4E0IA

Crystal structure of the c30s/c133s mutant of erv1 from saccharomyces cerevisiae
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
152
Chain Sequence
EGLSGRKIIYDEDGKPSRSCNTLLDFQYVTGKISELMPGSRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPCNWSAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDGWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of yeast sulfhydryl oxidase erv1 reveals electron transfer of the disulfide relay system in the mitochondrial intermembrane space
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Mitochondrial FAD-linked sulfhydryl oxidase ERV1
total genus 40
structure length 152
sequence length 175
chains with identical sequence B, C
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2012-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 4e0iA02
1JRAA 3GWNA 3LLKA 4LDKA 4E0HA 3TD7A 2HJ3A 3TK0A 1JR8A 3U2MA 3GWLA 3LLIA 3U2LA 3O55A 3R7CA 3U5SA 3W4YA 4E0IA 1OQCA 3MBGA
chains in the Genus database with same CATH superfamily
2KYHA 2EIJC 2LQGA 2GWWA 3ATPA 3GWNA 4MVSA 3NMKA 1H9TA 4NCQA 3W2VA 1JR8A 4J30B 1FTSA 2KW3C 1OKKA 4ULWA 3CQZA 5BUOA 3EFOA 3EPVA 4IB4A 3RH3A 1EI7A 3JCUQ 2RSEB 4D4XA 3TOMA 1D0ZA 1Z23A 3VAYA 2ICWG 3IEEA 3RQEA 3FDQA 1SMYF 2J0XA 2L7AA 3UMIA 3U3FA 1ORSC 3ZTMA 4BJ5C 3B0VC 2O9XA 2LIGA 2OKUA 4EUKB 3SNHA 3JT1A 2BC5A 4JRZA 1JOGA 4GQHA 1M2VA 4FESA 1HE1A 4MVMA 1A41A 2Q3TA 3KL4A 3RVZA 1L3PA 2H7OA 5DQTA 4XEFA 4U5FE 1OXKA 3IQTA 1CGNA 3C7JA 1V54C 2J9BA 2IXNA 3AG4C 4N4WA 3NMJA 3RF3A 2OQMA 3KH2A 3CAXA 4XWJA 1E83A 1ZHZA 4CS9A 3DAFA 2KGOA 2NSGA 1D0XA 4E0HA 5L0CA 4LERA 3B71A 3EH1A 4XLPF 5F5FA 1PV3A 3L8JA 2ZXPA 2Q9AA 2P61A 2WVOA 3ZSUA 3MLGA 3Q7LA 1R4TA 2CCYA 1FFHA 4O6YA 1BZ4A 3BRJA 4RDAA 4AL1A 2R9RB 5KYUB 1NSGB 5A6JA 4A4AA 1M2VB 4NTBA 1WOLA 3HKKA 4ANJA 3MYIA 4U5BE 3UMHA 3KMIA 3U9MA 1EKYA 4AE4A 1XZPA 1Y4CA 3B0UX 4HFFB 1YZCA 4G0HA 4MS2A 3LNRA 1V4AA 2B0HA 3TQOA 5JS5A 1F1MA 5KYNA 1PD0A 1H9GA 4XPYA 2I15A 2ZD9A 4U5GA 4UDVA 3AQBA 1YDIA 3AG3C 1RKEA 3C18A 2P1AA 4JC7A 5KYYB 2M4EA 2UUIA 3NG1A 4XPXA 5KYUA 3SEOA 3QW0A 4NQFA 1LS4A 2EPLX 1IW7F 1GGQA 1Q0KA 2XLWA 3ABLC 2ZXWC 1Z6AA 3BEHA 4W8KA 1XWJA 3X2QC 2NUTB 3C8GB 1M57C 1WGWA 2MYSA 1I5NA 5FZTA 1TFKB 2CGEA 3AG2C 4CS9C 1I4ZA 3POVA 2NSFA 1MMNA 1TQGA 1NZEA 1ZHWA 4M63A 1VOMA 3QMKA 1NLXA 5KYXA 1C03A 2I8BA 2R7XA 2EILC 3DD7A 3DM5A 1ZHYA 4JJFA 3GM1A 1O87A 3KKBA 1BR2A 5EGYA 3OA1A 3O6XA 1A7VA 2Y3GA 4AK9A 4DOZA 2QNLA 4DBQA 1B68A 1FAPB 2QTVA 1MMAA 4JTCB 2V26A 1EQ1A 1GQAA 2YL1A 3NYLA 1U0BB 4C7OB 2FFHA 1Q0FA 2G3KA 1DOWA 3M4CA 4U5EE 3U0CA 1A0BA 3FHDA 4N6CA 1AVOB 3ECSA 2NPUA 4XEKA 5JP7A 3S29A 1WTYA 3G4XA 4QI2A 3JRMO 2XL4A 3DWWA 4PJMA 3EG9B 3UR3C 2ZXRA 3TJ5A 3EQLF 3RYLA 1VTMP 5L0FA 5KYXB 2EPNA 3S28A 1LPEA 3EHMA 1ZVZA 4MTGA 1Q0GA 2L6GA 1NFNA 2W45A 3PMRA 1G8XA 2IXPA 5A6BA 2NG1A 1GM5A 4CS8C 4DVYP 3C8GD 1ORJA 4XEVA 3T6BA 1T5OA 2AU5A 3LS0A 1XZQA 2KC3A 2VCBA 3LAYA 4QDLA 2R7OA 5KYWB 4E0IA 1UG7A 3TULA 1Z3IX 4YL1A 2A0BA 3V7OA 2DYRC 4Z9JA 3L34A 4JCHA 3ZTZA 5KYWA 1BBHA 2PX3A 4OD5A 2DYSC 4MW8A 4NC3A 3ABMC 3S27A 5FCLA 1TR2A 2XL6A 1YZAA 4C3EA 4E7SA 2Y3DA 5A69A 1OW6A 5HSWA 3PDMP 2OEVA 2XM4A 3UNGC 3V5YA 1LIHA 1LVKA 1O3UA 3AOUA 3T9OA 5D92A 2YEVA 1LM3B 1I4YA 1SF8A 2ZPAA 2HV7A 2GA0A 2JD3A 1VLSA 2YVKA 1UFBA 3FAJA 4U9EA 5COGA 2XXAB 2LFFA 4ZLDA 4I44A 4JTDB 3NDBB 1AEPA 4HE8D 3Q6NA 2PFDA 4E17A 2R7UA 4G7ZF 3K66A 1GS9A 3HTKC 2MWQA 1AUEA 3DI5A 2J0WA 3TOLA 3SYNA 3I4UA 3K1IA 3J06A 1KTMA 4OIQF 1ZU4A 4BJTA 1MNEA 1LE2A 2A6HF 2BL2A 3L1MA 5L0GA 2A1DD 4CBEA 1A7EA 3EGXB 1QVXA 2EIMC 2LFDA 3DJUB 4MW3A 3C8GA 4ER9A 4CSAC 2HZ8A 3MBGA 4YT2A 2KK1A 1YA7O 2OCCC 4B6IA 2HSQA 3HNKA 3MFNA 3GWLA 1O5HA 256BA 3LNMB 4OINF 1OCOC 1VMAA 2ZXOA 2D4UA 4JCZA 5AC5A 4F4BA 2DI3A 1OR2A 3SXYA 1ZYRF 3H65A 2Y3HA 3DZAA 3GODA 5DS6A 3RIPA 1OCZC 4JZAA 1ZW2A 3FMSA 4Z9IA 2P6VA 2W4MA 3QVZA 1JRAA 3LLKA 2E87A 3LEVA 1T9KA 4CJGA 4LLEA 4PJJA 4JVSA 3AQCA 1K40A 1S05A 2A68F 4WGZA 1YVIA 3SXKA 5F5HA 2Q4FA 4MVUA 4DVZA 2HJ3A 3SXZA 2HSBA 3EH2A 2HS5A 4J7YA 3B29A 4N06A 3K7DA 4BEJA 3A9CA 2P0NA 2A0UA 3K33A 1SYQA 1ZHXA 4BEMJ 4PK4A 5CI8A 1TWHA 2LD6A 2W4BA 1L7CA 1RKEB 2HMZA 3NMIA 1FMVA 2PX0A 2Q00A 3K1IC 4PFPA 1MMDA 2XRHA 1OW8A 4DBRA 4JIOA 2DB4A 3WODF 4YK5A 3SXMA 1YARO 2A69F 1OCCC 2OEXA 1YYXA 4IWBA 1E85A 3IPMO 3EHNA 3A11A 5B3IA 1ZU5A 1ORYA 3DJNB 4XTKA 3CZ6A 5IY5C 4U5CE 2YLGA 3V5ZA 4EIYA 1FNTc 1TFOB 4JTAB 4MTOA 4E7ZA 1W2WA 5HV9A 1JAFA 1H6GA 3U8VA 2RD9A 4MVOA 1VB5A 1T6UA 4BJ5A 1CGOA 5L0HA 1G4WR 3K1HA 3U5SA 2YL3A 4KBLA 2R25A 5T3WA 2YZSA 2LP4A 1FR0A 4U5HA 5DS4A 3LJBA 4WGYA 4E18A 2BE5F 1MQVA 5GPGB 4ONSA 3IQCA 3N2ZB 5L0DA 3G50A 2R7TA 2YKZA 2NUPB 1MMGA 4J7TA 2NUTA 2XLHA 4CS8A 2HFIA 2L9JA 3NRHA 3ZQYA 4DRHB 3HNIA 4IGGA 4BJ6A 5JRAA 3TJ6A 2XM0A 4O79A 3TK0A 1OW7A 5DQZA 2XLVA 2YRFA 3FVYA 3WG7C 4BJ1A 3ASNC 3VF0A 5DLJA 1RXQA 1NFOA 1V74B 4JJGA 2J9WA 4EBJA 5A6KA 4Q4ZF 1NBBA 1TWGA 3S9OA 3US6A 1WN0A 1QKRA 4YL0A 3K6BA 1SR2A 3HNJA 4IRUA 3PHF2 1QSPA 2YHSA 4PJLA 1TWAA 1C02A 2YLIA 2HKVA 1E86A 2ETSA 4PACA 1Q0MA 2JX0A 5E33A 3MX3A 3UMKA 3H2UA 5AGFA 2PP4A 2CNWA 1QPUA 3EZIA 2EIKC 2CDQA 3M1CB 3U2LA 1HW2A 1T6QA 2Q9CA 3JSZA 3R2PA 4OD4A 3VM6A 4OIOF 4Q5SF 1ZW3A 3EG9A 3M4BA 2IOQA 2EPMX 4DRJB 1D0YA 2XLOA 1OR3A 1RCPA 1VLTA 3HJCA 4YL3A 4EBBA 3ITFA 5L0IA 2WB7A 2WZGA 3LLIA 4EKWA 5JUAA 3ZQVA 1YA9A 3JYYA 2MHRA 5COFA 4PJNA 4DXWA 2XS8A 1RMVA 3HNLA 2XS1A 3JRTA 5A6AA 3AG1C 1RKCA 4BJ6C 3EGDA 2VCAA 4RD9A 2IBFA 3N24A 5BQHA 3RKOF 1VK5A 1MNDA 1QLEC 1C17M 4XQ1A 4W8PA 2EPKX 3TD7A 4G78A 2AVKA 1LI5A 3GORA 3KYIA 2IXMA 1Z5ZA 2R02A 2C04A 3VYWA 2KNHA 2R7SA 4JE9A 4YWQA 2D5RB 1LKXA 2R03A 4U5DE 4QI0A 2VH3A 3QTHA 1T01A 2XXAA 1TWCA 1E2XA 1K05A 3GANA 2IM8A 2KJGA 3O39A 4NTFA 2Y3BA 4WJ0A 4C7OA 4AX2A 2DGJA 2PF4E 2AWYA 1EA8A 1Y6DA 1YYJA 1BDJB 1G4US 2R05A 3AGUA 3C62A 1QZXA 3C63A 3L0IA 4PFOA 4MVZA 1RJ9B 2YWAA 4K7BA 2H7BA 2HV6A 1WASA 2Q9BA 3B0PA 2J9VA 2YL0A 3W8HA 1H7IA 1G5ZA 2A6EF 2WZLA 2Y39A 3F47A 3GM2A 3HLZA 5BQIA 3EFOB 3ZIBA 3DKAA 3FOPA 1WWPA 2HJMA 5JLIA 4FX5A 2Y69C 2YL7A 1KNYA 1K04A 4CJOA 2R7RA 2KQ9A 2UUHA 4NTAA 4FAPB 4LACB 1BR1A 5DS5A 3GEEA 3SP1A 2IYLD 3T4RA 4C3BA 4ULVA 1ST6A 3QW1A 2JPUA 2OG2A 1R5ID 3E9VA 3WAQA 1OXBA 2ASRA 3MYFA 2Q7RA 3U8PA 3ZG1A 4XLNF 4JKVA 1JPNA 1D1CA 3FAPB 4MQ9F 4N6HA 4YT4A 5EK0A 3ZC4A 5JVEA 3WHNA 1APCA 1D1BA 1NU7D 3DE9A 3V5XA 2OU6A 2EPOA 2YQYA 3LESA 5COMA 5B1AC 2VCCA 3T6GB 3LUTB 4Q7CA 2QY9A 3RFYA 3T6JA 2TMVP 1FFTC 2X51A 3F46A 4O7GA 5EHHA 1FMWA 4GEHA 5JSLA 5AC4A 3AGTA 2HUJA 4H4KC 2L6HA 2J46A 1NU9C 3M79A 5B3SC 1TKNA 3LS1A 3NKDA 4U9DA 3W4YA 2AWCA 2LK4A 4KC9A 2F22A 5B1BC 2IXOA 5F28E 3EGXA 4CSAA 1N1CA 3NYJA 3Q6MA 2R7VA 4HFKB 3VRCA 1Q0DA 4P6IC 3U3BA 4AE4B 3S90A 1M2OA 3DMDA 2EINC 4G7HF 2AP3A 2GAQA 4L6RA 2OJQA 4I1MA 1OCRC 2B0JA 4MTFA 4CDAA 5A6BD 3O10A 5E2QA 3GM3A 2VASA 4LDKA 1JPJA 2J45A 4DRIB 1WATA 2L81A 3GEHA 2YLDA 3ZWIA 4EBKA 3DE8A 1HMDA 3IHUA 4FWVA 1M6TA 4H54A 4LDRA 3JSEO 3RVYA 4CIPA 1YLMA 2W9YA 4YT5A 4MNDA 3R7CA 5CIVA 2R7QA 5JT4A 4KI2A 5K0IA 2FAPB 2CYDA 2WL8A 2P7VA 4O6NA 5L3QA 4MVQA 1RJ9A 3ABKC 5E3AA 1JMWA 2V3CC 3U9JA 2PBEA 4X0RA 4J32B 3QZCA 3H2VA 1Z7Qc 1VYIA 2QLAA 1YJGA 4G7OF 4MVRA 1HMOA 2XLEA 1M56C 3GEIA 2OOCA 2J7PD 2GDCA 2WVNA 4JEAA 4CIHA 2XLDA 3FOOA 1V55C 2FGYA 4ZLCA 5TJ5E 5KYYA 4Z9HA 4EHPA 1BR4A 1LE4A 2XSEA 4HEAJ 4YJWA 5D91A 1PCXA 3PCVA 4CX9A 4LLCA 3JTLO 2VC9A 4GYTA 2PNOA 4I1OB 3L8IA 2X0CA 3EJNA 3CEXA 5L0JA 1T6IA 2H8AA 4KNWA 3DM9B 2G62A 2XL8A 3KYJA 4JW1A 3ZVRA 1J8MF 4C3DA 2LCHA 4JEBA 1NG1A 4CDYA 1SZIA 2J7PA 3U2MA 3N0TA 4O6MA 4AL0A 1E84A 3C8ZA 3DXJF 4YT8A 5CI9A 2HMQA 3S0XA 3I5QA 2Z15A 4BG0A 4IAOA 2CNWD 2LSEA 3W8IA 2NUPA 2WVQA 5BQGA 2R7WA 3W2WA 4KNVA 4EWCA 1HE9A 4A2NB 1OKKD 1U89A 3IQ5A 1PD1A 3IQ6A 5L3VA 2J8WA 1CGME 4BPMA 3G4ZA 3CSKA 1DOVA 4RBNA 5T1DB 4OIPF 4YN0B 1OQCA 4LDQA 3RQGA 1HY5A 2QUPA 3EGDB 4IARA 3DAGA 1U6HA 3OEOA 3E70C 4WABA 1KU2A 2CW0F 3AJMA 3EZHA 1Z63A 4NY3A 2QE9A 4K1OA 3UGOA 2J9UA 2M64A 3JZ0A 4I3MA 2H7VC 5E3CA 5DVWA 1CPQA 2VB6A 1LI7A 1CPRA 3X1OA 4D4NA 4PR9A 1J8YF 2G3VA 2OJED 3ASOC 3KPHA 3M15A 1S7ZA 4IJJA 4P9FA 3RQFA 4CS7A 3UGPA 3JYHA 3LEOA 2XLMA 2WZFA 3Q7GA 2L6FA 4K0DA 1HW1A 1ZHTA 4DJ9A 3NKEA 3ZDLA 2KSFA 3B9QA 4OIRF 4XPWA 1QQ3A 1YAUO 4P9TA 3RW0A 3I5PA 4JURI 4IAQA 3SZRA 3OWTA 3S84A 1A7DA 1D1AA 1ZZPA 1VYKA 1LS1A 3NYMA 2C03A 3O55A 5T3TA 4CDVA 3QVYA 3FXHA 4R32A 1IZMA 2GFHA
chains in the Genus database with same CATH topology
1JRAA 3GWNA 3LLKA 4LDKA 4E0HA 3TD7A 2HJ3A 3TK0A 1JR8A 3U2MA 3GWLA 3LLIA 3U2LA 3O55A 3R7CA 3U5SA 3W4YA 4E0IA 1OQCA 3MBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRA A;  3GWN A;  3LLK A;  4LDK A;  4E0H A;  3TD7 A;  2HJ3 A;  3TK0 A;  1JR8 A;  3U2M A;  3GWL A;  3LLI A;  3U2L A;  3O55 A;  3R7C A;  3U5S A;  3W4Y A;  4E0I A;  1OQC A;  3MBG A; 
#chains in the Genus database with same CATH topology
 2KYH A;  2EIJ C;  2LQG A;  2GWW A;  3ATP A;  3GWN A;  4MVS A;  3NMK A;  1H9T A;  4NCQ A;  3W2V A;  1JR8 A;  4J30 B;  1FTS A;  2KW3 C;  1OKK A;  4ULW A;  3CQZ A;  5BUO A;  3EFO A;  3EPV A;  4IB4 A;  3RH3 A;  1EI7 A;  3JCU Q;  2RSE B;  4D4X A;  3TOM A;  1D0Z A;  1Z23 A;  3VAY A;  2ICW G;  3IEE A;  3RQE A;  3FDQ A;  1SMY F;  2J0X A;  2L7A A;  3UMI A;  3U3F A;  1ORS C;  3ZTM A;  4BJ5 C;  3B0V C;  2O9X A;  2LIG A;  2OKU A;  4EUK B;  3SNH A;  3JT1 A;  2BC5 A;  4JRZ A;  1JOG A;  4GQH A;  1M2V A;  4FES A;  1HE1 A;  4MVM A;  1A41 A;  2Q3T A;  3KL4 A;  3RVZ A;  1L3P A;  2H7O A;  5DQT A;  4XEF A;  4U5F E;  1OXK A;  3IQT A;  1CGN A;  3C7J A;  1V54 C;  2J9B A;  2IXN A;  3AG4 C;  4N4W A;  3NMJ A;  3RF3 A;  2OQM A;  3KH2 A;  3CAX A;  4XWJ A;  1E83 A;  1ZHZ A;  4CS9 A;  3DAF A;  2KGO A;  2NSG A;  1D0X A;  4E0H A;  5L0C A;  4LER A;  3B71 A;  3EH1 A;  4XLP F;  5F5F A;  1PV3 A;  3L8J A;  2ZXP A;  2Q9A A;  2P61 A;  2WVO A;  3ZSU A;  3MLG A;  3Q7L A;  1R4T A;  2CCY A;  1FFH A;  4O6Y A;  1BZ4 A;  3BRJ A;  4RDA A;  4AL1 A;  2R9R B;  5KYU B;  1NSG B;  5A6J A;  4A4A A;  1M2V B;  4NTB A;  1WOL A;  3HKK A;  4ANJ A;  3MYI A;  4U5B E;  3UMH A;  3KMI A;  3U9M A;  1EKY A;  4AE4 A;  1XZP A;  1Y4C A;  3B0U X;  4HFF B;  1YZC A;  4G0H A;  4MS2 A;  3LNR A;  1V4A A;  2B0H A;  3TQO A;  5JS5 A;  1F1M A;  5KYN A;  1PD0 A;  1H9G A;  4XPY A;  2I15 A;  2ZD9 A;  4U5G A;  4UDV A;  3AQB A;  1YDI A;  3AG3 C;  1RKE A;  3C18 A;  2P1A A;  4JC7 A;  5KYY B;  2M4E A;  2UUI A;  3NG1 A;  4XPX A;  5KYU A;  3SEO A;  3QW0 A;  4NQF A;  1LS4 A;  2EPL X;  1IW7 F;  1GGQ A;  1Q0K A;  2XLW A;  3ABL C;  2ZXW C;  1Z6A A;  3BEH A;  4W8K A;  1XWJ A;  3X2Q C;  2NUT B;  3C8G B;  1M57 C;  1WGW A;  2MYS A;  1I5N A;  5FZT A;  1TFK B;  2CGE A;  3AG2 C;  4CS9 C;  1I4Z A;  3POV A;  2NSF A;  1MMN A;  1TQG A;  1NZE A;  1ZHW A;  4M63 A;  1VOM A;  3QMK A;  1NLX A;  5KYX A;  1C03 A;  2I8B A;  2R7X A;  2EIL C;  3DD7 A;  3DM5 A;  1ZHY A;  4JJF A;  3GM1 A;  1O87 A;  3KKB A;  1BR2 A;  5EGY A;  3OA1 A;  3O6X A;  1A7V A;  2Y3G A;  4AK9 A;  4DOZ A;  2QNL A;  4DBQ A;  1B68 A;  1FAP B;  2QTV A;  1MMA A;  4JTC B;  2V26 A;  1EQ1 A;  1GQA A;  2YL1 A;  3NYL A;  1U0B B;  4C7O B;  2FFH A;  1Q0F A;  2G3K A;  1DOW A;  3M4C A;  4U5E E;  3U0C A;  1A0B A;  3FHD A;  4N6C A;  1AVO B;  3ECS A;  2NPU A;  4XEK A;  5JP7 A;  3S29 A;  1WTY A;  3G4X A;  4QI2 A;  3JRM O;  2XL4 A;  3DWW A;  4PJM A;  3EG9 B;  3UR3 C;  2ZXR A;  3TJ5 A;  3EQL F;  3RYL A;  1VTM P;  5L0F A;  5KYX B;  2EPN A;  3S28 A;  1LPE A;  3EHM A;  1ZVZ A;  4MTG A;  1Q0G A;  2L6G A;  1NFN A;  2W45 A;  3PMR A;  1G8X A;  2IXP A;  5A6B A;  2NG1 A;  1GM5 A;  4CS8 C;  4DVY P;  3C8G D;  1ORJ A;  4XEV A;  3T6B A;  1T5O A;  2AU5 A;  3LS0 A;  1XZQ A;  2KC3 A;  2VCB A;  3LAY A;  4QDL A;  2R7O A;  5KYW B;  4E0I A;  1UG7 A;  3TUL A;  1Z3I X;  4YL1 A;  2A0B A;  3V7O A;  2DYR C;  4Z9J A;  3L34 A;  4JCH A;  3ZTZ A;  5KYW A;  1BBH A;  2PX3 A;  4OD5 A;  2DYS C;  4MW8 A;  4NC3 A;  3ABM C;  3S27 A;  5FCL A;  1TR2 A;  2XL6 A;  1YZA A;  4C3E A;  4E7S A;  2Y3D A;  5A69 A;  1OW6 A;  5HSW A;  3PDM P;  2OEV A;  2XM4 A;  3UNG C;  3V5Y A;  1LIH A;  1LVK A;  1O3U A;  3AOU A;  3T9O A;  5D92 A;  2YEV A;  1LM3 B;  1I4Y A;  1SF8 A;  2ZPA A;  2HV7 A;  2GA0 A;  2JD3 A;  1VLS A;  2YVK A;  1UFB A;  3FAJ A;  4U9E A;  5COG A;  2XXA B;  2LFF A;  4ZLD A;  4I44 A;  4JTD B;  3NDB B;  1AEP A;  4HE8 D;  3Q6N A;  2PFD A;  4E17 A;  2R7U A;  4G7Z F;  3K66 A;  1GS9 A;  3HTK C;  2MWQ A;  1AUE A;  3DI5 A;  2J0W A;  3TOL A;  3SYN A;  3I4U A;  3K1I A;  3J06 A;  1KTM A;  4OIQ F;  1ZU4 A;  4BJT A;  1MNE A;  1LE2 A;  2A6H F;  2BL2 A;  3L1M A;  5L0G A;  2A1D D;  4CBE A;  1A7E A;  3EGX B;  1QVX A;  2EIM C;  2LFD A;  3DJU B;  4MW3 A;  3C8G A;  4ER9 A;  4CSA C;  2HZ8 A;  3MBG A;  4YT2 A;  2KK1 A;  1YA7 O;  2OCC C;  4B6I A;  2HSQ A;  3HNK A;  3MFN A;  3GWL A;  1O5H A;  256B A;  3LNM B;  4OIN F;  1OCO C;  1VMA A;  2ZXO A;  2D4U A;  4JCZ A;  5AC5 A;  4F4B A;  2DI3 A;  1OR2 A;  3SXY A;  1ZYR F;  3H65 A;  2Y3H A;  3DZA A;  3GOD A;  5DS6 A;  3RIP A;  1OCZ C;  4JZA A;  1ZW2 A;  3FMS A;  4Z9I A;  2P6V A;  2W4M A;  3QVZ A;  1JRA A;  3LLK A;  2E87 A;  3LEV A;  1T9K A;  4CJG A;  4LLE A;  4PJJ A;  4JVS A;  3AQC A;  1K40 A;  1S05 A;  2A68 F;  4WGZ A;  1YVI A;  3SXK A;  5F5H A;  2Q4F A;  4MVU A;  4DVZ A;  2HJ3 A;  3SXZ A;  2HSB A;  3EH2 A;  2HS5 A;  4J7Y A;  3B29 A;  4N06 A;  3K7D A;  4BEJ A;  3A9C A;  2P0N A;  2A0U A;  3K33 A;  1SYQ A;  1ZHX A;  4BEM J;  4PK4 A;  5CI8 A;  1TWH A;  2LD6 A;  2W4B A;  1L7C A;  1RKE B;  2HMZ A;  3NMI A;  1FMV A;  2PX0 A;  2Q00 A;  3K1I C;  4PFP A;  1MMD A;  2XRH A;  1OW8 A;  4DBR A;  4JIO A;  2DB4 A;  3WOD F;  4YK5 A;  3SXM A;  1YAR O;  2A69 F;  1OCC C;  2OEX A;  1YYX A;  4IWB A;  1E85 A;  3IPM O;  3EHN A;  3A11 A;  5B3I A;  1ZU5 A;  1ORY A;  3DJN B;  4XTK A;  3CZ6 A;  5IY5 C;  4U5C E;  2YLG A;  3V5Z A;  4EIY A;  1FNT c;  1TFO B;  4JTA B;  4MTO A;  4E7Z A;  1W2W A;  5HV9 A;  1JAF A;  1H6G A;  3U8V A;  2RD9 A;  4MVO A;  1VB5 A;  1T6U A;  4BJ5 A;  1CGO A;  5L0H A;  1G4W R;  3K1H A;  3U5S A;  2YL3 A;  4KBL A;  2R25 A;  5T3W A;  2YZS A;  2LP4 A;  1FR0 A;  4U5H A;  5DS4 A;  3LJB A;  4WGY A;  4E18 A;  2BE5 F;  1MQV A;  5GPG B;  4ONS A;  3IQC A;  3N2Z B;  5L0D A;  3G50 A;  2R7T A;  2YKZ A;  2NUP B;  1MMG A;  4J7T A;  2NUT A;  2XLH A;  4CS8 A;  2HFI A;  2L9J A;  3NRH A;  3ZQY A;  4DRH B;  3HNI A;  4IGG A;  4BJ6 A;  5JRA A;  3TJ6 A;  2XM0 A;  4O79 A;  3TK0 A;  1OW7 A;  5DQZ A;  2XLV A;  2YRF A;  3FVY A;  3WG7 C;  4BJ1 A;  3ASN C;  3VF0 A;  5DLJ A;  1RXQ A;  1NFO A;  1V74 B;  4JJG A;  2J9W A;  4EBJ A;  5A6K A;  4Q4Z F;  1NBB A;  1TWG A;  3S9O A;  3US6 A;  1WN0 A;  1QKR A;  4YL0 A;  3K6B A;  1SR2 A;  3HNJ A;  4IRU A;  3PHF 2;  1QSP A;  2YHS A;  4PJL A;  1TWA A;  1C02 A;  2YLI A;  2HKV A;  1E86 A;  2ETS A;  4PAC A;  1Q0M A;  2JX0 A;  5E33 A;  3MX3 A;  3UMK A;  3H2U A;  5AGF A;  2PP4 A;  2CNW A;  1QPU A;  3EZI A;  2EIK C;  2CDQ A;  3M1C B;  3U2L A;  1HW2 A;  1T6Q A;  2Q9C A;  3JSZ A;  3R2P A;  4OD4 A;  3VM6 A;  4OIO F;  4Q5S F;  1ZW3 A;  3EG9 A;  3M4B A;  2IOQ A;  2EPM X;  4DRJ B;  1D0Y A;  2XLO A;  1OR3 A;  1RCP A;  1VLT A;  3HJC A;  4YL3 A;  4EBB A;  3ITF A;  5L0I A;  2WB7 A;  2WZG A;  3LLI A;  4EKW A;  5JUA A;  3ZQV A;  1YA9 A;  3JYY A;  2MHR A;  5COF A;  4PJN A;  4DXW A;  2XS8 A;  1RMV A;  3HNL A;  2XS1 A;  3JRT A;  5A6A A;  3AG1 C;  1RKC A;  4BJ6 C;  3EGD A;  2VCA A;  4RD9 A;  2IBF A;  3N24 A;  5BQH A;  3RKO F;  1VK5 A;  1MND A;  1QLE C;  1C17 M;  4XQ1 A;  4W8P A;  2EPK X;  3TD7 A;  4G78 A;  2AVK A;  1LI5 A;  3GOR A;  3KYI A;  2IXM A;  1Z5Z A;  2R02 A;  2C04 A;  3VYW A;  2KNH A;  2R7S A;  4JE9 A;  4YWQ A;  2D5R B;  1LKX A;  2R03 A;  4U5D E;  4QI0 A;  2VH3 A;  3QTH A;  1T01 A;  2XXA A;  1TWC A;  1E2X A;  1K05 A;  3GAN A;  2IM8 A;  2KJG A;  3O39 A;  4NTF A;  2Y3B A;  4WJ0 A;  4C7O A;  4AX2 A;  2DGJ A;  2PF4 E;  2AWY A;  1EA8 A;  1Y6D A;  1YYJ A;  1BDJ B;  1G4U S;  2R05 A;  3AGU A;  3C62 A;  1QZX A;  3C63 A;  3L0I A;  4PFO A;  4MVZ A;  1RJ9 B;  2YWA A;  4K7B A;  2H7B A;  2HV6 A;  1WAS A;  2Q9B A;  3B0P A;  2J9V A;  2YL0 A;  3W8H A;  1H7I A;  1G5Z A;  2A6E F;  2WZL A;  2Y39 A;  3F47 A;  3GM2 A;  3HLZ A;  5BQI A;  3EFO B;  3ZIB A;  3DKA A;  3FOP A;  1WWP A;  2HJM A;  5JLI A;  4FX5 A;  2Y69 C;  2YL7 A;  1KNY A;  1K04 A;  4CJO A;  2R7R A;  2KQ9 A;  2UUH A;  4NTA A;  4FAP B;  4LAC B;  1BR1 A;  5DS5 A;  3GEE A;  3SP1 A;  2IYL D;  3T4R A;  4C3B A;  4ULV A;  1ST6 A;  3QW1 A;  2JPU A;  2OG2 A;  1R5I D;  3E9V A;  3WAQ A;  1OXB A;  2ASR A;  3MYF A;  2Q7R A;  3U8P A;  3ZG1 A;  4XLN F;  4JKV A;  1JPN A;  1D1C A;  3FAP B;  4MQ9 F;  4N6H A;  4YT4 A;  5EK0 A;  3ZC4 A;  5JVE A;  3WHN A;  1APC A;  1D1B A;  1NU7 D;  3DE9 A;  3V5X A;  2OU6 A;  2EPO A;  2YQY A;  3LES A;  5COM A;  5B1A C;  2VCC A;  3T6G B;  3LUT B;  4Q7C A;  2QY9 A;  3RFY A;  3T6J A;  2TMV P;  1FFT C;  2X51 A;  3F46 A;  4O7G A;  5EHH A;  1FMW A;  4GEH A;  5JSL A;  5AC4 A;  3AGT A;  2HUJ A;  4H4K C;  2L6H A;  2J46 A;  1NU9 C;  3M79 A;  5B3S C;  1TKN A;  3LS1 A;  3NKD A;  4U9D A;  3W4Y A;  2AWC A;  2LK4 A;  4KC9 A;  2F22 A;  5B1B C;  2IXO A;  5F28 E;  3EGX A;  4CSA A;  1N1C A;  3NYJ A;  3Q6M A;  2R7V A;  4HFK B;  3VRC A;  1Q0D A;  4P6I C;  3U3B A;  4AE4 B;  3S90 A;  1M2O A;  3DMD A;  2EIN C;  4G7H F;  2AP3 A;  2GAQ A;  4L6R A;  2OJQ A;  4I1M A;  1OCR C;  2B0J A;  4MTF A;  4CDA A;  5A6B D;  3O10 A;  5E2Q A;  3GM3 A;  2VAS A;  4LDK A;  1JPJ A;  2J45 A;  4DRI B;  1WAT A;  2L81 A;  3GEH A;  2YLD A;  3ZWI A;  4EBK A;  3DE8 A;  1HMD A;  3IHU A;  4FWV A;  1M6T A;  4H54 A;  4LDR A;  3JSE O;  3RVY A;  4CIP A;  1YLM A;  2W9Y A;  4YT5 A;  4MND A;  3R7C A;  5CIV A;  2R7Q A;  5JT4 A;  4KI2 A;  5K0I A;  2FAP B;  2CYD A;  2WL8 A;  2P7V A;  4O6N A;  5L3Q A;  4MVQ A;  1RJ9 A;  3ABK C;  5E3A A;  1JMW A;  2V3C C;  3U9J A;  2PBE A;  4X0R A;  4J32 B;  3QZC A;  3H2V A;  1Z7Q c;  1VYI A;  2QLA A;  1YJG A;  4G7O F;  4MVR A;  1HMO A;  2XLE A;  1M56 C;  3GEI A;  2OOC A;  2J7P D;  2GDC A;  2WVN A;  4JEA A;  4CIH A;  2XLD A;  3FOO A;  1V55 C;  2FGY A;  4ZLC A;  5TJ5 E;  5KYY A;  4Z9H A;  4EHP A;  1BR4 A;  1LE4 A;  2XSE A;  4HEA J;  4YJW A;  5D91 A;  1PCX A;  3PCV A;  4CX9 A;  4LLC A;  3JTL O;  2VC9 A;  4GYT A;  2PNO A;  4I1O B;  3L8I A;  2X0C A;  3EJN A;  3CEX A;  5L0J A;  1T6I A;  2H8A A;  4KNW A;  3DM9 B;  2G62 A;  2XL8 A;  3KYJ A;  4JW1 A;  3ZVR A;  1J8M F;  4C3D A;  2LCH A;  4JEB A;  1NG1 A;  4CDY A;  1SZI A;  2J7P A;  3U2M A;  3N0T A;  4O6M A;  4AL0 A;  1E84 A;  3C8Z A;  3DXJ F;  4YT8 A;  5CI9 A;  2HMQ A;  3S0X A;  3I5Q A;  2Z15 A;  4BG0 A;  4IAO A;  2CNW D;  2LSE A;  3W8I A;  2NUP A;  2WVQ A;  5BQG A;  2R7W A;  3W2W A;  4KNV A;  4EWC A;  1HE9 A;  4A2N B;  1OKK D;  1U89 A;  3IQ5 A;  1PD1 A;  3IQ6 A;  5L3V A;  2J8W A;  1CGM E;  4BPM A;  3G4Z A;  3CSK A;  1DOV A;  4RBN A;  5T1D B;  4OIP F;  4YN0 B;  1OQC A;  4LDQ A;  3RQG A;  1HY5 A;  2QUP A;  3EGD B;  4IAR A;  3DAG A;  1U6H A;  3OEO A;  3E70 C;  4WAB A;  1KU2 A;  2CW0 F;  3AJM A;  3EZH A;  1Z63 A;  4NY3 A;  2QE9 A;  4K1O A;  3UGO A;  2J9U A;  2M64 A;  3JZ0 A;  4I3M A;  2H7V C;  5E3C A;  5DVW A;  1CPQ A;  2VB6 A;  1LI7 A;  1CPR A;  3X1O A;  4D4N A;  4PR9 A;  1J8Y F;  2G3V A;  2OJE D;  3ASO C;  3KPH A;  3M15 A;  1S7Z A;  4IJJ A;  4P9F A;  3RQF A;  4CS7 A;  3UGP A;  3JYH A;  3LEO A;  2XLM A;  2WZF A;  3Q7G A;  2L6F A;  4K0D A;  1HW1 A;  1ZHT A;  4DJ9 A;  3NKE A;  3ZDL A;  2KSF A;  3B9Q A;  4OIR F;  4XPW A;  1QQ3 A;  1YAU O;  4P9T A;  3RW0 A;  3I5P A;  4JUR I;  4IAQ A;  3SZR A;  3OWT A;  3S84 A;  1A7D A;  1D1A A;  1ZZP A;  1VYK A;  1LS1 A;  3NYM A;  2C03 A;  3O55 A;  5T3T A;  4CDV A;  3QVY A;  3FXH A;  4R32 A;  1IZM A;  2GFH A; 
#chains in the Genus database with same CATH homology
 1JRA A;  3GWN A;  3LLK A;  4LDK A;  4E0H A;  3TD7 A;  2HJ3 A;  3TK0 A;  1JR8 A;  3U2M A;  3GWL A;  3LLI A;  3U2L A;  3O55 A;  3R7C A;  3U5S A;  3W4Y A;  4E0I A;  1OQC A;  3MBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...