4E0IA

Crystal structure of the c30s/c133s mutant of erv1 from saccharomyces cerevisiae
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
175
structure length
152
Chain Sequence
EGLSGRKIIYDEDGKPSRSCNTLLDFQYVTGKISELMPGSRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPCNWSAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDGWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Mitochondrial FAD-linked sulfhydryl oxidase ERV1
publication title Structure of yeast sulfhydryl oxidase erv1 reveals electron transfer of the disulfide relay system in the mitochondrial intermembrane space
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 40
structure length 152
sequence length 175
chains with identical sequence B, C
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2012-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 4e0iA02
1OQCA 3MBGA 3GWNA 3GWLA 3U5SA 1JR8A 3TK0A 4E0HA 1JRAA 3LLIA 4E0IA 3R7CA 3O55A 2HJ3A 3W4YA 3TD7A 3U2LA 3LLKA 4LDKA 3U2MA
chains in the Genus database with same CATH superfamily
4U5FE 1NFNA 2EPOA 2IOQA 3LAYA 1MQVA 3K1IC 1ZW2A 1R5ID 2HJMA 3C8GB 4MW8A 4PACA 4N4WA 5E3AA 3UMKA 1NU9C 1T6UA 2TMVP 4E7ZA 1RJ9B 2Q3TA 3QVYA 4MVUA 1O3UA 3HNKA 3SXMA 2QE9A 3VRCA 1TWHA 4QDLA 2J45A 1D1AA 1QLEC 5KYUA 3B9QA 4MVQA 2H7VC 4XLNF 3ZTMA 1F1MA 3N2ZB 4XEVA 4D4XA 2O9XA 1E85A 5KYWA 1YLMA 1WGWA 2GA0A 5COGA 3B71A 3PHF2 2YHSA 2KQ9A 3M15A 3E70C 2UUHA 4JTCB 4U5EE 3RH3A 4BJ5C 2Q4FA 4LDRA 5F28E 5AC4A 1OW6A 1VYKA 3DE8A 1CGME 3U3FA 1TWGA 3U9JA 3ZVRA 3U2MA 1SYQA 1OQCA 3WHNA 5L0GA 3GM1A 4OIPF 2RD9A 4XPWA 3I5QA 3LESA 4JEAA 4BJ6C 3K7DA 2R02A 1G4WR 1Z23A 2HSQA 1O87A 3JRTA 1PD1A 5B3SC 1RKCA 4BEJA 2CNWA 2ASRA 1D0YA 1WASA 3U5SA 3AGUA 3FAJA 3I5PA 4KNWA 4LLEA 3AQBA 2XL8A 4O6YA 2XS8A 3ABLC 2Y3HA 2V3CC 1Y4CA 1V55C 1LIHA 5KYYB 1YVIA 1H7IA 2M4EA 3AQCA 2DYSC 4I44A 4MW3A 4OINF 3SEOA 5A6AA 2ZXWC 3DE9A 3Q7GA 3ZC4A 2XLMA 1GQAA 2HV7A 1KNYA 1M2VB 2XLHA 1AUEA 2MHRA 4G7OF 2HKVA 2HSBA 3B29A 2KGOA 3LUTB 4NQFA 2Q00A 4P6IC 3VAYA 5FCLA 3B0VC 4CDAA 5L0CA 3TULA 2KC3A 3NKEA 4MQ9F 3W2VA 3JCUQ 3L8JA 4CIPA 4W8PA 4E0HA 4U9EA 1TQGA 1ZHXA 3CZ6A 3TOLA 3UGPA 2A6HF 1MMNA 1Q0FA 5L0JA 2LP4A 4JVSA 2R7VA 3NYJA 4GYTA 2YVKA 1BR4A 3VF0A 3AG4C 2VC9A 1G4US 3RIPA 2OEXA 2R7SA 1RCPA 4OIRF 3U0CA 2XLVA 4O6MA 5COFA 4LACB 1FFHA 2WVNA 5T1DB 2A68F 3DAFA 4U5CE 2OEVA 4U5DE 4YL0A 3H2UA 4OIOF 1MNDA 3EZIA 4NCQA 3LNRA 3LLIA 2H7OA 1K04A 3IQTA 3PDMP 1QZXA 1D0ZA 2RSEB 3L1MA 3ITFA 1T6QA 5CI8A 1U89A 3T6BA 1A41A 1LVKA 1VYIA 256BA 1ZU5A 2I15A 2NSGA 3FOOA 3GM2A 4JE9A 4DJ9A 3ZQVA 1VMAA 4EBKA 4QI2A 4I1OB 3OA1A 3ZQYA 1ST6A 2QNLA 3W8IA 4PR9A 5L0DA 1LI5A 1ZHZA 1YZCA 4C3DA 4G7HF 5DS5A 2PBEA 1LM3B 4X0RA 3RFYA 4OIQF 1RMVA 1VB5A 2Q9AA 2AWCA 4JTDB 1YDIA 5BUOA 4WGZA 3LS1A 4FESA 4FWVA 3C8GA 3JYHA 2L7AA 4Z9HA 4DVZA 2KK1A 3G50A 4J32B 2C03A 1CGOA 2KSFA 3SYNA 4CDVA 3EGXB 1GM5A 1MMAA 4ER9A 2R7QA 2EILC 1RJ9A 1SZIA 5BQHA 2YL0A 2LQGA 2VB6A 4AE4A 1QPUA 2OJED 2QLAA 3RQFA 2W4BA 1YYXA 2W45A 2PFDA 2YL7A 3S27A 1E2XA 4KI2A 2MYSA 4CX9A 2OG2A 1Z63A 2R7RA 3U8VA 2BL2A 1D0XA 2XLDA 4JCZA 3WAQA 1ZHWA 4M63A 3AOUA 1Z7Qc 2L6GA 5D92A 2J0WA 1B68A 1IZMA 1ZVZA 4PJLA 5CI9A 1G5ZA 3ZDLA 3IQCA 4IARA 3EFOB 1UFBA 2OQMA 3GM3A 3H65A 3EG9A 4K1OA 2Y3GA 2YLGA 3QZCA 1S05A 4CJOA 2NUTA 4EWCA 2CNWD 5JUAA 2YLDA 5AC5A 1SF8A 3C62A 2WL8A 2ZPAA 3ZG1A 4CS8A 1I4YA 5L0HA 1H9TA 3X1OA 1HW2A 2A1DD 4W8KA 2JD3A 4JRZA 3FVYA 1Q0MA 3V5XA 2J9UA 3CAXA 4HEAJ 3HTKC 3Q6MA 3VYWA 5B3IA 5KYYA 3RQGA 1OCZC 3SNHA 1BBHA 2CDQA 1QSPA 2XS1A 1NBBA 3ASNC 1YJGA 4PJNA 4U5GA 4U9DA 2J8WA 2Q7RA 3RVZA 2FFHA 4KNVA 1M2VA 3QW0A 4NY3A 3AG2C 1Q0GA 1OCOC 2DGJA 2QTVA 2XLEA 2I8BA 3A9CA 2WZLA 3X2QC 2ICWG 5DLJA 2VH3A 4JURI 2IM8A 1YYJA 2IXMA 2OU6A 1G8XA 2YKZA 3JT1A 1NU7D 3KMIA 3TK0A 4PJJA 5EHHA 3LEVA 4AE4B 4IGGA 4XEFA 4RD9A 4FAPB 1K05A 3JZ0A 2W9YA 1U6HA 2EPKX 4H4KC 3W4YA 4CIHA 3QVZA 5DQTA 3S84A 3FXHA 1H6GA 1NG1A 4RDAA 2OKUA 2ZXPA 3EHNA 1YAUO 4N6CA 4DXWA 5K0IA 2EIMC 2EPNA 1D1CA 4PK4A 3UR3C 3FMSA 2W4MA 3LNMB 4K7BA 3FDQA 4A2NB 3EG9B 2WZFA 3IHUA 1A7VA 1APCA 2NG1A 3O10A 1MMGA 2NUTB 4JCHA 2YLIA 1FNTc 1DOWA 2VCBA 3GEIA 1A7EA 3ATPA 3I4UA 3SZRA 1IW7F 2IXNA 4PFOA 4O6NA 4NTFA 1WTYA 5JS5A 5HSWA 1ORYA 1XWJA 2CCYA 5L3QA 1JRAA 1ZW3A 5L3VA 3M4CA 1NZEA 5EGYA 2P1AA 5F5FA 3MLGA 2L9JA 3HKKA 1JAFA 1Y6DA 1DOVA 3C7JA 3W2WA 3C8GD 2IBFA 2LK4A 3MX3A 1QQ3A 4J7YA 1T01A 1Q0KA 4ZLCA 4IRUA 2C04A 1BR1A 4YJWA 2EIJC 2VASA 3R2PA 4XWJA 2UUIA 2P61A 1OXKA 4WABA 3S28A 1E83A 3S29A 1OKKA 2XL6A 4YN0B 3U9MA 3AG1C 1N1CA 4ONSA 3EGXA 3IQ5A 3RKOF 5JT4A 1RKEB 4IB4A 4C7OA 2XXAA 2A69F 2HFIA 1XZPA 1LE4A 3K33A 3ECSA 1TR2A 4U5HA 1VLTA 4CS7A 2LD6A 4XEKA 3QMKA 1YA7O 2OOCA 4OD5A 5T3TA 1CPQA 1T9KA 4XPYA 4IAOA 2Q9CA 4Z9IA 3SXZA 2OCCC 2HZ8A 3R7CA 1LKXA 4EBJA 3ASOC 5L0IA 2H7BA 3KKBA 3C8ZA 1I4ZA 2LFFA 4YK5A 3SXKA 2E87A 3EFOA 3J06A 1JMWA 2R7UA 2ZXRA 2MWQA 2DB4A 1MNEA 3UGOA 3T6GB 3TOMA 4CBEA 3N24A 2J9VA 1VK5A 4I3MA 2J9BA 2A0BA 2KYHA 2R03A 2R05A 3IQ6A 3LJBA 4YWQA 1MMDA 1S7ZA 3JSZA 3KYIA 2CYDA 4PJMA 2P7VA 3MYIA 3SXYA 4DRJB 2XRHA 4L6RA 2LSEA 2YL3A 4JTAB 2PP4A 3GANA 2Y3DA 3M4BA 2YRFA 2DYRC 3POVA 3US6A 3OEOA 5A6JA 4F4BA 1K40A 1Z5ZA 4U5BE 5D91A 3BEHA 5BQIA 1M56C 1M2OA 2EIKC 3LEOA 2XLOA 1GGQA 3ABMC 4Q5SF 4O79A 1YA9A 2HUJA 3AGTA 3S90A 1EI7A 2B0HA 4JZAA 4BEMJ 1SMYF 3U8PA 2IXOA 4C7OB 3N0TA 1J8MF 4MTOA 2XXAB 1WOLA 1NFOA 4G0HA 3G4XA 1LS1A 2WZGA 3PMRA 3MBGA 1AEPA 2FAPB 4XTKA 4NTBA 3RF3A 3RYLA 2R7XA 2YWAA 4MVRA 2HV6A 4WGYA 1M57C 1FAPB 4DVYP 3QW1A 3M79A 4MTFA 4JJFA 1FMWA 1KU2A 5TJ5E 1ZHTA 3GEHA 3NMIA 4E18A 3NRHA 5E33A 3L34A 4FX5A 2R7WA 4DBRA 3H2VA 3ZWIA 5DS6A 3DXJF 3FOPA 1EKYA 3IPMO 4IWBA 3HNLA 1EQ1A 1TFKB 2PX0A 3B0UX 4CS8C 1PCXA 3DMDA 1YZAA 2KJGA 2VCCA 5T3WA 2YQYA 1CPRA 4JIOA 3VM6A 1OCCC 3DD7A 4E17A 1WATA 1JPJA 3NMKA 2HS5A 1NLXA 2NSFA 4CDYA 4CSAA 1ORSC 2A0UA 2DI3A 1OXBA 3BRJA 4LDKA 4XQ1A 3E9VA 2GDCA 3KPHA 4JC7A 4G7ZF 2J9WA 3LS0A 4MVMA 1ORJA 4Q4ZF 1FFTC 1TKNA 1BZ4A 3Q6NA 4K0DA 5DS4A 4IJJA 3V7OA 1OKKD 3KYJA 1ZYRF 1W2WA 2EPLX 4KC9A 5KYXA 5JSLA 5DQZA 2FGYA 2P0NA 4DBQA 4YT8A 2Y39A 2AWYA 5B1AC 5JLIA 1WN0A 2R9RB 1PV3A 4HFFB 2KW3C 5COMA 2VCAA 5B1BC 1HE9A 3TJ6A 3DWWA 4E0IA 1RKEA 3EHMA 2YL1A 4AX2A 4YT2A 5F5HA 1UG7A 1V54C 4P9TA 1WWPA 5DVWA 4MNDA 3MYFA 4EIYA 3WODF 1VTMP 1BDJB 3UMHA 2YEVA 3FAPB 4C3EA 2V26A 3EGDB 1QVXA 4YT4A 2G3VA 2EINC 1TWCA 2NPUA 3DKAA 1J8YF 1HMDA 2Q9BA 3K1IA 4QI0A 3TQOA 1VLSA 3JYYA 4ULVA 2OJQA 3DJUB 4CJGA 1SR2A 2LFDA 3JTLO 3W8HA 4LDQA 4LLCA 4D4NA 3CSKA 3EH2A 1ZHYA 3CQZA 2A6EF 4H54A 4OD4A 4Q7CA 1Q0DA 3EH1A 3OWTA 2X0CA 1ZU4A 2NUPA 2XSEA 3DM9B 1CGNA 1O5HA 3MFNA 2GAQA 3ZTZA 3SP1A 1VOMA 4BJ5A 2P6VA 1JOGA 3V5ZA 5KYNA 3ZIBA 1C17M 5JP7A 1OW8A 3UNGC 5KYXB 4G78A 4EKWA 2Y3BA 4Z9JA 5HV9A 3EQLF 1FR0A 2LIGA 3HNJA 4DRHB 2H8AA 2GFHA 4BJ6A 2D4UA 4BG0A 2EPMX 1LE2A 3JRMO 4AL0A 1E86A 2XL4A 3A11A 4ULWA 4B6IA 3GWNA 2D5RB 2WVQA 3NG1A 4GEHA 4EUKB 1JR8A 3S0XA 2CW0F 1T5OA 2G62A 3TJ5A 4A4AA 4EHPA 4JJGA 5A6KA 4BJTA 1YARO 4DRIB 1OCRC 3KH2A 4HE8D 2HJ3A 2J7PA 2L6FA 1LS4A 2QUPA 3F46A 3KL4A 3NMJA 3NYMA 4J7TA 1L3PA 4JKVA 4NC3A 4YT5A 3T4RA 4MVOA 1LPEA 3HJCA 2ZXOA 4C3BA 2KNHA 3M1CB 2WVOA 3GEEA 5A6BD 4J30B 1HMOA 2GWWA 3EZHA 2J0XA 3S9OA 4DOZA 4MTGA 5KYUB 1L7CA 2BE5F 3AG3C 1R4TA 5A69A 1H9GA 2R7TA 2AP3A 3T6JA 5KYWB 3DZAA 2AVKA 3ZSUA 3IEEA 3K1HA 2NUPB 3G4ZA 2R25A 1Z3IX 4KBLA 5AGFA 1E84A 2XLWA 4XLPF 1GS9A 3GORA 1D1BA 1ZZPA 2Z15A 3DAGA 1V74B 2BC5A 5GPGB 3T9OA 4MVZA 1HW1A 3TD7A 3ABKC 3CEXA 1U0BB 1TWAA 3U3BA 3QTHA 2PX3A 1EA8A 4NTAA 4MVSA 2QY9A 4O7GA 3RQEA 5EK0A 1A7DA 2R7OA 4LERA 1QKRA 4JEBA 4MS2A 5L0FA 1LI7A 3GODA 2ETSA 4IAQA 1Z6AA 3RVYA 2PNOA 3UMIA 2LCHA 2L81A 1RXQA 1OR3A 4E7SA 3O6XA 4R32A 3GWLA 2CGEA 3NKDA 5E3CA 4PFPA 1C03A 3EGDA 1V4AA 2WB7A 3FHDA 3V5YA 3HNIA 4YL1A 2F22A 5CIVA 2J46A 3K6BA 1HE1A 1I5NA 1FTSA 3C18A 3DI5A 3L8IA 3NYLA 2IXPA 1JPNA 4N06A 4P9FA 1OW7A 3EPVA 5A6BA 1C02A 4UDVA 4CSAC 1M6TA 4AK9A 4N6HA 5BQGA 4HFKB 2G3KA 3K66A 4WJ0A 1A0BA 4AL1A 4I1MA 3JSEO 3O39A 2Y69C 2M64A 2HMZA 3PCVA 3B0PA 2L6HA 2XM4A 3EJNA 2IYLD 1T6IA 1PD0A 2AU5A 5JRAA 4JW1A 4GQHA 5JVEA 2PF4E 2XM0A 4XPXA 4YL3A 4BJ1A 5E2QA 3DM5A 5IY5C 3C63A 4CS9C 2X51A 2JX0A 3L0IA 2ZD9A 4RBNA 4ANJA 1KTMA 3WG7C 3Q7LA 1FMVA 4CS9A 3AJMA 1HY5A 2HMQA 2B0JA 3O55A 3NDBB 3RW0A 4ZLDA 2YZSA 1OR2A 1TFOB 3U2LA 4BPMA 1BR2A 4EBBA 1AVOB 1XZQA 3F47A 5FZTA 1NSGB 2JPUA 3DJNB 3HLZA 2J7PD 3LLKA
chains in the Genus database with same CATH topology
1OQCA 3MBGA 3GWNA 3GWLA 3U5SA 1JR8A 3TK0A 4E0HA 1JRAA 3LLIA 4E0IA 3R7CA 3O55A 2HJ3A 3W4YA 3TD7A 3U2LA 3LLKA 4LDKA 3U2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQC A;  3MBG A;  3GWN A;  3GWL A;  3U5S A;  1JR8 A;  3TK0 A;  4E0H A;  1JRA A;  3LLI A;  4E0I A;  3R7C A;  3O55 A;  2HJ3 A;  3W4Y A;  3TD7 A;  3U2L A;  3LLK A;  4LDK A;  3U2M A; 
#chains in the Genus database with same CATH topology
 4U5F E;  1NFN A;  2EPO A;  2IOQ A;  3LAY A;  1MQV A;  3K1I C;  1ZW2 A;  1R5I D;  2HJM A;  3C8G B;  4MW8 A;  4PAC A;  4N4W A;  5E3A A;  3UMK A;  1NU9 C;  1T6U A;  2TMV P;  4E7Z A;  1RJ9 B;  2Q3T A;  3QVY A;  4MVU A;  1O3U A;  3HNK A;  3SXM A;  2QE9 A;  3VRC A;  1TWH A;  4QDL A;  2J45 A;  1D1A A;  1QLE C;  5KYU A;  3B9Q A;  4MVQ A;  2H7V C;  4XLN F;  3ZTM A;  1F1M A;  3N2Z B;  4XEV A;  4D4X A;  2O9X A;  1E85 A;  5KYW A;  1YLM A;  1WGW A;  2GA0 A;  5COG A;  3B71 A;  3PHF 2;  2YHS A;  2KQ9 A;  3M15 A;  3E70 C;  2UUH A;  4JTC B;  4U5E E;  3RH3 A;  4BJ5 C;  2Q4F A;  4LDR A;  5F28 E;  5AC4 A;  1OW6 A;  1VYK A;  3DE8 A;  1CGM E;  3U3F A;  1TWG A;  3U9J A;  3ZVR A;  3U2M A;  1SYQ A;  1OQC A;  3WHN A;  5L0G A;  3GM1 A;  4OIP F;  2RD9 A;  4XPW A;  3I5Q A;  3LES A;  4JEA A;  4BJ6 C;  3K7D A;  2R02 A;  1G4W R;  1Z23 A;  2HSQ A;  1O87 A;  3JRT A;  1PD1 A;  5B3S C;  1RKC A;  4BEJ A;  2CNW A;  2ASR A;  1D0Y A;  1WAS A;  3U5S A;  3AGU A;  3FAJ A;  3I5P A;  4KNW A;  4LLE A;  3AQB A;  2XL8 A;  4O6Y A;  2XS8 A;  3ABL C;  2Y3H A;  2V3C C;  1Y4C A;  1V55 C;  1LIH A;  5KYY B;  1YVI A;  1H7I A;  2M4E A;  3AQC A;  2DYS C;  4I44 A;  4MW3 A;  4OIN F;  3SEO A;  5A6A A;  2ZXW C;  3DE9 A;  3Q7G A;  3ZC4 A;  2XLM A;  1GQA A;  2HV7 A;  1KNY A;  1M2V B;  2XLH A;  1AUE A;  2MHR A;  4G7O F;  2HKV A;  2HSB A;  3B29 A;  2KGO A;  3LUT B;  4NQF A;  2Q00 A;  4P6I C;  3VAY A;  5FCL A;  3B0V C;  4CDA A;  5L0C A;  3TUL A;  2KC3 A;  3NKE A;  4MQ9 F;  3W2V A;  3JCU Q;  3L8J A;  4CIP A;  4W8P A;  4E0H A;  4U9E A;  1TQG A;  1ZHX A;  3CZ6 A;  3TOL A;  3UGP A;  2A6H F;  1MMN A;  1Q0F A;  5L0J A;  2LP4 A;  4JVS A;  2R7V A;  3NYJ A;  4GYT A;  2YVK A;  1BR4 A;  3VF0 A;  3AG4 C;  2VC9 A;  1G4U S;  3RIP A;  2OEX A;  2R7S A;  1RCP A;  4OIR F;  3U0C A;  2XLV A;  4O6M A;  5COF A;  4LAC B;  1FFH A;  2WVN A;  5T1D B;  2A68 F;  3DAF A;  4U5C E;  2OEV A;  4U5D E;  4YL0 A;  3H2U A;  4OIO F;  1MND A;  3EZI A;  4NCQ A;  3LNR A;  3LLI A;  2H7O A;  1K04 A;  3IQT A;  3PDM P;  1QZX A;  1D0Z A;  2RSE B;  3L1M A;  3ITF A;  1T6Q A;  5CI8 A;  1U89 A;  3T6B A;  1A41 A;  1LVK A;  1VYI A;  256B A;  1ZU5 A;  2I15 A;  2NSG A;  3FOO A;  3GM2 A;  4JE9 A;  4DJ9 A;  3ZQV A;  1VMA A;  4EBK A;  4QI2 A;  4I1O B;  3OA1 A;  3ZQY A;  1ST6 A;  2QNL A;  3W8I A;  4PR9 A;  5L0D A;  1LI5 A;  1ZHZ A;  1YZC A;  4C3D A;  4G7H F;  5DS5 A;  2PBE A;  1LM3 B;  4X0R A;  3RFY A;  4OIQ F;  1RMV A;  1VB5 A;  2Q9A A;  2AWC A;  4JTD B;  1YDI A;  5BUO A;  4WGZ A;  3LS1 A;  4FES A;  4FWV A;  3C8G A;  3JYH A;  2L7A A;  4Z9H A;  4DVZ A;  2KK1 A;  3G50 A;  4J32 B;  2C03 A;  1CGO A;  2KSF A;  3SYN A;  4CDV A;  3EGX B;  1GM5 A;  1MMA A;  4ER9 A;  2R7Q A;  2EIL C;  1RJ9 A;  1SZI A;  5BQH A;  2YL0 A;  2LQG A;  2VB6 A;  4AE4 A;  1QPU A;  2OJE D;  2QLA A;  3RQF A;  2W4B A;  1YYX A;  2W45 A;  2PFD A;  2YL7 A;  3S27 A;  1E2X A;  4KI2 A;  2MYS A;  4CX9 A;  2OG2 A;  1Z63 A;  2R7R A;  3U8V A;  2BL2 A;  1D0X A;  2XLD A;  4JCZ A;  3WAQ A;  1ZHW A;  4M63 A;  3AOU A;  1Z7Q c;  2L6G A;  5D92 A;  2J0W A;  1B68 A;  1IZM A;  1ZVZ A;  4PJL A;  5CI9 A;  1G5Z A;  3ZDL A;  3IQC A;  4IAR A;  3EFO B;  1UFB A;  2OQM A;  3GM3 A;  3H65 A;  3EG9 A;  4K1O A;  2Y3G A;  2YLG A;  3QZC A;  1S05 A;  4CJO A;  2NUT A;  4EWC A;  2CNW D;  5JUA A;  2YLD A;  5AC5 A;  1SF8 A;  3C62 A;  2WL8 A;  2ZPA A;  3ZG1 A;  4CS8 A;  1I4Y A;  5L0H A;  1H9T A;  3X1O A;  1HW2 A;  2A1D D;  4W8K A;  2JD3 A;  4JRZ A;  3FVY A;  1Q0M A;  3V5X A;  2J9U A;  3CAX A;  4HEA J;  3HTK C;  3Q6M A;  3VYW A;  5B3I A;  5KYY A;  3RQG A;  1OCZ C;  3SNH A;  1BBH A;  2CDQ A;  1QSP A;  2XS1 A;  1NBB A;  3ASN C;  1YJG A;  4PJN A;  4U5G A;  4U9D A;  2J8W A;  2Q7R A;  3RVZ A;  2FFH A;  4KNV A;  1M2V A;  3QW0 A;  4NY3 A;  3AG2 C;  1Q0G A;  1OCO C;  2DGJ A;  2QTV A;  2XLE A;  2I8B A;  3A9C A;  2WZL A;  3X2Q C;  2ICW G;  5DLJ A;  2VH3 A;  4JUR I;  2IM8 A;  1YYJ A;  2IXM A;  2OU6 A;  1G8X A;  2YKZ A;  3JT1 A;  1NU7 D;  3KMI A;  3TK0 A;  4PJJ A;  5EHH A;  3LEV A;  4AE4 B;  4IGG A;  4XEF A;  4RD9 A;  4FAP B;  1K05 A;  3JZ0 A;  2W9Y A;  1U6H A;  2EPK X;  4H4K C;  3W4Y A;  4CIH A;  3QVZ A;  5DQT A;  3S84 A;  3FXH A;  1H6G A;  1NG1 A;  4RDA A;  2OKU A;  2ZXP A;  3EHN A;  1YAU O;  4N6C A;  4DXW A;  5K0I A;  2EIM C;  2EPN A;  1D1C A;  4PK4 A;  3UR3 C;  3FMS A;  2W4M A;  3LNM B;  4K7B A;  3FDQ A;  4A2N B;  3EG9 B;  2WZF A;  3IHU A;  1A7V A;  1APC A;  2NG1 A;  3O10 A;  1MMG A;  2NUT B;  4JCH A;  2YLI A;  1FNT c;  1DOW A;  2VCB A;  3GEI A;  1A7E A;  3ATP A;  3I4U A;  3SZR A;  1IW7 F;  2IXN A;  4PFO A;  4O6N A;  4NTF A;  1WTY A;  5JS5 A;  5HSW A;  1ORY A;  1XWJ A;  2CCY A;  5L3Q A;  1JRA A;  1ZW3 A;  5L3V A;  3M4C A;  1NZE A;  5EGY A;  2P1A A;  5F5F A;  3MLG A;  2L9J A;  3HKK A;  1JAF A;  1Y6D A;  1DOV A;  3C7J A;  3W2W A;  3C8G D;  2IBF A;  2LK4 A;  3MX3 A;  1QQ3 A;  4J7Y A;  1T01 A;  1Q0K A;  4ZLC A;  4IRU A;  2C04 A;  1BR1 A;  4YJW A;  2EIJ C;  2VAS A;  3R2P A;  4XWJ A;  2UUI A;  2P61 A;  1OXK A;  4WAB A;  3S28 A;  1E83 A;  3S29 A;  1OKK A;  2XL6 A;  4YN0 B;  3U9M A;  3AG1 C;  1N1C A;  4ONS A;  3EGX A;  3IQ5 A;  3RKO F;  5JT4 A;  1RKE B;  4IB4 A;  4C7O A;  2XXA A;  2A69 F;  2HFI A;  1XZP A;  1LE4 A;  3K33 A;  3ECS A;  1TR2 A;  4U5H A;  1VLT A;  4CS7 A;  2LD6 A;  4XEK A;  3QMK A;  1YA7 O;  2OOC A;  4OD5 A;  5T3T A;  1CPQ A;  1T9K A;  4XPY A;  4IAO A;  2Q9C A;  4Z9I A;  3SXZ A;  2OCC C;  2HZ8 A;  3R7C A;  1LKX A;  4EBJ A;  3ASO C;  5L0I A;  2H7B A;  3KKB A;  3C8Z A;  1I4Z A;  2LFF A;  4YK5 A;  3SXK A;  2E87 A;  3EFO A;  3J06 A;  1JMW A;  2R7U A;  2ZXR A;  2MWQ A;  2DB4 A;  1MNE A;  3UGO A;  3T6G B;  3TOM A;  4CBE A;  3N24 A;  2J9V A;  1VK5 A;  4I3M A;  2J9B A;  2A0B A;  2KYH A;  2R03 A;  2R05 A;  3IQ6 A;  3LJB A;  4YWQ A;  1MMD A;  1S7Z A;  3JSZ A;  3KYI A;  2CYD A;  4PJM A;  2P7V A;  3MYI A;  3SXY A;  4DRJ B;  2XRH A;  4L6R A;  2LSE A;  2YL3 A;  4JTA B;  2PP4 A;  3GAN A;  2Y3D A;  3M4B A;  2YRF A;  2DYR C;  3POV A;  3US6 A;  3OEO A;  5A6J A;  4F4B A;  1K40 A;  1Z5Z A;  4U5B E;  5D91 A;  3BEH A;  5BQI A;  1M56 C;  1M2O A;  2EIK C;  3LEO A;  2XLO A;  1GGQ A;  3ABM C;  4Q5S F;  4O79 A;  1YA9 A;  2HUJ A;  3AGT A;  3S90 A;  1EI7 A;  2B0H A;  4JZA A;  4BEM J;  1SMY F;  3U8P A;  2IXO A;  4C7O B;  3N0T A;  1J8M F;  4MTO A;  2XXA B;  1WOL A;  1NFO A;  4G0H A;  3G4X A;  1LS1 A;  2WZG A;  3PMR A;  3MBG A;  1AEP A;  2FAP B;  4XTK A;  4NTB A;  3RF3 A;  3RYL A;  2R7X A;  2YWA A;  4MVR A;  2HV6 A;  4WGY A;  1M57 C;  1FAP B;  4DVY P;  3QW1 A;  3M79 A;  4MTF A;  4JJF A;  1FMW A;  1KU2 A;  5TJ5 E;  1ZHT A;  3GEH A;  3NMI A;  4E18 A;  3NRH A;  5E33 A;  3L34 A;  4FX5 A;  2R7W A;  4DBR A;  3H2V A;  3ZWI A;  5DS6 A;  3DXJ F;  3FOP A;  1EKY A;  3IPM O;  4IWB A;  3HNL A;  1EQ1 A;  1TFK B;  2PX0 A;  3B0U X;  4CS8 C;  1PCX A;  3DMD A;  1YZA A;  2KJG A;  2VCC A;  5T3W A;  2YQY A;  1CPR A;  4JIO A;  3VM6 A;  1OCC C;  3DD7 A;  4E17 A;  1WAT A;  1JPJ A;  3NMK A;  2HS5 A;  1NLX A;  2NSF A;  4CDY A;  4CSA A;  1ORS C;  2A0U A;  2DI3 A;  1OXB A;  3BRJ A;  4LDK A;  4XQ1 A;  3E9V A;  2GDC A;  3KPH A;  4JC7 A;  4G7Z F;  2J9W A;  3LS0 A;  4MVM A;  1ORJ A;  4Q4Z F;  1FFT C;  1TKN A;  1BZ4 A;  3Q6N A;  4K0D A;  5DS4 A;  4IJJ A;  3V7O A;  1OKK D;  3KYJ A;  1ZYR F;  1W2W A;  2EPL X;  4KC9 A;  5KYX A;  5JSL A;  5DQZ A;  2FGY A;  2P0N A;  4DBQ A;  4YT8 A;  2Y39 A;  2AWY A;  5B1A C;  5JLI A;  1WN0 A;  2R9R B;  1PV3 A;  4HFF B;  2KW3 C;  5COM A;  2VCA A;  5B1B C;  1HE9 A;  3TJ6 A;  3DWW A;  4E0I A;  1RKE A;  3EHM A;  2YL1 A;  4AX2 A;  4YT2 A;  5F5H A;  1UG7 A;  1V54 C;  4P9T A;  1WWP A;  5DVW A;  4MND A;  3MYF A;  4EIY A;  3WOD F;  1VTM P;  1BDJ B;  3UMH A;  2YEV A;  3FAP B;  4C3E A;  2V26 A;  3EGD B;  1QVX A;  4YT4 A;  2G3V A;  2EIN C;  1TWC A;  2NPU A;  3DKA A;  1J8Y F;  1HMD A;  2Q9B A;  3K1I A;  4QI0 A;  3TQO A;  1VLS A;  3JYY A;  4ULV A;  2OJQ A;  3DJU B;  4CJG A;  1SR2 A;  2LFD A;  3JTL O;  3W8H A;  4LDQ A;  4LLC A;  4D4N A;  3CSK A;  3EH2 A;  1ZHY A;  3CQZ A;  2A6E F;  4H54 A;  4OD4 A;  4Q7C A;  1Q0D A;  3EH1 A;  3OWT A;  2X0C A;  1ZU4 A;  2NUP A;  2XSE A;  3DM9 B;  1CGN A;  1O5H A;  3MFN A;  2GAQ A;  3ZTZ A;  3SP1 A;  1VOM A;  4BJ5 A;  2P6V A;  1JOG A;  3V5Z A;  5KYN A;  3ZIB A;  1C17 M;  5JP7 A;  1OW8 A;  3UNG C;  5KYX B;  4G78 A;  4EKW A;  2Y3B A;  4Z9J A;  5HV9 A;  3EQL F;  1FR0 A;  2LIG A;  3HNJ A;  4DRH B;  2H8A A;  2GFH A;  4BJ6 A;  2D4U A;  4BG0 A;  2EPM X;  1LE2 A;  3JRM O;  4AL0 A;  1E86 A;  2XL4 A;  3A11 A;  4ULW A;  4B6I A;  3GWN A;  2D5R B;  2WVQ A;  3NG1 A;  4GEH A;  4EUK B;  1JR8 A;  3S0X A;  2CW0 F;  1T5O A;  2G62 A;  3TJ5 A;  4A4A A;  4EHP A;  4JJG A;  5A6K A;  4BJT A;  1YAR O;  4DRI B;  1OCR C;  3KH2 A;  4HE8 D;  2HJ3 A;  2J7P A;  2L6F A;  1LS4 A;  2QUP A;  3F46 A;  3KL4 A;  3NMJ A;  3NYM A;  4J7T A;  1L3P A;  4JKV A;  4NC3 A;  4YT5 A;  3T4R A;  4MVO A;  1LPE A;  3HJC A;  2ZXO A;  4C3B A;  2KNH A;  3M1C B;  2WVO A;  3GEE A;  5A6B D;  4J30 B;  1HMO A;  2GWW A;  3EZH A;  2J0X A;  3S9O A;  4DOZ A;  4MTG A;  5KYU B;  1L7C A;  2BE5 F;  3AG3 C;  1R4T A;  5A69 A;  1H9G A;  2R7T A;  2AP3 A;  3T6J A;  5KYW B;  3DZA A;  2AVK A;  3ZSU A;  3IEE A;  3K1H A;  2NUP B;  3G4Z A;  2R25 A;  1Z3I X;  4KBL A;  5AGF A;  1E84 A;  2XLW A;  4XLP F;  1GS9 A;  3GOR A;  1D1B A;  1ZZP A;  2Z15 A;  3DAG A;  1V74 B;  2BC5 A;  5GPG B;  3T9O A;  4MVZ A;  1HW1 A;  3TD7 A;  3ABK C;  3CEX A;  1U0B B;  1TWA A;  3U3B A;  3QTH A;  2PX3 A;  1EA8 A;  4NTA A;  4MVS A;  2QY9 A;  4O7G A;  3RQE A;  5EK0 A;  1A7D A;  2R7O A;  4LER A;  1QKR A;  4JEB A;  4MS2 A;  5L0F A;  1LI7 A;  3GOD A;  2ETS A;  4IAQ A;  1Z6A A;  3RVY A;  2PNO A;  3UMI A;  2LCH A;  2L81 A;  1RXQ A;  1OR3 A;  4E7S A;  3O6X A;  4R32 A;  3GWL A;  2CGE A;  3NKD A;  5E3C A;  4PFP A;  1C03 A;  3EGD A;  1V4A A;  2WB7 A;  3FHD A;  3V5Y A;  3HNI A;  4YL1 A;  2F22 A;  5CIV A;  2J46 A;  3K6B A;  1HE1 A;  1I5N A;  1FTS A;  3C18 A;  3DI5 A;  3L8I A;  3NYL A;  2IXP A;  1JPN A;  4N06 A;  4P9F A;  1OW7 A;  3EPV A;  5A6B A;  1C02 A;  4UDV A;  4CSA C;  1M6T A;  4AK9 A;  4N6H A;  5BQG A;  4HFK B;  2G3K A;  3K66 A;  4WJ0 A;  1A0B A;  4AL1 A;  4I1M A;  3JSE O;  3O39 A;  2Y69 C;  2M64 A;  2HMZ A;  3PCV A;  3B0P A;  2L6H A;  2XM4 A;  3EJN A;  2IYL D;  1T6I A;  1PD0 A;  2AU5 A;  5JRA A;  4JW1 A;  4GQH A;  5JVE A;  2PF4 E;  2XM0 A;  4XPX A;  4YL3 A;  4BJ1 A;  5E2Q A;  3DM5 A;  5IY5 C;  3C63 A;  4CS9 C;  2X51 A;  2JX0 A;  3L0I A;  2ZD9 A;  4RBN A;  4ANJ A;  1KTM A;  3WG7 C;  3Q7L A;  1FMV A;  4CS9 A;  3AJM A;  1HY5 A;  2HMQ A;  2B0J A;  3O55 A;  3NDB B;  3RW0 A;  4ZLD A;  2YZS A;  1OR2 A;  1TFO B;  3U2L A;  4BPM A;  1BR2 A;  4EBB A;  1AVO B;  1XZQ A;  3F47 A;  5FZT A;  1NSG B;  2JPU A;  3DJN B;  3HLZ A;  2J7P D;  3LLK A; 
#chains in the Genus database with same CATH homology
 1OQC A;  3MBG A;  3GWN A;  3GWL A;  3U5S A;  1JR8 A;  3TK0 A;  4E0H A;  1JRA A;  3LLI A;  4E0I A;  3R7C A;  3O55 A;  2HJ3 A;  3W4Y A;  3TD7 A;  3U2L A;  3LLK A;  4LDK A;  3U2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...