3ZC4A

The structure of csa5 from sulfolobus solfataricus.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
157
Chain Sequence
b'PVAETISKRFWTLIKMLRFYVVLRRFGYIDPLIYSIDPKQIKDVLSEALREFVSYTSSSSSRSIVIYDDPKNPVTAQAPCLVVAKRDEIPQNFPSIYRYTIYKIDKSSEYCISPLVVNDKYATLITPNESVIKEFFDKLDSNIQYARVLASLAVGGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SSO1398
publication title Structure of the Archaeal Cascade Subunit Csa5: Relating the Small Subunits of Crispr Effector Complexes.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Immune system
total genus 52
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2012-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3zc4A01
3.30.70.2780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3zc4A02
3ZC4A
chains in the Genus database with same CATH superfamily
1M1GA 1X0FA 3ZTOA 4IAOA 1JLAB 5AXNA 3U2LA 3A3OB 4USJC 3US5A 1H9GA 4CH7A 2MB0B 4XPCA 3LNMB 4H4MB 2GO9A 2QX0A 3M1VA 5KG2A 4JI0J 4O3OA 2G0JA 2MKYA 2EFOA 1MU2A 4NYOA 2GFHA 4PJNA 1DLOA 4OLOA 2WSCC 3B29A 3R27A 4DV2J 5JXSA 4LF6J 1RWVB 2ZVSA 4TVAB 1TL5A 3MR5A 2DXDA 4OI6A 5DETA 4WIIA 1S6PB 4ZVHA 1GTEA 5E5NA 5FLXY 1W25A 3RB4A 4USVA 1YBTA 1YJUA 4DUYF 1BQNA 2AQ4A 3KPHA 2ZBCA 1I4YA 3CMES 5LXYA 2DNHA 1GX6A 4KHMA 4ED0A 3S01A 5HLFB 2HWHA 3I5AA 5B0EA 2BZ2A 1TP7A 3MD3A 5AE1A 1REGX 4K0KF 1NLXA 2EFGA 4DOZA 4S0MA 3OQ2A 1DURA 1NZEA 1LFWA 3DI6A 2ZH7A 3BO2A 2AZ3A 1ORJA 5GADI 1JRAA 2B9YA 1BQMA 3CJTA 4IQMA 4L3KA 2V6AA 2WVEA 4P6IC 1OQ6A 2RS2A 3ENWA 5KYUB 2YKNA 3MMAB 5BXIA 3V4MA 1FJCA 4DR4J 1VQYA 2XLDA 3RB0A 4FBTA 4JI3J 3ZZTA 5KG5A 3M2UB 9ATCB 1G1XA 3UD5A 3I0RB 3F46A 2C2ZB 4B3OB 5B0BA 1OYEA 2WBMA 2YBVA 2J6UA 1LWEA 1LE2A 1JLCB 1O5JA 2BUNA 4I2QB 2CQ3A 2YWFA 1GQEA 1ZHZA 5KYXB 4WK1A 1X60A 3T5LA 2H5JB 2R3VA 2OUGA 4IOBA 1LQ9A 1LV5A 1WHVA 1O51A 3P6YC 5CZVA 2HBQB 3MI7X 1KBRA 3N4WA 2UUBF 2Z4PA 2XC9A 5DGBA 3RB3A 1J5EJ 1TKTA 3NMIA 1K1QA 3K7DA 5FCLA 2KJGA 3SXZA 3RIPA 2VODA 5KT4A 3SI8A 3BS9A 3S9OA 3RR7A 1U7LA 4RBTA 3TOQA 2HFZA 4EBEA 2IJRA 2A68F 1VMBA 2BABA 4XK8C 3CJ5A 2OIHA 2HHUA 2OMLA 2ZH3A 5HMYA 2DEJA 2MKSA 1A7DA 3DRPA 4TY9A 2IRYA 4OJ3A 3M8SA 1IR2A 1NU7D 1VMAA 3ZDLA 4J9PA 2XS2A 3CGIA 4O3SA 1VJQA 1HD1A 5BYRA 2ZUGA 1XZQA 2IYGA 5KFEA 4M95A 4DR3J 2JWNA 3VHQA 3HI9A 4TKTA 3B78A 4OX9J 4F25A 4K4ZA 1VRTA 2IA6A 1LXJA 2UVRA 4CYUA 4IFYA 3K59A 3VZHA 1L3PA 4O7GA 3AGTA 3UDVA 1YRUA 2Z15A 1RGVA 1FCAA 2RU9A 4IR1A 3D0HE 4NEZA 3AQOA 3PRVA 2RD5C 3T1HF 4WFBQ 3TZZA 2R4FA 5GPGB 3CD0A 2QL5B 2R7UA 1QAXA 5A2QY 2JNJA 4BJ5C 1EA8A 2Q9AA 3J80Y 2HQDA 2YKNB 3GCWP 2DNMA 1S9FA 3LWMA 4CWBA 5DDQC 4O3PA 4KKOA 1D0EA 3C14A 2DNOA 3QT8A 1TWAA 1HNXF 2YNFB 4K7QA 1N34F 1HBOA 3FEZA 4TU9A 1SR2A 3TAQA 2W9AA 2BV3A 2A1DD 2FLOA 2XMVA 2DPIA 1UL3A 5D78A 4UZBA 5EX0A 2QSWA 2VASA 2KT3A 2DVIA 2FJXA 1SKWA 4F4ZA 2XRHA 4JI1J 2XBPA 4FVCA 4KHPF 3TOLA 2ZH4A 6FDRA 1A7VA 1AXQA 2ZOMA 1CPRA 2DXEA 4QZVB 2J7UA 2WRMA 5A6BA 1TKTB 4K4UA 1HARA 1D1AA 4ID8A 4B3RF 4O4RA 4ALZA 3FCVA 1AUDA 2HZVA 1QE1A 1FVQA 3MEGA 4ED6A 4JEBA 2V2KA 2QMXA 1RT3A 3EG9B 5K8MA 1MLAA 2Q66A 4JOUA 2BYCA 2M4MA 3X1OA 2E5GA 3MPWA 2DD8S 3K1IC 3EFOA 2BJ8A 3TEGA 1KHVA 1WEYA 2BJ1A 1FKPA 3QIDA 3DRPB 4OZ2A 6AT1B 4ZPDA 2VBWA 3WDOA 1L3SA 3H42A 1RKJA 2XM4A 3RAMA 3MPYA 5DGAA 4RUHA 2LQ9A 3WX8A 2I0XA 3PVXA 2EFPA 1RXQA 1SC1B 4A8QA 4JC7A 1OCOC 3OTBA 2NUTA 3M32B 2VFRA 4CDIA 2IMWP 5I3QA 5HSWA 2IBOA 1SIWB 2RB7A 3OR2B 4U5HA 4Y2KA 1HMVA 4CYUB 4IFYB 1TWGA 2GW8A 1IKVB 3RRKA 2IFXA 2F9JA 1YX2A 3DE9A 4NCGB 1D1CA 4LDKA 3NGSA 4FZVA 2HPUA 3N0VA 4RD9A 1VQLS 3H25A 3QJPA 2P61A 4XLNF 1KNZA 3BDPA 3P49B 4CLYA 4ZVOB 3BQ1A 1XZPA 3BJYA 2W8KA 1U47A 4I69A 5KFCA 1Y4ZB 2QY9A 4KKOB 3C14B 2YQ3A 3HX9A 4QIGA 3D6FB 2ROGA 1R3NA 1X5SA 1C2PA 1TUGB 4PYDA 2HZAA 3TRGA 1Y3JA 2A69F 1HBOB 3WQPA 3OR1B 1SV5A 3QJJA 3CDBA 3HSGA 1QQ3A 2ALYB 3CIMA 4NCAA 2MSTA 4NXMF 1SBRA 2ASLA 1ZYRF 3KLFB 4DFJA 2OEKA 3DKAA 4QR2A 3MGJA 3MDFA 1E2XA 4N4WA 3K58A 2DY1A 1SH2A 2J76E 2LA6A 4ES2A 3N79A 1LS1A 3S29A 4ANJA 1RHMB 1X4EA 2FHMA 2GIRA 4XWJA 1YBUA 3NKYA 2XG8A 1YDLA 1WI6A 1QE1B 5KT3A 4USWA 1ZM3A 3TQOA 1FTCA 5CD4H 1RT3B 5GAGI 1WN0A 4NLRA 4CT9A 1EP4A 3EFOB 1S9GA 4C7OA 2K3KA 1NZAA 2UXBJ 1FKPB 1S79A 2VONA 2HNDA 2HV6A 3UWTA 4ED8A 4UOCA 3DNCA 1I94J 2J45A 4PXCA 3JSMA 2EKYA 2V5HG 4W90B 2E5LJ 4IDKA 1XNRF 3HHLA 3NAIA 1LWXA 2KM8C 2Y3GA 2NUTB 1JNRB 2B6AA 1FX2A 3F44A 4DR5F 1FFHA 1FJEB 1CS4A 2G2YA 4OYPA 4P7TA 3J7Z5 3U1LA 4RW7B 1D8ZA 4UDVA 1XWJA 3F41A 1OY8A 2VDIA 3QBCA 3J81j 3AJMA 4O3NA 4OZ0A 1H74A 1SJRA 1OXBA 4YS2A 1FNMA 4RW9A 1N52B 2G0IA 3DOKA 4FAPB 3FBFA 4OFZA 1VRQC 3VVTA 2IM3A 4Y2MA 4ZS6A 2DGTA 1RYRA 5DVWA 1FNOA 3HF5A 4E2FB 1OXKA 2Z56B 4Y6IA 3W60A 2UUCF 2PFFB 4AL5A 2XSJB 1U6HA 5L0IA 1YHQS 3AXMA 1QVFR 4NMXA 5M2PA 2YH1A 1QUPA 4EK2A 1N5YA 4YOEA 1N0UA 1N32J 3B9QA 4DLGA 4Z9JA 4QWBA 4O44B 3OT9A 4ZOSA 2BE7D 2KQ9A 1FRLA 3C8ZA 3ITHA 4KC9A 5IC6B 4X64J 3LH2S 4QOTA 1T7PA 1TKXB 2Q00A 4PRFA 4DPUA 1SL2A 1RBAA 2H4YB 3CVKA 2QT7A 4QIWD 3DE8A 3CNQP 2HHTA 3JTNA 1ZH5A 4IH6A 1G4WR 1V74B 2BA9A 4RUCA 2M52A 2F1FA 4ELVA 2G62A 8RUCA 3ZO7A 4N56A 1ROFA 4X4PA 5F8HA 1A7EA 4DSKA 1XBWA 3H5UA 2ZH1A 4NTAA 1K05A 2KSFA 2EINC 1RU1A 4WK3A 2LCWA 4JKVA 2AHOB 3I6PA 5E3QA 1OYDA 2MZ1A 4CCHA 1UPMB 5HI7A 2B0HA 1JR8A 2CYYA 5D0RA 2Z2MA 3HHKA 2HHXA 5ETVA 1TL1A 2J7KA 4NE9C 2BR0A 5D4NA 3QAEA 2RHSB 2O1PA 3SV3A 3SIPB 4EBKA 2PX3A 1EP4B 2R8IA 3SP1A 4C7OB 1IM6A 2J0SD 1SJ4P 2V3CC 3UNGC 3UW1A 3GP9A 1RAJA 2CVIA 2WONA 2J0WA 2R7QA 2DR8A 3AOCA 3JSMB 3AJDA 2LYVA 2FZKB 1HMOA 2Z57B 3HHLB 2M64A 2YNIA 2CRLA 1KTMA 4RNNA 2B6AB 4JURI 2JEFA 4J9SA 5F8GA 3V5XA 2XMAA 4DSIA 3ZTQA 4PXEA 4X62J 2B4UA 3ITFA 3QWPA 1X4GA 1FNXH 2BE2B 1S99A 4DF8A 3JYTA 4RW9B 3DOKB 2EEYA 3QFHA 1YBAA 1VBZA 4C6AA 4IQXA 2ZH2A 2HG4A 4DV6F 2J9BA 3ZNUA 1U2CA 1UEUA 2U1AA 3DLKA 1Q16B 1RHQB 3MPUB 5AT1B 1IWAA 1U1KA 2O67A 1WSRA 5KFUA 2FD2A 1G3OA 1Q95G 1N48A 4D4XA 3ABLC 4GC6A 5I4MA 2AJ2A 2ASDA 2E5JA 3EPVA 1GMWD 1BQXA 3AB4B 3RZAA 3IBFB 3CO0P 3TD7A 2Q6CA 1D9AA 4XDDA 3FOPA 1MN7A 5B7WA 4U6PA 4NLPA 3OFGA 5H1SV 1JJ4A 4C8OA 1RT2A 2QL7B 1WKJA 3TI0A 1VQPS 4EHPA 4IUFA 3EHMA 3F0NA 3JYHA 2W4CA 3JXOA 3NL0A 1RCOB 1FNTc 2EBEA 2JHEA 4FXVA 2Y39A 3HT3A 1BXNA 4NCBA 1XR5A 5D6GA 4J9QA 1VDHA 4ZVUB 1H7WA 2H3EB 2WW4A 2CNKB 2B43A 1VS3A 2VG6A 1G8XA 3NCQA 2DGQA 4JTDB 2W8LA 1HNZF 2HGMA 2L9DA 2C2MB 3QZ8A 3GG0A 3OD2A 2VQEJ 5HMZA 1BLUA 2Q1LA 3FSIA 3OWTA 3W8HA 2BM0A 4NLQA 3SZ2A 1S1VA 3GEEA 1K8AT 4DR4F 1TKDA 1TKZB 2Z30B 4DL6A 5KFWA 2UU9J 2MKHA 2DHHA 3NBPA 3S7RA 3IGNA 4DSEA 1S05A 3UFCX 2AYMA 2PA8D 5E3PA 3ZTZA 1RK8A 4FF2A 1NU9C 2WVQA 1RAOA 3L95X 2YNIB 4C0BA 1U6BA 2EPLX 1AA1B 2YKMA 2GAHC 2PF4E 1KQKA 2E5HA 2OSRA 1T8EA 5IS2A 4NX9A 3P4UB 2VICA 3Q8UA 2VCBA 3GIIA 3BGFA 3QO9A 2QN6B 2IDEA 4C8YA 3IWXA 4GRSA 3FOOA 4L75A 1FXLA 1XMQJ 3W2VA 3BGLA 4O6YA 2QV6A 3UGPA 1V3SA 4BBYA 2M8HA 2QSFA 5CCMA 3G6ES 4PWDA 1WUUA 3DLKB 1T9VA 4X65F 2OPSA 2KGOA 3R3TA 4C3BA 1OKKA 2E5IA 1EIYB 2VJVA 3VRCA 3WIUA 3OTDA 1FD8A 1YIJS 1ZHTA 4QPXA 4ICLA 2G3KA 1PJ6A 1BC6A 4LUBA 3KXDA 1WACA 5JUAA 5HJYA 4OYXA 4JI5F 4PEOA 3DM9B 4FYDA 3DDKA 2VH7A 5E3AA 3L4BC 1NDLA 3BR9A 1Y00A 4EMDA 4GEHA 2EPMX 4CLPA 2XLEA 2DYAA 3VGUA 3K2YA 4UF4A 2LKZA 1F9EB 1BY9A 2XMMA 3LA0A 4YT4A 2QMWA 2HRTA 2ADBA 1S0OA 3C6TA 1L7CA 4JI2F 3O44A 4O3RA 3N6MA 2KFZA 5HJXA 3GTYX 3VR1A 4NYZA 1S76D 3IO1A 1KVKA 2JSXA 4CBEA 4EBBA 2ZITA 3LGHA 2QIFA 1HQUB 2XS5A 2XXAA 1ZZPA 3PX6A 3G50A 2KVIA 3FEXB 3GIKA 2AEMA 5RUBA 1Y3KA 1EZZB 1IR0A 1IXKA 1DOVA 3W9JA 2KFYA 2O9XA 1C0UA 2GJ2A 1O0PA 2JDJA 1HMDA 4ULVA 1U1QA 3EH2A 3R6LB 2NR0A 2VBXA 4BG0A 1U1MA 5ETMA 2W2OP 1SI9A 5DLGA 1X4DA 4WP3A 3J7YI 3OVBA 1FK9A 3BKTA 2NPIA 2H7VC 2KXFA 1H6GA 4ZPBA 3I0SA 3OVAA 3KH2A 4WABA 3O39A 4OV1A 5AE2A 2OO4A 3KDNA 3EGVA 5JJBA 1NJIT 5GAEU 1VYAA 2V69A 5F3TA 1RXOB 3V81A 3HKKA 2XYPB 3QO9B 4B9SA 4KQZA 2PIIA 4O0NA 4MFBB 2ZHAA 2PGCA 3W2VB 1LNQA 3MMJA 1SKSA 3TJ9A 4F0KA 4CLLA 3U8VA 3CULA 1XC9A 3CJ3A 4DJBA 2B4PA 2L6GA 4PWDB 1ZW2A 1WC1A 3LQVA 4ELTA 2OPSB 5EUHA 3V4IA 2HRUA 2F9DA 3PV8A 5GADU 2JZ5A 2L7AA 1M6TA 1F3FA 4CIHA 5CYMA 1BUXA 3AHPA 1WD6A 4BEJA 4CM0A 1WTBA 4BJ5A 3POTB 2WZGA 3MCMA 1NEEA 4N6HA 4P2FA 3TX8A 1OS5A 2OEJA 4ZVSB 2Q79A 1NSKL 2GHWA 4OHXA 2QEXS 4PXDA 3AQPA 3LLKA 4LFCJ 3VF0A 3V6HA 3RBXA 4URSA 4MTOA 3EICA 1JLGA 3MAHA 2CDRB 2ROEA 1GK8A 2RUGA 3SXLA 3Q83A 1Z2ZA 2LXIA 2JVRA 2KB2A 3C6TB 3MLGA 2YWEA 3DM5A 3C15A 4L6V3 2LXUA 4WKRA 3QMQA 2BKNA 2XXAB 2DPJA 2PDAA 5A6JA 4DFKA 3OXLA 1FHTA 4WP9A 2H5EA 4BEMJ 2Z2LA 5LJ3Y 4G78A 2NUUG 1UVNA 3DLGB 3E8OA 3THPA 2KZMA 1MMDA 2ZH9A 3NRHA 2AV5A 2D3OR 4F67A 4B9TA 1VTMP 1WG4A 1WKLA 3MM6A 2NREA 1URNA 4PPDA 3TJAA 4QR0A 4UY8T 1U8SA 4YWQA 3LESA 3BGOP 5IWAJ 3H5YA 4USHA 1FK9B 2HLTA 3LNRA 3IAM9 1V4AA 3O5TB 1YG0A 3K1IA 2R7RA 3MMBA 1ZHXA 5A8KB 4K4SA 2A6EF 3I0SB 3N9UC 3PYGA 2EPNA 2MYSA 4JE9A 4H4KC 3A8KA 3JSRA 2J6SA 2MQLA 3CCZA 3B4DA 3BREA 5F9NA 1SUQA 3NGTA 3V81B 4MW8A 4FXDA 1EQ1A 3H2VE 4A8WA 4YUDA 3UO0A 4KFBA 4ZCKA 2HHVA 4M5IA 5J2PB 4P9SA 1HWUA 3D7SB 4X4OA 3D0IE 1M0SA 2XSFA 3LAMA 4OIRF 5DS5A 1DOWA 1E83A 2MMYA 1TVRA 3DLEA 3PEHA 2B5JA 4EZ9A 4L76A 4J91A 1YVIA 1IUJA 3FC9A 2CQGA 2HS3A 3TJ8A 2DHXA 5CYMB 1PJ5A 5KFGA 3B4MA 2K7KA 1TAQA 1D3WA 5ETSA 2ZE2A 4LIRA 3AG2C 2OPQA 3Q8SB 3OTCA 4DG1B 1RAIB 4BC7A 2XL4A 1QDUB 1KVJA 5L1JA 4EBJA 2EC2A 3HNKA 1PIEA 2XMUA 1RT6A 2YWHA 4AL0A 1M1KT 4ZIVA 1P9QC 1WC5A 2OTJS 3KK1B 4CP5A 2P7VA 3THVA 3X3UA 5GVQA 2F5GA 1JLGB 3UN2A 3BR8A 1HPZA 4CO3A 4HDHA 2VG5A 3RBEA 2ZH8A 1DAXA 3EGXA 4J9NA 1X4AA 1YITS 1E85A 3DYAA 3R8YA 5L0CA 3C15B 1Z6AA 1CPZA 4RNMA 3KLIA 2XWYA 1K0TA 4AK9A 1W2WA 3ETMA 2P0NA 1GS9A 4C8MA 1IKWB 4QDLA 2XL6A 3CIZA 2BACA 3HK2A 3U1MA 1PG5B 5LMUJ 5HQLA 4C0OC 1OSDA 3PKYA 3Q6MA 2B0JA 2KXNB 3I9V9 3HVTA 4I6YA 3KOAA 4I2PB 3MM9B 3OL8A 4DPXA 4MH8A 1WWHA 4A8SA 2CW0F 5KFNA 2POKA 1LXNA 1KOHA 4CLFA 4X4SA 4TNOA 2AGOA 1H6KX 3LGNA 3CE8A 5EDWA 5J1NA 4X64F 2O66A 5A8RA 2HNZA 4FXWA 3MMBB 5FD1A 4UW2A 2ZZMA 3HNJA 4E7ZA 4LF4F 1N1CA 1W2BR 3CD5A 4FNIA 3PEJA 5A0YA 2Y1JA 5G4DA 4BJ1A 3T1AA 1EKYA 4PG8A 4G65A 1ZVZA 1FI4A 1SMYF 3PXGa 1SUQB 2WAQD 4LSNB 2AKWB 1UEKA 1RWUA 4MVZA 5C25B 4DV7F 2MQOA 1FA0A 4KFBB 2HQGA 3MUTP 3K7RA 2VA3A 5LSLA 1H2TZ 1U26A 3TJ5A 1XJWB 2V2QA 1S0MA 1V9OA 4YR2A 2WSEC 3M6VA 1EKRA 3Q2TC 1TVRB 5KFZA 3DLEB 3ILIA 2B5JB 5U47A 3MTKA 1P1TA 2AWZA 4PACA 1ZYQA 2GVZB 4PJLA 4RDAA 2R25A 5HVFA 3D1QA 4U5EE 2EK6A 4CJGA 1NLKL 4CRJA 4UZCA 4OIPF 4YDXA 5C2CA 4DR6F 3FSYA 2OPQB 3NNHA 4JV5J 2C2EA 1H98A 2HQ3A 5ADZA 1Z4UA 4ZLJA 1QSLA 1AYEA 4ED2A 4ECXA 3CCES 3PDNA 4DI6A 3BGRA 3ZFVA 3QNWB 5BQIA 1RT6B 1SQEA 3L7PA 5HANA 2QC3A 4JI8J 2W9CA 4QI0A 5EWGA 4LR8A 2GA0A 1FEHA 3JB9k 3PR5B 4U7CA 2X3DA 2YHSA 1AUSL 2RT3A 4NC3A 1FXRA 5KYWB 1HPZB 2I15A 2DIVA 2VG5B 2CADA 3UN5A 2W1BA 3EGXB 5H9EJ 4P2SA 2RVJA 2Y8YA 3ZSUA 1UA1A 2EBGA 3KLIB 4M5GA 3GJTB 3R5CA 4EUKB 3BO3A 3H2UB 5L9NA 2KW3C 1ZM2A 2R8JA 5KFLA 3IR7B 2JRSA 2C42A 1HBMB 4LQ9A 1FJ7A 2J5AA 2XWXA 2FVSA 1NFOA 1GEHA 5GMKa 3HVTB 2D41A 3PNIA 4R8UB 2ZHOA 1HY5A 5GAGU 2VPXB 3M2VA 2ZM6J 2OPPA 3HSJA 3K89A 5AJ3F 1KKHA 3GSIA 3CT9A 1LWCA 1JLQA 1T9YA 1SVDA 2E66A 5D4LA 5KG6A 1XNQJ 1N5QA 4A8OA 3LP2A 1TR2A 5A8RB 2HBYB 2HNZB 4C0HA 3D28A 2UUWA 1CGOA 4X4RA 3KHHA 4A46A 3ONQA 1R27B 1T05B 1R0AA 3CCQS 2QJ3A 1KTVA 4M5HA 3KG4A 1R0CB 2LQBA 3UVJA 1C17M 1B0VA 3W5YA 3M2RB 3LW5C 3N5BA 1HI8A 2VD3A 3MEKA 3ZZUA 2R42A 3GLJA 3K17A 1HHTP 3EVOA 4WPAA 1IZMA 1HNWF 1WOPA 2Z58B 3G86A 4B02A 2MGZB 4DL3A 2XB2D 4USIA 1YWXA 2YQ0A 3CB4A 1MWQA 4CZCA 3AXKA 1WEZA 2UUHA 2R9RB 3PTWA 4KV8A 1U2RA 1UFKA 4H4OB 3GZ7A 4Q5SF 4QPTA 2DNKA 1XTZA 1C02A 3N0TA 3I5BA 2L48A 3DRYA 4TLQA 5T41A 1I1GA 2Z8QA 1Q5VA 3MX3A 1XERA 3NOCA 2FLNA 4JI6F 2XS8A 2J8AA 3BGRB 3FCWA 4AE5A 1K47A 1NBEB 2V8PA 4QJVA 2W9CB 3TZYA 5CIVA 1DFDA 3R9LA 2YL3A 4AX2A 4OJGA 3M9OB 4OL8A 5B3SC 3R5BA 2R03A 4DR1J 1QJHA 4PG4A 3U27A 3V5RA 1LEOA 2LSEA 5H9EK 3IMQJ 4FNHA 3GEIA 4HLBA 2YLIA 2X1GA 2Y9HA 4HHUA 3UR0A 3PW2A 5E3CA 3FNNA 2CGEA 3DHXA 1CBKA 1IKYA 2HMZA 2ZUAA 2FJWA 2LP4A 3O10A 4DR7F 3M2VB 2W2QP 4EIYA 2OPPB 1B0PA 2IBFA 1LWCB 2J0XA 3DDNA 4NCQA 3QIPB 1JLQB 4WXWA 2R2RA 3U3BA 1A0OB 3SCIE 1NU4A 2DO0A 3LP2B 4Y2AA 3ABKC 1N5VA 2D3O1 2MPUA 2AJ0A 3UDLA 3CD7A 2HWTA 3KLVA 4GC7A 4CTAA 4E18A 1F5BA 2ZXRA 5L0GA 3W8PA 3Q8QB 3L7OA 5I3PA 2MXYA 1Q79A 4W92B 4OIXA 5HQMA 4ECRA 3N5FA 2AMCB 3OW2R 4JI4F 5LXRA 2IJNA 1NNDA 2ZKTA 3JCUQ 1FRXA 1UEVA 2HFSA 3VQSA 4RW8A 5KFMA 4P9FA 3ZTMA 2L9JA 3SXYA 2OGUA 1RWKB 2HV7A 2MQ8A 3KYIA 3R5AA 4IG0A 2FY1A 2C04A 5E0OA 2V4JA 4KV8B 1HWKA 3T19A 1XQIA 5L0DA 3T6GB 5KT6A 4YT8A 3DAGA 1PC5A 2YNHA 1OW8A 2QLAA 4DMZA 1VQ5S 2GDCA 4FYVB 2ILYA 2XLWA 3NG8A 2KU7A 4U5CE 1JLEA 1NPPA 1LW0A 4BDPA 3G4XA 5CXTA 2YTCA 2NXCA 4M5LA 2YX7A 1K04A 5JP7A 3FK4A 4XO0A 2MZSA 2KG0A 4QIEA 3MPVA 1JXEA 4U7UD 3N6LA 2YL7A 4DUYJ 4YL0A 4WFYA 3EGDA 2DR7A 2XSEA 3TULA 5DQZA 3EGWB 2HZ8A 3JT1A 1TFKB 4C2MA 3KDOA 3CZ6A 4L3NA 4MKAA 4R0JA 2B9WA 2I9SA 2CNWA 4K0KJ 2CZVC 1JQGA 3GJSB 1LE4A 2MZTA 1Y5IB 1FEEA 5K8OA 2UVWA 3K0JA 3G2XA 4KAIA 2WBRA 3AOBA 3FSXA 1IKYB 4RWXA 4G7HF 1CJUA 1S48A 5HVHA 2F63A 1GAOA 1GX5A 3DMJA 2QRRA 5E3RA 3MR2A 3UD3P 3N2ZB 1IR1A 1HA1A 1AW0A 3PM9A 2GCFA 1VBXA 3UCGA 3CJ2A 1BR1A 1SB6A 2C03A 4QCLA 4USMA 4LFCF 1DHMA 3F47A 3FXHA 4EYIB 2LFVA 2E7VA 3C6UA 2CIMA 4CTAB 3NY0A 1JWWA 1Q0KA 2OELA 1T3NA 4HDGA 3MECA 1TL7A 3HP6A 4YEAA 2MZJA 1XMOF 5L0JA 2UUBJ 1FRIA 2ZFHA 3M8QA 4DR2F 4RL1A 3O6XA 1S5ZA 3KYJA 3UQSA 3WZ0A 4QIVA 2YQ1A 3B8HA 3UMIA 2LU2A 4DLEA 2A10A 2PE8A 1D1BA 2EC0A 1U4BA 4RO0A 4XPEA 3JSZA 1MQVA 5KFFA 4IG0B 3DU5A 1VHIA 2HHSA 1KOOA 2V4JB 3KJFB 2OEMA 2FDNA 1K44A 1WC3A 2ZJRQ 2CAJA 2IVFB 3Q86A 1VJWA 4OHWA 1HL6A 2O5DA 4KTQA 1KQGB 1MMLA 3ENQA 2W9BB 2UP1A 1C0TB 1S6QA 1JLEB 1VCTA 3PX4A 4EZ6A 2XO6A 2V68A 4ZP9A 1RT4A 4R32A 1OPZA 2R05A 5K8PA 5IM0B 4P7VA 2HYIB 2CQ2A 4CO5A 2LEAA 3NKDA 1CULA 2YKAA 3HO1A 3M8YA 1LS4A 2BXJA 4JYAF 3TJ6A 1UW4A 1RHUB 2AWCA 3EGDB 1FXDA 4OQJA 1B68A 4LIWA 2OU6A 2K1RA 2ZD1B 1OWXA 4F0HA 2E29A 2KNHA 4ED5A 2ASJA 3IN5A 2Z2ZA 3VGVA 3TQ1A 1RT7A 2ZBIA 3T1HJ 1LW2A 4DEZA 1YJRA 2CJQA 3AOUA 2KN4A 1Q7YT 1M90T 5COGA 3T6BA 2IM1A 3SCLE 3CJ8A 3AY0A 4Q0BA 1VIOA 5IT9U 2KRBA 1HQ2A 2DYSC 4BS2A 2W2NP 2DO4A 5KOXA 3UD4P 3D4JA 3Q23A 3T1YF 5HN0A 2V26A 3LOUA 1FWKA 2FHJA 2ICWG 1RWWB 3CCRS 4JB8B 2IMOA 1CJUB 3DRRB 1U89A 1HNXJ 3DMJB 4DU8A 2BQ3A 4MYTA 4LF7F 4MKVA 4JIOA 3J7YU 4HYKA 1NSAA 4KGKA 1G5ZA 2XLOA 3S1TA 3QSIA 3Q8VA 2VC1A 3W9HA 2J9EA 3OLAA 1XK8A 2GIFA 3QFWA 4C4WA 2X1AA 2UZAA 3P5BP 2MWQA 3RB6A 4JZAA 3CJSA 4NPOA 5K5MA 3SDEA 1TK8A 4KHPJ 3BRJA 2FJDB 3HZEA 1DJ0A 1FMVA 2EXUA 1LM3B 1RKEA 4OYWA 2CJ9A 4H4KA 1WF1A 3I31A 1E84A 4P10A 2BBEA 3KJQB 4FF1A 4ECSA 1Q0GA 4B3RJ 2VCAA 3PYDA 1JXVA 4PJJA 1RWOB 2CXEA 4DZ6A 1S0NA 4M5KA 2VBYA 3HMJG 3C2PA 1N33F 2FFHA 4LSZB 1RLDA 2HBRB 1Y11A 3M9MB 1GQAA 1CQNA 1RA7A 1Q0FA 1F0XA 4AE4A 4ZHRB 4EFAC 4LSLB 5HATA 3TP2A 4C3MA 1RAFB 5J2NA 1H7XA 1NKEA 4Q7AA 2IM2A 1RSCA 2CJAA 2D9OA 3B0VC 1ZM9A 4P2MA 4J5OA 3TARA 1RT4B 2G2ZA 4U5DE 4YP3A 1F3VA 2QFJA 3IQ6A 2X1BA 2OG2A 4YB1P 4F8RA 3VYWA 1YYXA 2B56A 2V50A 1NHKL 4AYBD 4PQUA 3K33A 4I4BA 1ZA2B 1CULB 1ULRA 1IN0A 4Y65A 2QNLA 1B7YB 2JEIA 4IR9A 2ALZA 2EIMC 4A4JA 1IBMJ 2HVIA 4I7FA 2GZOA 1HD0A 3RF3A 4HFFB 3BBFA 5F0UA 2K1RB 2B4VA 4P2XA 1S7HA 1RT7B 4UOHA 1H73A 4HEA9 4E0HA 2MHEA 4Q0BB 1PCAA 2RIJA 4C3EA 5GAHI 2BRLA 3MCOA 4LFAF 4OJ1A 3A11A 1VK3A 1HHSA 2QYCA 1FRKA 1QLNA 1JKHB 4OZLA 3R2DJ 2LFFA 1XR7A 5CD4A 1DTTB 4H54A 2YKPA 5AGFA 4AD6A 4AUKA 4DV4F 2JX0A 4ZP6A 4ANEA 2H51B 3J81Y 1F9HA 4JCHA 4NXMJ 2UXCF 1UVKA 4E0DA 2ZH6A 3W8GA 5LM7E 5C42A 4EKWA 1Q0NA 4LDRA 1NKCA 3NYMA 4RX6A 5J2QA 3DU6A 4ECWA 3SDEB 1QAJA 1HYSA 1YRTA 2HK2A 4IG3A 4NTBA 2YZSA 3I96A 2KC3A 1RKEB 2XZDB 4OZ3A 1UP1A 2BOAA 3MZIA 4J7CA 4QWCA 4X4NA 3VAKA 1M2VA 2FUG9 2IXMA 1HIYA 3SYNA 4WCEQ 1U0BB 2DB1A 3SQGA 3C8YA 1G4US 1MG7A 1KU2A 5I42A 2J9DE 4CDVA 1U0HA 3KFWX 5D8HB 4I1TA 3HFVA 4K0DA 3CSKA 5F5HA 1IKXA 2ZJQQ 4AE4B 2HMIA 3CMAS 2RUSA 4RU9A 4AXIA 2J7PA 3VZIA 3I56S 1D9DA 5J2NB 2ZM6F 2ATCB 2GGPA 2AWYA 1REVA 1WHWA 2GX8A 1VBYA 4LVNP 1VC0A 1ZW3A 1XNRJ 1VQOS 2RD9A 4WU2A 4OMFG 5KFKA 1PO6A 2HNYA 3KG0A 2HRYA 4LJMA 4PQUB 4ED7A 3BSOA 3EHNA 4YT2A 3QTHA 2AX0A 4DUTA 2BM1A 2DR9A 3ZIBA 1KTQA 2CYDA 5KFRA 3QVYA 3WC2A 2FJBB 1UZDA 1AFJA 4F4XA 4ZPAA 1DQAA 3DLBA 3MFIA 1D0XA 2C2OB 2Q9BA 3DAFA 3U7JA 3RVYA 3EZ5A 2VH3A 3LEVA 2UUCJ 2FVRA 1VQ6S 2XCPA 1RCXB 1X5OA 4RU2A 3C8GA 1VYKA 3NWGA 2P6VA 1O8BA 5DQHA 3IEEA 1TK0A 1S10A 4TY8B 2J7WA 2PEBA 4IFVA 1UMJA 1KLNA 2IDLA 3D67A 4NA1A 3W1YC 3OXGA 1A41A 1UAWA 5KAKA 1WORA 5M2UA 3ECSA 3MR3A 1HW2A 1YJGA 5C42B 5T3WA 1HQEA 4F50A 2JL9A 4YR3A 4LF9J 3GG1A 3OLBA 1VQ4S 5J2QB 3NKEA 2P6TA 3ZG1A 1Y7PA 1UFWA 1HYSB 2BOPA 3M4CA 1J8YF 2HVDA 3N24A 4ZJQA 2IHR1 3QVZA 1X8DA 2RKIA 2PNOA 4P52A 4JVSA 1ORYA 1M2VB 2R02A 3DOLA 2ZXOA 2H8AA 1RAHB 4N8NA 3M6WA 3UDCA 3RYLA 3NMRA 4C11A 5I42B 1VR6A 3A9CA 2NXUA 5DLFA 1U0HB 4Q7CA 1FFWB 4LDQA 4DBQA 3H5XA 4QWEA 1IKXB 4U96A 3DLJA 4ZIWA 1WATA 2DRDA 3MWBA 2QMUB 5KFYA 1REVB 4Z7CA 4X2BA 2E44A 2HS5A 1WGWA 3QW0A 1UWBB 2G3VA 2G13A 4U9DA 3BEGB 1U6ZA 3IWNC 1RTHA 4OI1A 1HBNA 1PAUB 1SQGA 4RKUC 4J7YA 2RS8A 1W7WA 3HSZA 4BWMA 2OCCC 3PJ9A 4DL5A 3HJVA 1HHQA 2R7OA 1B3TA 4GQHA 2W4BA 3I4PA 3O3LA 5A6WA 2ZBPA 3KJVA 4IARA 2MZRA 4OJHA 3DRSB 1HR0F 2H54B 5B09A 1S6OA 1NHVA 1Z1ZA 4DHVA 4WFXA 1RHJB 4DV6J 1ZAXA 1SJ1A 4A2NB 1Q81T 1UW9A 2HVZA 2BJ3A 4RR5A 2MLYA 3GANA 4DBRA 1PBAA 4NLTA 3C8GB 4WTYA 3T9OA 1GTHA 3OSNA 1SJ3P 1EX8A 1RT5A 1AVOB 1S1WB 4NTFA 1BE4A 1HE1A 2DBBA 3T6JA 2FJEB 1FX4A 2NLWA 2FQQB 4IFVB 2C1EB 3T41A 1N6QB 3JQKA 2HS0A 3K8VA 3JRMO 2P5VA 3VAJA 4G1QB 4CLSA 3HZGA 2DI3A 2GVDA 2VOOA 1X9SA 2LQ8A 1GH8A 3OJUA 3MM7A 1TV6A 4U5BE 4NI2A 4NLUA 4JBCA 2IXNA 1RT1B 5T1DB 2QLFB 3HSDA 2I8EA 3JTPA 4DS5A 5DM7Q 4F4BA 2BW2A 1YKWA 3HVRA 3ZTSA 3G4ZA 3I4UA 2LD6A 1K73T 5KFAA 4O3QA 3ISZA 5T14A 3BEHA 3HD2A 3KHLA 1APSA 3NXZA 3SZRA 2RKIB 1EAYC 1WHXA 5F3ZA 1ZPVA 3WAQA 1P27B 2A2CA 3DOLB 2Y69C 5L1IA 3H40A 3M8RA 2BVZA 3EVWA 5KYNA 2D74B 2WVFA 4Q43A 1HNZJ 4C11B 1T02A 4LF8F 1M5PC 3MM8B 2LDYA 2DISA 2G4BA 3PHEA 5BQHA 1APCA 2MSSA 3L7UA 2NUPA 3MR7A 1X9MA 3HFKA 2HIQA 3OUYB 4PKDB 3GU0A 1HFEL 2NSGA 1KLMA 4CNYA 2IY5B 3IHUA 1T9UA 3CO9A 1PJ7A 2F7VA 3RKOF 3FJ2A 1NM2A 4WJ0A 1RTHB 4PUOB 1HBNB 5IQ6A 4WU3A 4DDFA 4ZVFA 5KT2A 2QYGA 1BWEA 1J2VA 4DS4A 2TMVP 1ZETA 4BLGA 3PY8A 2D7SA 1WASA 2V8GA 3BKFA 4JRZA 3D9BA 1R8AA 2YVSA 2H1YA 4GKKF 2XO7A 1NK4A 3RRHA 1RB0A 3QGIA 2QA4S 5JS5A 4X65J 5AXMA 3KLGA 6FD1A 4CO4A 1QUVA 4PCQA 4ERDA 1S7IA 4NRUA 1Z63A 3JSBA 3TWZA 4QR1A 2Y1IA 1W2IA 4QYRA 2DNRA 2RJZA 4DV0F 3THTA 4O6MA 4AL1A 2KZZA 4YK5A 4J90A 4K4XA 3AG1C 4JI5J 3M1VB 1FRHA 3D3CJ 1SC3B 3X1LB 3LF0A 1I5NA 1O5HA 4GYTA 4G7ZF 3O6QA 4DPTA 1ZS6A 3QSYB 1MU2B 2CWXA 5JVHQ 2Y3HA 1C4CA 3OFEA 2R7WA 1RKCA 1DLOB 3BPSP 1V5IB 4Y00A 4NI2B 2HSBA 1S6UA 3VWSA 4B08A 2RRAA 2AP6A 1YJTA 5F9LA 1NCLA 5L1LA 4ECYA 3CJ0A 3WIVA 3NS5A 3CQZA 5KG1A 3HLZA 1WOLA 3U1NA 5L0FA 1OCZC 4ZMMA 4JI2J 3LP1A 4LQ3A 1BQNB 5L38A 2Y8WA 2FIUA 1DZ5A 1VC5A 2BQRA 3VALA 5CYQA 3S90A 2CNOB 1GMVA 3D0GE 4LF2A 1U1LA 2G0CA 2NXJA 3GM2A 4FYXB 3RU0A 4NYPA 1XWLA 3DI6B 2MKKA 2XI2A 2VHGA 2OJ3A 2ZWPA 3HPOA 1BQMB 1N5SA 2NUPB 3JZ0A 1N88A 5THWA 4N06A 4DV5F 4ZP8A 4C3KA 4CS7A 4LFBF 4MW3A 2GQ2A 1FMWA 1I51B 2NXEA 2ZC4A 2N4CA 1KDNA 3NNAA 3ZZOA 5L1KA 1RACB 2RNEA 2H48B 4DUZF 5BYSA 1LWEB 1R89A 2UVVA 4OD4A 2PT0A 1JMTA 1KRPA 5AC5A 1A0BA 4WGYA 4OYMA 1Q8IA 3DOMA 2BX6A 4LMZA 3OL6A 4DX8H 1NK0A 2YVKA 3CCLS 1E6YA 4HTIA 2MQMA 2QTWA 2WOMA 1YA7O 1UJ5A 1IBKF 5HO4A 3AD7C 5B1AC 3KLGB 4HE8D 5ETRA 4EI2A 3VAIA 1NFNA 2WCXA 1GXTA 1LWFA 1YQHA 1HW9A 1AZSA 2FZCB 3ENAA 3AD9C 3M8PA 1WWPA 4KI2A 3NOGA 2ZNYA 2R8GA 1C03A 3KG1A 1Q0DA 4J9RA 2HFIA 4Q2LA 2H5IB 4ZPCA 1H2VZ 3ZZPA 3GIRA 3AQCA 4ZJLA 2XGPA 2KVQE 2Q6BA 2UUIA 4JJGA 3H98A 2W4DA 1BHNA 2V4QA 2FGYA 2D3ZA 3CJQA 4P73A 2FJAB 3G96A 4TXSA 1YJ7A 1VRTB 1IBMF 3Q6NA 2K7JA 4FX5A 4RWWA 1RTZA 1T6IA 1SC6A 3NMKA 4RLEA 4NLOA 3JAMY 1S77D 2NSCA 4KBIA 2C2RA 4EU0A 5IV4A 2QE9A 2ILZA 2CNNB 4MVSA 3BQ0A 2GMHA 5KFQA 5B0GA 4C3LA 3GORA 2W4MA 4DL2A 4CI0B 1R6VA 2XTJP 3AG3C 1RZMA 2BJ7A 4C98A 2C2KB 4OZNA 3HLUA 3AT1B 3BSCA 3SYZA 1T94A 2JEJA 5DS6A 4D3HA 2BDPA 2KH9A 3NMAA 2M8DB 2BANA 4IOAQ 4I3MA 2W2PP 2YX4A 2JJ4D 4J9MA 1TU0B 4X0RA 2E87A 1NDCA 5HAOA 3PO5A 3LLIA 2YH0A 3H2VA 1KONA 1FO1A 3FBEA 4C48A 4HT5A 2EG1A 3WC0A 1UCNA 3RBZA 4G7OF 3DOMB 3EMTA 5ETQA 5D0GA 4WFNQ 4ZN1A 2C3MA 1UG7A 1FWLA 3H0PA 2P9GA 1E6YB 4MK7A 3CF5Q 3LP0A 2A3JA 3M7VA 1L5UA 1PAEX 2K3IA 3PIOQ 4Q8FA 2KO1A 3NGKA 2YNGA 5F41A 4F3MA 2WZ1A 1U02A 3OL9A 3MEGB 3UDEA 3DGPA 3PW0A 1AZSB 2GMJA 3CCWA 1RCPA 1TZ0A 2BJEA 3W3SA 1PSDA 1T11A 2DHAA 4XTTA 4C9DA 4HACA 4G0HA 1V54C 3ABMC 4BPMA 4EWTA 3FUYA 2BQUA 4PFOA 3OEOA 2A6OA 3R7NB 4WTOB 4OINF 2EPKX 1RA6A 5G0RA 3MURP 2XS1A 3IM9A 1ZHYA 3JQMA 3PHTA 4UUXA 1B64A 4I6WA 4I6AA 4M5DA 2J6TA 2DR6A 3R7CA 2V9KA 3ET6A 1U1OA 4EBDA 2KT5A 3TNVA 4X4UA 4ANCA 4OX6A 5B08A 3L8JA 1HMVB 3CTRA 3SSRA 2E9ZA 3DLHA 2MEWA 4ETZA 3GIJA 4F26A 3WODF 2I1RA 5CABA 2ADCA 3PRBA 2CKWA 2J7PD 3RW0A 3WX4A 5FLXU 2J46A 1KHWA 2E7XA 3NYJA 3RFYA 4U8YA 3SEOA 5DDOC 1HKAA 4RJVA 2WSFC 3VM6A 3T9NA 4C7QA 4ZVTB 2IPOB 4HH0A 1KR4A 1K0VA 1LVKA 2WVOA 5F8MA 3R6GB 2CQPA 3TVKA 1FE4A 1DRZA 3D3BJ 3DJNB 5DDPC 2GAQA 1T03A 1XN9A 2BANB 5HBMA 1SV5B 1KEKA 1ZA1B 4LF4J 5B0DA 1YZAA 2DK2A 3AD8C 3ELHA 2ZD9A 4ZLDA 3E2EA 2DGUA 3B6BA 1M2OA 4LF9F 4U9EA 4MJKA 1H0HB 1IBLF 1B0TA 4DV7J 3M4XA 3W61A 1M5HA 4HR2A 2VZ9A 3JSEO 4LBIA 1RBLA 3V2UC 1S57A 2VFVA 4D3GA 3NMJA 4EEYA 2KRRA 2ZXWC 3US6A 1OMSA 3LP0B 1QAIA 2DGSA 4AXJA 1PD1A 3AQBA 2UUAF 2I8BA 2OEVA 1EETA 2GS8A 3DXSX 1FWPA 1QY7A 1UETA 5IXUA 4QU6A 5HV9A 2PSZA 2UXDF 5GAHU 2XY5A 3D6TB 3FKBA 4DR6J 3TAPA 4HACB 2EFQA 3PFOA 1R8HA 1S9GB 2FY8A 3TUIC 4DX7A 4DL4A 1Q82T 3DGVA 1RYSA 3LUYA 1KFSA 1O3UA 5KFDA 2HNDB 3W66A 4CX9A 1ZZFA 4ELUA 3I4HX 4IDKB 3T5JA 4XAKA 1ZOTA 3LAKA 4M5DB 3CMQA 2IYIA 3UE2A 3UPFA 1JB0C 3OXFA 4OZ5A 1CS4B 1B7FA 4V19X 2CZ4A 4I67A 1SH3A 1NHUA 4ED1A 5IFMA 4DN9A 1H3DA 5JT4A 4USKA 3M6UA 3OTEA 3BO4A 3LAYA 3BPDA 3E01A 2MLZA 3LS1A 4PPZA 4CLZA 1HBUA 1ZAWA 1YGYA 4DJ9A 2GNKA 2LIGA 2X1FA 2ACMA 1D9FA 4RPFA 1FKOA 2XZTB 2KJWA 5MAOA 1BR4A 1MNDA 4ILRA 1WOOA 3FGVA 4PR9A 1N5YB 1M1HA 1SCJB 5AJ3J 1LOUA 4KIAA 3AOAA 4PFPA 5DG7A 3MYFA 3QMKA 1FDAA 3ITHB 4DL0C 1T03B 2XGQA 5F8IA 2MY8A 3IQCA 5A2QU 2GO8A 2M70A 3LALA 4P74A 3UI3A 4M5MA 2N82B 3J80U 3IGVA 5DLJA 3C3LA 2JPUA 1S72S 1FRJA 4Y2CA 3I82A 2Z0GA 1IWGA 4ZK7M 3FRYA 1L3UA 4NLGA 3CC7S 1X4CA 3BSAA 1RE1B 3C19A 2CPDA 1JNZB 1HNWJ 1FT8A 3MHYA 1JLAA 4WZQA 4EO6A 2KK1A 1H38A 3DJUB 2W7PA 4K4VA 2JH3A 2ZOFA 1EETB 2MYFA 4H4MA 2VCCA 3OSPA 5ETKA 3CJ4A 1FAPB 1RWPB 1HNVA 1N36F 3M1CB 1TL1B 4WFAQ 3NCPA 1HE9A 2IOQA 4WWSA 4ATNA 1VYIA 4XEVA 2EFVA 1F2GA 2P2CB 1RP5A 1WJ9A 8ATCB 4DQIA 1BZ4A 4ZVRB 1WOSA 4NL5A 3CDUA 4JI6J 3AG4C 2WONB 1RHKB 5D91A 2QGFB 2LXFA 1S6PA 4HI1A 1ZBTA 2IVYA 3DC2A 1U6FA 5KOWA 2HFUA 1FFTC 3G87A 2CVEA 3ZTRA 1UJ6A 3CCJS 2LECA 5E2QA 5HLFA 2M2BA 4OHZA 3ZZYA 3Q8PB 3EZOA 2QFIA 3JYTB 3E01B 4P71A 4LERA 4LRFA 3E3XA 4NZ6A 2M9KA 3ISND 1RU2A 3G71S 1CEZA 5KYUA 2YY3A 2OAUA 1FKOB 1LKXA 4PK4A 3U9JA 3GPAA 2LQGA 4DR7J 2KXHA 2EW9A 2W2MP 4DU7A 2PO4A 4C8LA 5F5FA 4B3OA 3FDSA 3ILJA 2K2PA 1S0VA 1JLCA 5KG7A 2AF6A 2W24A 1IVZA 2RILA 2ZHBA 5JSLA 1FJGF 3O8WA 1LK7A 5KFOA 4K2XA 3TX0A 2YLDA 1CGNA 1UVMA 3MEEA 2OHDA 4ECZA 4DFPA 1RHRB 3EZIA 1RT2B 3MPDA 5HK4A 3HCXA 2QTVA 4DCOB 4WYLA 1VIXA 1BD6A 1S1XA 2HS4A 4M5NA 1X4HA 3NG1A 5BR8F 5CH7B 4JI4J 4ECTA 1HI1A 1OW6A 5L46A 3GR0A 5AC4A 5L3QA 4RNHA 4RZRA 3M9NB 3AGUA 3QGGA 2VG6B 5D15A 2WVDA 2MY7A 2ASYA 1H2UX 4N77A 4K50A 1HNVB 4ZVGA 2MJUA 4WF9Q 2DHGA 2H9ZA 1Q78A 3K1HA 4MIAA 1RWNB 1TMMA 3H90A 3GIMA 2VC9A 3H7HB 1QD1A 3BYRA 2DRBA 1S1VB 2XYGB 1F5CA 3FQKA 4FPRA 4ZVQB 1OQ3A 3AA8A 4O0IA 3Q7LA 1YTYA 1NK9A 2EPOA 4E98A 3NBPB 4FKYA 2KYZA 5GAEI 3OVSA 3KLEA 2F65A 4ES1A 2PI5A 4NXNF 1VQMS 1WF0A 2YX1A 1E86A 3POVA 5C24A 2QUPA 2YKMB 2I38A 3EPGA 2A2DA 2OI2A 2ASRA 3R5DA 2RQCA 3LTOA 1JMWA 2GIQA 1S9EA 2WTFA 2ZXPA 4J9OA 2R7VA 2KL8A 2IJFA 3PCVA 1VBKA 1A7GE 3BF4A 4LVOP 2MQNA 2HFVA 5L3VA 1MN9A 3TQEA 2HQCA 3R5JB 2DH7A 3NGDA 2FHOB 5M2RA 4E0IA 4KGXB 1UVJA 1RJ9A 3P96A 5LMNF 1WEXA 3EQLF 3VVUA 2AZ1A 3G9CA 2YEVA 4KB7A 4XQ1A 4Q5VA 2GV1A 1HWJA 2YNFA 3LEOA 5L8RC 3IRXA 4ICLB 3M79A 3GYGA 5KG3A 2IM0A 1FTSA 1OW7A 2R2TA 3VAHA 2ZVIA 5H9FJ 3PACA 2F8MA 2D1CA 1S1TA 2ZH5A 4ZCIA 2M0GB 4PG7A 4F4AA 2RQ4A 2KT2A 2L08A 3WHNA 5LSRA 3MEEB 2B0GA 1JJCB 4TQSA 4B3TF 2KG1A 2IXPA 2CA9A 2HEKA 2Y0SD 4Y28C 1R8CA 4UOFA 1GXUA 1TFOB 3GFYA 2HIYA 1Q7LB 3KUEA 4KNWA 5A6BD 2HK3A 8AT1B 4Y3CA 1S1XB 2OKQA 1XMOJ 3KMIA 1R8BA 1IJFB 4DR2J 4LT6A 4DL7A 1Y5LB 1RKIA 4F3OA 4N7TA 1VOMA 4PG6A 3OV7A 1NJXA 2E9RX 4ANDA 3BM7A 3NS6A 3EG9A 1AB8A 1SXLA 1H9TA 2EI5A 4TN2A 1UFBA 4OD5A 3LO3A 2JC0A 4NZ0A 4AL6A 1BGXT 2KYXA 3S84A 2HGNA 4N8OA 1NRKA 4PZVA 2MQPA 3Q24A 1C0UB 2DGXA 2V8VA 4Y0FA 2F4VJ 3R7BB 1FTRA 3G8TA 1Z2LA 4DQSA 2Y1RI 2VPWB 2KDOA 3JTOA 4JTCB 2NUHA 2X3GA 3NLCA 3NRBA 4W8KA 3FMBA 2F8HA 3M32A 2AD9A 2L6FA 4YB7A 4IRUA 2LQ5A 1WKKA 3KLEB 1NSGB 2BMBA 5JUMA 2QLXA 3OR2A 4KHRA 2BJ9A 5C24B 2X0CA 3D66A 2GMLA 4O79A 3TEHB 3KLHA 5HP1A 1H72C 4JYAJ 4YN3B 1FRMA 4N47A 1IKVA 1Q8LA 1KS2A 1S9EB 4BJ6C 4NCGA 3U9MA 4OIOF 5L9XA 2JD3A 1KP6A 4O23A 1X4FA 3D1HA 1I5OB 4B3MJ 3A8IA 2BE5F 3PJXA 1RJ9B 1TELA 2VOPA 2CPZA 5D77A 3HJFA 1PKUA 2Q43A 4GVLA 4ID5A 3MD1A 3V4IB 3R1HA 4MK9A 2DEIA 4LRDA 2NYHA 1U09A 3T1YJ 3Q89A 1NXIA 3RGIA 2DB4A 4ZKAA 2XL8A 2VFUA 3DHWC 4DQQA 1LK5A 3Q7GA 4AFFA 3OR1A 3IRXB 3EDQB 2E1CA 1RAAB 2KKHA 4LLCA 4Q45A 4LF7J 3EDRB 2BW7A 1YA9A 3KLFA 1T01A 2EIJC 1S1TB 5H9FK 3SBMA 1LI5A 5DRKA 2V8DA 1VQKS 2PP4A 1RI7A 3AJ2A 4NA3A 1LFPA 3VF0B 1T5OA 1S97A 3S6EA 4ZCMA 4U5FE 5FJ4A 2YKOA 4YY3F 5AXLA 4QWDA 1VK5A 2FVCA 4K59A 256BA 1QPUA 2VV5A 4KGZB 4L6RA 2AJQA 3NWRA 3TR5A 4B3SF 2J8WA 1SKUB 3RTVA 3TZXA 4K5RA 4CM2A 2OQMA 4PWUA 4JTAB 3TYTA 2FGCA 4PXBA 2EKNA 3J06A 1NO8A 1L3KA 1J5OA 4KRWA 4IAQA 3EYZA 1N33J 2E1AA 2VU5A 3HFZB 4OYAA 1U1RA 4DV3F 1VGYA 2I6WA 5EN1A 1SL0A 4DF4A 2NSFA 4K4TA 1VRUA 4G6VB 2H7OA 3HHLD 3KYLA 2A6HF 3G6YA 4WZMA 1S4FA 2HHWA 2HAIA 2DGWA 2WHOA 3MM6B 3CDEA 3V6KA 1B70B 3VCDA 1R43A 3WHIA 4PR6A 1D09B 3ZZZA 4K2JA 4RW7A 2V4RA 3PW5A 2E7WA 4F36A 1R31A 3E9VA 4CDAA 2OTLS 3KLHB 5HP1B 2J9CA 4HL9A 2JOQA 4KGMA 2IBKA 2IA0A 1KWMA 3U8PA 3SXMA 4XLPF 2F3JA 1T3OA 2VPZB 4FPIA 1VQ8S 1G6BA 5C7PA 2XSJA 4RBNA 4MIWA 2FHKA 2F22A 3ZXWA 2ZDPA 4Z7YA 1URRA 1AUEA 4YB6A 1EARA 2D69A 4LFAJ 4ID5B 4O44A 3K66A 1N0VC 3LUTB 2LLZA 5KT5A 4JV2A 2PMZD 3I32A 2B9XA 4IJJA 4CS9C 2VPYB 2E1PA 4Q44A 4J32B 1KC8T 1B4SA 2ZE2B 2QG9B 2CQIA 2MTLA 2DTJA 3NNCA 1IJEB 4DV4J 3K57A 1SKRA 5B0FA 1TKXA 2RU3A 2FC8A 2NYIA 4BCAA 1YJVA 4DPWA 2UXCJ 1TQLA 1NK5A 1SQFA 4XDCA 2N3OA 3GWCA 3TUZC 4XEFA 3SFUA 5COFA 4UOGA 3BH7B 3MCSA 4GKJF 3BYPA 2RE1A 3UMKA 2FLLA 2P9CA 2FAPB 1YZCA 5JLIA 2IM8A 3Q2SC 3FMWA 3PRDA 3GILA 3SMZA 2VKZG 1OSCA 3DYAB 4TYBA 1QAYA 3QT7A 1EI7A 3PYEA 2FB0A 1EHWA 4DQPA 1QVXA 4JI7J 1Y4CA 2J9DA 4ZLCA 4OZ1A 2LEBA 2IXOA 1Q8KA 1J5OB 2C3PA 1I3OB 2L81A 2CG8A 4FF4A 4OI4A 3HNIA 3HHDA 3JRTA 2A0BA 2A18A 3ZC4A 4R5PA 4Q8EA 1VRUB 2XY7A 3EX7B 4OHYA 2W01A 2LCHA 2J8SA 7FD1A 3ILOA 2WZLA 1JJ2R 4MMOA 2AEFA 1N54B 2RSQA 3R2PA 2HMQA 3FBBA 1ZM4A 1PYSB 5HQ8A 4OX7A 1TTHB 2VFTA 1QM9A 1VQNS 1PV3A 1T9XA 2B3TB 3QGHA 4DV1F 2YKZA 2CPJA 2V2VA 1V3ZA 2BE2A 2P1AA 3TOMA 1WTFA 5A0YB 3CCVS 3VAFA 3HTKC 3EPIA 2DNZA 2KM8B 3KHGA 3BZQA 2HHHJ 2AYEA 4A8MP 3MXHP 4QI2A 1QTNB 3C18A 3RW7A 3OTOF 2CJKA 1PD0A 2ZBQA 4HFKB 2RF2A 3BN4A 1IBCB 2F8EX 4NLXA 2YWAA 3FZBA 3FAPB 4A8FA 2KYHA 3MUVP 4OYOA 1QZXA 1VQSA 5KTQA 2F40A 1R0BG 3AFGA 1UJ4A 3ILLA 1MMNA 4J9UE 2RDDA 1NPRA 1RAEB 2VDHA 2XHWA 2OJED 4UQTA 1T6UA 3V7OA 4PYAA 4EBCA 5T7LA 4YL1A 2BKPA 1K1SA 4L74A 3L0IA 3MYIA 4URQU 2Y1LB 5K20B 7FDRA 1TR0A 2OEXA 2K8GA 1T9KA 2GFFA 2RHQB 4DVZA 1NAQA 5KFSA 2M88A 1U45A 1HI0P 2OKUA 1LIHA 3OFHA 3MFNA 2PD1A 2OD6A 1XIQA 3C46A 1JIHA 2FVQA 2CJYB 4K1OA 2AJFE 3PZPA 4URGA 1SYQA 3QT6A 4YB5A 3KTQA 1FESA 4E7SA 5D3GA 3TVYA 2A0UA 1Z7Qc 3GB0A 3FCHA 3EWGA 3KKFA 2FGOA 2E1MC 3B0UX 4CLWA 3VAMA 3VGSA 4YL3A 2PX0A 1NH7A 4NA2A 3IWLA 4JCZA 4I68A 1TKZA 1N4LA 1RWXB 3ADAC 2DRAA 4RNFA 2EPIA 2DGVA 2HHPA 2ACYA 3NGRA 4R5PB 2ZWOA 4KY3A 2VQFF 4HHJA 3GM1A 2OPRA 4P9TA 4K4WA 4LF5F 1LPEA 1P1LA 2V8HA 2ZDOA 2W4PA 3BBCA 1ZAVA 4ZPVR 1YJWS 1XEZA 3GMGA 3QZCA 1AROP 4ILLA 2C2DA 2CPXA 4IWBA 2N7CA 3MEDA 2ABYA 3CW2C 2C2NA 2ZZNA 2J9WA 2O01C 1R0AB 1KD1T 2UVUA 3W4YA 1HR0J 2XMTA 3UVJB 5L39A 1FFSB 4F2SA 1OKKD 3FFIA 4WBFA 4CO1A 4NLVA 1WNEA 2X7IA 3CJRA 3ENVA 3DD7A 4YHHJ 2LU1A 2RF2B 3HJCA 1O87A 4ED4A 3ZZ0A 5DS7A 3P8BB 2OH2A 1Y0HA 1GFWB 5L0HA 4DPYA 1Z23A 4JI0F 4PJMA 2XULA 2QO3A 4KGVB 3EE3A 3IAS9 3GCXP 1IW7F 4MNDA 2HURA 2OD4A 3Q22A 5IT0A 2DR5A 2FC9A 5T7LB 4LF6F 4DV2F 2G1DA 4ED3A 1UZHA 2NG1A 1NB7A 1Z5ZA 4MTFA 4WGZA 4PABA 2DNGA 4B6IA 3TANA 4M8LA 2XM3A 4CO0A 1NB2A 3ULHA 1U2FA 4W8PA 2VF3A 1HQUA 4NLWA 2XEXA 2VA2A 4B9UA 3V6DA 2FYXA 2XY6A 3C7JA 1ITPA 5D3GB 2AU5A 4CLUA 1GGQA 1OJ4A 5LOQA 3L1MA 4GMKA 1BMQB 5KFBA 2YPYA 3V5ZA 1DQ9A 2HWIA 3R5GA 1YLMA 4LF8J 2PEHA 1QLEC 2V2ZA 5D92A 3W5ZA 5DM6Q 5CAAA 3FQLA 2DNYA 4JV0A 4WE1A 3DXBA 3KK2A 3I87A 4JI3F 4ECUA 4N76A 3D5MA 3QATA 4NLDA 3MBGA 4UT4A 2OPRB 1SZIA 4YN0B 1ZPWX 2Q4FA 4K5SA 3D2WA 2MKCA 1X7VA 3PDMP 3QZ7A 1DTQA 3L09A 3TUPA 1G7CB 3MFHA 3CCUS 4FBUA 2AYGA 3CPWR 4MAKA 1NH8A 1PC4A 4ES3A 3FAJA 2PI4A 4CS8C 3MEDB 3DN9A 1EQ0A 3A3NB 4IB4A 3GM3A 4IYQA 1TWHA 3EM1A 4A8YA 4MFBA 3TO8A 2CWKA 2LVWA 5JVEA 4YQWA 1EJ7L 5JVGQ 1J5EF 4GKKJ 2KI2A 1T9WA 1FR0A 3FFIB 5A6AA 5GMEA 2L9WA 5SZTA 2HFNA 4RW8B 1CLFA 4ZDNA 4IRKA 1S12A 3CCSS 3KUGA 3RRGA 3EJNA 4TLRA 1ICEB 3PG9A 3GYNA 3SXKA 4DV0J 3POTA 5J2MA 3NS7B 4W4MA 2M4EA 2VC0A 2YNHB 3DM2A 5CA5A 5J1PA 2F4VF 2FVPA 4HEAJ 1RJJA 4C8NA 1PBUA 3IRWP 4LBHA 4LRCA 1YRXA 1CG2A 4X66J 3KNGA 1LW0B 4I64A 2UV8A 3ZQYA 1KVIA 3OFFA 3QQCD 4DR3F 1RLCL 2CFXA 1UTAA 5E41A 4V19J 4Q4ZF 2OP5A 1W26A 4OX9F 5F8NA 1PYTA 2DCLA 2HQIA 2C3YA 1ZHWA 1U25A 2DITA 1HW8A 1RAGB 4IRCA 3V6DB 2LQJA 4F02A 1T0TV 2ZJPQ 4HKQA 4A8KA 5IY5C 4CIOA 3ZQVA 2QL9B 4AQYJ 1RUSA 2HKEA 3OHBA 5COMA 2MDAA 3DLGA 5K14A 4O4GA 4N6CA 1FKAF 4KYZA 4B3MF 2LEPA 2R7SA 4WIQA 2Q7RA 3PIPQ 2LK4A 2D5RB 4L73A 3UCZP 3EUNA 4WE1B 1N8RT 1S59A 2VG7A 1KNYA 3KK2B 2OMOA 4DV5J 1SL1A 4KNVA 2RRBA 4LFBJ 3V6JA 3VAYA 5BYQA 3OHAA 2CDQA 5A8KA 1TWCA 4ER9A 1YZ6A 3H65A 1DTQB 1MMGA 1TK5A 3GV7B 1OR2A 4DUZJ 3LPEA 5D0HA 3J7ZT 4CH1A 5TJ5E 1HWIA 3LPYA 1XMBA 4HVZA 3MOJB 3PX0A 2NSBA 4LBPA 4JI1F 2XQCA 1Y5NB 1FE0A 4DRIB 3C6UB 5J2PA 2Y0BB 2CPEA 2Z2YB 2G1HA 4ZLPA 1JX4A 3MECB 1TL7B 1RWMB 2XLJA 1SF8A 3FMSA 3M8QB 4QW9A 4FWVA 5BUOA 3DWWA 4WJBA 2CQDA 3ZVRA 1IBKJ 2HUJA 4BJ6A 4QIFA 2VFSA 2L6HA 4NZ7A 1NPKA 3O1LA 1F60B 2PN6A 3E51A 2BEFA 4DG1A 3OA1A 5J2MB 3KKBA 4I1OB 3F73A 2YWWA 3DM2B 4QU7A 4B9VA 1TQGA 1VLOA 4CT8A 2XM0A 1MNEA 3UNYA 3A8EA 1IQTA 3KK1A 4O6NA 1R5ID 5DS4A 4X4VA 1U49A 2ERRA 1S6QB 4FVMA 4DRHB 4QYZJ 3M15A 4F3QA 2PA3A 1CVJA 2ATLA 1UKUA 2I5JA 4EYHB 1P9YA 4DCJB 3B54A 5LT5A 4W98A 3A8JA 3D6MB 1SPBP 1ZU4A 2HFOA 2A1BA 1S7ZA 2DNNA 3HDSA 1PYOB 1IKWA 2AX1A 3N28A 5KFIA 1MSWD 2HW3A 2XI3A 5DZ6A 1L3TA 5ETTA 2P6SA 5K14B 4O4GB 4KPCA 1UVIA 1LW2B 3W65A 4I2PA 1UA0A 2PMHA 2V63A 4Z2XA 2DH9A 3MM9A 2ZC3A 3MF5A 2BE9B 4N41A 2EIKC 1FDDA 2WW8A 2VG7B 3FVYA 1Y9OA 1P8GA 3U3FA 2NS1B 2ZEJA 4MKBA 5C5JA 1DQ8A 1CSJA 3FBCA 5GMDA 1YARO 1LKZA 3W63A 4TQRA 3K6BA 3KHRA 2WK4A 2HAFA 2W45A 1EKSA 2IRUA 4F0MA 4LSNA 5C25A 4Q2MA 4NRTA 1A6LA 3O55A 4MKYA 2GAGC 1AT1B 4DZDA 2ROPA 1UPPA 3G6VA 3CUNA 3QAUA 4B9NA 2UUTA 3QPIA 2FPHX 2XMWA 1E6VA 1MROA 1NK7A 3A12A 2VIHA 2GVZA 2CQ1A 4JI7F 1VLYA 3Q8YA 1RADB 2JVOA 2N4DA 2IC3A 1M5VC 4JUZA 5DQIA 2H65B 2C3OA 3CJKA 1WI8A 4DSLA 2UXBF 2MHNA 5CI9A 3AA9A 2JLFA 1VISA 5KFHA 4HT7A 2HJMA 5HMWA 3HT0A 3RG6A 3N6NA 2R9LA 1I94F 2D9PA 2A0FB 4FF3A 4PG5A 2GHPA 2E5LF 3AODA 4CS9A 3W64A 5BJRA 1BR2A 5KYWA 1SIZA 1YAUO 3JQJA 2GHVC 2CCYA 2XNRA 4QYZK 3A13A 4A48A 2UV8G 4OI2A 4KH1B 4OYZA 2XLHA 3OBIA 2B8PA 2I5JB 4U9RA 5IQQA 3DFEA 1RBOB 4XEKA 3FRZA 2B7CB 3GR1A 1L3VA 3K8WA 3OPKA 3RAQA 3H2UA 1VC6A 1SC4B 1U0SA 4KE5A 1LI7A 4I7FB 5AXKA 2ZNZA 5CHCB 3IP0A 1FF2A 3JTLO 2R7XA 2HHHF 1HBMA 4NWBA 4ONSA 4ENOA 3W8IA 1ZU5A 4WP8A 4R8UA 1FERA 3IR6B 4HI2A 4OIQF 4NY3A 4PWWA 4ZCLA 3PKMA 1N32F 5I3UA 3EH1A 3L9ZA 5B3IA 3RBDA 4XTKA 5B0CA 1YI2S 1XR6A 3GONA 1C1BA 4IH7A 5CQGA 3RH3A 3LANA 1T05A 2AW0A 3EZUA 1VK8A 1FD2A 2W25A 1VQ7S 2CNLB 2HZCA 2L41A 2GWWA 3M30A 2GJFA 4U8VA 4JV1A 4CIPA 2GC8A 3M2RA 4I0WA 4OHVA 1X9WA 2VBZA 5EWEA 2YWGA 1DBDA 1IBLJ 4WYWA 4IG3B 4WXOA 4IRDA 3NGUA 1U24A 2MGZA 2DJWA 1U1PA 3MAAA 4C97A 5KFPA 2LA4A 5DG9A 3JYYA 1E6VB 4DX6A 3KMQA 1MROB 2EVZA 2AVKA 2UUAJ 4H4OA 5EGYA 1D0ZA 3SQGB 5K0IA 2IC3B 3BQ2A 3LWLA 3GSDA 3BSNA 4FS1A 1X5PA 3QLHA 1CPQA 5D4OA 2NQPA 1TMJA 3SFGA 2UXDJ 4ZJOA 4ZA1A 1JXLA 1HWLA 3O2IA 1WG5A 1CJKA 3CJKB 1NBBA 3UR3C 4CSAC 2XS7A 3MUMP 3LGMA 2HMIB 4Y2IA 2DXFA 2MKIA 2HJ3A 2GGPB 3I9ZA 3SCJE 1RISA 3BDEA 1A9NB 3P3DA 1I4ZA 1WDDA 4I44A 4OI3A 1P6TA 1NUEA 1M5SA 2DIUA 1OCCC 3I55S 5IT9Y 2HNYB 3Q8RB 4ITSA 3R2CJ 4MS2A 2PMWA 4HH1A 1AEPA 4X62F 1V3RA 2W9YA 2CQCA 2WB4A 2CQ0A 2OSQA 4U67Q 2ZKUA 2I2YA 2DGOA 1M57C 4GO5X 3DDIA 1ORSC 1MW7A 2JX2A 4I56A 4DRJB 3QJLA 1UFLA 2VB6A 3KWMA 4YDDB 2X51A 2EWHA 2GA7A 2AIRB 2OFHX 5EX3A 4U95A 4CO2A 4YHHF 1SJFA 5A6PA 2DGJA 1PILA 3KUHA 1YVFA 2AJ4A 2KHCA 3S27A 1YK9A 2VKRA 1SJQA 5I3UB 4DSFA 2QLJB 3QIPA 1NMEB 1RTIA 4XIUA 1WC4A 4FP9A 3TUJC 3MOZA 1C1BB 2SXLA 2QA2A 1NK6A 4L72B 2V34A 4OYIA 2EK1A 2PFDA 2CZ9A 1F1BB 3S0XA 4M1KA 4MK8A 5F28E 5HROA 3M30B 5D0EA 1HQEB 3E70C 4USUA 1WHYA 4DSJA 1OY6A 4DXLA 1FFGB 2NXNA 4OYBA 3ASNC 4YR0A 4DXWA 1N56A 3ZWIA 4GVBA 5E33A 3MAAB 2IVMA 1X4BA 3HULA 2XZWA 2EFNA 1HNIA 3IG1A 1X31C 5K9FA 3PW7A 4LRBA 4MVOA 4R0EA 1EQMA 3CWJA 2XCAA 5LL6d 4J30B 5KG4A 2VQEF 3QLHB 1N36J 3RQFA 3PW4A 1JPNA 1WF2A 5CI8A 3ATPA 1CJKB 1VB5A 3FHDA 1WELA 4EO8A 2LMIA 1SH0A 2IAJA 2UU9F 2XNQA 2ZZTA 4C8KA 3DCAA 2N3LA 4UUWA 1NK8A 4A47A 4BJTA 4LREA 4E17A 4I1MA 2G2OA 2H4WB 5A6KA 2V67A 3OL7A 1OCRC 1KFDA 1ZTTA 4F4WA 1M5OC 3SNHA 1UVLA 3QT5A 3QRQA 2CNWD 3K5LA 2WZFA 1VQ9S 2O3DA 1ZZNA 4B9LA 3NDBB 3B0PA 4IO9Q 3BN7A 4CDYA 3KJVB 2FLPA 3RW6A 2YLGA 3EZHA 1XMQF 2XLMA 2AU0A 1KN6A 4KJIA 4IO1A 1BWVA 3GFXA 1OIAA 2B8QA 4NLYA 3TZWA 3WBZA 3MAQA 4K8RA 1Y10A 1TUVA 1MWZA 3PCOB 3D54A 4LLEA 3IQ5A 3U0CA 1N5TA 3H59A 4JEAA 3W7BA 1GNKA 3KK3A 2QE5A 3J7AN 2HVEA 4HHHA 3HNLA 3KNAA 2XLVA 3RQGA 2B7BB 3C16A 3WG7C 1RT5B 1RTIB 1J8MF 4MTGA 2BC5A 1K9MT 1AFIA 3ASOC 4CH0S 1FJGJ 3G82A 1OY9A 2VJUA 4DFMA 2GVDB 3TA0A 4MIBA 2DH8A 1JOGA 5IV3A 4X66F 3MM7B 2N7YA 1TV6B 1S49A 4V1Ak 4Z9HA 5BQGA 4TU8A 3VGTA 5HROB 5ETLA 4P75A 3VQTA 2XMJA 2ZBRA 2CQBA 4ECQA 2J9UA 5AE3A 5CYJA 3TK0A 5BR8J 4ZITA 2AEJA 4CS8A 4ZVEA 2HHQA 4IOCQ 5HSPA 3ISNC 4GVBB 3J81U 4CLTA 2OOCA 2CPIA 2L9NA 3F56A 1HNIB 3IG1B 1OO0B 2Y3BA 3GWLA 4AQYF 5IC4B 2YL0A 1TFWA 4RNOA 4J9KA 1V5VA 3LS0A 1CJVA 4ZN3A 2WVBA 2Q3TA 3BV8A 3L8IA 2V94A 5CZXA 2KTQA 4GO7X 1V6HA 2L3MA 2JFDA 3A4TA 1CC7A 4LR9A 2W9BA 4KSEB 3MTJA 1C0TA 2AJ1A 5JRAA 5KFXA 3P5TL 2M3DA 2IAJB 1QTMA 4G3IA 2HQFA 1JK9B 3QRPA 4IKAA 3VAGA 4B9MA 3EVMA 3D1OA 2F4FA 5IM0A 3K5OA 1KLMB 4QQBA 2MQQA 3HM9A 4USTA 2IIHA 4NXNJ 2R2SA 5F0WA 4M94A 2V9WA 3IR5B 4CLKA 2E1RA 2CPYA 3CAXA 1BDJB 5KG0A 3HHEA 4JW1A 4XPWA 2ZD1A 3QWUA 5EHHA 2M7SA 3K5PA 3EXYA 1YJNS 3L3CA 2NZCA 3C66A 1U1NA 1UWAA 3X2QC 1GM5A 4J9VA 1WDTA 3AB2B 1YDIA 1D0YA 3FEYB 4DN0A 4KC5A 2JFKA 4ER8A 3GQCA 2XLIA 3UCUP 5F8LA 5F8JA 1TL3A 3V5YA 2FHJD 1JLFA 2E9TA 4NEYA 5LMNJ 3KK3B 4QWAA 4G1PA 2HBZB 1J27A 4E8UA 1PGZA 2DHSA 3DLLQ 2B4OA 3DRRA 1TL4A 1ZTWA 3S28A 1NSPA 3C16B 2AGPA 1T95A 3G6XA 1YYJA 3NAHA 5DDRC 1RQ0A 5SUHA 4PQAA 1TUWA 5LJ5Y 2G9OA 2DT9A 2APOA 2FTRA 3PYFA 4F4KA 2DNLA 3VV2B 3G82B 3G4SS 4PAAA 5FIIA 3M6XA 4BWJA 1KQFB 1YZ7A 3BBBA 4AT1B 2BKOA 3DMDA 1I6JA 2JLEA 4B3TJ 5KYYA 2PBEA 2XMKA 1Q0MA 3G8SA 1CGME 3KJNB 2CQ4A 2W7AA 3PJWA 4YT5A 2YPZA 4BC9A 2IYLD 3GEHA 4UQGA 1RTJA 3H20A 3DXJF 2Y3YA 2YXLA 3NP5A 3ZTPA 4CJOA 1QSSA 4K7BA 3LP1B 1OQCA 4LACB 1FVSA 4ZPTR 3MCNA 5CYQB 4FYYB 4NASA 4P72A 3HVWA 3U2MA 1GMUA 1KSPA 1MMAA 3R7SB 2BL2A 5A8WA 4YMEA 3UGOA 1WC0A 4Z9IA 3GFHA 1C1CA 1RDRA 3MM5A 3QYYA 1HW1A 1CJVB 2RDIA 4ZHRA 4LSLA 7AT1B 2GQCA 3K5MA 3P45B 4ZP7A 2QZ8A 3DKDA 3IS9A 3EJMA 2MJNA 4F4YA 2ZOGA 4KH0B 3LJBA 2VUGA 1VFJA 2J0QD 1Q86T 4X84A 5DZ7A 3QRRA 5IWAF 1IQZA 3GFZA 1NJYA 1D8YA 3RUBL 5T3TA 2RSEB 3B82A 1QVGR 4MVMA 1U8WA 4MVQA 2R7TA 3ICLA 3UMHA 2NPUA 2AGQA 3T9ZA 5K8NA 3KL4A 3EGZA 3SV4A 1Q1KA 1QSPA 3NEKA 4FS2A 2MKJA 3IPMO 4Y34A 4ZVPB 2J9VA 3NYLA 2GJIA 3PFEA 3BH6B 4C3DA 3DRXA 1M56C 5KFVA 3TA1A 2JC1A 3CXCR 5J1EA 2WL8A 4RBUA 2DNQA 1G4CA 4MQ9F 9RUBA 2CUYA 4FESA 3ZNJ1 2KHDA 1YLXA 3PMRA 2CPFA 2WOMB 1IM4A 2MZQA 1YSJA 4RW4A 1TL3B 1NJZA 4TU7A 2QLWA 2WB1D 1JLFB 3GYXB 4ZLLA 3PR4A 4FKXA 2WVNA 4RW6A 1JKHA 3BB5A 2V0NA 3IM8A 1NZ8A 1LWFB 2RDJA 1WSVA 1NG1A 1DTTA 1VLTA 1N34J 2R8HA 2RQKA 3M8PB 1TAUA 4ILMA 3M4BA 2YL1A 3TW0A 3T5KA 3PHF2 3T4RA 3HVAA 3I5CA 3Q0AA 1JJHA 2WVCA 4K4YA 5KYYB 4HTJA 4IH5A 1T6QA 3H4BA 4JJFA 2MHRA 3BKUA 3W2WA 2ZPAA 1M5KC 4YY3J 4MT1A 3W5XA 3RVZA 2OLWA 2B9EA 2U2FA 3MR6A 4B3SJ 1RTJB 3R1LA 2Q9CA 3U5SA 1FDBA 2XLKA 3EGNA 4M5JA 2DKOB 3CC4S 4AL7A 4P6QA 4NLSA 4DVYP 3TVZA 1VI7A 4UTGA 4X4TA 5LMUF 3A1YG 3EXCX 5A8WB 4QBUA 4NMLA 1RMVA 1C1CB 4RUAA 3MM5B 3CC2S 3J7A1 4DV3J 4A8XA 4MYUA 2YKQA 2EILC 2C28A 4MVUA 4LR7A 2BRKA 2HGLA 3RJMB 2CJBA 3IS9B 2JEGA 2OJQA 1BBHA 2CPHA 3I5QA 3TAMA 4LF1A 1Q8BA 1WC6A 5EK0A 1JLBA 2R2UA 3M8WA 3I5PA 5IT4A 2BJDA 4ULWA 1RABB 4X4QA 1PCXA 4YFUA 3FZ2A 3B71A 4FN5A 3DZAA 3VTIA 3SQOP 4DPOA 1T9TA 4XPXA 4F2RA 1DY3A 5CCLA 2C22A 4F04B 4A4AA 4XPYA 2QA1A 3HKZD 2LDIA 3DI5A 3H4DA 4RBVA 5IOLA 3T5HA 3N01A 3NCRA 2M5YA 4U7UK 5J1EB 4ETXA 3C8GD 4N5SA 2KJVA 5ETPA 1TKNA 2HKVA 4WKYA 4QW8A 2NPFA 1WTYA 4RW4B 5KFTA 1HLWA 3CCMS 4KR0B 3M05A 2FJVA 2YNGB 5MLCV 4RW6B 4TY8A 3C63A 3DGPB 3HKWA 3HHLC 3RR8A 5FZTA 1R6YA 4J9LA 3C62A 1H7IA 3GWNA 4LRAA 4JV5F 2GQQA 1C4AA 3D6HB 4CQ1A 1U48A 3MMCA 3R97A 4KT0C 3HXMA 4UY85 4C8ZA 4JI8F 3RQEA 5G0RB 4KO0A 1X0PA 4TYAA 3W2WB 2HVHA 3H5SA 1F1MA 4GKJJ 1CJTA 1R4TA 2YQYA 2KFNA 4EWCA 4OI0A 2HSEB 2OFGX 3G8QA 5DJBA 3ET6B 2W7OA 2HSQA 1NSQA 5DG8A 1CQMA 3GJRB 3AJ1A 2HLUA 3CDWA 2FZGB 4YJWA 4Z37A 1D1UA 3BGUA 4KPYA 3QGPA 2LFDA 1S1UA 1NDPA 4OX8A 5ETNA 1CC8A 3IFEA 4ZPWR 5FDLA 1NDKA 1Z3IX 4BHQA 2XHCA 4IGGA 1ST6A 5HL7Q 3CEDA 4ZLNA 2B51A 1UWBA 5LSOA 5A69A 3IBWA 3TAMB 5A76A 1XNQF 3SSSA 2MLXA 3GODA 2D3UA 3TA2A 1TFYA 3IA0A 1JLBB 4MVRA 4CSAA 4DR5J 4G1IA 1V55C 1VLSA 3FDQA 3GV5B 5HBMB 4J37A 2A6MA 4DV1J 3DRSA 2CJXB 3IC1A 1RTDA 1X5TA 1VHFA 2IRXA 5ETOA 2Q3PA 1F6TA 3AH6A 1R8PA 5DQGA 4ECVA 1Y6DA 3K5NA 3H2LA 5E7OB 2AP3A 1NKBA 1WG1A 3GV8B 2C3UA 1Q4RA 5JMNA 1QSYA 3OTOJ 3CCTA 1JPJA 4U5GA 1S1WA 2NZ4A 2RH3A 1YJ9S 1OPIA 3U02A 3JS9A 3QW1A 3UN3A 3CD6S 1B99A 4OV6A 1N6QA 2DYRC 1F2HA 3W9IA 4MTPA 2QLBB 4G1QA 4FDFA 4B17A 5HMXA 4M63A 3T3FA 3M8ZA 1EB0A 3MMCB 3SSQA 1R7IA 2WB7A 1RT1A 1OR3A 5HVGA 5KFJA 1ACMB 2D4UA 2RMLA 2YRFA 4KO0B 2RAQA 4EGLA 1CJTB 5B0AA 2CQHA 1S4EA 4KBLA 4DR1F 2AYBA 1K40A 4F7VA 3HHNB 3HD1A 2YWKA 2COLA 5D4PA 4NOHA 5DQTA 3RAXA 1F9FA 2K06A 3IQTA 1NJWA 3KMSA 3GE9A 3SCKE 3ZZRA 4FYWB 4EUVA 3MM8A 2P9EA 4RUBA 5EWFA 2RRNA 1DARA 1MWYA 4JP8A 3AAWB 1QKRA 1FDNA 1HBUB 3L34A 2EG2A 3MMAA 3OUYA 1S1UB 2JLGA 2XYHB 3IXQA 4DQRA 2ETSA 2AT1B 1GT8A 5IZHA 2PC6A 1F5AA 3D68A 5FDLB 3CEXA 2DNPA 4DWIA 2H7BA 3M2UA 5ITHA 5C2GA 2VQFJ 4WFZA 4LF5J 1Q5YA 3JSYA 1KQSR 3I0RA 2RQMA 2VL1A 3PO4A 1Q53A 4PUOA 4J7TA 3JAMU 1G2EA 2DY9A 4NQFA 5KT7A 3CDAA 4I2QA 1O6XA 5DO2A 2NCKL 4DX5A 5KYXA 2Y3DA 2R8KA 2CG4A 4R25A 1GMWA 3W62A 3S8SA 5B1BC 3GJQB 3IBCB 3A3PB 4OZJA 1RTDB 1GXLA 3OJSA 2P8IA 3ETOA 2QA4G 3H8YA 4OLPA 1JAFA 4D4NA 2DCUB 4CNZA 1ELOA 4DCPB
chains in the Genus database with same CATH topology
3LP0A 1X0FA 2A3JA 2R8JA 5KFLA 1L5UA 3OHBA 3DLGA 2MDAA 2K3IA 5K14A 4O4GA 3PIOQ 4Q8FA 4IAOA 1FKAF 1JLAB 5AXNA 3IR7B 2JRSA 2C42A 2KO1A 1HBMB 3NGKA 2YNGA 4LQ9A 4USJC 2J5AA 5F41A 4F3MA 1FJ7A 4B3MF 3US5A 2XWXA 3OL9A 2FVSA 3MEGB 2LEPA 3DGPA 2R7SA 5GMKa 3HVTB 4CH7A 3PIPQ 3PW0A 2MB0B 2D41A 3PNIA 2GMJA 3CCWA 4R8UB 2ZHOA 4XPCA 4H4MB 2GO9A 2D5RB 5GAGU 1TZ0A 3UCZP 2BJEA 3EUNA 4WE1B 3W3SA 1PSDA 2VPXB 3M1VA 3M2VA 5KG2A 2VG7A 1N8RT 3KK2B 2OMOA 2DHAA 1SL1A 4KNVA 4C9DA 4G0HA 1V54C 2RRBA 4O3OA 2OPPA 5AJ3F 3ABMC 3V6JA 3VAYA 2EFOA 5BYQA 1MU2A 3CT9A 1LWCA 3OHAA 1JLQA 2CDQA 2E66A 5D4LA 4NYOA 4EWTA 2GFHA 4PJNA 5A8KA 2BQUA 5KG6A 1DLOA 4PFOA 1N5QA 3OEOA 1TWCA 4A8OA 4OLOA 2WSCC 3LP2A 1TR2A 5L9NA 3R27A 3H65A 5JXSA 4OINF 1DTQB 5A8RB 2HNZB 1RA6A 1MMGA 5G0RA 3MURP 1TK5A 4C0HA 2ZVSA 3GV7B 1TL5A 1ZHYA 3D28A 4UUXA 2UUWA 4I6WA 1B64A 3MR5A 3J7ZT 4X4RA 4OI6A 5DETA 4CH1A 3KHHA 4I6AA 1HWIA 4WIIA 3LPYA 1S6PB 4M5DA 1GTEA 3ONQA 1XMBA 4ZVHA 1R27B 4A46A 4HVZA 1R0AA 5E5NA 5FLXY 3CCQS 1W25A 1T05B 2J6TA 3MOJB 1KTVA 3PX0A 3RB4A 2NSBA 3KG4A 2V9KA 1YJUA 2LQBA 4JI1F 4DUYF 1BQNA 2AQ4A 2ZBCA 3CMES 5LXYA 4EBDA 1U1OA 1Y5NB 2DNHA 1FE0A 3C6UB 1GX6A 5J2PA 2KT5A 1B0VA 3M2RB 3TNVA 3LW5C 4X4UA 3N5BA 1HI8A 4KHMA 4ED0A 4OX6A 2CPEA 3S01A 2VD3A 5B08A 3MEKA 3CTRA 1HMVB 3ZZUA 3SSRA 4ZLPA 1JX4A 3MECB 5HLFB 2HWHA 3I5AA 5B0EA 2BZ2A 1TP7A 3MD3A 1SF8A 5AE1A 2XLJA 2E9ZA 3DLHA 4K0KF 1HHTP 4ETZA 3GIJA 1IZMA 1HNWF 4F26A 3WODF 3M8QB 3G86A 4QW9A 2EFGA 2I1RA 4B02A 2MGZB 4FWVA 4DOZA 5BUOA 4WJBA 2CQDA 4DL3A 3ZVRA 3OQ2A 1DURA 1NZEA 1LFWA 3DI6A 2ZH7A 3BO2A 2XB2D 4USIA 1YWXA 1UA0A 5GADI 3CB4A 2ADCA 3PRBA 2B9YA 4BJ6A 2J7PD 2CKWA 4CZCA 3WX4A 4QIFA 1BQMA 4IQMA 2J46A 1KHWA 2VFSA 1WEZA 2E7XA