBH A;  3KKB A;  5E3A A;  3NYJ A;  3VF0 A;  4E0I A;  1NSG B;  2LD6 A;  3DKA A;  4YJW A;  4BJ5 C;  3Q7G A;  1YVI A;  3EH1 A;  2GDC A;  2QNL A;  3NG1 A;  4P9T A;  3US6 A;  5L3Q A;  1WGW A;  4EIY A;  1BR4 A;  4O6N A;  3N24 A;  1JOG A;  2LIG A;  3W4Y A;  4EHP A;  1K40 A;  4PJN A;  3FAP B;  1TWH A;  4U5B E;  1Z7Q c;  3HNI A;  4BJ6 A;  1LE2 A;  3ATP A;  2G62 A;  1Z63 A;  4MVZ A;  1LVK A;  3LJB A;  4E7Z A;  2Q9C A;  4JZA A;  2Q7R A;  2DB4 A;  2L6H A;  4ANJ A;  3DE9 A;  3JRM O;  1LKX A;  1YAU O;  3E70 C;  4X0R A;  4AE4 A;  3EGX A;  5E2Q A;  4AE4 B;  3CAX A;  3EGX B;  1VTM P;  3OA1 A;  1HY5 A;  5EHH A;  2OKU A;  4WGZ A;  4JJF A;  4PR9 A;  3AGU A;  5JS5 A;  1QKR A;  1O5H A;  4F4B A;  3EFO A;  2KSF A;  4XLP F;  2ASR A;  1MMG A;  2KC3 A;  3ECS A;  3EFO B;  4JIO A;  1PD0 A;  2I15 A;  5L3V A;  5KYX A;  4CS9 C;  4J30 B;  4U5H A;  5KYX B;  3EQL F;  1D1A A;  2R7U A;  3O55 A;  4OIP F;  1M56 C;  2M4E A;  2NUP A;  2NUP B;  2YL3 A;  3VYW A;  4WAB A;  1ZU4 A;  2W4B A;  3B29 A;  5L0C A;  1YYX A;  1TWG A;  1ZHZ A;  4CBE A;  1W2W A;  2QLA A;  2LP4 A;  4QDL A;  2XLV A;  2EIK C;  3DM5 A;  3EGD A;  3MLG A;  3EGD B;  4H54 A;  2J45 A;  2ZD9 A;  3ZTM A;  2V26 A;  3FOO A;  3DE8 A;  3NYL A;  4IJJ A;  4LLE A;  1FAP B;  5D91 A;  4EWC A;  3S90 A;  2P61 A;  1EKY A;  1H9G A;  4XLN F;  1FR0 A;  4PK4 A;  4JEA A;  1TWC A;  2YEV A;  1MQV A;  3JTL O;  2E87 A;  4MVS A;  4OD5 A;  3EZI A;  3TK0 A;  3X2Q C;  2YKZ A;  3JT1 A;  5EK0 A;  3IQC A;  4CSA C;  2R7S A;  2KJG A;  2A6E F;  3KL4 A;  1SR2 A;  4MW3 A;  1JRA A;  2XM0 A;  2QUP A;  3J06 A;  2EPN A;  1I4Z A;  3MFN A;  3MYI A;  1S7Z A;  4K0D A;  1FTS A;  2IBF A;  4BJ1 A;  4AL0 A;  3AG4 C;  1OXB A;  4GYT A;  4NTB A;  2Y3D A;  2VAS A;  1XWJ A;  2BC5 A;  3EHM A;  5HV9 A;  3SYN A;  4YT4 A;  1EQ1 A;  5CI8 A;  1G4W R;  1TQG A;  1YDI A;  5EGY A;  3ZIB A;  2EPL X;  3DJU B;  3S29 A;  5KYY A;  5KYY B;  1RJ9 A;  4NY3 A;  2EIJ C;  1RJ9 B;  1O87 A;  2EIN C;  3L34 A;  3RQF A;  3DI5 A;  5DS4 A;  4G0H A;  1QQ3 A;  2XL8 A;  1HMO A;  3I4U A;  3LAY A;  4IAQ A;  4MVO A;  2R9R B;  4Z9I A;  4AX2 A;  4IAR A;  5BQG A;  4AL1 A;  2YZS A;  2LSE A;  1YAR O;  1NFN A;  3DM9 B;  2KNH A;  2Y3B A;  3BRJ A;  4RD9 A;  3WAQ A;  1BDJ B;  5B3S C;  3MBG A;  4KNW A;  4LDK A;  1IZM A;  1O3U A;  3T6B A;  2TMV P;  1GS9 A;  2HV7 A;  2LCH A;  4JC7 A;  4XEF A;  4CJG A;  2CNW D;  2J7P D;  4U5D E;  4JUR I;  2IXM A;  3UR3 C;  3SNH A;  1VYK A;  3V5X A;  5DQT A;  3DAF A;  2Q9B A;  4CDA A;  1D1C A;  1A7D A;  2ICW G;  1CPR A;  1M57 C;  4YL0 A;  5A6K A;  2DYS C;  3I5P A;  4D4N A;  1WAS A;  3LEO A;  2RD9 A;  2D4U A;  4IWB A;  2R7O A;  2JX0 A;  3U2M A;  3K1H A;  4I1O B;  4K7B A;  4N6H A;  4YK5 A;  3U8P A;  3WG7 C;  5A6B A;  1QPU A;  3ZDL A;  5A69 A;  2A0B A;  1OCC C;  4DRJ B;  3TD7 A;  2XL6 A;  2YQY A;  5A6B D;  1T6Q A;  1R5I D;  3L1M A;  2MHR A;  4P9F A;  2XLE A;  3HJC A;  4DBR A;  2CW0 F;  2HSQ A;  2WZG A;  3SP1 A;  2Q4F A;  2R02 A;  3W8H A;  3QW0 A;  1FNT c;  3PHF 2;  1CGM E;  1NFO A;  4E17 A;  3S27 A;  4E7S A;  5FZT A;  3GM1 A;  3O39 A;  3SZR A;  3X1O A;  3JCU Q;  2ZXR A;  1ORJ A;  3U5S A;  1ZU5 A;  2YL0 A;  1MNE A;  3HNJ A;  3AG2 C;  4JEB A;  5F28 E;  2R7R A;  4YT8 A;  3DAG A;  3LS1 A;  3IHU A;  3M1C B;  4JRZ A;  2Z15 A;  3RYL A;  3WOD F;  4CS7 A;  2NSF A;  3AG1 C;  3U3F A;  5DS5 A;  3QZC A;  2KQ9 A;  4GEH A;  4R32 A;  4NTF A;  3W8I A;  4C7O A;  3U3B A;  1C02 A;  4C7O B;  4Q5S F;  1Y6D A;  4LAC B;  2J8W A;  1E83 A;  2L9J A;  3RQE A;  2F22 A;  2IXO A;  3N2Z B;  3ASN C;  2EPK X;  2OEX A;  4LDQ A;  3WHN A;  3L0I A;  4JJG A;  1T01 A;  3TJ6 A;  4O79 A;  2HKV A;  4BJT A;  1AVO B;  2WB7 A;  4YWQ A;  1Q0M A;  4N4W A;  2XLM A;  4CIH A;  3LLK A;  4PFO A;  5TJ5 E;  2R25 A;  4ONS A;  2ZXP A;  3EPV A;  4IAO A;  5DVW A;  3RIP A;  1Z5Z A;  2O9X A;  2PX3 A;  4CDV A;  4OIN F;  2PX0 A;  3B0V C;  1APC A;  2VCA A;  1T9K A;  2L81 A;  3G4Z A;  4I44 A;  2YVK A;  4CS8 A;  4DOZ A;  4U5E E;  4EBK A;  5BQH A;  4MND A;  5CI9 A;  2JPU A;  3IQ5 A;  2H7B A;  1YZA A;  5IY5 C;  5L0I A;  3N0T A;  3GOR A;  4NC3 A;  1A7E A;  2IM8 A;  4Q7C A;  3S28 A;  1EI7 A;  1LS1 A;  2IOQ A;  2XSE A;  1G5Z A;  2CCY A;  2UUI A;  3KYJ A;  1OW6 A;  3C63 A;  3C8G A;  3QMK A;  4KI2 A;  3C8G B;  3K66 A;  2LFF A;  3U2L A;  4YT2 A;  3NDB B;  1PD1 A;  2R7X A;  1U6H A;  3C8G D;  1YA9 A;  1Y4C A;  4CX9 A;  5JSL A;  2A0U A;  3Q7L A;  3UMK A;  1ZW3 A;  2YLG A;  3ITF A;  3ZC4 A;  4H4K C;  2VCC A;  1LM3 B;  1H9T A;  3FMS A;  4O7G A;  4XEV A;  1OCO C;  4Q4Z F;  2YLI A;  3JRT A;  4W8K A;  1ZVZ A;  1NU7 D;  4DVZ A;  2V3C C;  1XZP A;  4N6C A;  1Q0G A;  4NTA A;  2NUT A;  2VCB A;  2NUT B;  2WVQ A;  4U9E A;  4OD4 A;  1LPE A;  1LI5 A;  3K7D A;  2ZPA A;  3QVZ A;  2OJQ A;  3CQZ A;  1A7V A;  1RKC A;  1V4A A;  2EPO A;  2QE9 A;  1TKN A;  2IXP A;  4J7Y A;  4U5C E;  2XRH A;  1MMD A;  3U9J A;  4BJ6 C;  2MWQ A;  3UMH A;  2KYH A;  3EJN A;  3F46 A;  4XWJ A;  3MX3 A;  2HFI A;  1D0X A;  2YLD A;  4YL3 A;  1K05 A;  2HZ8 A;  2HMQ A;  1S05 A;  3K1I A;  4Z9J A;  3LS0 A;  1Z6A A;  1YJG A;  5F5H A;  5COG A;  1WTY A;  4KBL A;  4G7O F;  1KU2 A;  2WVN A;  3UNG C;  3S0X A;  2R05 A;  3NYM A;  3DD7 A;  2HJ3 A;  1U89 A;  3UGP A;  4OIQ F;  1RMV A;  2C03 A;  3S84 A;  4D4X A;  5E3C A;  1SMY F;  4JTA B;  4BPM A;  4EBB A;  1VMA A;  2R7T A;  1L7C A;  3GOD A;  2HMZ A;  1XZQ A;  1ZZP A;  5COM A;  1OR3 A;  4MQ9 F;  3RFY A;  1FMW A;  1JPN A;  2XM4 A;  3DMD A;  1NZE A;  4ULW A;  3NMJ A;  5JT4 A;  1RKE A;  2WL8 A;  3A9C A;  1RKE B;  4NQF A;  5BUO A;  3HNK A;  5AC5 A;  2J9U A;  3HLZ A;  2CNW A;  2J7P A;  2B0H A;  3L8J A;  1V55 C;  3JYY A;  4C3B A;  2L6F A;  4K1O A;  2HUJ A;  3LEV A;  4MVQ A;  3CZ6 A;  5DLJ A;  4EBJ A;  2BL2 A;  3TOM A;  5F5F A;  1B68 A;  1SZI A;  2P1A A;  3UGO A;  2YL1 A;  2D5R B;  1HMD A;  3U8V A;  1OXK A;  4MVU A;  3VAY A;  2IXN A;  3PCV A;  3HKK A;  4J32 B;  5BQI A;  1VOM A;  1DOW A;  1OW7 A;  4XPW A;  2MYS A;  4FES A;  1SYQ A;  3TUL A;  1AEP A;  4LER A;  1SF8 A;  2XL4 A;  4BG0 A;  1KNY A;  3MYF A;  3AJM A;  3VRC A;  3V7O A;  4DRI B;  1NU9 C;  1YZC A;  3BEH A;  2AWC A;  4JTD B;  3C8Z A;  4DVY P;  3KYI A;  1QLE C;  1OCZ C;  2AWY A;  4MVM A;  4G7Z F;  2GAQ A;  4O6M A;  1LI7 A;  1J8Y F;  3L8I A;  1M2O A;  1JAF A;  4IGG A;  2NPU A;  4MVR A;  1BR2 A;  4EUK B; 
#chains in the Genus database with same CATH homology
 1JRA A;  3U2L A;  4E0I A;  3O55 A;  3GWN A;  4E0H A;  3LLK A;  3U5S A;  2HJ3 A;  3GWL A;  3W4Y A;  3R7C A;  3LLI A;  3U2M A;  1OQC A;  3TK0 A;  3TD7 A;  3MBG A;  1JR8 A;  4LDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...