3ZC4A

The structure of csa5 from sulfolobus solfataricus.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
157
Chain Sequence
PVAETISKRFWTLIKMLRFYVVLRRFGYIDPLIYSIDPKQIKDVLSEALREFVSYTSSSSSRSIVIYDDPKNPVTAQAPCLVVAKRDEIPQNFPSIYRYTIYKIDKSSEYCISPLVVNDKYATLITPNESVIKEFFDKLDSNIQYARVLASLAVGGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords SSO1398
publication title Structure of the Archaeal Cascade Subunit Csa5: Relating the Small Subunits of Crispr Effector Complexes.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 52
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2012-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3zc4A01
3.30.70.2780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3zc4A02
3ZC4A
chains in the Genus database with same CATH superfamily
3KUHA 2OQMA 4JI7J 1H72C 4LF8F 5B0DA 4OZLA 1ZHXA 2Q7RA 2GQQA 2DGVA 4X66J 2IC3A 3BJYA 3CEXA 1FRJA 2HGLA 1HNWJ 3DFEA 4J9NA 2GJIA 4LF7J 4RUBA 3W8HA 3L95X 1NJYA 4JKVA 4P7VA 3M2RA 2CVEA 3RZAA 1QAJA 2Q3TA 2Z56B 5KT2A 2BVZA 4QPXA 4NXMF 4NLGA 3QO9A 1HD1A 3RJMB 2GIFA 4IR9A 4MFBA 2IJRA 4WP8A 1S0OA 3GODA 1S57A 5EK0A 2VL1A 3IGNA 2DGOA 5FLXU 4ZPCA 1DARA 2K7JA 1VI7A 3BKTA 4I6YA 2FVRA 4OHXA 2HWTA 1V54C 4OX7A 1U2CA 5BJRA 4NZ6A 4NEZA 1FNTc 3IO1A 2XGPA 3T9ZA 1SJQA 2XXAA 2F9DA 2ZD1A 3O5TB 2GVZB 4NTAA 2H1YA 5KFQA 1CS4B 1S6QB 5DLJA 3LOUA 5J1EB 3W5ZA 4USMA 1U0BB 3GWNA 1BLUA 2V2QA 1Q82T 1CJUA 3SBMA 3CEDA 3G86A 3CO9A 2GHVC 3CCSS 1YJRA 1L7CA 1RT2B 1PCXA 2BJEA 1RCOB 2PFDA 4BWJA 1XERA 1YYJA 3WBZA 3VAJA 4MIWA 4FESA 3VALA 4N5SA 2QJ3A 2J6TA 4CLSA 2G2YA 4IDKB 3MR2A 3CT9A 2CZ4A 4V19X 2AYGA 3GM1A 5KG1A 5KYXB 2Q43A 4Q2LA 1ST6A 2EG1A 1PIEA 3ZDLA 1VS3A 1ZAVA 3WHIA 1TKTA 3TULA 4DG1B 1X5TA 5ADZA 2YKNB 4CRJA 5J1NA 1RA6A 1WOLA 2VQEF 2KGOA 4WKYA 2YQYA 2J9UA 4K4YA 4TQSA 2YNIB 2QE5A 2VCBA 3MM6B 3GG1A 4UOCA 2C03A 4MKVA 3SQGB 4B3RF 4NYOA 2MQOA 3CQZA 4J7CA 3R1LA 2KK1A 2QA4G 4ED7A 2HFNA 1T9KA 1RWNB 1IBMJ 1L3KA 5C2CA 1FJGF 4B9VA 3HJVA 4XEKA 2EPLX 5AT1B 2H3EB 4USKA 3EJMA 3V7OA 3ZZRA 4WJBA 2HMQA 3U7JA 4UW2A 1NZAA 3M8PB 3D1HA 3FEZA 2PMWA 2VHGA 1F2GA 5KAKA 2CYYA 2OGUA 3PCOB 5DGBA 3OTOJ 4HEA9 5HJXA 4PJJA 1KWMA 3TA2A 3JRMO 3P96A 3AG3C 5IC4B 2AWYA 4JBCA 2R7OA 3OTBA 1TWAA 1UVNA 4DV5J 1R3NA 4A8KA 5EX0A 3G71S 4DR2J 4TLRA 4KGKA 1I51B 2L9NA 5DRKA 4UY85 3DOMA 1OO0B 1NK8A 2HHVA 2NPIA 1OSDA 3TARA 4E98A 3M8WA 5D3GA 1ZU5A 2F65A 2HVIA 2M52A 2KM8C 4K4SA 2E7VA 4DJBA 2HV7A 4Z7YA 4F2SA 5AE3A 1IKYA 3W7BA 1RQ0A 1NMEB 3DMJA 4H4KC 4N6CA 4RNMA 2GZOA 3DJUB 1SF8A 2LFFA 2H5JB 4QCLA 2DPJA 1L3VA 3DRXA 3AGTA 1RT4B 4YS2A 2XNQA 3M8QB 3U27A 5LMUJ 1OKKA 3HHDA 2I38A 4PABA 1K0VA 2YNGA 2NZCA 2Y39A 1F9FA 2GW8A 4GVBB 4K4UA 2ALZA 4AFFA 4M63A 2E5LJ 1KHVA 3ZZUA 3AB2B 2J7KA 5LSLA 1VQ8S 2OJ3A 2LA6A 4TY9A 3E01A 1LV5A 2DNQA 2MZ1A 4NEYA 4DL2A 4ED4A 3ETOA 3MR3A 5L39A 2ZM6J 2DHGA 4ZA1A 5JUMA 2KYHA 2IBOA 1VK5A 2Y3HA 3OFHA 1R27B 3KJQB 2DR5A 2EC0A 2QL5B 3OEOA 3EGXA 3RG6A 4PJLA 2GGPB 1JLEB 4C3EA 2HRUA 1ZPWX 2YXLA 2R03A 3BBCA 3CCWA 4CO4A 2K1RB 3DMDA 2NSFA 5A8WB 3TYTA 3KLFB 2YVKA 3MTJA 2UV8A 4WE1A 3PJWA 1R7IA 1VHFA 1NB7A 1CLFA 4X4OA 4OIXA 5EHHA 4OX9F 1Y11A 1WF0A 1FXLA 2H4WB 4DUZJ 2CNKB 2YL7A 3SI8A 4N41A 2IXNA 4ER8A 5B1AC 1E6VA 1GEHA 2DNOA 2Y1IA 1YLXA 1IKWB 4ILRA 1U89A 1BY9A 3OL7A 1TK5A 1URRA 1SPBP 2Z2ZA 3DN9A 1V4AA 4IG0B 2JEIA 1BR4A 4B9TA 1K47A 3NG1A 3QMQA 4O0IA 1DOVA 4WP9A 2CPDA 2KXFA 2RNEA 4CT8A 1HMOA 3PW2A 2RD9A 1WI8A 2MKJA 2RU3A 2DH7A 2KG0A 3WX4A 4LBIA 2C2MB 2WTFA 2Q1LA 2YKPA 1F3FA 2C3UA 2J45A 2QC3A 2VG5A 3PIOQ 1R8BA 2ATLA 1YZAA 2JSXA 3DAGA 2CQGA 2ZKTA 2B4VA 3TA0A 3QVYA 1S72S 2GA7A 2NXUA 1T05B 3UNYA 4PKDB 1S6OA 3UW1A 3DRSB 4K4TA 3C8YA 1QUPA 1YJGA 4Q7AA 2CJKA 5DQGA 1TK0A 5JJBA 2WZFA 2HBYB 1RP5A 2QA4S 2RQKA 1TWCA 4DRHB 1N0VC 1FWLA 1MMNA 3K17A 3EVMA 1XMBA 3MAHA 1SJ4P 1DQ9A 4X4NA 1IBKJ 2KFYA 4GKJJ 4KO0A 5HMWA 3GJTB 4OX8A 3CJKB 5KG5A 2BJ1A 1VQKS 1BQNB 2OKQA 5BXIA 2L6GA 2POKA 2A1BA 1EETA 3OL9A 5KYUB 4C97A 2CQ2A 1BBHA 3DGPB 3I5CA 3TJ6A 3LS0A 3MFHA 3GV8B 2V9WA 4AL6A 2WB1D 1Y5IB 4L75A 2CQ1A 4C7OB 1TL4A 2GVDB 1ZM9A 2BRKA 5F8HA 4TQRA 4N8OA 2V8PA 1MWYA 4JI4J 1SL0A 4WGYA 1L3PA 4XPCA 4JI0F 2I2YA 3PKYA 3CB4A 1BWVA 4ANJA 3QAEA 4IYQA 4DDFA 3QAUA 3GTYX 4H54A 3DLKA 3WHNA 5E5NA 1G4CA 3ZO7A 1AFJA 4IFVB 5J2PB 2RS8A 1H6KX 2HWIA 4LDKA 2JFKA 4LR7A 1FRHA 2IIHA 1IM4A 1MW7A 3BDEA 4M1KA 1H0HB 3JZ0A 4HFFB 4NX9A 4RPFA 3ZSUA 4LF8J 2CG8A 3MAQA 2IVYA 3DRRB 2KYZA 4EO6A 1JLAB 2FVQA 1BQMB 1Z4UA 1OY8A 3LGNA 2ASYA 2KL8A 3W2VB 4OZ5A 3CMQA 3HT3A 1JAFA 2YLDA 2YKMA 3HI9A 5J2NB 1ACMB 2V67A 2MKYA 3MEDB 4KC5A 4OIPF 3GU0A 3D5MA 2PN6A 1NLXA 4QR1A 3FJ2A 4LRAA 4WYLA 1YYXA 4C8ZA 4RU9A 3X3UA 3U3FA 4YP3A 3MHYA 1LW2B 2I5JB 2XM3A 1EARA 1OW7A 2R7RA 4P74A 1UVKA 3FAPB 2XMVA 1FDBA 3I82A 2HBRB 3TOQA 1GXLA 5CABA 3TUJC 4J9SA 4Y34A 5BQHA 1WWHA 3R7SB 2ILYA 2V34A 5H9EK 2OD4A 5A8RA 1V3RA 3A8KA 1NSPA 4ZN1A 3VYWA 3WODF 1HYSA 2ZE2B 2MYFA 1OR3A 3NXZA 1ZTTA 2RKIB 4EU0A 1L5UA 5LJ3Y 4A8MP 1U7LA 5KFTA 4CTAB 1F5AA 2ZJQQ 4ED5A 1A9NB 2B9EA 3M2RB 3TP2A 3A9CA 3EZUA 1X5OA 2VA3A 4LF5F 2Y3GA 4C48A 2J76E 2ZH8A 2OO4A 4Q8EA 4H4OB 3QSIA 2DNNA 1VIXA 1JXEA 4DFMA 3FEXB 2PI5A 2WBMA 3KG1A 4AE5A 3OTEA 1FCAA 2EK1A 2MQ8A 4B02A 5KOXA 4DV0J 1VQPS 3W64A 5MLCV 3L1MA 2LLZA 4FF3A 1LXJA 2BOAA 5D0EA 4KHPF 2EILC 4EBDA 3M4BA 5T3WA 3T41A 2UV8G 1VYIA 4ETXA 2FTRA 1PC4A 2EPNA 2HS5A 4G1QA 4OHZA 3HSDA 2ZD1B 3N9UC 1XK8A 5EDWA 2M4MA 3T6GB 5HP1A 4ZIWA 2VKRA 4BJ5A 4CO3A 3EGNA 4FYVB 4DQPA 4RR5A 1EKRA 4K0KF 1S48A 3IQTA 4JTCB 3C6UA 1YJVA 1X7VA 2DNHA 4USVA 4PR9A 2ZZMA 5ETMA 2DKOB 2OD6A 3HVAA 1JXLA 1HMVB 2JNJA 3HNIA 4ED0A 2OEMA 4C3BA 2HEKA 3MPUB 3MMBA 3CIMA 2GV1A 5ETVA 2NLWA 5JP7A 2MXYA 2CQPA 5CQGA 4RBVA 1SCJB 1VCTA 2V94A 2H7BA 1FJGJ 2L48A 2LIGA 3C2PA 2HS3A 1IKVA 1NLKL 1Q53A 2J9DE 2AGOA 1DLOB 3K33A 4MJKA 3HPOA 4N77A 2AKWB 1TQGA 1ELOA 2QG9B 4ED6A 1KD1T 3MCNA 2WK4A 4J5OA 3FC9A 2O66A 2LXFA 2I1RA 4WPAA 4E7SA 5DVWA 3W62A 2DNMA 4YR3A 3HSJA 2WZLA 5DS4A 4M8LA 4C0OC 3HJCA 2ETSA 3B0PA 2HBZB 1YITS 4DL7A 4Y3CA 2BKOA 2RD5C 4A2NB 3HVWA 2CADA 3VAHA 3Q8PB 4RUHA 4UZCA 2QLXA 4NASA 4HLBA 1BZ4A 1SL2A 2L9DA 3H65A 4PUOA 3IWXA 2Y0SD 4ZCIA 1LPEA 2OKUA 4CO2A 2HHPA 2B8QA 4HHHA 1D1UA 2D1CA 3Q86A 5L1KA 1ZA2B 2Z2YB 1RMVA 2JPUA 4ZVUB 3MM5A 2HG4A 4M95A 1UJ5A 2KYXA 1FXRA 1UFKA 3MURP 4KBIA 3PW0A 1S1UA 5K8MA 4ZVFA 1TKZA 2C2KB 3CCRS 3NAHA 4PWDA 1Q16B 1SI9A 2F40A 3HHLB 3U2MA 3MEEA 5F41A 3DMJB 4PPZA 4U8VA 2E1CA 4KR0B 1LXNA 5CXTA 1B68A 2K7KA 2C2OB 3TD7A 4K2JA 4PWUA 2FUG9 5JVEA 3ZXWA 3FQLA 5LSOA 2IBFA 2P9CA 3FOPA 1DTTA 4W4MA 4OX9J 2N4CA 1I94F 2LA4A 1SJRA 5KFMA 5EN1A 4KNWA 3OWTA 4F26A 1P1LA 4RW6B 1FF2A 2ICWG 3G2XA 4RW8A 2AYEA 3M30B 3J81j 2APOA 1DY3A 3VAKA 1QAYA 2J7UA 1JMWA 3VRCA 1Q8BA 3KG4A 1UMJA 1GMVA 2M8DB 2HGMA 4DX6A 2EVZA 3M9OB 3A11A 3UMIA 4OYMA 3FOOA 4DI6A 4I6AA 1ZAXA 2IY5B 3GMGA 4ZJQA 4RO0A 3K8VA 2YLIA 1ZZPA 4IRKA 4ZCLA 2BL2A 2QA2A 1HL6A 1NJXA 2EFNA 2VONA 2NUHA 1XNRF 3B29A 3G96A 2X1GA 4M94A 4MVRA 3ISND 2IM0A 1J5EF 4PYDA 4DR7F 3IHUA 4BG0A 2LKZA 5LM7E 2NYIA 3ITHA 3T3FA 5F5HA 2WB7A 1L3UA 3LW5C 2OPPA 1CG2A 3MZIA 4ID8A 2YY3A 4Y2KA 3PCVA 4OIOF 1D0ZA 3NGRA 3QT7A 5D4NA 3FSYA 3P3DA 4PFOA 4A4AA 2M0GB 4MTPA 5IS2A 4X65F 2MKKA 1WKKA 3BSNA 2E5GA 4URSA 2VODA 2DNYA 3PJXA 1X4DA 2J9DA 3RRHA 3BQ0A 2L6FA 3DLEA 2DRAA 1JPNA 2HV6A 1FX2A 2QRRA 5F3TA 1VC0A 4YT8A 2H65B 2V5HG 2WSFC 1MMLA 2BW2A 5C24A 1TTHB 2VPZB 5JXSA 2V9KA 4JRZA 1B70B 4FPRA 2NUUG 2LCWA 1FA0A 2HVEA 5KFIA 2XLDA 2UXBF 2U2FA 4X62J 2EKYA 3IG1A 3B8HA 2CPEA 3M4XA 4CIOA 4FF4A 1S0VA 4TVAB 4BLGA 5IFMA 5HL7Q 4G7ZF 3CD0A 1S76D 3EICA 2FYXA 4YQWA 1O5JA 4ECSA 1LWFB 3SDEA 4O3SA 3MMJA 1VQMS 1YJ9S 2WVCA 1Z63A 2Q9AA 3O6XA 3FZ2A 4WFBQ 3N5FA 2MY8A 1JLBA 3EQLF 4TNOA 2R05A 3OV7A 1JRAA 5ETKA 1TKNA 4CS9A 1K05A 4M5HA 5L0FA 5KFEA 1IR2A 3KK1A 1VBXA 2XL4A 2XL8A 1UA0A 2HNZB 2NXNA 1QSLA 3WDOA 1GH8A 1M2VA 2HNYA 3T5HA 1RA7A 2P5VA 2VDHA 2J9BA 4Y6IA 5A6BA 4DR3J 1HNZF 3ELHA 1TK8A 3P45B 3M2VB 2UVRA 7FD1A 2XQCA 1N48A 6FDRA 3IBCB 2CJQA 1RT3A 5HANA 2FLPA 1X31C 4G7OF 1HI8A 5B1BC 5B0EA 5KFBA 4JI1J 3V4IB 3GB0A 2UVUA 1QSYA 1A0OB 1S1XA 1OCOC 5J2QB 3UDEA 2EBGA 1U47A 3QIPB 1H98A 2J7WA 1QAXA 3AOAA 3DLJA 5KT4A 3AQBA 3TAMB 4O4RA 3R97A 3Q8UA 3VWSA 1VQSA 3OQ2A 1HHSA 3V6JA 3HFKA 4NZ7A 2MZRA 3F73A 1Q79A 3HDSA 3EFOA 4FXWA 2WAQD 3GIJA 4EKWA 3F46A 2P9EA 2Y3DA 2Z2LA 3EXYA 3GFXA 4Q8FA 3HD2A 4OHYA 1YBAA 5A6KA 1H2UX 2XMWA 2FJWA 2IMOA 1LK5A 1HNIA 1IQTA 1OQCA 3TVYA 4FN5A 4PJNA 3HFZB 3SXZA 3VGSA 4C8MA 3M32A 1A7EA 4WFNQ 4DSKA 3TJ8A 4C3KA 1WC0A 1VK8A 2OLWA 1HBNA 3OL6A 5KFDA 3M9MB 2A6OA 4F2RA 4JCZA 1S9GA 2Q6CA 4Y00A 4OLPA 1OPIA 4IG3A 3UVJA 3U8PA 2QMUB 2RF2A 2N7CA 2XSJA 1S0NA 3X2QC 3Q0AA 4PJMA 2QV6A 4K5RA 1C1BA 4ZLJA 3JSRA 2XLHA 3MPDA 3WC0A 4LFAJ 1WASA 4ZVEA 4GRSA 4WTYA 3J81Y 4WFXA 2ZXWC 1DHMA 5T14A 1NRKA 2Z57B 2BX6A 2ZC3A 2J9EA 5KG6A 5CYMA 5DDPC 3BPSP 4O3QA 1NH7A 1IBLF 4DSLA 1S99A 4NXNJ 3R2DJ 1RT5A 3GYNA 5A8KA 4OHVA 4GVLA 4P73A 1JWWA 2DNRA 4QPTA 1SR2A 1VLSA 4H4MA 3LPEA 4RW4A 2A10A 3I5BA 2OSQA 2V4RA 2AWZA 1S6PB 3MFIA 1NG1A 4EFAC 1F9HA 3AXMA 3VQSA 5COGA 4CQ1A 1UWBA 2ZVSA 3QFWA 4ZP7A 4X2BA 5DJBA 3WAQA 1SKWA 1RAEB 3HHEA 3VVTA 5AGFA 2Q9BA 2RHSB 2OPRA 3SCJE 2XLWA 3PX6A 1MN9A 1RAIB 3H8YA 3VV2B 1X4BA 2WVBA 1F5CA 1XMOF 1MMGA 1Z2ZA 1OXBA 3D0IE 2R8IA 2MLXA 1SC4B 4NA1A 3LP0A 2MZTA 2P6VA 1S4FA 1IZMA 1CGME 2VG7B 4QWBA 2YPYA 2RILA 3QRQA 3K5PA 1AUSL 1M5PC 4IARA 1MROA 2VFSA 2RUSA 4LRBA 1TMMA 1D0EA 8AT1B 4TKTA 3CJ0A 3S1TA 4NLTA 3O6QA 3DXJF 5KG3A 5E3RA 3NBPB 3HNLA 3L8JA 1JK9B 2ZFHA 2R42A 2VFTA 4O7GA 2AV5A 3BGUA 1GGQA 1KNYA 2K06A 2XGQA 3ZTPA 3N0TA 3DE9A 5L8RC 3IQCA 4YR0A 1JLQA 2LFVA 4CZCA 4X84A 4OQJA 4U7UD 3G6XA 2UUBJ 3PR4A 1DTQA 2Q4FA 2B51A 3MM9B 4PG4A 1PYOB 2WVFA 1B99A 3CCLS 4KKOB 2B7BB 3IP0A 3SSSA 1JLCA 2W24A 3RR7A 1JX4A 4JVSA 1RBOB 1IM6A 2NCKL 4P71A 5E41A 4O3RA 2AVKA 4J37A 5AC5A 3JYTA 3O10A 4Z9JA 3ICLA 4F0HA 4J7YA 2FIUA 4ED3A 1I94J 4TY8A 4ZIVA 1SUQB 2GJ2A 5HK4A 4J90A 1Q0DA 2ERRA 1CPZA 4C0BA 1UZDA 4LF6J 3C15B 3U1NA 1AEPA 2W7OA 2HFUA 3GANA 1F5BA 4IH5A 4JI8J 1JJ4A 4PWDB 4TU9A 4LACB 5B0GA 3KLIA 2VCAA 4RW7B 4K1OA 4MW3A 3IS9A 3MGJA 1BUXA 2HPUA 2DNGA 3FQKA 2AX0A 3KLGA 2XRHA 4G65A 4XDCA 2BJ8A 1CULB 1BXNA 1YA9A 1FR0A 1RLDA 3IM9A 2W4PA 1URNA 1RADB 1NBBA 4DWIA 4HTIA 4CI0B 2ZBCA 2D9PA 2YVSA 3UD3P 5KFKA 2OSRA 4CBEA 1XNRJ 4ECVA 1YBUA 4QU6A 1ZHYA 2FHJA 4B9UA 2BJDA 2G0JA 4XAKA 4JI2F 4HI1A 1IJEB 4LQ3A 2FJAB 4DPWA 5B3SC 5L9NA 3VF0A 3MOJB 3TI0A 3GZ7A 4RZRA 2ZBQA 1EP4B 4L6RA 4K2XA 3VGTA 2VF3A 3NKYA 3AQPA 1EQ1A 4P2SA 2C2DA 2ZVIA 3DU6A 2A6MA 4PPDA 3Q8RB 4OI0A 3W8IA 1JMTA 1J8YF 3N6MA 1TV6B 3UPFA 3H98A 4LSZB 1OWXA 3RBZA 3GIMA 4KFBB 4U5HA 2NXEA 4RL1A 5LL6d 3DCAA 3OR1A 4DU8A 3QJLA 2OAUA 1RWMB 4BJ6C 3U5SA 2Q79A 3G8TA 3J06A 2IJFA 2KKHA 1SKUB 3ET6A 3H2VE 5D0RA 2A68F 2PMHA 5KOWA 3RBEA 2OPQB 1SYQA 1B0PA 3FCHA 1FVSA 2EG2A 2H51B 4B3TJ 2A2DA 3OJSA 3RB3A 3PR5B 4IJJA 3M2UA 3C8ZA 4LR8A 4O4GA 1NU9C 2UXBJ 3HF5A 1K9MT 4N47A 3G4ZA 4FXVA 3BR8A 2B5JB 4C3DA 4LF4J 3GJSB 2B9YA 2KRRA 1FWKA 2DGQA 2R7WA 2NR0A 1S4EA 4KHMA 2DGUA 3KLEB 4BC9A 5LXYA 3ITFA 3AG4C 2HNDA 4FNHA 2OPSB 1FK9A 3I96A 2JEJA 2I0XA 3MR6A 3UWTA 3TX0A 1CGOA 1OW6A 3TWZA 1XZPA 4OJHA 5B0AA 1S6UA 4P6IC 5K14B 1NKEA 3MWBA 1FRKA 4RW9B 5CYQA 5D0GA 4DCJB 3AY0A 4J9VA 3RAXA 5KYYB 2J7PA 2W45A 2IXOA 3WZ0A 4A8FA 3HVTA 3H5UA 2DI3A 4YJWA 2BEFA 3LGHA 5I3UA 1S1TA 1R89A 4ZP8A 4FF1A 5ETTA 3C62A 3ZZYA 4Q45A 2OTJS 4WU2A 2XZWA 1Q0NA 4ZVPB 1TUGB 4P2XA 2V50A 1PG5B 2VASA 4F67A 3I5AA 2L3MA 1SL1A 4DR5F 4C8LA 3S7RA 3DDNA 1RTDB 4K50A 2GMJA 4ZJLA 1Q0KA 1RTJB 1A7VA 1CQNA 2J8AA 1GTEA 1TAQA 1WF2A 1XEZA 2BOPA 3CXCR 4IO1A 2MGZA 1X4FA 4I64A 4HACB 2ACYA 5IQQA 4DR4F 2WZGA 4MK9A 4K8RA 2E7XA 4M5IA 4YOEA 1R0BG 2GQ2A 1VRQC 1YTYA 3T4RA 5BYRA 5TJ5E 1OY6A 2QGFB 4P72A 3NRHA 1QD1A 2BQUA 3UR0A 1TL7B 1SC1B 3DOLB 3TQEA 1ZU4A 3NMRA 3VGVA 3HK2A 1GK8A 5AE1A 4CLYA 3CCJS 5D4OA 4FS2A 4ONSA 4NPOA 4CLFA 2HQ3A 2GS8A 1RWVB 1D1CA 4OJ3A 4QI2A 4CSAA 4M5KA 1J8MF 1H2VZ 1B4SA 3TA1A 1VQ9S 1N52B 4UOGA 1LS1A 4ZVTB 3JSMA 2H5IB 1B64A 2LVWA 2R9RB 5KG4A 2C1EB 4LRCA 4LREA 3Q24A 3MPVA 5BYQA 1GM5A 1XR6A 1R4TA 2CJBA 2R3VA 1N5VA 1P6TA 5D91A 2GWWA 1TL3A 4IFYB 4O44B 4EYHB 1AW0A 2DYSC 2H7VC 3V5YA 1HWKA 4D4NA 3BS9A 2ZKUA 2EBEA 1NPRA 2OU6A 1HNIB 1CJVB 4OYOA 1NDCA 4ZJOA 2LK4A 3VZHA 3RQEA 3VR1A 3N2ZB 4IO9Q 2AD9A 1QJHA 2KT2A 3TO8A 3AFGA 4FYYB 3HLZA 4U7UK 4ID5A 1RHRB 2B0HA 1MWQA 3R6GB 4DL0C 2VV5A 3FK4A 1RWWB 2BE9B 4A8WA 2B9XA 4IG3B 3CF5Q 5H9EJ 3A8EA 4X4RA 4B9SA 1E85A 1VRUB 2ZC4A 1MSWD 1NKBA 3NG8A 3Q7LA 4KV8B 3DOKB 1VHIA 2W4MA 2C04A 3H2VA 5IY5C 2PC6A 5HQ8A 4MH8A 3LLIA 1PYSB 3RB0A 5CIVA 5HLFB 3EGDA 2QLWA 3FBCA 1Y5LB 3PX4A 4B3OB 1RXQA 3UN3A 4EBJA 4P9FA 3M79A 1ZYQA 4OZ1A 2ZHOA 1GAOA 4DXWA 1JJ2R 2R8GA 2F9JA 1R0CB 5GAGU 2FHMA 4LRDA 3BN7A 4ZMMA 4MIBA 1RWUA 3LP1A 2QY9A 4GO5X 2JOQA 2EI5A 4Q7CA 1HQEA 2C2NA 3QZ7A 3V6KA 1UCNA 3K66A 5E3CA 1G6BA 4RW4B 1S1VA 4ZHRB 2NUTA 1RU1A 2F63A 3R1HA 4FXDA 2AZ3A 5A76A 2B0JA 4L73A 3W66A 4DCOB 1NCLA 4KGXB 2V4JA 1FXDA 3OTDA 4IAOA 4AQYF 1N5QA 4DVYP 2JLGA 3WG7C 1X9WA 3QTHA 3KHLA 1KN6A 2DXDA 4R8UA 1MU2B 3S28A 3AQOA 1J2VA 2ZWPA 1UFWA 2IAJA 2QN6B 1VBYA 3MCSA 2KT5A 4KQZA 2XLEA 1K73T 4J30B 3BGLA 3BREA 1JJCB 3SFUA 4MIAA 4G3IA 1FTSA 2CZ9A 3DRYA 4JE9A 2HKEA 4PWWA 2CPJA 2A3JA 3E51A 4KPYA 4LF9J 4F4YA 1IKXB 4GO7X 2HJMA 3HTKC 2ALYB 2VICA 3F56A 1FO1A 4ES3A 4HH0A 2HS0A 4XQ1A 4CIPA 2YX4A 4YN0B 4LMZA 2BR0A 8RUCA 2RH3A 3KYJA 4ER9A 4YY3F 2CW0F 2MKHA 3CCMS 4QIFA 3C66A 2H48B 3D1QA 4ILLA 1TVRB 2R8HA 4QYRA 5D6GA 1B7FA 1M1HA 4J9LA 3DNCA 1I4ZA 4JI7F 2MQLA 2PNOA 1KOOA 3CJ4A 1ZAWA 3RVYA 4P6QA 5F8LA 4OYBA 2HMIB 1HNWF 4ZPVR 5CCLA 4OD5A 4LF7F 2YL3A 2GVZA 4CCHA 2HJ3A 3DD7A 1CS4A 2JC1A 1S6QA 5J1EA 5RUBA 2QLBB 3QIDA 1PV3A 2DO0A 5AXLA 2A2CA 2HIYA 1PCAA 1RT2A 3X1OA 1KQGB 2WZ1A 3NWGA 4MKYA 2M9KA 1RHJB 3BEHA 4UOFA 3M6WA 1S9EB 2JFDA 4K4ZA 1SH3A 4JI2J 1IBCB 1YRXA 4N06A 5CD4H 3FRZA 3FSXA 2Z0GA 3C7JA 3QWUA 8ATCB 2HAIA 4KH0B 1KHWA 5KYXA 3O8WA 5H9FK 3KLIB 3QT8A 3R27A 2UP1A 4PG6A 1D9FA 1X4CA 4FAPB 4AUKA 1WTYA 2DY9A 2HHSA 4DG1A 2XMTA 2KH9A 2ROEA 2D69A 2YKNA 3HZGA 4R0JA 3DI6B 2COLA 3ZG1A 5L3QA 3DZAA 4N4WA 2QX0A 4O3PA 5HMXA 1V9OA 1FKAF 2YNIA 4TU7A 4PFPA 3JT1A 2V26A 3IEEA 3GIKA 5IT9U 3H7HB 2EPOA 1X5SA 2CPFA 2IA0A 5BR8F 4I67A 5IT4A 2PT0A 5LT5A 3IA0A 4QR2A 3KLHB 3C16B 1E84A 1ZM4A 4CYUA 2HK3A 3KDOA 5FIIA 1FKOB 5FJ4A 1N6QB 1FJEB 1GXUA 4E2FB 3M8PA 4XO0A 1LVKA 3I0SB 3QJPA 2CDRB 3OFGA 2PE8A 1LWXA 2XMMA 2YNHB 4PZVA 2AGPA 3DU5A 1NFOA 4MK8A 3P6YC 2AYMA 1KTQA 2QL9B 4NCQA 3H5YA 3EZOA 4XPWA 3ZNJ1 3GV7B 2H8AA 3NOGA 4JTAB 3ET6B 1U1RA 4QU7A 3K5NA 5HV9A 4RNNA 9ATCB 3QNWB 4M5DA 2P61A 3FMBA 4FPIA 4NOHA 3OHBA 1RUSA 1IBMF 1NU7D 3J7AN 3DC2A 3MMCB 3ZWIA 4NZ0A 3MECB 2CPZA 1NPKA 4W92B 3TANA 2XWYA 5LMNF 2BM0A 3GM2A 3C3LA 2A0FB 3Q8VA 1W25A 3ENQA 3Q6NA 3MM8A 3ZZZA 4ZLCA 2RB7A 4DZDA 1M5KC 1WC6A 4J9OA 1IXKA 2YTCA 1ZHZA 1UEUA 1L3TA 1RT4A 1YA7O 3OTOF 3PX0A 4TLQA 3M8QA 2DHAA 2EWHA 4U67Q 3N0VA 4J9RA 4DF8A 1K1QA 4GVBA 3FNNA 3IR7B 4CT9A 4DR5J 1RU2A 2HHXA 3U1LA 4EWCA 1YLMA 1HI1A 1LE2A 1EQMA 3R5AA 3K58A 3C14B 5DS5A 1U8SA 3SMZA 2HBQB 3OUYB 3R7CA 2AMCB 2WOMB 2V8DA 5AXMA 2G0CA 1FEHA 2HLTA 4UF4A 5F3ZA 4CH7A 3T1AA 3U9MA 5D4LA 4OZNA 2GGPA 2J8WA 1JLEA 4OI6A 2MKIA 2VOPA 1S1WB 1MN7A 2O67A 5D15A 2K1RA 5LMUF 3DAFA 2X3DA 5A8WA 3KLFA 4ELVA 1HKAA 3ISZA 3U9JA 4WP3A 2X3GA 4G0HA 2IDLA 2XNRA 5GAEI 3MAAB 1HMDA 4NCGB 3EVOA 3TQOA 3RW7A 256BA 2UUHA 3C19A 3QGIA 3GWLA 2E5JA 1IKWA 1RAJA 1Q81T 5HSWA 4IG0A 1NNDA 1SJFA 2PSZA 2YQ0A 1Z2LA 1KRPA 1UTAA 3H5SA 1ZM3A 1RKEB 5SZTA 4DFJA 2FAPB 4MW8A 2XLIA 3CSKA 2AJQA 4FVCA 1CEZA 3E2EA 3SCKE 1OYEA 3WIUA 4ELTA 2D3OR 1Y9OA 1X0PA 5JVHQ 2DGWA 4C0HA 5AJ3J 3V81B 1WG4A 4MKAA 4CLUA 2O01C 1Y10A 4Z2XA 4A46A 2YZSA 1PD0A 2J9VA 1BDJB 4EWTA 4HKQA 4UQTA 4JJFA 1XJWB 1S49A 2JX0A 1T05A 2QL7B 2HQGA 1KTVA 3DRSA 3PHF2 1U09A 1TUVA 2QSFA 3RU0A 1U45A 4DR6F 3HCXA 5L1JA 3PG9A 1ZOTA 4AXJA 1HBMB 3D54A 1J27A 3UN2A 1RHMB 1APCA 3D9BA 2IYGA 3BN4A 2RS2A 3GP9A 4D4XA 3AJMA 4XPXA 3OL8A 4DL6A 3UGPA 2GA0A 2VPWB 1YJUA 2DGJA 2UU9F 2CXEA 1N5YB 2CQDA 2WW4A 3CJKA 4YR2A 2XS5A 2HMZA 3PDMP 1BQNA 2HQIA 1UW9A 5E3QA 3UMKA 4QJVA 5KYUA 2G13A 5L38A 1N56A 5BQGA 1YHQS 3L9ZA 3M05A 2HQDA 3DGPA 1KFDA 1T5OA 1G4US 4NLPA 1KSPA 4JTDB 5I42B 2L81A 4DV2F 2M8HA 3R9LA 2UUCJ 1G8XA 4ANCA 2AJ2A 3FEYB 3ZNUA 2PEBA 2GVDA 3IC1A 3DKAA 4IH6A 2ZXOA 1AYEA 5THWA 2GJFA 2FZCB 3OXLA 3BO2A 1UVLA 3CIZA 2IBKA 4AQYJ 1IBKF 3MFNA 4GKJF 5MAOA 3R5JB 3LJBA 5ETOA 4NE9C 3POTB 3C8GD 3LUTB 3K5LA 3Q8SB 4RBTA 2JX2A 1LWEB 1ZBTA 4BWMA 3L7OA 3NS5A 2NPUA 2YWKA 1QLNA 1OKKD 3HKKA 5L46A 4IFVA 5J2PA 1HQEB 2NUPB 5KFJA 3MR5A 2HZAA 1LKXA 2YKQA 4RBUA 3DRRA 4E8UA 2EFVA 1JLAA 4HHJA 3LGMA 1T03B 1ICEB 2NPFA 1BQMA 2C2RA 1H6GA 2MSSA 2LSEA 4CWBA 1SKSA 4YMEA 4I3MA 2B43A 4ZITA 3W2VA 1REVB 2B6AB 5LSRA 2AJFE 3SZ2A 4LSNB 2DRDA 5J2NA 1RAFB 4AT1B 3MEDA 3A3OB 5A2QU 3OT9A 4RNOA 1R6YA 3V5XA 4N7TA 3RKOF 2W4BA 2C3OA 2XYGB 4F4XA 3WIVA 3JSBA 4O23A 4YY3J 2MQPA 3S0XA 2MTLA 2GFFA 4PEOA 1YARO 2IYLD 5ETNA 1M2OA 2FJVA 3W61A 4ZLDA 2QNLA 5HQLA 2VH3A 2DR9A 5F0WA 2B8PA 4XLPF 1XC9A 2QE9A 2KI2A 2GFHA 2CNLB 2A69F 3SNHA 1TMJA 1N8RT 4GYTA 5GAHU 2MJNA 2ZE2A 3QGGA 4R32A 3SZRA 2RKIA 3BYPA 4E18A 1UWAA 2L9WA 2FVSA 1X4HA 4CTAA 3JAMU 3TJAA 1ORYA 4EUKB 4F36A 1HQUB 3SXLA 3HT0A 4KGVB 4DV6J 1IUJA 1YKWA 2N3LA 2Y1JA 3Q8QB 4LSLB 1OIAA 1QM9A 4H4OA 2ZHBA 4ZVQB 3ATPA 5I4MA 3CD5A 5ETLA 5CAAA 4A48A 1U6ZA 4R5PB 3J7A1 3SFGA 5JMNA 4OD4A 4J32B 3SXMA 2PA8D 1BD6A 4KGMA 5JRAA 2DNLA 2AU0A 2R02A 4ATNA 2PI4A 2FGYA 3ZTQA 2HW3A 1Y3JA 1E6YB 2MYSA 5GVQA 1U6FA 2R2RA 2MHEA 4AL1A 1FFSB 5IM0B 4PK4A 2HSBA 5G0RB 1MNDA 2OMOA 2IM3A 2RSQA 5EWEA 5L0HA 3P4UB 4ENOA 1FTRA 4QIEA 2YEVA 3W5YA 4ZCKA 1RDRA 2YKZA 4BEMJ 1HMVA 2EKNA 4DV0F 4V1Ak 4WZMA 1X9SA 3QLHB 1QVGR 2OOCA 2IPOB 1LFWA 4OYWA 4RUCA 4DBQA 2DCUB 5KFWA 3CPWR 5BR8J 5KFPA 1DBDA 2IOQA 2O5DA 3ABKC 1RABB 3EE3A 1RT7B 1DLOA 2AP6A 2CDQA 5KFZA 5EWFA 3A12A 4OZ0A 4K4WA 2GHPA 1C0UA 3J7YI 3MD3A 1DQAA 2PA3A 1PBUA 1AA1B 4IH7A 4FX5A 2PX3A 1MQVA 2K8GA 2EFQA 1N34J 4E7ZA 3NMIA 1NO8A 2BABA 3BQ2A 1T9UA 3UDVA 2K3KA 1ZH5A 1FE0A 3R8YA 1HW1A 1UVJA 1S9FA 1RGVA 4YB6A 2KW3C 2E29A 1F3VA 1KTMA 3FBBA 4USJC 4CYUB 3FSIA 3JS9A 3LWLA 5LMNJ 4JV5J 4MKBA 1JLGB 3HULA 4HT5A 1EB0A 3CMAS 3W2WA 2V0NA 2QUPA 1YJNS 4AXIA 4I69A 3N28A 4WU3A 3F0NA 1XTZA 5DZ7A 3PRDA 4ECZA 1HE9A 1QKRA 2ZH9A 4NMLA 4RDAA 3TZZA 1Q0MA 2AEMA 1PKUA 3S9OA 1LWCA 3BH6B 5KFSA 2YH0A 1HE1A 2KN4A 1K04A 5KFOA 4CDVA 4B08A 3JSZA 4MVQA 3OLBA 4DV7F 3GEEA 2D74B 5D0HA 3JYYA 4M5DB 2M64A 3H2UA 2ASLA 4DSJA 4DUTA 2XO6A 1OR2A 3HHLA 1LIHA 2A1DD 5F28E 3EPGA 1CJTB 1SH2A 3ZVRA 3LNMB 3UQSA 1ZPVA 3MM8B 4A4JA 2HLUA 3JQKA 1ZM2A 1FJCA 2F4FA 2F3JA 4QIGA 1U6HA 3ADAC 1YDIA 1U1LA 4YEAA 4EBCA 1N0UA 2WL8A 1P27B 2XLJA 1B3TA 4WGZA 3QW0A 2CJXB 1JNRB 4P7TA 4DUYJ 3HM9A 1HD0A 1TL5A 1XR5A 3K2YA 1V6HA 4DS4A 1BC6A 1GNKA 4YFUA 1TFOB 4RW6A 5HVFA 1WORA 1TQLA 4L72B 3M30A 3OD2A 2MZJA 3U2LA 1PSDA 2FY8A 3H90A 4NLOA 2F8MA 1TL1B 3NYLA 4LBHA 3D0GE 4K7QA 1PO6A 1H9TA 3W9HA 2IM2A 1U6BA 4YT5A 2GCFA 2CRLA 4NA3A 2L41A 3FHDA 1Z3IX 1TZ0A 1DAXA 3HO1A 4DSFA 1T6QA 3H20A 4JYAF 1RJ9A 4R25A 1U0HB 2BANB 2ASRA 1FD2A 4IRDA 3MUTP 2W9CB 2VQFF 1FFWB 1A0BA 2BQ3A 1S12A 4DSEA 1VLYA 5A0YB 1VJWA 4URQU 5GPGB 2JVOA 2ZXRA 3Q2TC 2ZH3A 1KLMB 1RT1B 1DFDA 1L3SA 4D3HA 4DR6J 3RFYA 3BBFA 2OHDA 1VDHA 4KYZA 3PYGA 1DURA 2LYVA 3CO0P 4B3MJ 4DPOA 2DR6A 3P8BB 4M5GA 3GONA 3T9NA 2ZITA 3PRBA 4I2PB 3D6HB 1XZQA 4JB8B 3PDNA 2MKSA 2X1BA 2H9ZA 4OIRF 2YNFB 2GIRA 2HFZA 2UU9J 3QRPA 3PYEA 3OXFA 3KYIA 1T01A 2W4CA 1NSAA 2XI2A 4CJGA 2R7QA 1FT8A 2JL9A 5KYWB 2OEJA 3MYIA 4KIAA 2CJ9A 1WNEA 1U48A 2Y3BA 4DV2J 1M1GA 1TFKB 4NLRA 3DXBA 3N6LA 2YL1A 4OI1A 4DZ6A 2LQBA 1SQEA 4YUDA 1QUVA 2F4VF 3MCOA 4WBFA 3IN5A 1I6JA 1SIZA 2VCCA 3ILLA 4C11B 2FHKA 2V3CC 1M90T 4C4WA 3FAJA 2FD2A 1RKJA 1LWFA 2DEIA 4OFZA 2CQ4A 2ZEJA 2CGEA 4X4QA 3CC2S 5B7WA 3UN5A 3L8IA 2XC9A 4G78A 1Y5NB 1H74A 3DLLQ 3QW1A 2HNZA 2PX0A 3PHTA 2DYRC 2Y8WA 4DQSA 5DLGA 2RJZA 1FDNA 4NLWA 4X62F 5F8GA 3LH2S 3CE8A 2DIVA 1SJ3P 1HARA 4C8OA 4N8NA 3O55A 5JSLA 3DHWC 3M2VA 2CAJA 1HHTP 4LLCA 4U5BE 2DVIA 2RHQB 2W2NP 4Y28C 2OCCC 4JUZA 1FRLA 2MWQA 3M6XA 3VQTA 4OYAA 3V4IA 4RD9A 1RWKB 1A7DA 2V68A 1NKCA 3A1YG 3H4DA 3BEGB 5J2QA 4I1TA 1YJ7A 3DKDA 5KG2A 2BM1A 4LJMA 2XLVA 1WHVA 1Y6DA 2YBVA 2RDIA 3OHAA 3QIPA 1WDTA 1UEKA 2OH2A 4U9DA 2R7TA 3B71A 4NLXA 4OYZA 3TAMA 4E17A 2IRYA 2IA6A 3CULA 3KHHA 3ILJA 4DR3F 4QYZJ 5K20B 2KHCA 4C8KA 2J9WA 2YWHA 3MEGA 1U0SA 2CA9A 5C2GA 5LJ5Y 4BJ1A 1NDKA 1SV5B 4OI2A 4JI1F 5HO4A 4CNZA 4FYWB 1NK4A 1E2XA 2DISA 4DBRA 3LQVA 3QVZA 5IWAJ 3I4UA 4IB4A 3TVZA 2WHOA 3BB5A 3OVAA 4HDGA 4C8NA 3K1IA 4P2FA 1OXKA 4EI2A 4I7FB 4XWJA 2XY7A 3MUMP 1FDAA 2IRUA 2XSEA 1AUDA 1VLOA 3Q2SC 5G4DA 2ABYA 1T6IA 2NG1A 3ZQVA 1C1CA 4ZP9A 3KUGA 1C03A 3SCIE 1O6XA 1BHNA 3ZZOA 1B0TA 3HKWA 5C5JA 5GADI 2J0SD 3LESA 3NNHA 4PQAA 5DGAA 4U5CE 3TOMA 2ZBRA 4IRUA 1V3ZA 3I56S 4USHA 2XMUA 3EZIA 3ULHA 2W2PP 2HK2A 2PF4E 2W9BB 4X4VA 2D3UA 3W3SA 4L76A 4C6AA 3NDBB 3GYGA 1NSKL 3Q8YA 1YSJA 5KFUA 2R7VA 5KFHA 1S6PA 1TR0A 2RE1A 2KXHA 4LFAF 4EEYA 4HE8D 5M2RA 2FLLA 5D78A 1DZ5A 5CZVA 2M7SA 3W8PA 2YWAA 4DV1J 1LW0B 4KGZB 3ASOC 4CS8A 3WX8A 3V6DB 1TELA 1RCXB 2DH8A 4WJ0A 4ECQA 2A0BA 1E83A 1Q86T 3POVA 4LF2A 3EHMA 1HFEL 3AOBA 5L1IA 1X60A 2HSEB 2ROGA 4ZCMA 5DM7Q 1N4LA 4NXNF 3OTCA 2AJ1A 3P49B 3THPA 3TUPA 4LFCF 4JC7A 3V5ZA 3NMJA 2X7IA 2VOOA 4LIWA 2BDPA 4YB1P 2XS1A 2DK2A 2IFXA 5T7LB 3C18A 3AQCA 2BE5F 5FDLA 2VG7A 1YJWS 2D4UA 3LP2B 4QWCA 1Q0FA 3DRPB 3NYJA 4FKXA 4O6YA 2Q66A 3KMSA 1ZW2A 5BYSA 2MDAA 1QAIA 5SUHA 3CCTA 1NHVA 2OTLS 2RRAA 4CO0A 3GCWP 2H5EA 1K1SA 2CQIA 1VRTB 4CO5A 2AT1B 3B4DA 3KMIA 3NBPA 1RHQB 1KU2A 3THVA 4LFBJ 3G82A 1C0UB 5A6BD 4D3GA 2YL0A 2CNOB 3KG0A 4U6PA 2ZH5A 3PIPQ 1RT6A 5F8JA 1Q4RA 5C25B 1WHYA 2C3MA 2BYCA 4UQGA 3EG9B 3LS1A 2GC8A 4ITSA 4X4PA 3Q22A 2GHWA 2P6TA 1XN9A 1G2EA 4DV7J 3RB4A 5CH7B 3EGWB 1CQMA 1PJ7A 3D66A 4OV6A 1WHWA 1CPRA 1HWIA 3LO3A 3HP6A 3MM9A 4DQRA 4CJOA 4ZOSA 4ECUA 3X1LB 3K5MA 4C3LA 1KQSR 1KC8T 3TVKA 3CWJA 1WKJA 2Q3PA 1NH8A 3W2WB 4KKOA 3ENAA 3HD1A 2HFOA 4YHHF 4HVZA 1AZSB 1M57C 4DQIA 3UMHA 1K44A 1T7PA 1HNXF 1P8GA 2AU5A 3NWRA 1YI2S 5DQZA 5M2PA 4V19J 4DV3F 4MVUA 1C0TB 4QIWD 1LWCB 1N1CA 1RACB 1GS9A 1RAHB 1SUQA 3KTQA 4KC9A 3B9QA 2GO9A 4UT4A 3C15A 2UUBF 1S0MA 3LANA 3ZTMA 3H2UB 3IRWP 2OEXA 1I5NA 1UPMB 5J2MB 4XPYA 2W7AA 5K0IA 2G62A 4RW7A 2ZBIA 4GMKA 3WQPA 3G50A 3BO3A 4MQ9F 5KFXA 2B4OA 1CULA 1WJ9A 4XEFA 1NK6A 2A0UA 2QTWA 4HR2A 2UXCJ 4ULVA 5K8PA 2KRBA 4OL8A 5D77A 1X9MA 4JYAJ 1JKHB 5E3AA 1D0YA 2ZJRQ 1Q7YT 1FI4A 1OYDA 4F4ZA 2VQFJ 4DXLA 1SZIA 4BJ5C 1NBEB 3I9ZA 1F1BB 4ZPWR 5KT5A 2F22A 2RIJA 2EW9A 3UO0A 4LF6F 1EP4A 1IWGA 4JI8F 1JB0C 3I0RA 2LP4A 1LQ9A 3RW6A 4NCAA 3MM7B 5B09A 3EZHA 4CDAA 2QO3A 4PAAA 3BR9A 3GEIA 4A47A 3QT6A 4JI3J 2FVCA 3V5RA 4DL4A 4I1OB 2JRSA 2KFZA 1TV6A 1WWPA 4BC7A 4KFBA 2VH7A 3N4WA 5GMEA 1FNXH 2LQ9A 2XWXA 4XDDA 1GMWD 1U1OA 1GFWB 4JEBA 2C28A 4KT0C 2UVWA 3BRJA 1HR0J 2AIRB 4B9NA 1RJ9B 3JYHA 2HS4A 4FF2A 3GR0A 4AK9A 5D8HB 2I15A 5IT9Y 3J80U 3B0VC 4HI2A 2OPQA 5B0FA 3L4BC 4DR1J 1TKDA 1WEYA 3SP1A 3AGUA 3KK2B 1UETA 4KPCA 5T1DB 3HFVA 4CH1A 5HMZA 1RK8A 2WVDA 4KAIA 2JVRA 2DXFA 4F0MA 3DLHA 2P9GA 4QI0A 2KNHA 3C6TB 1EHWA 4CLZA 3D2WA 4PG5A 2F4VJ 1JLFB 4EHPA 7FDRA 4CDIA 3GCXP 2B5JA 3M1VB 2ZXPA 1YBTA 2BA9A 2KB2A 2GAHC 2JWNA 1KEKA 4HHUA 3W1YC 4U5GA 1N32F 4YN3B 5LXRA 3KLEA 2XBPA 3MX3A 1SMYF 4I2QB 2FHOB 3BV8A 3EX7B 2OPSA 1RTZA 1XWLA 2UUIA 5K8NA 4WFAQ 2N82B 3NY0A 4O3NA 2KJVA 3M15A 2XZDB 3OFFA 2VBWA 2UZAA 1AFIA 1UG7A 4B3TF 5K14A 3EMTA 4RW9A 3BF4A 3RAQA 3IWNC 2CIMA 3IAM9 2VB6A 2PO4A 4XIUA 3DM2B 1R0AB 5KYYA 1U02A 1WC1A 3LAYA 4RWWA 1OCZC 4F4KA 2VDIA 4LF4F 2CYDA 2V63A 4ECYA 2EIKC 2I6WA 2RDJA 3AD7C 1FJ7A 4H4KA 3R7NB 3M6UA 2O1PA 3HMJG 1KP6A 4X4UA 5DO2A 3NGDA 1RTDA 3T1HF 1Y7PA 4QDLA 3D6TB 1FNOA 4NLYA 2LEPA 1R8HA 3M1CB 2E66A 2D3ZA 3K7DA 1RTJA 2P2CB 5EUHA 1T95A 3RW0A 4HACA 3CJSA 3UNGC 5DDRC 4EK2A 1YG0A 2JC0A 3GFHA 3DI5A 3K1HA 1BGXT 5EGYA 3KNAA 1TL7A 2QEXS 3DOLA 1FFGB 1O8BA 1YZ6A 5CCMA 3VCDA 3KL4A 3EZ5A 3GSIA 3GV5B 2XLOA 3JCUQ 2ZH4A 3BKUA 3W65A 1VTMP 2XCAA 3DJNB 3MR7A 1VQNS 4IOAQ 1Z23A 3KYLA 1NK7A 3B78A 4X64F 1HWJA 2VG6B 2CJYB 4LVNP 4G6VB 4OI3A 2WVOA 4GEHA 4TYAA 2B7CB 3SXYA 3QQCD 4I6WA 2MZSA 2BUNA 4Z9HA 3L7UA 4ICLB 2XL6A 3OXGA 4YT2A 1R8CA 2ZHAA 2ADCA 3DM5A 3RH3A 1PBAA 2FHJD 4MYUA 4IFYA 4O44A 3VAGA 3TJ5A 4MNDA 1HW9A 1UKUA 1EZZB 2M70A 3MEGB 4Q0BB 4RLEA 4EYIB 2CJAA 1TFYA 1EKSA 3G6ES 1CJVA 4F3OA 4PG7A 3I4PA 2VC9A 4CNYA 4F25A 4U96A 3K7RA 1YZ7A 2RDDA 3PYDA 1ZZFA 4IAQA 1Y4ZB 4F4AA 2C3PA 3B4MA 4DF4A 1OQ3A 4FZVA 1X4EA 3IQ6A 4P2MA 4WXOA 3NKEA 5CYJA 1VRUA 4UZBA 4KV8A 1WEZA 3VAFA 3DOKA 4FYDA 2VA2A 3MXHP 1C1CB 4IKAA 3M8SA 4MTOA 1K0TA 1M5SA 3AD8C 4BDPA 2MKCA 2OP5A 2XYHB 4ERDA 2N3OA 5HLFA 5IV3A 4NYZA 3S84A 4B3OA 4ZVRB 2Y69C 4DJ9A 1FFTC 1WTFA 1WN0A 4NI2B 2H54B 1QLEC 4USWA 2WW8A 1M1KT 1WF1A 3C63A 2ZNYA 3C8GA 2XO7A 4K7BA 4LFCJ 1N5SA 2VJUA 4ZP6A 1WGWA 3GJQB 3PMRA 4CS7A 4F3QA 5DS7A 1WHXA 1O0PA 1JOGA 2JLFA 2GDCA 2XM4A 3MI7X 5KFCA 4ZHRA 2ZNZA 4CS9C 2FC8A 4K59A 2KZZA 3IRXB 2EEYA 2Y0BB 1WOOA 4Q2MA 4ZK7M 1G1XA 3N01A 5I3PA 3LAMA 1OCCC 2J6UA 2VUGA 3K8WA 3PEJA 1RZMA 4JIOA 3PFEA 4DHVA 4C8YA 3QJJA 3H40A 4YL0A 1MU2A 4JEAA 2OMLA 4TN2A 3T1YJ 2HQCA 2J7PD 2EPKX 4KY3A 3QPIA 5E2QA 4MAKA 4NL5A 3CDAA 4CIHA 2IVMA 2AGQA 4KNVA 4DSIA 2AF6A 1OPZA 1OS5A 2QT7A 2UXDJ 1D8ZA 3B6BA 2FC9A 2GAQA 1XMQF 1T9XA 4EMDA 3QGPA 1Q78A 2F1FA 3CVKA 4ED8A 5FDLB 4OJGA 1U4BA 2HKVA 1QSSA 2CNWA 3DLBA 2UUWA 1U26A 2LECA 2XS7A 3J7ZT 4DS5A 1IKXA 4LR9A 1U1KA 3OJUA 3F47A 1RKCA 2IJNA 3ZTRA 2ZUGA 1KVJA 4PRFA 3FMWA 2DBBA 4W90B 5A2QY 1AT1B 1HW2A 4X4SA 4J9PA 4NWBA 2ACMA 4FWVA 3GLJA 3EGZA 2CPIA 1AROP 2O3DA 4YHHJ 3SSQA 1FKPA 2XM0A 2KO1A 2VBYA 3G82B 2RUGA 2I9SA 2RRNA 3PW7A 3T6BA 1HNXJ 3TOLA 2E9TA 4DV3J 1NM2A 1RT6B 4HL9A 1M5OC 4CP5A 3KK3B 1D8YA 3JQJA 2RQCA 1TVRA 3O2IA 2IM8A 1SC6A 2BKNA 5E0OA 3NGTA 1HBUB 3D6FB 4RNHA 4I0WA 2CNNB 2PGCA 1J5OB 4LF9F 1Q8LA 1S7ZA 2G1HA 4QOTA 2HRYA 1O5HA 1VGYA 2KT3A 3JAMY 2HMIA 1WELA 2NYHA 4JCHA 2GX8A 2KXNB 2KJWA 2R25A 4YDDB 5DQHA 2W2MP 3QSYB 2ZH7A 5DQIA 1Z7Qc 3MTKA 3RQFA 1VOMA 1C02A 4EZ6A 3W9IA 3SEOA 3G6VA 4F7VA 3NEKA 2FB0A 5KFGA 2Z15A 5DETA 3KH2A 3SSRA 4WF9Q 5DDOC 2JLEA 2ATCB 4C9DA 1RYRA 3NYMA 2FGOA 5K8OA 5COFA 2AP3A 1T6UA 2D9OA 2ZOFA 4ECWA 1S9EA 1BE4A 3GORA 4NMXA 5HBMB 1JJHA 4DFKA 2BRLA 3H42A 3M6VA 4TYBA 3CD7A 2G1DA 2M2BA 1Q7LB 5C7PA 3BPDA 4DEZA 1WG5A 1RISA 4UOHA 1HPZB 4CLPA 3HSGA 1ZA1B 1RTHB 4A8YA 3JTOA 2EC2A 1VB5A 3AJ1A 4B9LA 4AE4B 1UP1A 3DYAB 2WB4A 2XS2A 1R31A 4Z37A 3KJFB 5ITHA 3TR5A 2IHR1 6FD1A 3AODA 2KZMA 3DI6A 4M5MA 5IZHA 3GJRB 4M5JA 2E44A 3FFIB 3PM9A 4LERA 5GMDA 4YT4A 5C42B 4ED1A 5H1SV 4FNIA 4O6MA 2XCPA 4CH0S 1RHUB 2PBEA 3DXSX 2AEJA 1EX8A 3IQ5A 3PW4A 4FBUA 2HUJA 3I0RB 2FGCA 3ABMC 3KLHA 1V3SA 3C16A 1WC4A 1D3WA 1I1GA 4MK7A 3GIIA 3KJVB 1FKOA 2YPZA 5K9FA 5IV4A 3E70C 1D09B 1N6QA 3KMQA 4LF1A 5DG7A 3I0SA 1B0VA 3D0HE 2BKPA 2M3DA 3N5BA 2YNHA 4C98A 1HBOB 1V5VA 3VM6A 3GFYA 1FFHA 2YHSA 3M8RA 3EYZA 4NC3A 3D7SB 3L7PA 5HMYA 1N32J 2G4BA 4DMZA 4OYIA 2BE2B 1S05A 1VMAA 2K2PA 1T11A 4PYAA 2AJ0A 2G2ZA 2HHHF 1W2IA 3QZ8A 3I87A 2QFJA 4JV2A 3UE2A 2B0GA 2C2EA 4URGA 1CJKB 2WCXA 3IM8A 3MMCA 2VKZG 3MECA 3FXHA 2OEKA 5E7OB 4ZPDA 5KT3A 2AYBA 3DHXA 2FJXA 4OJ1A 2DNPA 4DV4F 4NXMJ 3R2CJ 2HGNA 4HYKA 3PY8A 1UA1A 1VMBA 3BGRB 3B54A 1RAAB 1LI5A 1DOWA 3MMAA 3MDFA 2IVFB 3G4SS 1YVIA 3NAIA 1QE1B 2N7YA 3JSEO 4MS2A 3F44A 4C3MA 3QBCA 1YK9A 3ZIBA 1LM3B 4LUBA 3LA0A 3T1HJ 4JOUA 3C14A 2IC3B 1KOHA 1P1TA 5EWGA 4PG8A 3OUYA 3TX8A 4EGLA 3QYYA 1QTNB 2PD1A 2WOMA 3V4MA 2B4PA 2QSWA 5L1LA 5LOQA 4I44A 1NHUA 2P6SA 3PTWA 4CLWA 1RCPA 2HFIA 4UDVA 4DL3A 2MZQA 3QO9B 4GC7A 4XTKA 1EIYB 3NP5A 4WWSA 1S1WA 2KM8B 1C17M 1WG1A 1SQGA 1T02A 4MFBB 3EUNA 4JI5F 3BYRA 1IW7F 5IC6B 2LQGA 4USTA 2RSEB 2HQFA 1O87A 4X64J 4ECTA 3H0PA 1BR2A 3MAAA 4NCGA 2XXAB 3CDBA 4RNFA 3CCUS 2XB2D 1YRTA 1XIQA 1I3OB 4KB7A 5IT0A 3D3BJ 1S59A 4DQQA 1CJUB 3RGIA 1OY9A 3CJ8A 4BS2A 3PYFA 2VQEJ 1MNEA 1RKEA 1JNZB 2V8GA 3EHNA 3Q6MA 4B3RJ 2MHNA 5FCLA 4OZJA 2VC1A 4J9KA 3TK0A 3UD5A 3LALA 1FERA 3RTVA 5KFYA 5HI7A 3V81A 2C2ZB 3OLAA 2V2KA 1XR7A 3AB4B 5KYNA 4PXBA 4WK3A 1WC3A 1VQ4S 1ZZNA 3MOZA 1Q0GA 5A6PA 2XS8A 1U1PA 2ASJA 2XYPB 1TKTB 1KQKA 2BQRA 1U1MA 3KNGA 2XSFA 2EIMC 3BSCA 3ABLC 5EX3A 1HBMA 2F8HA 4BJTA 4HH1A 1IWAA 4ALZA 4U5FE 5KT7A 3US5A 2V69A 2DRBA 2BXJA 1N54B 3TUZC 4TXSA 3R5BA 1RAGB 2W8KA 4RWXA 5AJ3F 4YL3A 2J6SA 3HNJA 3AG1C 3AA8A 3KWMA 1N5YA 2KJGA 2CWKA 3CDUA 2XLKA 4CX9A 2XY6A 2YWGA 4NQFA 1QQ3A 3QFHA 4ZN3A 1JIHA 3W8GA 3OR2A 1TAUA 1MG7A 1X8DA 5I42A 3PZPA 2CZVC 3MF5A 2CPHA 3NGSA 2DY1A 2I8EA 1RI7A 4MVSA 1UJ4A 2ZZNA 1WTBA 1M6TA 4MVZA 4DL5A 1F2HA 2HURA 1D0XA 1HA1A 3R5DA 1Q1KA 2KQ9A 2W2OP 1KFSA 3AD9C 3DOMB 3KOAA 3CZ6A 4UUWA 1QPUA 1TKXA 5F9LA 3POTA 5D3GB 2DHSA 2OFGX 4GKKF 4WFZA 3DDKA 4ECXA 2B4UA 1LWEA 4QBUA 2L08A 1XQIA 2MB0B 1IKYB 3O39A 1XBWA 3C8GB 5HQMA 3CJRA 1OMSA 4OHWA 4DOZA 3MD1A 2FJEB 3QZCA 1XMQJ 4ZLNA 2NUPA 2WONA 3EGVA 2UUCF 5JS5A 1EJ7L 1XWJA 3FUYA 1F9EB 3RB6A 2DT9A 2YNGB 4WIIA 1T03A 3UDCA 3MUVP 3EM1A 1KDNA 2XEXA 2ILZA 2B6AA 1REVA 5A69A 3NNAA 4LSNA 3A13A 3NKDA 3E01B 4OV1A 2JZ5A 3SCLE 3TZWA 4OZ2A 3QATA 4BPMA 2FPHX 2V2ZA 1GQEA 4NRTA 3I6PA 2YKOA 3DLGA 3L34A 4C2MA 2E5HA 3OSNA 1G3OA 2MSTA 3EWGA 1BR1A 2H4YB 3M4CA 3FGVA 5M2UA 1SC3B 3S8SA 3EGXB 4USIA 1FRIA 1S7HA 4BEJA 4XK8C 3JB9k 5HVGA 1ZS6A 4WCEQ 3AOCA 1LK7A 2BJ3A 4GC6A 4CSAC 2LDIA 4EIYA 3SYNA 4WE1B 3NLCA 1NFNA 3U3BA 5KG7A 2R9LA 3BM7A 3R2PA 3ZC4A 4KH1B 4QR0A 1WI6A 1SQFA 2FLNA 4CO1A 1ZHTA 1UFBA 2N4DA 2ZH1A 1VQOS 1HQUA 1KS2A 3GE9A 4WK1A 4JURI 1KVIA 2Y3YA 2JEFA 1Z1ZA 1E6VB 2IRXA 2QMXA 1FKPB 3KFWX 4LSLA 4FS1A 2OFHX 2BACA 2D5RB 3BH7B 2WVEA 3PO5A 3BSAA 4R5PA 2YX7A 4JV1A 1VQYA 2DR8A 3TJ9A 1HI0P 1NZEA 1EKYA 3OVSA 2XMKA 4I56A 1H7IA 3AJ2A 4IOBA 1Q95G 1FTCA 3CCZA 3CAXA 1GQAA 4ZDNA 1E6YA 4NY3A 2VG5B 1M5VC 4KI2A 1RWXB 5IM0A 3H59A 3O1LA 2NSBA 2ZH2A 2JHEA 5G0RA 4DV6F 1OJ4A 4QW8A 2NQPA 1FWPA 4RJVA 3RRKA 1YRUA 4U5DE 1ZVZA 3FZBA 3E3XA 4YB5A 4IUFA 3EJNA 3PVXA 2P7VA 1WEXA 3JTNA 1RE1B 3M8YA 3LAKA 5JVGQ 4DPUA 1OSCA 1UVMA 3QLHA 3PV8A 2BMBA 5DZ6A 1H9GA 2RMLA 4LT6A 2PEHA 2Y1LB 4AL7A 3I9V9 4MYTA 1XNQF 5A6AA 4JI0J 2YWEA 4KO0B 4W8PA 4ZS6A 1WOPA 4WXWA 1HW8A 1RT7A 4W98A 2WRMA 3V6HA 1EETB 4O6NA 4U9EA 3R3TA 2CQCA 1W2BR 2KDOA 2D41A 1X5PA 4JP8A 1VFJA 3T19A 5B0CA 2VU5A 2FDNA 3QT5A 5CD4A 1RBAA 1MLAA 4NLDA 3BSOA 4XEVA 1TFWA 4F4BA 2HHHJ 5JLIA 3CDWA 4F0KA 3ZZ0A 3GG0A 1V74B 3FBEA 4O3OA 1ITPA 3IGVA 2ROPA 2R8JA 3Q83A 1RYSA 3D1OA 4DV4J 1JLGA 2MEWA 5KG0A 2R2SA 3NGKA 4ZVSB 2DGTA 1W2WA 3N24A 4DPTA 3JQMA 2PMZD 1WDDA 1I4YA 3KKBA 4J9QA 3DLKB 4U5EE 3ENVA 1D9AA 4BBYA 3PO4A 3DM9B 3BZQA 9RUBA 3UFCX 2UVVA 5CA5A 2LU1A 1LE4A 4Y2AA 3TW0A 3SV4A 3D6MB 3MEKA 2XG8A 5B0BA 1N34F 1EA8A 2F5GA 3KHRA 2HFVA 4EZ9A 2WVNA 2BC5A 1F6TA 3W60A 4K4VA 2DXEA 2YKMB 3VAMA 2DGSA 1UZHA 1NJZA 1BWEA 1M0SA 1C4CA 3FVYA 4LF5J 2W9YA 1CJTA 4JV5F 4O0NA 1UEVA 3F41A 2QTVA 4ZVHA 1T9VA 2HIQA 3MMAB 4JI5J 3US6A 2R7UA 3BGFA 3HJFA 1WUUA 4Y2CA 5L0JA 1KONA 2CCYA 2GQCA 4DVZA 2DB1A 2EK6A 4KHPJ 1RJJA 1M5HA 5A8RB 1P9QC 3KDNA 4U7CA 1Y3KA 4F02A 2XMAA 1HYSB 4Y2MA 3SIPB 1G4WR 4L3KA 2J5AA 3OVBA 2BBEA 1PD1A 3A3NB 2YWWA 3D68A 1RSCA 1TL1A 1RTIA 1WSVA 2RT3A 4DPYA 4HTJA 1X4GA 1LNQA 3CJQA 2OI2A 3TZYA 2DYAA 4K0KJ 4QIVA 4Q5VA 2IM1A 1HWUA 2I8BA 3HHKA 2DGXA 4QZVB 3M9NB 1SIWB 3I32A 5JUAA 1VC5A 1WC5A 4WZQA 2QMWA 3CC7S 1GMWA 3S27A 1H7XA 4AX2A 1U0HA 2NSCA 3TAQA 2BANA 2V8HA 1YDLA 4FYXB 2W9CA 4DUYF 5DG9A 1GXTA 1KR4A 4A8SA 1PAEX 5A6JA 5A0YA 1NK0A 4M5LA 4G1QB 4ETZA 3ZZPA 4MMOA 4JW1A 2A18A 5COMA 5HP1B 1VYKA 1KLMA 2EFGA 4PQUA 1RT1A 4WTOB 5L3VA 1N33F 5KFAA 5E33A 2X1FA 4HT7A 2XI3A 1VK3A 2C3YA 4IWBA 3AA9A 3C6UB 4FVMA 1NHKL 1NK5A 2CPXA 4KE5A 5KFVA 5E3PA 4B9MA 5T41A 2MJUA 1S97A 4I2PA 1NK9A 5J1PA 2RQ4A 3FDSA 1YWXA 4HFKB 1R6VA 5HATA 3GIRA 1VISA 2YNFA 2LQJA 3MMBB 2VJVA 1QTMA 3C46A 4NRUA 1S77D 3J80Y 4ES1A 4ELUA 4E0IA 1RLCL 4QWEA 2Z8QA 4RBNA 4U9RA 1C4AA 1H7WA 2L7AA 4BJ6A 3NS6A 1IKVB 1NPPA 3D3CJ 5KYWA 1ORJA 3AG2C 3JXOA 3FKBA 3MCMA 1WKLA 2P0NA 3K89A 2XMJA 5KFLA 5L0GA 4F04B 3JTLO 2WVQA 3RR8A 4B3MF 4G1PA 4RU2A 4J9UE 1GX6A 5L0IA 3B0UX 1OW8A 3QMKA 3TEGA 4YL1A 2PIIA 1T8EA 5CHCB 5HSPA 4C11A 3EPVA 2DB4A 2FZGB 2EPMX 2EXUA 1VBZA 3FRYA 2QLFB 4GKKJ 2HHWA 4OIQF 2JJ4D 4FKYA 4NLUA 2VD3A 3MPWA 2NZ4A 5CZXA 1G5ZA 2XHWA 3OR2B 1SH0A 4PUOB 2Z30B 5F8MA 1UVIA 3IWLA 1GT8A 1FNMA 3FCVA 4ZPAA 1FE4A 4Y65A 2AQ4A 3UCZP 1YZCA 3MM5B 1U24A 3I5QA 3PXGa 4U8YA 5FLXY 3VAIA 1APSA 1S1UB 4LQ9A 3ZTZA 3HHLD 1TKXB 1TKZB 4P9TA 3J7Z5 5ETRA 2LQ5A 1HIYA 4OI4A 2ADBA 4DCPB 2IXPA 3S6EA 4WKRA 3MEEB 5AC4A 4TU8A 4X4TA 2AX1A 1NU4A 4RUAA 3QRRA 3PACA 4UTGA 3CTRA 2OUGA 4BCAA 2ZBPA 5ETQA 5B3IA 2WONB 2HHQA 4DX8H 2E1RA 2MY7A 3LUYA 5AXKA 2B56A 2IDEA 2LQ8A 2AWCA 4DFPA 4N56A 2E1AA 3ISNC 1SVDA 3RBDA 4AYBD 1DTTB 3CCES 5GAEU 1JXVA 4KBLA 1J5EJ 4FP9A 4DR7J 5CI9A 1EI7A 1SV5A 4E0HA 3HVRA 2E9RX 1FRMA 1A6LA 3NOCA 1NZ8A 2M4EA 1HNVA 4RW8B 1YX2A 5B08A 3DLGB 3NCQA 2FFHA 2HHUA 3LWMA 3O3LA 1FMVA 1HQ2A 1FMWA 5U47A 1PILA 3A3PB 3R6LB 1X0FA 3RUBL 4UUXA 3VGUA 4OZ3A 5BUOA 4I7FA 3H5XA 1RBLA 2BJ7A 2LD6A 4YK5A 1EQ0A 5F5FA 4X65J 3M8ZA 2HWHA 2YQ1A 3PHEA 2E1PA 3EDRB 3GQCA 4ZPBA 4BHQA 4OYPA 2R7SA 4P10A 3RQGA 1I5OB 3ITHB 4A8OA 4IOCQ 4EBKA 3GYXB 2ZH6A 1N36F 2OPPB 4RX6A 2FLOA 5IWAF 2FJDB 2JD3A 1ZHWA 1SXLA 3L3CA 2VBZA 2W9BA 2DPIA 4ECRA 2MPUA 2FZKB 1Z6AA 2DD8S 1NEEA 4IQMA 2U1AA 4CLKA 4DX5A 3ZZTA 1R43A 4NLQA 3BGOP 2YH1A 2JH3A 4EUVA 3OSPA 3N6NA 1PJ6A 1IR0A 1XNQJ 1NDPA 1V55C 2H7OA 3GPAA 1SB6A 4ZVOB 1LW0A 2CFXA 2DO4A 3V6DA 3DLEB 4YWQA 2DEJA 3EDQB 3K0JA 5F0UA 2VFRA 2KHDA 1TP7A 1MWZA 5C24B 2MHRA 3JSYA 4XLNF 1Y0HA 4ES2A 4FDFA 1BQXA 3UD4P 5GAGI 4IRCA 4PR6A 2KTQA 1PAUB 4Z9IA 3IG1B 5T7LA 4LDQA 4FBTA 1HNZJ 1QVXA 1AXQA 5GMKa 4KJIA 2UUTA 4UY8T 4NLSA 5HVHA 5CI8A 4JI6F 2HVDA 1HHQA 1ORSC 3LP2A 3DRPA 4S0MA 1S5ZA 4IGGA 2YRFA 3SDEB 3IXQA 1U1NA 2KC3A 3ZTOA 2W4DA 3Q7GA 1GTHA 3KPHA 2G3KA 1OQ6A 4DV1F 5KFRA 2QYGA 3ZFVA 1JLBB 4WYWA 2R4FA 2XULA 1K8AT 3D67A 1FHTA 1SKRA 3TQ1A 4Q44A 1OCRC 1FAPB 1K40A 1VRTA 4DLEA 3PEHA 3KK1B 1YVFA 1T3OA 4EBEA 1M2VB 2KFNA 2HNYB 3W9JA 1IQZA 4NTBA 3TNVA 1WATA 5C25A 3EVWA 3NRBA 2Y8YA 3EG9A 4Z7CA 1NAQA 1TWGA 3HNKA 2BE7D 1RT3B 4HDHA 1Q8IA 1YJTA 4MVOA 4CM0A 1X4AA 3K5OA 3TAPA 2Y9HA 2RRBA 1UL3A 4O79A 3NGUA 3U1MA 2KG1A 3OW2R 1MMDA 1Q8KA 1S1XB 2AZ1A 4OMFG 5HAOA 2HYIB 3R5CA 4XPEA 1QVFR 4DX7A 4I68A 1LKZA 1FD8A 2P8IA 4LIRA 2UUAF 4LFBF 1AZSA 2G2OA 3I55S 3CCVS 4LLEA 1HY5A 2PDAA 2HZ8A 5BQIA 2DH9A 1LS4A 1C0TA 3NCPA 3EFOB 2L9JA 1H3DA 3BQ1A 2XLMA 3KHGA 3A8JA 4OLOA 1VR6A 2LXIA 5KFFA 3GSDA 4A8XA 1W7WA 1LOUA 4OINF 4DRJB 2M88A 2A6EF 2V6AA 1TR2A 3K57A 5J2MA 2C22A 1S7IA 2RQMA 2NXCA 2GIQA 2HZVA 4Q43A 1T9TA 3IAS9 3M32B 5KTQA 1IBLJ 1RKIA 4I1MA 4M5NA 1FVQA 3I31A 1N88A 2E1MC 2KSFA 1YGYA 3BDPA 1HBNB 1QY7A 1NJWA 4DU7A 1S9GB 2KVIA 1AUEA 1H73A 2ZPAA 1U2RA 3FBFA 5IOLA 5DLFA 4NA2A 1SBRA 2E9ZA 3IBFB 4NTFA 4N76A 1ZW3A 3GEHA 4ILMA 1T0TV 3HHNB 1ZETA 3UVJB 2YLGA 2EIJC 2RF2B 3D28A 1JKHA 3PW5A 2XSJB 1F60B 2NXJA 2CQHA 2ZOGA 1C1BB 3GM3A 4G7HF 3E9VA 3V2UC 3PNIA 4WABA 4G1IA 3EXCX 1O51A 1CPQA 2E5IA 2K3IA 3B82A 1RTIB 3MM7A 4J7TA 1UAWA 5HROA 4ZPTR 5CYMB 1N33J 1FESA 1HWLA 1CC7A 3P5TL 3JTPA 4J91A 3U0CA 1RT5B 2ZDPA 3W5XA 2DJWA 3KXDA 1VLTA 1XMOJ 4Q5SF 5A8KB 3KUEA 5ETPA 2W2QP 3AAWB 2HRTA 6AT1B 4H4MB 5HJYA 2GAGC 3HXMA 3G8QA 2VC0A 2UXCF 3S29A 2ZWOA 2PFFB 2XZTB 1NSGB 4QQBA 2EINC 2OELA 4NLVA 5L9XA 3EH2A 3K59A 3S01A 3NL0A 5IXUA 2NS1B 2EFPA 2B9WA 4QYZK 3HX9A 2ZJPQ 3G8SA 1D1BA 3TZXA 2LMIA 1UWBB 2GNKA 5KFNA 3T9OA 1RAOA 4EBBA 3BO4A 2MQQA 3KK2A 2J8SA 3UDLA 4PQUB 3I5PA 2OPRB 1LI7A 4F50A 1T9WA 3ASNC 3J7YU 2LCHA 3AH6A 4JI3F 2GMLA 3T6JA 1MMAA 2DHXA 4B3SF 4B6IA 2QLJB 1E86A 3C6TA 3AT1B 4ZLPA 1R8PA 1UW4A 3VVUA 1JLFA 2YKAA 2ZOMA 3M1VA 5IQ6A 4WFYA 5DDQC 1HR0F 1Z5ZA 1KBRA 3TEHB 4AL0A 3LP0B 3SYZA 3FMSA 3GILA 1U1QA 4I2QA 3OFEA 3ETMA 3NS7B 1GX5A 4LBPA 3UCUP 3CGIA 2YWFA 2B3TB 1MROB 3TRGA 3CNQP 2WBRA 1D9DA 2WSCC 1RWOB 4USUA 4OX6A 2L6HA 1T94A 1REGX 2DITA 4DR1F 3MBGA 2DHHA 2XY5A 3MYFA 4P75A 4JJGA 2OJED 4W8KA 2CUYA 2GMHA 3U02A 1IVZA 3CDEA 3HSZA 2DIUA 4ULWA 3DM2A 1R0AA 3H2LA 1VQ5S 3NMKA 3MLGA 3CJTA 1H2TZ 3G6YA 4YB7A 4PXEA 3I4HX 4F4WA 4E0DA 3HHLC 3PFOA 3HKZD 2ASDA 4ZVGA 2W25A 2VFUA 1JLQB 3KJNB 4ED2A 3OPKA 1VC6A 1VBKA 4XTTA 3A8IA 3IPMO 1DQ8A 1PJ5A 3OA1A 1UPPA 4X66F 2IMWP 2V4QA 1DTQB 3U8VA 2Z58B 3IR5B 4ANEA 1FEEA 4QWDA 2CG4A 2DR7A 2E7WA 2YQ3A 2G0IA 2W7PA 3G4XA 4DN9A 2CQ0A 4WIQA 1FRXA 3DDIA 3E8OA 3RBXA 2W8LA 2W9AA 3LF0A 1JLCB 1M56C 1QSPA 2R8KA 4PACA 4ANDA 2W01A 4KSEB 2V2VA 1NUEA 3JYTB 4Y0FA 1RB0A 1CVJA 3LEVA 2TMVP 4OYXA 4TY8B 3KLVA 2HHTA 2RVJA 3A4TA 2XTJP 5JT4A 4IDKA 3CCQS 5DG8A 3IBWA 2WSEC 1D1AA 2VG6A 3AJDA 3IS9B 3K6BA 1FDDA 2FJBB 1VIOA 3BKFA 1W26A 2QFIA 3KLGB 1WSRA 1WD6A 2NSGA 3THTA 4ICLA 2QA1A 1IN0A 1F0XA 1DJ0A 3GWCA 3MPYA 2P1AA 2BV3A 4P9SA 3SQOP 3MM6A 3SQGA 1YIJS 4Q0BA 1KNZA 2J0QD 2MLZA 3VF0B 2AW0A 1HNVB 3SXKA 2QYCA 3ENWA 1N36J 1JR8A 4L3NA 2AEFA 4LVOP 2R2TA 3CC4S 3G9CA 4JV0A 4MVMA 1QDUB 2XHCA 1NXIA 4CLTA 2OIHA 4CM2A 3ZTSA 7AT1B 3OR1B 2V8VA 3IR6B 4DRIB 1ROFA 1S10A 3UGOA 2ZDOA 4CDYA 4Q4ZF 5D4PA 5FD1A 1FX4A 1ULRA 1PC5A 2VBXA 3W63A 5ETSA 4JZAA 2HVHA 2E87A 5DS6A 3UCGA 3UR3C 4NI2A 1ZYRF 3PRVA 3EPIA 3VZIA 4ZKAA 2DNZA 3ONQA 4L74A 4GQHA 4J9MA 3O44A 1U8WA 2R2UA 3M2UB 4ZLLA 2FVPA 2MMYA 1UFLA 4O4GB 1LEOA 3UI3A 2KU7A 1NDLA 3VHQA 5FZTA 3EH1A 5HN0A 1EAYC 5F8NA 3L0IA 2QIFA 1AB8A 1VYAA 4JI6J 5DQTA 1Y00A 3IRXA 1KVKA 4DV5F 1CSJA 2HNDB 4DR2F 4LRFA 1A7GE 2LEBA 1T3NA 1FK9B 4PCQA 4NCBA 2CPYA 1NB2A 2CKWA 3LEOA 1CC8A 3HLUA 3RIPA 1CGNA 2A6HF 2AHOB 4DR4J 4K4XA 4MTGA 4MTFA 4YDXA 2C42A 5CYQB 1U2FA 1KLNA 4F8RA 2CQ3A 2W1BA 3QGHA 2J9CA 1T9YA 1YAUO 3HVTB 2AJ4A 4NYPA 3CD6S 4KTQA 2VFVA 4HEAJ 5D92A 5I3UB 1S1TB 2R7XA 2J0XA 3T5JA 2JEGA 3RF3A 1NSQA 3IFEA 2J46A 2NREA 3N79A 4QWAA 1WACA 3BBBA 2Z4PA 3ILOA 3LTOA 5H9FJ 4N6HA 2E5LF 2KVQE 4K5SA 2EFOA 1U49A 2RAQA 1HLWA 3PKMA 2MGZB 3CJ2A 5I3QA 2ZM6F 4I4BA 1S79A 3R7BB 3T1YF 2UUAJ 2G3VA 2MQMA 3RAMA 2UXDF 5F9NA 3RVZA 2JDJA 2ZZTA 1QZXA 3KK3A 2FY1A 1VQ6S 4P52A 2X51A 2QLAA 1RWPB 2IXMA 1TUWA 2ZUAA 1H38A 1HBUA 2Q9CA 3NCRA 2BW7A 3M7VA 5AE2A 1J5OA 3T5KA 3H25A 3RYLA 3PJ9A 2PP4A 3VAYA 1A41A 2O9XA 3AXKA 5AXNA 4RKUC 1VQLS 3K1IC 1LFPA 3CW2C 2HVZA 4DUZF 2LU2A 4AD6A 5GAHI 3WC2A 3DE8A 2ZD9A 1RXOB 3ILIA 4PXCA 3FDQA 2Y1RI 2MLYA 1PGZA 1DRZA 4IQXA 3JSMB 2VZ9A 2OJQA 2MQNA 3NNCA 2DCLA 2LFDA 2CVIA 1AVOB 2VIHA 4A8QA 1C2PA 2HSQA 1R8AA 5HBMA 2LEAA 3G87A 1TL3B 1IR1A 5L0CA 1YQHA 2HAFA 5GADU 2HFSA 1HPZA 3J81U 2LXUA 1WOSA 1U25A 1TWHA 1ZTWA 5DM6Q 1RTHA 4EO8A 1Q5YA 1F1MA 2CWXA 2F7VA 3TUIC 3CJ3A 4AE4A 3OBIA 3AHPA 3DYAA 2BZ2A 1KKHA 1V5IB 3Q23A 3DGVA 1VJQA 3AOUA 4LDRA 4ID5B 3GR1A 3D4JA 3R5GA 4CLLA 2QZ8A 5A6WA 2VPYB 3FFIA 1R5ID 3RRGA 2OEVA 1BMQB 5F8IA 1UJ6A 4CS8C 2Z2MA 1PYTA 2M5YA 3QWPA 5C42A 2GO8A 4MT1A 4C7OA 1B7YB 4PXDA 2Q00A 1Q5VA 2F8EX 4DPXA 2LDYA 3IMQJ 2BJ9A 2EPIA 3GFZA 4QW9A 2IYIA 2HZCA 3DWWA 2FQQB 5K5MA 3JRTA 3EGDB 1SJ1A 2D3O1 2DTJA 3S90A 3L09A 3CUNA 3CJ5A 1P9YA 5HROB 5T3TA 4F3MA 3KJVA 2X0CA 2YX1A 3KKFA 3CMES 4Y2IA 4B3SJ 3W4YA 1JQGA 1HBOA 4DLGA 3LP1B 3FCWA 2J0WA 1TU0B 1CBKA 1Y4CA 2Q6BA 1S1VB 1N5TA 3VTIA 2SXLA 2NUTB 2BE2A 3Q89A 1GMUA 1IJFB 4L6V3 1NJIT 4R0EA 2RU9A 1KQFB 3T5LA 3P5BP 3H4BA 4B17A 4X0RA 4DN0A 5L0DA 3ZQYA 2D7SA 3ECSA 1JPJA 4JI4F 1VQ7S 1CJKA 2V4JB 4C7QA 4KRWA 2DNKA 3LNRA 2VPXB 4U95A 2CQBA 4K0DA 4R8UB 4AL5A 1O3UA 2X1AA 1LW2A 2I5JA 1RHKB 3LPYA 3LLKA 3HZEA 3SV3A 4IR1A 2OG2A 3BGRA 1G7CB 2IAJB 2G9OA 3NMAA 2CNWD 4KHRA 1QE1A 5KT6A
chains in the Genus database with same CATH topology
4K2XA 5IM0A 3H59A 3O1LA 3CE8A 2DIVA 1SJ3P 1HARA 4C8OA 2NSBA 2ZH2A 4N8NA 2JHEA 5G0RA 4DV6F 3DHWC 3NKYA 4QW8A 3AQPA 3M2VA 5B0DA 4LF8F 2NQPA 4OZLA 1HHTP 1ZHXA 4P2SA 2C2DA 3DU6A 4LLCA 4PPDA 4U5BE 3Q8RB 4OI0A 3W8IA 3RRKA 1JMTA 1YRUA 2GQQA 2DVIA 1J8YF 4U5DE 2DGVA 3N6MA 1TV6B 3UPFA 3H98A 4Y28C 2OCCC 2IC3A 3BJYA 1OWXA 1FRLA 2MWQA 4JUZA 3GIMA 3M6XA 3FZBA 3VQTA 3E3XA 4KFBB 1FRJA 4U5HA 2HGLA 4RD9A 3V4IA 3DFEA 4YB5A 4IUFA 3EJNA 4J9NA 2GJIA 5LL6d 3W8HA 3DCAA 3OR1A 3PVXA 1NKCA 2P7VA 1WEXA 3A1YG 3H4DA 3BEGB 3QJLA 5J2QA 2OAUA 3JTNA 3L95X 4I1TA 1NJYA 4BJ6C 3LAKA 5KG2A 5JVGQ 4P7VA 1OSCA 1UVMA 3M2RA 2CVEA 2BM1A 3QLHA 4LJMA 1WHVA 3PV8A 2Q79A 3RZAA 2RDIA 3OHAA 3G8TA 2RMLA 3QIPA 4LT6A 2IJFA 1QAJA 2Q3TA 2KKHA 5KT2A 2PEHA 2OH2A 2BVZA 4QPXA 4AL7A 3I9V9 4NXMF 4MYTA 4NLGA 1XNQF 2R7TA 4NLXA 3H2VE 3QO9A 3TAMA 2A68F 2PMHA 5KOWA 1HD1A 2IRYA 2OPQB 2YWEA 3RBEA 4KO0B 4ZS6A 4WXWA 4IR9A 1B0PA 3FCHA 4MFBA 2IA6A 3CULA 1S0OA 1HW8A 1FVSA 3KHHA 1RT7A 3GODA 2EG2A 4DR3F 2A2DA 4QYZJ 2WRMA 3OJSA 3V6HA 2VL1A 2KHCA 3RB3A 1EETB 4O6NA 4C8KA 3PR5B 3R3TA 2J9WA 3IGNA 2YWHA 2CQCA 4IJJA 2DGOA 3M2UA 3MEGA 2KDOA 2D41A 4ZPCA 1W2BR 1DARA 1X5PA 1VI7A 2K7JA 4I6YA 4O4GA 2FVRA 4OHXA 2HWTA 1NU9C 1V54C 1VFJA 4OX7A 5LJ5Y 5BJRA 3T19A 4BJ1A 5B0CA 4NZ6A 2FDNA 1SV5B 3IO1A 2XGPA 3HF5A 1SJQA 4OI2A 2XXAA 3T9ZA 4N47A 1K9MT 4JI1F 2F9DA 5HO4A 4CNZA 4NLDA 2ZD1A 3O5TB 4FXVA 3BR8A 1NK4A 2B5JB 4C3DA 2B9YA 5KFQA 3BSOA 2KRRA 5F8GA 4K4YA 1S6QB 4DBRA 2DISA 1TFWA 3LQVA 5DLJA 4F4BA 2R7WA 2DGQA 3LOUA 5J1EB 2NR0A 4KHMA 2DGUA 3KLEB 4BC9A 5LXYA 3ITFA 3CDWA 3I4UA 1BLUA 3AG4C 3TVZA 2WHOA 3ZZ0A 3GG0A 2HNDA 1Q82T 4FNHA 2OPSB 3BB5A 3OVAA 4HDGA 3CEDA 3G86A 4C8NA 3CO9A 4O3OA 2GHVC 1FK9A 3IGVA 3CCSS