4E0IA

Crystal structure of the c30s/c133s mutant of erv1 from saccharomyces cerevisiae
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
152
Chain Sequence
EGLSGRKIIYDEDGKPSRSCNTLLDFQYVTGKISELMPGSRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPCNWSAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDGWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial FAD-linked sulfhydryl oxidase ERV1
publication title Structure of yeast sulfhydryl oxidase erv1 reveals electron transfer of the disulfide relay system in the mitochondrial intermembrane space
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 40
structure length 152
sequence length 175
chains with identical sequence B, C
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2012-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 4e0iA02
1JRAA 3TD7A 3O55A 3GWLA 3U2LA 3TK0A 3U2MA 3LLIA 3LLKA 4LDKA 3U5SA 3R7CA 3MBGA 3W4YA 4E0IA 3GWNA 2HJ3A 1JR8A 4E0HA 1OQCA
chains in the Genus database with same CATH superfamily
2BC5A 2R05A 2AWCA 4BJTA 4XTKA 1H9TA 4C7OA 1S05A 2XL8A 3U0CA 4IAQA 1H9GA 1OW6A 3GODA 4JURI 3KH2A 3AG2C 4E7ZA 1CGOA 1WGWA 2CW0F 2YVKA 3M4CA 3OWTA 3C63A 2XLVA 4XPXA 3U2MA 1NZEA 3W8IA 1T6IA 2ZXRA 2YLDA 1U89A 3M15A 1OXKA 2L6FA 1D1CA 3N24A 2KQ9A 3BRJA 4NY3A 3ZWIA 3RF3A 2W9YA 1YA9A 1YJGA 3SXKA 3TULA 3K1HA 5FZTA 3SXYA 3ZC4A 2NUTB 3JTLO 4E7SA 1OXBA 3IEEA 2Y3HA 1AVOB 2J7PD 4PK4A 1YYJA 1LVKA 3K1IC 5AC5A 1XWJA 3JZ0A 3K66A 1ZW3A 2DB4A 5A6KA 2UUIA 3FAJA 1OR3A 3NKDA 4IJJA 1V54C 4XEFA 3RYLA 3QZCA 4D4NA 3UGPA 1PV3A 3ZQYA 2G3KA 1TWAA 2KGOA 3N2ZB 4I3MA 4ULWA 4X0RA 1LE4A 2OJQA 3T4RA 1GM5A 2R9RB 4WGYA 1TWHA 4Z9HA 1A7VA 4N4WA 1E85A 3C62A 1EQ1A 2GAQA 3LEOA 5JSLA 4BJ6A 3A11A 1PD1A 3LAYA 3LLKA 3U5SA 1VLSA 2J9WA 3HNJA 4KNVA 1I4ZA 4J7TA 1APCA 2OEVA 4U5CE 4AK9A 2R7SA 1A41A 2CNWD 3I5QA 2QLAA 3LS0A 3JYYA 3SEOA 5DQTA 1WTYA 1HY5A 5KYWA 3AGUA 1ST6A 1TWCA 5CI8A 4D4XA 3R2PA 5E3CA 3ASNC 2P61A 2PFDA 4YL3A 2YL1A 2P0NA 1NU7D 5JVEA 1OW8A 2YL0A 1FAPB 3NYMA 2OEXA 5COMA 3O55A 1Q0DA 2XRHA 2HS5A 1N1CA 1ORSC 4DRHB 4CIHA 1ZW2A 4PR9A 3TK0A 1HMDA 2L9JA 2OJED 5T3WA 3TJ5A 2J46A 2NSFA 3DD7A 3DI5A 3EGXB 2A0BA 1EA8A 2IM8A 3EQLF 3IQTA 3QVYA 5COGA 3GM2A 4BEJA 2LSEA 5E2QA 1OCOC 3B0PA 1NFNA 2IYLD 4O6YA 5KYYB 1V55C 4CS8C 3J06A 1I5NA 1U0BB 1EKYA 4H4KC 3DE9A 1AEPA 3QW1A 2CCYA 2XS8A 2M4EA 1EI7A 4WABA 4E17A 2C04A 2XM0A 3NG1A 4LERA 3O10A 2HJ3A 3NDBB 1L3PA 5L3VA 3GANA 1RXQA 1MMDA 4K7BA 1OKKD 4EHPA 3UGOA 3MLGA 1CPRA 3ABLC 4I1OB 2LCHA 4M63A 4YL1A 2OOCA 2YLGA 3WHNA 2A6HF 3QTHA 1U6HA 1YYXA 2G3VA 4MTGA 4MVUA 4EBBA 1MNEA 4ANJA 3G4ZA 4Z9IA 3NMJA 4RD9A 2VB6A 3B0UX 5F5FA 1VK5A 2VH3A 5E33A 2OKUA 3EGXA 4Q7CA 3WG7C 4BJ5C 2OQMA 4EKWA 4KNWA 3PDMP 1NG1A 2Q9BA 2YHSA 4NTAA 5KYYA 2RD9A 2R03A 3M79A 1MMGA 2TMVP 3FHDA 4IB4A 2Y39A 3L0IA 3O39A 3Q7LA 3AGTA 4JKVA 2O9XA 3ZG1A 2IOQA 4N06A 2R7VA 1FFHA 2XLOA 1QVXA 2XS1A 3Q6MA 4DJ9A 5L0HA 1LI7A 2WVQA 4MVSA 1JR8A 3WODF 4HFKB 5JS5A 5HSWA 1QLEC 1TQGA 5DS5A 1C03A 3TD7A 4P9FA 2P7VA 2YL3A 4PJMA 4CDYA 4KI2A 3ZVRA 4ONSA 2HKVA 4U5DE 2MWQA 3IPMO 3W8HA 3U2LA 2R7OA 2ASRA 3LLIA 3AQCA 2CYDA 4F4BA 3M4BA 2GFHA 4G78A 4IARA 3X2QC 3RH3A 1MNDA 3DWWA 2UUHA 4LLEA 4MVQA 3RVYA 3SNHA 4EBJA 3JSEO 3ZSUA 3ASOC 1JPNA 3N0TA 4K1OA 2XL4A 3CAXA 2J7PA 4BJ6C 2HJMA 2YL7A 4DRIB 5BQIA 2G62A 3WAQA 3SXZA 1GQAA 4MVMA 4UDVA 2WB7A 2FFHA 5B1BC 2GDCA 1JOGA 2Q9AA 5EGYA 4PFOA 1D1BA 3EG9A 5CIVA 1YDIA 1B68A 1GS9A 4XPWA 3EH1A 2X51A 3S84A 4YL0A 3DKAA 1K05A 4MS2A 4IAOA 1ORJA 1J8MF 3C7JA 1T6UA 4P6IC 4Z9JA 2EPOA 3M1CB 3RQFA 1M2OA 4XPYA 2Z15A 4DBRA 2MYSA 5B1AC 5L0CA 2VC9A 3AG1C 5CI9A 2CNWA 4G0HA 3DAGA 5KYWB 3U3BA 4AE4B 2R7UA 3FOOA 2MHRA 1RCPA 2XM4A 2L6HA 1SMYF 1HW2A 1XZQA 4QDLA 1C17M 1G4WR 2EPNA 3NMIA 3TOMA 4IRUA 2OG2A 3DXJF 1LKXA 2EIJC 2HUJA 4EBKA 4PJJA 2WVOA 2AWYA 4FX5A 1ORYA 3S28A 3U8PA 3W2VA 1E2XA 1WATA 2A69F 2FAPB 3GWLA 3ZIBA 3B0VC 5A6BD 2XXAA 3LJBA 1QKRA 2WVNA 3KYJA 2R7XA 4A4AA 4CSAC 2LFDA 4LACB 1IW7F 5T1DB 4CS9C 3GM3A 2XLEA 4GYTA 2J9UA 4C3DA 1M6TA 3DM5A 3KYIA 2Q9CA 3FAPB 1BBHA 4JEAA 2W4MA 4EIYA 2EPLX 4CX9A 4I44A 1HMOA 1ZHWA 4AE4A 5KYXA 3CSKA 3PHF2 3NRHA 1QPUA 3VAYA 1A7EA 1K04A 4AX2A 2J0WA 1TFKB 1IZMA 2FGYA 3TJ6A 1OCRC 5BQGA 2Q3TA 1OKKA 1TWGA 3RQEA 1HE1A 2HSBA 4MVZA 2XLMA 1W2WA 1YVIA 2I8BA 2ZPAA 1RJ9A 3DZAA 4XEKA 3SP1A 4CS9A 4MNDA 3SYNA 4P9TA 1T6QA 1LS1A 3MX3A 4IGGA 3IQ6A 3AJMA 3NMKA 4JRZA 2J9VA 2OCCC 5BQHA 4G7ZF 2J0XA 4LLCA 3EJNA 4KC9A 1YA7O 3T9OA 4BPMA 1O5HA 4CIPA 2R7TA 2QY9A 3R7CA 3ZTZA 4MVOA 2J9BA 3A9CA 2W45A 4OINF 4I1MA 3GORA 3O6XA 3MFNA 3RKOF 3FVYA 3V5YA 3HKKA 3TOLA 1K40A 1D0YA 2Q4FA 3H65A 1R5ID 2GWWA 1R4TA 2C03A 3HTKC 2H8AA 4JVSA 1V4AA 2PNOA 2XLDA 2WL8A 1LM3B 3GEHA 2JX0A 2LK4A 2IXPA 3HLZA 1G5ZA 4W8KA 3ABKC 1RKCA 3NYLA 1E86A 1L7CA 4GEHA 1CGME 1JRAA 1KNYA 4OD4A 2DGJA 3JT1A 3US6A 1E84A 2NUPB 3K7DA 4DBQA 4BEMJ 3DAFA 1LPEA 4JZAA 4YT5A 3F47A 1MQVA 3EHMA 5DS6A 5JRAA 2YZSA 5DLJA 3L8IA 3NYJA 2KK1A 1CGNA 5B3IA 3ZDLA 2LQGA 1T01A 3RW0A 5FCLA 2WZFA 2R7WA 3GEIA 1Y6DA 3JSZA 5L0GA 1ZZPA 2QNLA 4JCHA 2AP3A 5D91A 1Q0FA 2H7BA 2KYHA 3T6BA 4YT8A 1MMNA 2A0UA 2KC3A 4E0HA 2QUPA 2XSEA 3EZHA 2WZGA 4NTBA 4CJGA 4WGZA 4HEAJ 3UMHA 3E9VA 2I15A 2IXMA 3KPHA 3EG9B 3H2UA 2KSFA 1VYKA 1TR2A 1YZAA 4O79A 3B9QA 1OCZC 2NUPA 3FOPA 2VCCA 3Q6NA 3SZRA 4CDAA 2LP4A 4LDKA 5KYNA 4J7YA 5JT4A 3B71A 1NSGB 4N6HA 4RDAA 5JP7A 2E87A 1TKNA 2EILC 3UR3C 2NPUA 3MYFA 4YWQA 3UMIA 2EINC 1YZCA 1O3UA 3DJUB 1RKEA 4BG0A 5T3TA 4AL0A 2R7RA 1DOVA 1FMVA 2D5RB 1YLMA 3S0XA 5AC4A 1BDJB 2KW3C 2HFIA 2B0HA 1BR1A 1S7ZA 4ZLDA 1G4US 1Q0MA 4PACA 5E3AA 4JCZA 4CS8A 4XLPF 3G50A 2JPUA 2QE9A 4YT2A 1YARO 4E18A 1MMAA 1O87A 3CQZA 4MQ9F 1GGQA 4XLNF 2ICWG 1FFTC 2IXNA 3S29A 3IHUA 2XXAB 2HV6A 4JJFA 3G4XA 3OEOA 4JC7A 1PCXA 5A6BA 1VMAA 5AGFA 4YN0B 3DM9B 1AUEA 2ZXWC 2RSEB 3V5XA 2Y3GA 3GEEA 2X0CA 3S9OA 3T6GB 4FWVA 2J45A 2KJGA 4DRJB 2Q7RA 5HV9A 2OU6A 3HJCA 1YAUO 3MBGA 2L7AA 1ZHZA 5KYXB 3S90A 1XZPA 1Y4CA 4A2NB 1WASA 4H54A 2R25A 2A68F 4HFFB 1M2VB 1SYQA 2R7QA 4MW3A 3UMKA 4AL1A 4BJ5A 1JAFA 1H7IA 3L34A 1NBBA 4JTDB 4CBEA 5BUOA 1Q0KA 1OQCA 3ATPA 2R02A 4OD5A 3C8GD 5F28E 2HZ8A 2CDQA 2H7OA 2PX0A 4PFPA 2ZD9A 1I4YA 1RJ9B 2YLIA 2YWAA 2LFFA 5A6AA 2ZXOA 3LEVA 3IQCA 2IXOA 3ZQVA 5L0IA 1BZ4A 1SF8A 3EHNA 4QI0A 2A1DD 3EPVA 3ITFA 1SR2A 2Y69C 3POVA 3RFYA 3RQGA 4U9EA 4IWBA 3V5ZA 4RBNA 4G7HF 2A6EF 1ZU5A 3SXMA 3DE8A 3AG3C 3ECSA 3ZTMA 4BJ1A 3GM1A 1HW1A 4DVZA 4U5EE 1LE2A 3K33A 5EHHA 1UG7A 2BE5F 3HNLA 1LS4A 1Z23A 1D1AA 2PP4A 3QVZA 1VB5A 1OR2A 2VASA 1M2VA 1ZHXA 3U9JA 1DOWA 3BEHA 2PX3A 4Q4ZF 4OIQF 2JD3A 2AVKA 3QW0A 1LIHA 2CGEA 1J8YF 1NLXA 3FMSA 3IQ5A 3JCUQ 4NTFA 4MTFA 1ZVZA 4U5FE 5GPGB 3HNKA 3CZ6A 4ZLCA 1NFOA 5L0JA 5L0DA 1OCCC 4MW8A 1KU2A 4O7GA 3PCVA 2Y3BA 2J8WA 4JIOA 3LS1A 2EPKX 1Z5ZA 4EUKB 4C3BA 2EIKC 3PMRA 4PJNA 3F46A 2W4BA 5DS4A 2AU5A 5EK0A 2L6GA 2NG1A 2NUTA 1LI5A 1V74B 2EIMC 3S27A 5L0FA 3DMDA 1FNTc 2HMQA 2VCBA 1T9KA 5F5HA 1D0XA 3K6BA 1H6GA 4MVRA 4J30B 5DVWA 3T6JA 4FAPB 1BR2A 3QMKA 2XL6A 2D4UA 3C8ZA 3LNMB 1FMWA 4LDRA 4NQFA 1KTMA 4OIOF 3AOUA 3VM6A 1VLTA 4YJWA 4ULVA 4DOZA 1NU9C 3K1IA 3X1OA 1HE9A 4GQHA 3CEXA 3VYWA 1F1MA 3VRCA 3Q7GA 1CPQA 2LIGA 1QSPA 3NKEA 3TQOA 4U5GA 1QZXA 3RIPA 2HMZA 3FXHA 2KNHA 4O6MA 3AQBA 2P1AA 4J32B 2L81A 1SZIA 1T5OA 1RKEB 2DI3A 5A6JA 1JMWA 3KL4A 4XQ1A 5L3QA 3LESA 3KMIA 2PBEA 1TFOB 4CSAA 4DXWA 2YKZA 3I5PA 2XLWA 2H7VC 2HSQA 1ZHYA 2ZXPA 5JLIA 1E83A 1VOMA 3L1MA 2QTVA 3U9MA 3C8GB 3UNGC 1UFBA 2IBFA 4OIRF 4JTAB 4CDVA 2Q00A 4OIPF 3MYIA 5B3SC 1G8XA 2YRFA 1RMVA 4JJGA 1ZU4A 4NCQA 3FDQA 2LD6A 1OW7A 2XLHA 1C02A 3I4UA 3LNRA 4K0DA 3L8JA 3B29A 1M56C 2ETSA 4W8PA 1D0ZA 4N6CA 1Z7Qc 5K0IA 4MTOA 4WJ0A 3H2VA 4PJLA 3EFOB 2WZLA 3C18A 4NC3A 2B0JA 256BA 4JW1A 5DQZA 1FTSA 5KYUB 4XWJA 3U8VA 5JUAA 1WWPA 4HE8D 2V26A 4B6IA 4R32A 4LDQA 3KKBA 3EGDB 3JRTA 4JTCB 4E0IA 4U5HA 3HNIA 1A0BA 2P6VA 4JEBA 3EZIA 4DVYP 3E70C 5COFA 1PD0A 4G7OF 4C7OB 1JPJA 4O6NA 4YK5A 2YEVA 4L6RA 3C8GA 4XEVA 2GA0A 3U3FA 5A69A 4ER9A 1VTMP 2DYSC 2VCAA 2HV7A 4KBLA 4QI2A 1Q0GA 2M64A 4EWCA 1BR4A 2BL2A 1WN0A 3VF0A 2EPMX 1Z3IX 3JRMO 4CS7A 4FESA 3OA1A 1ZYRF 4C3EA 3EFOA 2PF4E 1Z6AA 1ZHTA 1QQ3A 1Z63A 3JYHA 5KYUA 4U9DA 3W2WA 4CJOA 2V3CC 3V7OA 3W4YA 1VYIA 2Y3DA 2YQYA 3AG4C 3DJNB 1WOLA 3GWNA 4JE9A 3EGDA 5TJ5E 5IY5C 2DYRC 5D92A 3LUTB 1M57C 3RVZA 4U5BE 1FR0A 2F22A 3EH2A 4Q5SF 1A7DA 2NSGA 3ABMC 4YT4A
chains in the Genus database with same CATH topology
1JRAA 3TD7A 3O55A 3GWLA 3U2LA 3TK0A 3U2MA 3LLIA 3LLKA 4LDKA 3U5SA 3R7CA 3MBGA 3W4YA 4E0IA 3GWNA 2HJ3A 1JR8A 4E0HA 1OQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRA A;  3TD7 A;  3O55 A;  3GWL A;  3U2L A;  3TK0 A;  3U2M A;  3LLI A;  3LLK A;  4LDK A;  3U5S A;  3R7C A;  3MBG A;  3W4Y A;  4E0I A;  3GWN A;  2HJ3 A;  1JR8 A;  4E0H A;  1OQC A; 
#chains in the Genus database with same CATH topology
 2BC5 A;  2R05 A;  2AWC A;  4BJT A;  4XTK A;  1H9T A;  4C7O A;  1S05 A;  2XL8 A;  3U0C A;  4IAQ A;  1H9G A;  1OW6 A;  3GOD A;  4JUR I;  3KH2 A;  3AG2 C;  4E7Z A;  1CGO A;  1WGW A;  2CW0 F;  2YVK A;  3M4C A;  3OWT A;  3C63 A;  2XLV A;  4XPX A;  3U2M A;  1NZE A;  3W8I A;  1T6I A;  2ZXR A;  2YLD A;  1U89 A;  3M15 A;  1OXK A;  2L6F A;  1D1C A;  3N24 A;  2KQ9 A;  3BRJ A;  4NY3 A;  3ZWI A;  3RF3 A;  2W9Y A;  1YA9 A;  1YJG A;  3SXK A;  3TUL A;  3K1H A;  5FZT A;  3SXY A;  3ZC4 A;  2NUT B;  3JTL O;  4E7S A;  1OXB A;  3IEE A;  2Y3H A;  1AVO B;  2J7P D;  4PK4 A;  1YYJ A;  1LVK A;  3K1I C;  5AC5 A;  1XWJ A;  3JZ0 A;  3K66 A;  1ZW3 A;  2DB4 A;  5A6K A;  2UUI A;  3FAJ A;  1OR3 A;  3NKD A;  4IJJ A;  1V54 C;  4XEF A;  3RYL A;  3QZC A;  4D4N A;  3UGP A;  1PV3 A;  3ZQY A;  2G3K A;  1TWA A;  2KGO A;  3N2Z B;  4I3M A;  4ULW A;  4X0R A;  1LE4 A;  2OJQ A;  3T4R A;  1GM5 A;  2R9R B;  4WGY A;  1TWH A;  4Z9H A;  1A7V A;  4N4W A;  1E85 A;  3C62 A;  1EQ1 A;  2GAQ A;  3LEO A;  5JSL A;  4BJ6 A;  3A11 A;  1PD1 A;  3LAY A;  3LLK A;  3U5S A;  1VLS A;  2J9W A;  3HNJ A;  4KNV A;  1I4Z A;  4J7T A;  1APC A;  2OEV A;  4U5C E;  4AK9 A;  2R7S A;  1A41 A;  2CNW D;  3I5Q A;  2QLA A;  3LS0 A;  3JYY A;  3SEO A;  5DQT A;  1WTY A;  1HY5 A;  5KYW A;  3AGU A;  1ST6 A;  1TWC A;  5CI8 A;  4D4X A;  3R2P A;  5E3C A;  3ASN C;  2P61 A;  2PFD A;  4YL3 A;  2YL1 A;  2P0N A;  1NU7 D;  5JVE A;  1OW8 A;  2YL0 A;  1FAP B;  3NYM A;  2OEX A;  5COM A;  3O55 A;  1Q0D A;  2XRH A;  2HS5 A;  1N1C A;  1ORS C;  4DRH B;  4CIH A;  1ZW2 A;  4PR9 A;  3TK0 A;  1HMD A;  2L9J A;  2OJE D;  5T3W A;  3TJ5 A;  2J46 A;  2NSF A;  3DD7 A;  3DI5 A;  3EGX B;  2A0B A;  1EA8 A;  2IM8 A;  3EQL F;  3IQT A;  3QVY A;  5COG A;  3GM2 A;  4BEJ A;  2LSE A;  5E2Q A;  1OCO C;  3B0P A;  1NFN A;  2IYL D;  4O6Y A;  5KYY B;  1V55 C;  4CS8 C;  3J06 A;  1I5N A;  1U0B B;  1EKY A;  4H4K C;  3DE9 A;  1AEP A;  3QW1 A;  2CCY A;  2XS8 A;  2M4E A;  1EI7 A;  4WAB A;  4E17 A;  2C04 A;  2XM0 A;  3NG1 A;  4LER A;  3O10 A;  2HJ3 A;  3NDB B;  1L3P A;  5L3V A;  3GAN A;  1RXQ A;  1MMD A;  4K7B A;  1OKK D;  4EHP A;  3UGO A;  3MLG A;  1CPR A;  3ABL C;  4I1O B;  2LCH A;  4M63 A;  4YL1 A;  2OOC A;  2YLG A;  3WHN A;  2A6H F;  3QTH A;  1U6H A;  1YYX A;  2G3V A;  4MTG A;  4MVU A;  4EBB A;  1MNE A;  4ANJ A;  3G4Z A;  4Z9I A;  3NMJ A;  4RD9 A;  2VB6 A;  3B0U X;  5F5F A;  1VK5 A;  2VH3 A;  5E33 A;  2OKU A;  3EGX A;  4Q7C A;  3WG7 C;  4BJ5 C;  2OQM A;  4EKW A;  4KNW A;  3PDM P;  1NG1 A;  2Q9B A;  2YHS A;  4NTA A;  5KYY A;  2RD9 A;  2R03 A;  3M79 A;  1MMG A;  2TMV P;  3FHD A;  4IB4 A;  2Y39 A;  3L0I A;  3O39 A;  3Q7L A;  3AGT A;  4JKV A;  2O9X A;  3ZG1 A;  2IOQ A;  4N06 A;  2R7V A;  1FFH A;  2XLO A;  1QVX A;  2XS1 A;  3Q6M A;  4DJ9 A;  5L0H A;  1LI7 A;  2WVQ A;  4MVS A;  1JR8 A;  3WOD F;  4HFK B;  5JS5 A;  5HSW A;  1QLE C;  1TQG A;  5DS5 A;  1C03 A;  3TD7 A;  4P9F A;  2P7V A;  2YL3 A;  4PJM A;  4CDY A;  4KI2 A;  3ZVR A;  4ONS A;  2HKV A;  4U5D E;  2MWQ A;  3IPM O;  3W8H A;  3U2L A;  2R7O A;  2ASR A;  3LLI A;  3AQC A;  2CYD A;  4F4B A;  3M4B A;  2GFH A;  4G78 A;  4IAR A;  3X2Q C;  3RH3 A;  1MND A;  3DWW A;  2UUH A;  4LLE A;  4MVQ A;  3RVY A;  3SNH A;  4EBJ A;  3JSE O;  3ZSU A;  3ASO C;  1JPN A;  3N0T A;  4K1O A;  2XL4 A;  3CAX A;  2J7P A;  4BJ6 C;  2HJM A;  2YL7 A;  4DRI B;  5BQI A;  2G62 A;  3WAQ A;  3SXZ A;  1GQA A;  4MVM A;  4UDV A;  2WB7 A;  2FFH A;  5B1B C;  2GDC A;  1JOG A;  2Q9A A;  5EGY A;  4PFO A;  1D1B A;  3EG9 A;  5CIV A;  1YDI A;  1B68 A;  1GS9 A;  4XPW A;  3EH1 A;  2X51 A;  3S84 A;  4YL0 A;  3DKA A;  1K05 A;  4MS2 A;  4IAO A;  1ORJ A;  1J8M F;  3C7J A;  1T6U A;  4P6I C;  4Z9J A;  2EPO A;  3M1C B;  3RQF A;  1M2O A;  4XPY A;  2Z15 A;  4DBR A;  2MYS A;  5B1A C;  5L0C A;  2VC9 A;  3AG1 C;  5CI9 A;  2CNW A;  4G0H A;  3DAG A;  5KYW B;  3U3B A;  4AE4 B;  2R7U A;  3FOO A;  2MHR A;  1RCP A;  2XM4 A;  2L6H A;  1SMY F;  1HW2 A;  1XZQ A;  4QDL A;  1C17 M;  1G4W R;  2EPN A;  3NMI A;  3TOM A;  4IRU A;  2OG2 A;  3DXJ F;  1LKX A;  2EIJ C;  2HUJ A;  4EBK A;  4PJJ A;  2WVO A;  2AWY A;  4FX5 A;  1ORY A;  3S28 A;  3U8P A;  3W2V A;  1E2X A;  1WAT A;  2A69 F;  2FAP B;  3GWL A;  3ZIB A;  3B0V C;  5A6B D;  2XXA A;  3LJB A;  1QKR A;  2WVN A;  3KYJ A;  2R7X A;  4A4A A;  4CSA C;  2LFD A;  4LAC B;  1IW7 F;  5T1D B;  4CS9 C;  3GM3 A;  2XLE A;  4GYT A;  2J9U A;  4C3D A;  1M6T A;  3DM5 A;  3KYI A;  2Q9C A;  3FAP B;  1BBH A;  4JEA A;  2W4M A;  4EIY A;  2EPL X;  4CX9 A;  4I44 A;  1HMO A;  1ZHW A;  4AE4 A;  5KYX A;  3CSK A;  3PHF 2;  3NRH A;  1QPU A;  3VAY A;  1A7E A;  1K04 A;  4AX2 A;  2J0W A;  1TFK B;  1IZM A;  2FGY A;  3TJ6 A;  1OCR C;  5BQG A;  2Q3T A;  1OKK A;  1TWG A;  3RQE A;  1HE1 A;  2HSB A;  4MVZ A;  2XLM A;  1W2W A;  1YVI A;  2I8B A;  2ZPA A;  1RJ9 A;  3DZA A;  4XEK A;  3SP1 A;  4CS9 A;  4MND A;  3SYN A;  4P9T A;  1T6Q A;  1LS1 A;  3MX3 A;  4IGG A;  3IQ6 A;  3AJM A;  3NMK A;  4JRZ A;  2J9V A;  2OCC C;  5BQH A;  4G7Z F;  2J0X A;  4LLC A;  3EJN A;  4KC9 A;  1YA7 O;  3T9O A;  4BPM A;  1O5H A;  4CIP A;  2R7T A;  2QY9 A;  3R7C A;  3ZTZ A;  4MVO A;  2J9B A;  3A9C A;  2W45 A;  4OIN F;  4I1M A;  3GOR A;  3O6X A;  3MFN A;  3RKO F;  3FVY A;  3V5Y A;  3HKK A;  3TOL A;  1K40 A;  1D0Y A;  2Q4F A;  3H65 A;  1R5I D;  2GWW A;  1R4T A;  2C03 A;  3HTK C;  2H8A A;  4JVS A;  1V4A A;  2PNO A;  2XLD A;  2WL8 A;  1LM3 B;  3GEH A;  2JX0 A;  2LK4 A;  2IXP A;  3HLZ A;  1G5Z A;  4W8K A;  3ABK C;  1RKC A;  3NYL A;  1E86 A;  1L7C A;  4GEH A;  1CGM E;  1JRA A;  1KNY A;  4OD4 A;  2DGJ A;  3JT1 A;  3US6 A;  1E84 A;  2NUP B;  3K7D A;  4DBQ A;  4BEM J;  3DAF A;  1LPE A;  4JZA A;  4YT5 A;  3F47 A;  1MQV A;  3EHM A;  5DS6 A;  5JRA A;  2YZS A;  5DLJ A;  3L8I A;  3NYJ A;  2KK1 A;  1CGN A;  5B3I A;  3ZDL A;  2LQG A;  1T01 A;  3RW0 A;  5FCL A;  2WZF A;  2R7W A;  3GEI A;  1Y6D A;  3JSZ A;  5L0G A;  1ZZP A;  2QNL A;  4JCH A;  2AP3 A;  5D91 A;  1Q0F A;  2H7B A;  2KYH A;  3T6B A;  4YT8 A;  1MMN A;  2A0U A;  2KC3 A;  4E0H A;  2QUP A;  2XSE A;  3EZH A;  2WZG A;  4NTB A;  4CJG A;  4WGZ A;  4HEA J;  3UMH A;  3E9V A;  2I15 A;  2IXM A;  3KPH A;  3EG9 B;  3H2U A;  2KSF A;  1VYK A;  1TR2 A;  1YZA A;  4O79 A;  3B9Q A;  1OCZ C;  2NUP A;  3FOP A;  2VCC A;  3Q6N A;  3SZR A;  4CDA A;  2LP4 A;  4LDK A;  5KYN A;  4J7Y A;  5JT4 A;  3B71 A;  1NSG B;  4N6H A;  4RDA A;  5JP7 A;  2E87 A;  1TKN A;  2EIL C;  3UR3 C;  2NPU A;  3MYF A;  4YWQ A;  3UMI A;  2EIN C;  1YZC A;  1O3U A;  3DJU B;  1RKE A;  4BG0 A;  5T3T A;  4AL0 A;  2R7R A;  1DOV A;  1FMV A;  2D5R B;  1YLM A;  3S0X A;  5AC4 A;  1BDJ B;  2KW3 C;  2HFI A;  2B0H A;  1BR1 A;  1S7Z A;  4ZLD A;  1G4U S;  1Q0M A;  4PAC A;  5E3A A;  4JCZ A;  4CS8 A;  4XLP F;  3G50 A;  2JPU A;  2QE9 A;  4YT2 A;  1YAR O;  4E18 A;  1MMA A;  1O87 A;  3CQZ A;  4MQ9 F;  1GGQ A;  4XLN F;  2ICW G;  1FFT C;  2IXN A;  3S29 A;  3IHU A;  2XXA B;  2HV6 A;  4JJF A;  3G4X A;  3OEO A;  4JC7 A;  1PCX A;  5A6B A;  1VMA A;  5AGF A;  4YN0 B;  3DM9 B;  1AUE A;  2ZXW C;  2RSE B;  3V5X A;  2Y3G A;  3GEE A;  2X0C A;  3S9O A;  3T6G B;  4FWV A;  2J45 A;  2KJG A;  4DRJ B;  2Q7R A;  5HV9 A;  2OU6 A;  3HJC A;  1YAU O;  3MBG A;  2L7A A;  1ZHZ A;  5KYX B;  3S90 A;  1XZP A;  1Y4C A;  4A2N B;  1WAS A;  4H54 A;  2R25 A;  2A68 F;  4HFF B;  1M2V B;  1SYQ A;  2R7Q A;  4MW3 A;  3UMK A;  4AL1 A;  4BJ5 A;  1JAF A;  1H7I A;  3L34 A;  1NBB A;  4JTD B;  4CBE A;  5BUO A;  1Q0K A;  1OQC A;  3ATP A;  2R02 A;  4OD5 A;  3C8G D;  5F28 E;  2HZ8 A;  2CDQ A;  2H7O A;  2PX0 A;  4PFP A;  2ZD9 A;  1I4Y A;  1RJ9 B;  2YLI A;  2YWA A;  2LFF A;  5A6A A;  2ZXO A;  3LEV A;  3IQC A;  2IXO A;  3ZQV A;  5L0I A;  1BZ4 A;  1SF8 A;  3EHN A;  4QI0 A;  2A1D D;  3EPV A;  3ITF A;  1SR2 A;  2Y69 C;  3POV A;  3RFY A;  3RQG A;  4U9E A;  4IWB A;  3V5Z A;  4RBN A;  4G7H F;  2A6E F;  1ZU5 A;  3SXM A;  3DE8 A;  3AG3 C;  3ECS A;  3ZTM A;  4BJ1 A;  3GM1 A;  1HW1 A;  4DVZ A;  4U5E E;  1LE2 A;  3K33 A;  5EHH A;  1UG7 A;  2BE5 F;  3HNL A;  1LS4 A;  1Z23 A;  1D1A A;  2PP4 A;  3QVZ A;  1VB5 A;  1OR2 A;  2VAS A;  1M2V A;  1ZHX A;  3U9J A;  1DOW A;  3BEH A;  2PX3 A;  4Q4Z F;  4OIQ F;  2JD3 A;  2AVK A;  3QW0 A;  1LIH A;  2CGE A;  1J8Y F;  1NLX A;  3FMS A;  3IQ5 A;  3JCU Q;  4NTF A;  4MTF A;  1ZVZ A;  4U5F E;  5GPG B;  3HNK A;  3CZ6 A;  4ZLC A;  1NFO A;  5L0J A;  5L0D A;  1OCC C;  4MW8 A;  1KU2 A;  4O7G A;  3PCV A;  2Y3B A;  2J8W A;  4JIO A;  3LS1 A;  2EPK X;  1Z5Z A;  4EUK B;  4C3B A;  2EIK C;  3PMR A;  4PJN A;  3F46 A;  2W4B A;  5DS4 A;  2AU5 A;  5EK0 A;  2L6G A;  2NG1 A;  2NUT A;  1LI5 A;  1V74 B;  2EIM C;  3S27 A;  5L0F A;  3DMD A;  1FNT c;  2HMQ A;  2VCB A;  1T9K A;  5F5H A;  1D0X A;  3K6B A;  1H6G A;  4MVR A;  4J30 B;  5DVW A;  3T6J A;  4FAP B;  1BR2 A;  3QMK A;  2XL6 A;  2D4U A;  3C8Z A;  3LNM B;  1FMW A;  4LDR A;  4NQF A;  1KTM A;  4OIO F;  3AOU A;  3VM6 A;  1VLT A;  4YJW A;  4ULV A;  4DOZ A;  1NU9 C;  3K1I A;  3X1O A;  1HE9 A;  4GQH A;  3CEX A;  3VYW A;  1F1M A;  3VRC A;  3Q7G A;  1CPQ A;  2LIG A;  1QSP A;  3NKE A;  3TQO A;  4U5G A;  1QZX A;  3RIP A;  2HMZ A;  3FXH A;  2KNH A;  4O6M A;  3AQB A;  2P1A A;  4J32 B;  2L81 A;  1SZI A;  1T5O A;  1RKE B;  2DI3 A;  5A6J A;  1JMW A;  3KL4 A;  4XQ1 A;  5L3Q A;  3LES A;  3KMI A;  2PBE A;  1TFO B;  4CSA A;  4DXW A;  2YKZ A;  3I5P A;  2XLW A;  2H7V C;  2HSQ A;  1ZHY A;  2ZXP A;  5JLI A;  1E83 A;  1VOM A;  3L1M A;  2QTV A;  3U9M A;  3C8G B;  3UNG C;  1UFB A;  2IBF A;  4OIR F;  4JTA B;  4CDV A;  2Q00 A;  4OIP F;  3MYI A;  5B3S C;  1G8X A;  2YRF A;  1RMV A;  4JJG A;  1ZU4 A;  4NCQ A;  3FDQ A;  2LD6 A;  1OW7 A;  2XLH A;  1C02 A;  3I4U A;  3LNR A;  4K0D A;  3L8J A;  3B29 A;  1M56 C;  2ETS A;  4W8P A;  1D0Z A;  4N6C A;  1Z7Q c;  5K0I A;  4MTO A;  4WJ0 A;  3H2V A;  4PJL A;  3EFO B;  2WZL A;  3C18 A;  4NC3 A;  2B0J A;  256B A;  4JW1 A;  5DQZ A;  1FTS A;  5KYU B;  4XWJ A;  3U8V A;  5JUA A;  1WWP A;  4HE8 D;  2V26 A;  4B6I A;  4R32 A;  4LDQ A;  3KKB A;  3EGD B;  3JRT A;  4JTC B;  4E0I A;  4U5H A;  3HNI A;  1A0B A;  2P6V A;  4JEB A;  3EZI A;  4DVY P;  3E70 C;  5COF A;  1PD0 A;  4G7O F;  4C7O B;  1JPJ A;  4O6N A;  4YK5 A;  2YEV A;  4L6R A;  3C8G A;  4XEV A;  2GA0 A;  3U3F A;  5A69 A;  4ER9 A;  1VTM P;  2DYS C;  2VCA A;  2HV7 A;  4KBL A;  4QI2 A;  1Q0G A;  2M64 A;  4EWC A;  1BR4 A;  2BL2 A;  1WN0 A;  3VF0 A;  2EPM X;  1Z3I X;  3JRM O;  4CS7 A;  4FES A;  3OA1 A;  1ZYR F;  4C3E A;  3EFO A;  2PF4 E;  1Z6A A;  1ZHT A;  1QQ3 A;  1Z63 A;  3JYH A;  5KYU A;  4U9D A;  3W2W A;  4CJO A;  2V3C C;  3V7O A;  3W4Y A;  1VYI A;  2Y3D A;  2YQY A;  3AG4 C;  3DJN B;  1WOL A;  3GWN A;  4JE9 A;  3EGD A;  5TJ5 E;  5IY5 C;  2DYR C;  5D92 A;  3LUT B;  1M57 C;  3RVZ A;  4U5B E;  1FR0 A;  2F22 A;  3EH2 A;  4Q5S F;  1A7D A;  2NSG A;  3ABM C;  4YT4 A; 
#chains in the Genus database with same CATH homology
 1JRA A;  3TD7 A;  3O55 A;  3GWL A;  3U2L A;  3TK0 A;  3U2M A;  3LLI A;  3LLK A;  4LDK A;  3U5S A;  3R7C A;  3MBG A;  3W4Y A;  4E0I A;  3GWN A;  2HJ3 A;  1JR8 A;  4E0H A;  1OQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...