3ZC4A

The structure of csa5 from sulfolobus solfataricus.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
157
Chain Sequence
PVAETISKRFWTLIKMLRFYVVLRRFGYIDPLIYSIDPKQIKDVLSEALREFVSYTSSSSSRSIVIYDDPKNPVTAQAPCLVVAKRDEIPQNFPSIYRYTIYKIDKSSEYCISPLVVNDKYATLITPNESVIKEFFDKLDSNIQYARVLASLAVGGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SSO1398
publication title Structure of the Archaeal Cascade Subunit Csa5: Relating the Small Subunits of Crispr Effector Complexes.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Immune system
total genus 52
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2012-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3zc4A01
3.30.70.2780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3zc4A02
3ZC4A
chains in the Genus database with same CATH superfamily
1UA0A 4JI1J 4DQQA 3J81U 3H40A 4GO5X 2VB6A 3OR1B 3CD5A 2IBFA 2KHCA 4P10A 4WE1B 4XTTA 2XTJP 3LPEA 1JJ4A 3JTPA 2G0JA 3HVRA 4IFVA 2AJFE 1LK7A 2P8IA 2N7CA 3IQTA 1T03B 3AGTA 1MWYA 3RBEA 3K89A 4YL0A 4GVBB 3RW7A 1R0AA 4I7FB 1I5NA 2OAUA 4YMEA 5A2QY 1N33J 2HVIA 2XS8A 1NKEA 2F7VA 2KK1A 4NLQA 4URSA 1CJTB 3FXHA 3IEEA 3TYTA 1XMOJ 4I44A 2ASJA 3KH2A 3HO1A 2IVFB 2YNHA 1DTQB 3CJ4A 4HACB 1WC0A 2H54B 4IDKA 3TWZA 1IBKJ 4PQUA 2LFDA 2R4FA 4N06A 2QTWA 4XAKA 4NCAA 2ZH4A 3IWNC 1U0BB 4Y6IA 1FTCA 1IBCB 3W2WB 3HCXA 4PACA 2J6TA 2QA4S 4CH7A 3R2DJ 4CYUB 2VPXB 1VK8A 1S1XB 3RBXA 3V7OA 3OFEA 5DLFA 1EAYC 2F22A 3F73A 4CI0B 2HZCA 3CIMA 3G96A 4DUYJ 3QPIA 5HAOA 4Y65A 4Z9HA 5RUBA 4UZBA 3THPA 3U2MA 2LCWA 1M2VA 1WOOA 2MYFA 4R8UA 3TUIC 1FFGB 4C3BA 3D4JA 1BE4A 3OLAA 1ZPVA 4ATNA 1FKPA 3RR8A 5C24B 1LW2A 1BR4A 2BE2A 4A8XA 3C6UB 4C0OC 4QW9A 1FJ7A 3L8JA 256BA 3JQJA 4C8MA 2YKPA 2E5HA 1F3VA 4I1MA 1TVRB 1JXVA 4ZN1A 3NS7B 5M2RA 3G4ZA 3SCLE 2C3UA 2ZH7A 2ZFHA 1CJKA 5THWA 1HBNB 2EC2A 3ZTZA 1HMDA 5ETTA 3OL8A 1A0OB 3AJ1A 3GSDA 4ZOSA 2ILZA 3GP9A 4U8VA 2B5JA 3FVYA 3EZIA 3HULA 3BZQA 4I6WA 2KC3A 4KFBA 4B17A 1YRUA 2DITA 4DV7J 2ROEA 3NNHA 2DO0A 2D1CA 1Y6DA 2CKWA 4AL1A 2PGCA 2XMAA 2B7BB 4TU9A 2RT3A 4TYBA 1WOSA 5GMKa 3D0GE 2R42A 5JVEA 4ZCKA 3RRGA 2XY5A 2V4JA 2L81A 4PPZA 1L3VA 2RJZA 4WFBQ 2ASDA 1NFOA 4UF4A 2Y8WA 4QR1A 4FYWB 2XMUA 4W4MA 4N77A 1CLFA 5IXUA 1DQ8A 2FJAB 4K59A 4MVSA 2MQNA 1ITPA 4C0HA 4U9DA 3S27A 3DLKA 1YLMA 1MROA 5DDPC 5FZTA 1KD1T 4MK8A 3EPIA 3W8IA 2LU1A 1UZDA 2V2VA 4I2PB 4JOUA 1EQ0A 3LANA 4C97A 1SF8A 1RABB 1JLGA 3MPUB 2NUTB 2I2YA 4NCGA 2WZ1A 2V26A 5I4MA 2DK2A 4DUZF 3WIVA 1QQ3A 2NSCA 2UXDJ 1T9YA 4CNZA 2WBMA 5ETVA 5J2QB 3I31A 2P1AA 4F4BA 3DZAA 2IVMA 4LF8F 2ZHAA 3RBDA 1HW9A 2AGPA 1QD1A 3DRYA 4LSLA 4ED8A 1REVA 1RTIB 4N6CA 1BQMB 1NRKA 5B0CA 2B7CB 3DHWC 3R5AA 5IM0B 2NPIA 1IW7F 2KRRA 4O6YA 1EP4B 4Q4ZF 3KLFA 2LXFA 4DU8A 4TQSA 3ZC4A 4DL6A 5DG8A 5CI9A 4MYUA 4OYZA 4RDAA 2RDJA 4GYTA 4D3HA 1Y4ZB 3N01A 1HBMB 3NXZA 2HAIA 3IGVA 1K44A 1K47A 2ALZA 3ILOA 4EI2A 2Z2ZA 4J91A 4QZVB 1LWFB 2AWCA 3M1VB 2R9LA 1WATA 2R8IA 4HR2A 4CO3A 3K5LA 4X4OA 1NDLA 4JI2F 1L3PA 4RNOA 1HR0J 1H2UX 2HZAA 3ZO7A 3FC9A 3KXDA 1Q8KA 1YVFA 2YQYA 1OPIA 1RHJB 1X0FA 4CP5A 1VQ7S 1UA1A 1U2FA 3GQCA 3F56A 1HNZF 4FYDA 1N5TA 1KVIA 4EYIB 1HYSB 2FVSA 1B99A 1X4HA 1U1OA 4C3KA 4H4OB 1HWLA 2OEKA 4USWA 5AC4A 2CA9A 1SH2A 1UCNA 3ZFVA 2OSRA 2NUUG 2EKNA 3V81B 2QN6B 3OSNA 2NZ4A 3DXSX 3WC0A 1NHVA 3FDSA 3Q86A 4BHQA 1RAIB 4H4MB 5D4PA 1QE1B 2QA2A 5HN0A 3MCMA 3ZNJ1 1BDJB 3HHKA 3TA0A 1AT1B 2NS1B 1RISA 3I6PA 3THTA 2KI2A 2WONB 2XLIA 4Y2CA 5IV4A 2COLA 5KYWA 4FYXB 4RBUA 2E5LF 4NZ0A 4RJVA 4NLDA 5EUHA 2NSBA 3D3CJ 3HJFA 5COMA 3OTOF 2UUBF 1H7IA 4LR9A 1VCTA 3LO3A 3AJ2A 2CQPA 3HNJA 1PSDA 2HNDB 4MVMA 2GQCA 4TU8A 4AL0A 4OD4A 2IY5B 3HJVA 3J06A 4YDDB 1KTMA 5F3ZA 3BSOA 3UR0A 1LKZA 1NK4A 1VQMS 1OCOC 4PUOA 1LE4A 2ZHOA 5F28E 4AXIA 3UVJB 3EWGA 4IRUA 4ERDA 4J90A 2H7VC 5DQTA 3MM7A 3RKOF 4P9SA 2A1BA 3TEGA 2RU3A 4PQAA 4K5SA 2ILYA 1R8BA 2YNFB 1P1LA 1QSLA 3N9UC 4OI1A 5CCLA 4OZLA 2JWNA 5CH7B 1X5TA 3SIPB 3IXQA 1S6QA 4O23A 3DOKB 3CO0P 5HV9A 2HBRB 2LQBA 1NAQA 5DETA 3KG1A 1CQNA 3QSIA 1RAJA 3L9ZA 3TD7A 1J2VA 4YR2A 2B51A 1YARO 1Q0DA 4KKOB 2KFZA 1V3SA 1G1XA 5K14B 4XEFA 3PXGa 1FRMA 3GM1A 1GFWB 4FN5A 3RAXA 2P61A 2AP3A 2B9YA 3RGIA 3ISND 3AG1C 4NTFA 2VONA 1LWCA 1WC1A 1ZHYA 2XSJB 5F5HA 1RTZA 3SEOA 2E1PA 4N56A 4CLUA 3K1HA 1APSA 2HGMA 2R3VA 3C18A 3AGUA 5I3QA 3KPHA 1KOOA 1IN0A 2PMZD 1N5SA 5CAAA 2GMHA 2YKNA 2CJQA 3HD2A 4ZVTB 4MFBA 4ONSA 3IAS9 1NJIT 1YRTA 4USVA 3AJMA 1JLBB 5K9FA 2VBXA 4OZ5A 4O79A 3TOMA 1T3OA 3K7DA 3CJ0A 4LFCJ 1JJHA 4XPWA 4DR1J 4Q43A 3Q2TC 4M5DB 2EFOA 2HNZA 3SYNA 3H4DA 3MYIA 3DYAA 1WKJA 2M52A 3IQ5A 3OR2A 3BGRB 5ETRA 3M15A 3FSXA 2G1HA 4WTYA 4JI4F 2ZH5A 3CQZA 3OR1A 4DX7A 2MZ1A 3N6LA 4WE1A 2V34A 3FZ2A 3HKKA 4WU3A 4ED1A 2OPQB 5JUMA 4DVZA 1YKWA 4ZLCA 2KYHA 4HEA9 4QU7A 2D3OR 1FXLA 4KT0C 4OI2A 1T03A 3CCJS 1Q5YA 3BN7A 4GVBA 1RAHB 1FESA 4I7FA 1GM5A 1UETA 3FEXB 4X4UA 4J7CA 2HHWA 3IRXB 2IIHA 1HBUB 1TL1B 4U95A 3TK0A 4B3TJ 2DR9A 3FKBA 1QTMA 4B3RF 2WK4A 1AYEA 1DTQA 2GJ2A 4ZPTR 1ZZNA 2HHXA 3QYYA 3GJTB 5J1EB 3JSBA 5FIIA 4QR0A 5LXRA 5K8OA 2MQOA 1VK3A 1FDBA 2IFXA 2J0WA 1MMLA 3PRDA 3M4BA 2YKAA 3W2WA 4K4YA 1ZTTA 1XR6A 1VHIA 1K1QA 2QLBB 4PYDA 4CYUA 1VQYA 2CWKA 3KTQA 2LLZA 4FS1A 5DLJA 2YXLA 4RU2A 4DJ9A 3R5DA 3GEIA 2XYHB 4GC6A 2QYGA 4GKKJ 1T01A 2GV1A 2D7SA 3GANA 3MDFA 2AU0A 3IM9A 3A9CA 3CAXA 5EDWA 1IZMA 3MI7X 2B9XA 3DM9B 4NL5A 3LA0A 2XMWA 4B9UA 4F50A 1JXLA 1RT2B 2EK6A 2FUG9 4FPIA 3AHPA 3HZGA 4MKAA 1DOVA 3K2YA 3QAEA 2FLLA 2CG4A 3SCIE 3DLLQ 2HBZB 3CW2C 3I5AA 2W4CA 1R3NA 4B3MF 1ROFA 5C24A 2BDPA 1PC5A 1NK0A 1VBXA 1F1MA 1T9TA 3C6UA 3LP1A 2FC9A 4WFNQ 1SQEA 1NJXA 4U5CE 4R5PB 3M2VB 2FY1A 5HQLA 4G1QB 3T19A 1Y00A 2EPOA 1HBNA 2P6VA 4MIAA 1SQGA 2BOAA 2CJYB 4ZVQB 4LF7F 3JCUQ 2GAGC 5K8PA 4DF8A 1HPZB 4K4TA 2VODA 3A8JA 2DNPA 3H4BA 1S10A 2FZGB 1XN9A 3Q23A 3L7PA 4N5SA 1U1LA 2P9GA 4IH5A 3ENWA 4Y2IA 5KT6A 2IM0A 1GXUA 4JB8B 4HL9A 2HHHF 3U8PA 4WK1A 3MEDB 2IYIA 2BW2A 1VC0A 2GFHA 4FWVA 3J7YU 3LAMA 4QQBA 3H5YA 4J9NA 4KC9A 3SQGB 4JCZA 5F8LA 1HI8A 2CDQA 2UUIA 5B3SC 4J9OA 2CPIA 1SMYF 1YJGA 1EKRA 3PYFA 5IC6B 3G50A 4TU7A 5B0DA 2XM3A 4I2PA 3HXMA 5HROB 2NUTA 1NBEB 4LBIA 1I4YA 1NSPA 5HI7A 1I94F 2I0XA 4UOFA 3KKBA 3LP2B 1WDTA 3ZWIA 3K6BA 5J2QA 4J9PA 4JV1A 4KGKA 4AE5A 4LERA 1R5ID 4GO7X 3MEGB 5KT3A 3TUPA 2QMXA 2F4VF 2VPZB 1FVQA 1RTIA 2V68A 5CZVA 4TQRA 2UVVA 3IAM9 1T95A 5IM0A 3BGFA 1EP4A 1RLDA 3PX0A 3EZUA 3IPMO 4B9VA 5F9NA 1QAXA 3I32A 1Q8LA 3HSDA 4UZCA 4U7CA 1HBMA 2XO6A 4H54A 1RHRB 4YHHF 5AGFA 2CPZA 3J7ZT 4ZPDA 5U47A 2ROPA 4KNVA 1VYIA 3HD1A 1ZAVA 3PDMP 1LWFA 2IM3A 3M1VA 2L6GA 5AE2A 3QZ8A 1K0VA 3MPWA 4E7ZA 2BJ9A 3UD4P 5COFA 5KYYB 1NLKL 5HQ8A 3T5JA 2LFFA 2YLIA 5I42B 2HYIB 3HFZB 5KFDA 3AAWB 2RD5C 2QX0A 1VQ9S 3W3SA 2J9EA 1MSWD 3MZIA 4J7YA 3VR1A 1S4FA 2G3VA 3PYDA 2ZHBA 1X9MA 1HI1A 1FRLA 1L7CA 2XMVA 4L76A 2YKMB 3FOPA 5KTQA 1HYSA 3GCWP 1TKTB 4KGXB 2ZJPQ 4PWUA 2MZJA 5KG7A 2J7KA 3OTDA 4WCEQ 2DVIA 3NRHA 4RW9B 2DXDA 1HD0A 4FNIA 5KFHA 2Q4FA 3TZYA 3HT0A 3CCRS 4MMOA 1RWMB 1WC4A 3R7SB 4H4MA 1S0VA 3IHUA 1MG7A 2J0QD 3TJ6A 1QE1A 4Z9IA 2WZLA 4QIWD 3DLJA 4MTOA 5EWEA 3LLIA 1M57C 1AUDA 1V9OA 4LF5F 1V55C 5J2MB 3P96A 4LFBF 4X4NA 1ZVZA 2ASRA 2WSCC 1SH0A 2VA2A 4MTFA 2JX0A 2VZ9A 1SKSA 2XGPA 2C3OA 2YY3A 1JMWA 5A6BA 3Q8YA 3GEEA 3MM9B 4FDFA 4DUZJ 1VFJA 4MT1A 1KTQA 2L41A 4MIWA 2QT7A 4HHJA 5EGYA 4LF8J 2HNDA 2OMLA 4J9KA 1NB7A 1IQTA 4DSFA 3V5YA 3ZSUA 3DHXA 3QJPA 1VMAA 3JTNA 1KWMA 4O44B 5BR8F 4ZDNA 4RBNA 2ZD1B 1LPEA 3ENQA 3DJUB 5JVHQ 3BBCA 3ZZTA 3OXGA 3KUHA 1RBOB 4OIPF 3UVJA 1X4FA 2VH3A 1FE4A 5L9XA 3D2WA 4X4TA 1LIHA 1SV5B 3A3OB 4FYYB 4DV1F 3MPDA 1JR8A 2QL7B 2XMKA 3MYFA 2X3GA 4EYHB 2HQDA 1B0VA 3D67A 1VJQA 3MD1A 4Q8FA 1RAFB 5IWAF 3B4MA 4JI2J 2YNFA 4U8YA 1TAQA 4K0DA 1UVNA 1KC8T 3DU5A 2KJGA 2J9DE 4Y00A 4FF4A 3JAMY 1QJHA 3A4TA 5BYRA 2RS8A 2GGPB 3DOKA 1AW0A 5DVWA 1W2IA 2CNWA 1PD0A 1HNZJ 1NSAA 5ETKA 3PACA 2MQLA 2OLWA 1RSCA 2M9KA 4ZJLA 5IOLA 3RTVA 5IY5C 3TAQA 4FX5A 3WX8A 1PYSB 4HTIA 2XMJA 3GWNA 4KKOA 5K14A 2DRDA 4FS2A 3KLGB 4ILLA 3FK4A 2E7WA 2XMTA 2XO7A 3U7JA 3EHMA 5DGBA 2VC1A 1F2HA 5A6BD 1TKXA 3Q8QB 2XSJA 4KH0B 3W5YA 5D4LA 2GWWA 2YWGA 3JYYA 5EX0A 1KFSA 5SUHA 2Q7RA 1TL5A 1YZ6A 1Q5VA 2JH3A 2MKYA 1LFWA 2KSFA 3M8YA 5A6PA 4DS4A 2JD3A 1TKDA 5FJ4A 5ITHA 1FKAF 1AVOB 1VYKA 4NLUA 4YB1P 3X3UA 3A12A 5ETNA 3AQOA 3W8PA 2L9DA 3ET6B 4ES2A 4ES1A 2UUBJ 1UJ5A 1JLAB 4L6V3 2M8DB 2NPFA 4MVOA 3T6GB 5D92A 4F4YA 4ZCMA 1X7VA 2NYIA 4ZVPB 4CO0A 5H9FJ 2JOQA 2CQDA 1T05B 4QCLA 3KMIA 1S1VB 1VRQC 2FGOA 1LVKA 3IP0A 4ZPWR 4B9MA 1NKCA 1D9DA 2V4QA 5KFNA 3BGRA 2IJRA 1TK5A 3QTHA 3VAYA 2CQ2A 2VUGA 3QZCA 2XNQA 4OYIA 2BRLA 2A6HF 3IWXA 2WTFA 1DQAA 3BM7A 3F44A 3FHDA 1TUWA 3SV3A 2HHTA 5D91A 2OPQA 2CNWD 4U7UD 3BBBA 1QVGR 1NJZA 2MKIA 2YLGA 3TEHB 5EN1A 5HMZA 1X4BA 3LGMA 1TMJA 1ZA2B 1FKOB 1G4US 2D69A 4C3DA 4S0MA 1V6HA 4M5IA 5KFYA 3AFGA 2LQ8A 3HX9A 3DE8A 4IUFA 2W9YA 2PN6A 3IRXA 1HBUA 1TL1A 3H5UA 4QBUA 4GRSA 4YT2A 1EKSA 2B0HA 2GQ2A 4NASA 5J1EA 1WHYA 2GVZB 9RUBA 1AFIA 1OMSA 3QMQA 5B0BA 4JJGA 1T11A 1EB0A 2EPLX 3PV8A 1S6PB 4Y2AA 3JAMU 1FNXH 3NNCA 4DBQA 3SXKA 4CIPA 3OTCA 3QNWB 2G4BA 4WYLA 1UEVA 2ZXWC 2OU6A 1E6YB 3DGVA 1KQKA 3FNNA 2BJ1A 4I68A 2RKIB 4O6NA 3HFVA 3WAQA 2M70A 2AV5A 4Y28C 4KAIA 1JLCB 3C14B 4DRIB 4LJMA 1ACMB 2H1YA 2ZDOA 3CDWA 4ZIVA 1M1GA 2V8PA 4C8KA 1QY7A 4NY3A 2H5IB 3SP1A 1RT2A 3T5KA 4DFPA 5KFGA 1U1PA 3OUYA 1FRHA 2R2SA 2Q66A 3MM8A 5D0HA 4IG3B 4DL7A 3PFEA 5L39A 1PCXA 3DMJB 3R6LB 2CQ1A 1SL2A 2M4EA 2DNOA 1FWKA 3DMDA 4URGA 5GMEA 3US6A 2PFDA 4MYTA 5B1AC 2W4PA 4DQRA 4R5PA 1NM2A 3M2VA 1TWGA 4G1QA 2BW7A 1UVIA 5DQIA 1YJRA 3OHBA 1MU2B 1NCLA 2AEMA 1VOMA 2ZWOA 2BRKA 5HK4A 3DKAA 1HPZA 4JI4J 1HHQA 3AA8A 3U8VA 3DN9A 1SH3A 2J9UA 3VAKA 1OXBA 3MEDA 1E6VB 2QLXA 3CJ8A 2YWFA 2M88A 4RWXA 5GADI 1QAIA 2JVOA 2G2OA 3DI5A 4B3RJ 3SQGA 3EHNA 4IFYB 1HW8A 4F3MA 1NU4A 4IG0B 2BE5F 2ZJRQ 3KL4A 2K3KA 4DL4A 4EWCA 1SL1A 4DSIA 4QWAA 1T9KA 1K40A 3FEZA 4RL1A 4N47A 3LP2A 2GQQA 1RP5A 4J30B 4RW4B 2P6TA 1VQNS 3MEGA 3C2PA 2Z15A 3MF5A 4OYAA 2A69F 4E0IA 4JTCB 3QFWA 3L7OA 1NSGB 2DH8A 2ZE2B 2J9WA 5DRKA 1S12A 2GVDB 4B3MJ 3UW1A 3LUTB 3GR1A 4ZVRB 2OJQA 4HFKB 4LQ9A 4CS9A 2UUTA 4BWMA 3E70C 3JRTA 5HATA 5F8MA 1TKZB 5KYNA 3PKYA 1HHSA 2YH0A 5IC4B 3B54A 4MS2A 2OSQA 1FNOA 3W64A 5KYYA 1HMVA 3MWBA 5I42A 4X4RA 4OHXA 2D9PA 4LF7J 2NUPB 1UPPA 1SVDA 4FBTA 3OL7A 1N34F 1KVJA 1EHWA 2RVJA 3C15B 4N7TA 3PM9A 4GVLA 2Z2MA 4U7UK 2AKWB 2F1FA 3RYLA 4ZP7A 2YKMA 2ZH1A 4HT7A 1TKTA 2PNOA 2JFKA 4DZDA 4HYKA 3T9ZA 2CZVC 3V5RA 2HHHJ 1CBKA 2J7UA 3I5PA 4RW9A 5DG9A 2FIUA 1Y4CA 3PDNA 5LSLA 2AMCB 2YWWA 3UD5A 2W25A 3S90A 2BC5A 2ZITA 1UZHA 1KR4A 2HQ3A 1YITS 2DIUA 5HVGA 1IUJA 3U3BA 4QIFA 2MHNA 4JKVA 3QJJA 1WI6A 1KTVA 4F4AA 4BC7A 2V50A 3CTRA 3H20A 2IXMA 4RBVA 2RRBA 1WKKA 3EH2A 3RBZA 5J2MA 3TP2A 3QGPA 3NGUA 1X60A 2XI3A 5J1NA 2OKQA 4ER9A 2WB4A 4OL8A 2VJUA 3TQOA 1R89A 3EICA 4Q45A 1I94J 5IT4A 2CQBA 1QTNB 1YA9A 4AFFA 2FHKA 4O0IA 2KXHA 3ZZZA 4OV1A 3R5GA 3NNAA 1W7WA 1T8EA 3L09A 5B08A 2CYDA 3FBFA 1OY6A 2O3DA 1ZH5A 2F4VJ 2M3DA 4OFZA 1N5QA 3A8KA 2MJNA 4O44A 3OVSA 3OXFA 4U9EA 2ZD1A 3K8WA 3M8PB 1I4ZA 5JP7A 4N6HA 2CDRB 2W2OP 3HVTB 4WK3A 1ZS6A 3LWLA 3CF5Q 3NAHA 2AF6A 3NCPA 3L0IA 3WIUA 1I5OB 4DCJB 3OTEA 4PEOA 3EPGA 2A2DA 3CSKA 3TQEA 2KT2A 1SV5A 2LSEA 4YHHJ 1RYRA 2OO4A 3CD7A 3QLHB 4LUBA 4DHVA 1S05A 4PJLA 1Z7Qc 4ZP9A 2Y39A 2R7SA 4CO4A 2QNLA 5HVFA 5KFZA 3W62A 1J8MF 1F5BA 4A8SA 3LS1A 1RA7A 4HH0A 5KG3A 1Q7LB 1U1RA 3T1YF 4EO8A 4XQ1A 2CPJA 2WOMA 1FT8A 3M9NB 3W5XA 2FD2A 4ZLNA 5E41A 2DHAA 2GGPA 3I4UA 4M1KA 3MUTP 4NLYA 1BR2A 3D3BJ 3IRWP 2WBRA 3KLEB 2B9WA 2FJDB 4RLEA 1SB6A 1X4DA 3UCGA 4RW8B 2PT0A 3MX3A 4F3QA 5GAGU 2HVEA 4IRKA 2K8GA 4M8LA 3UMIA 3BSAA 4G7OF 4QPXA 1TWAA 4DQIA 1TELA 3I96A 5FLXY 2XS2A 4MVZA 4RR5A 4BJ5A 3BO2A 1YLXA 4ZS6A 1URNA 2FJBB 4UOCA 1M56C 3CB4A 5FCLA 1VQ5S 3C62A 3DDNA 1H7WA 3BS9A 4LF5J 1G4CA 2HVDA 1IJEB 4LFBJ 1KN6A 1PKUA 4DPWA 2HQCA 4AQYF 1QSSA 3LF0A 4MIBA 1KONA 1ZW3A 1VLTA 2DNHA 1FD2A 1FK9A 4USIA 2XNRA 1ZYQA 1B0TA 4PYAA 3ET6A 1JLAA 3WBZA 3EH1A 3P5BP 5DM6Q 1R4TA 1FX2A 5A8WB 1TFOB 4M5NA 1S0MA 4QWCA 4CO1A 2R7WA 3KMSA 1T05A 2HJMA 1S1VA 2ZXPA 4QPTA 2D3O1 1J5EF 5BR8J 1KOHA 5JUAA 5L9NA 3MM6B 1L3KA 3EGXB 1SKRA 3GV7B 2MZSA 3EG9B 4NC3A 3WG7C 2CVEA 1PGZA 2CVIA 4DV1J 1FTSA 2BXJA 1F5CA 3ZQYA 2D5RB 2XQCA 4A47A 4IH7A 1UKUA 1U47A 3DI6B 3HNLA 2OPRB 2A10A 3SYZA 5IWAJ 4WGYA 2J9DA 4WKYA 3DE9A 5LMUF 4USKA 4J5OA 3ILJA 3Q6MA 2KXNB 2AX1A 3DKDA 3ISZA 3BQ1A 4UUXA 2FJXA 3RR7A 1RWUA 2OGUA 4HEAJ 4B9NA 1WACA 2DYAA 1TP7A 2HLUA 4XPYA 1NH8A 3W9HA 1EZZB 2BJ7A 4DR4F 4NXNF 2GVZA 2L6HA 2UVWA 1SBRA 4C11B 1PCAA 2VV5A 4L3KA 3VALA 4URQU 3SXMA 2HFNA 1S6PA 1RWVB 3KK2B 3TZWA 1WTFA 1N88A 4WU2A 1RWOB 3RB3A 4UOHA 4RW6B 1M1HA 1E6YA 2AYMA 4FP9A 3JYTB 1TL3A 4DI6A 2UV8G 3M4XA 2RKIA 3MXHP 4ZVOB 4X65F 4DBRA 4J9LA 4FXWA 2CJAA 1VHFA 2X51A 5E3RA 4XDDA 1JLCA 3C14A 2VPYB 1PD1A 4KO0B 1UEUA 3T6JA 3RRHA 2GA0A 3RAMA 4IO1A 4FBUA 2MLZA 3LH2S 4U5GA 1Z4UA 3VGSA 3MLGA 4IG3A 4DQSA 3CUNA 4EWTA 3C46A 1VC5A 2R7XA 1BHNA 2FGCA 5TJ5E 5H1SV 3DMJA 5J2NB 3CMES 1AEPA 1LW0B 3FAJA 4I6YA 4X0RA 2FHMA 3UWTA 3C63A 4OX8A 2CQ4A 2ZOGA 4YQWA 2PX3A 2YNGB 3CE8A 1GS9A 4ECWA 2GAHC 3FOOA 3HNIA 1MU2A 1JLFA 2GS8A 4ECTA 2RUGA 2X1GA 1CJVA 2XCAA 2Z4PA 2NXJA 1ZAXA 4ANCA 3U1MA 2XL6A 2HIQA 4WGZA 2A0BA 1RKJA 2ZWPA 2AYGA 1WC6A 2O1PA 4CH1A 1VQLS 4E18A 1JPJA 4ED7A 1F6TA 3KHHA 5L1JA 1PAEX 3OFFA 1GTHA 5JJBA 1SJQA 1E6VA 2L08A 4DV6F 1RTJB 5HMWA 1F5AA 2GCFA 5L0DA 3R8YA 4MW8A 2ACMA 4KPYA 2LP4A 4UOGA 3EUNA 5C7PA 2XI2A 2C2NA 4IFYA 5DO2A 1B64A 3W60A 5B3IA 4XDCA 2JFDA 1E85A 1YK9A 3MTKA 5KG4A 1GEHA 1VQOS 3S6EA 3D6HB 3MR6A 1H7XA 4KV8B 1ZYRF 2BVZA 2Y0BB 5KG2A 1WSVA 1N8RT 2BMBA 2N3LA 5D0EA 4G6VB 1D0EA 2LKZA 2B6AB 3MEEB 2XLWA 1XWJA 2A0FB 4P2XA 2LU2A 4UUWA 4RW4A 3AA9A 4ECVA 2Z58B 4QYZJ 4Y0FA 1FRJA 1Y5LB 3N0TA 4QI0A 1TZ0A 2E44A 3CXCR 1N6QA 3PG9A 1N1CA 3WODF 1DARA 1MQVA 3HI9A 3D5MA 4CBEA 4C8YA 3POVA 5ETQA 2B0JA 1IXKA 4NOHA 2ZE2A 2JJ4D 3R2PA 3G6XA 2GVDA 5D6GA 1Q86T 2OEMA 2KH9A 1NSKL 3N24A 1AA1B 1RTDB 4OLOA 1JWWA 1XJWB 3VZHA 3V4IA 3HPOA 4IH6A 1VYAA 4XEKA 5I3PA 4XK8C 4YK5A 2IYGA 1TKZA 1TUVA 4DEZA 3KUEA 2KYZA 1ORYA 2HWHA 3L4BC 2DGXA 2XM0A 3CJ5A 3M32B 1CGNA 1FR0A 3MECB 2QMUB 2NG1A 4H4KA 2CAJA 3PW4A 3C15A 3HK2A 2YQ0A 3CJTA 4A2NB 2DGVA 1RKIA 3QO9B 4MJKA 2CJKA 2IM2A 2V8DA 1PG5B 2HK3A 1MNEA 2X1FA 2EPIA 4V19J 2JC1A 2JC0A 4C0BA 2XLDA 4K8RA 4E8UA 3DRPB 2KG1A 1C0TB 2B43A 2CPYA 1S5ZA 1EI7A 3UN2A 4R0JA 4ZCIA 2W7OA 1LI7A 2UU9F 1VQ6S 3G71S 4RX6A 2I9SA 3ZTQA 4WFXA 5ADZA 4DPTA 5CCMA 4FXDA 3O3LA 4EBKA 2ZKTA 3GFHA 4JYAF 3LAYA 1GNKA 1OJ4A 3PYEA 3N2ZB 3GZ7A 3ITHB 1ZM3A 4E7SA 3LQVA 4O7GA 3K5OA 3KHGA 2BR0A 1D9FA 4CT8A 2SXLA 4KPCA 4OLPA 4X4PA 1S9EA 2VFVA 1SXLA 1A7DA 2B8PA 3RRKA 1LS4A 1T94A 4RPFA 4JC7A 3VQSA 1V4AA 1OQ6A 1O5HA 2Q9AA 2R7VA 5B0AA 1NHKL 3NG1A 2MGZA 3DDKA 3M8PA 2J0XA 2RDIA 4QJVA 1YJTA 1NXIA 2AEFA 1LKXA 3HHEA 4ED2A 2I5JB 1VS3A 4Z37A 2C2RA 3B8HA 3V6DB 3CZ6A 2IPOB 4MVUA 4UY8T 1U7LA 3QLHA 3MAHA 1CVJA 2UZAA 4CJOA 3BKTA 1FEEA 3T9NA 1Q95G 3TI0A 4KHPF 4CLSA 1VLYA 4JZAA 1JOGA 3NKDA 3AQCA 2VQFF 4BEMJ 1C17M 1NUEA 3RQGA 3NS5A 4LMZA 1Z6AA 4ZA1A 1RU1A 1N34J 4QYZK 3QRPA 1R8AA 1WEZA 3BDPA 4KTQA 1T0TV 2JX2A 4FZVA 4Q7CA 3VRCA 4PABA 1SJRA 1JPNA 2R8HA 3QGGA 1C4AA 4CZCA 3M30B 2L9NA 3ICLA 2MQQA 1IWAA 1QPUA 1XR5A 1S0NA 1JLEB 4PG5A 2RILA 2MZRA 4NRUA 1YDLA 2RQ4A 1OQCA 3RQFA 1S4EA 5AXMA 1WHWA 5KYUB 2W2QP 2CW0F 3SZ2A 3DLGB 2ERRA 2E9TA 4FAPB 2PA8D 2VJVA 2R05A 1P8GA 2CQ0A 3M79A 3TNVA 4F3OA 3R1LA 1ZM9A 2IC3B 1UFKA 5HL7Q 3GE9A 1H2TZ 2UXCF 2C2DA 3Q89A 4DU7A 3T6BA 2V2QA 1FXRA 1C1BA 3OT9A 3P8BB 2JEIA 3NL0A 3R5CA 4OZ0A 2QLJB 1RWNB 4BJ1A 4E2FB 2AZ3A 4M5KA 3HVWA 3O39A 4OV6A 2XZWA 1RHKB 5A8WA 1FFWB 3GR0A 3I9ZA 2ZD9A 2VF3A 1F9EB 4K5RA 3OPKA 3EMTA 2DRBA 4HE8D 3GLJA 3O2IA 4LT6A 3W63A 3CCUS 1KVKA 3SI8A 3S9OA 5LMNF 3JQKA 3I0SB 2VIHA 3MM6A 1FVSA 5CXTA 4N8NA 3EGXA 2IDLA 3TX0A 4NI2B 2HGNA 1EIYB 3EG9A 1VQPS 2ZNZA 2XHCA 2DRAA 3RUBL 5C2CA 3J81Y 4EBBA 1UTAA 4WZQA 2NXUA 3OV7A 4U5EE 3DI6A 1T02A 2OPRA 2WZFA 4RNFA 1X4EA 3TW0A 3PNIA 4HFFB 1FJGJ 4P2MA 2XULA 3KLHB 3TA2A 3T1YJ 3K5MA 2AGOA 2VCAA 1NDCA 4ECZA 5GAEI 3ETMA 1V3RA 3ABLC 4EKWA 1ZU5A 3H2VE 2ZVSA 3VAJA 1FFHA 2F40A 1WF1A 4NE9C 4WFYA 3W7BA 2CQIA 4ITSA 4C11A 3JTOA 3UPFA 3UNGC 4WXWA 4I3MA 3RF3A 4OJHA 3BBFA 3KK2A 2OIHA 3OVAA 2GHWA 3KYIA 2J45A 5CIVA 3H65A 3JYTA 2AJ0A 3HHLB 2XS5A 2HS0A 5CYJA 2RF2B 4DXWA 3F47A 3BR8A 3CD0A 3ZTOA 2C1EB 4KO0A 1L5UA 4DLGA 2QE5A 4NX9A 4CLYA 3DU6A 4AQYJ 3GIJA 1K8AT 4OZJA 3NEKA 3KMQA 2AYEA 4X62J 2KJVA 3U5SA 3TUZC 1GX5A 2DH9A 2H3EB 2BOPA 2GX8A 1HE1A 2OQMA 4B9TA 4DPXA 2GJIA 1LW0A 2E9RX 5GADU 1MWQA 2C2OB 3DLEB 5E7OB 3DWWA 2BKNA 3BYRA 4YFUA 1OSDA 4ED5A 1J5EJ 2EW9A 4A46A 3KJFB 2PF4E 4HHUA 2W9CA 2HV7A 2LEAA 4C3LA 2A68F 5JLIA 3G8QA 1H6GA 2H5EA 1RK8A 4UQGA 5MAOA 2ZOFA 4O6MA 4WF9Q 4KGZB 4K0KF 2BKPA 2GJFA 4WP9A 3M1CB 2LFVA 4OZ1A 2V3CC 2D3UA 4LR8A 2Q3PA 4M5JA 2WVDA 3TUJC 4TY8B 1VI7A 4NRTA 4DJBA 1U1QA 3B4DA 5H9EJ 5LMUJ 4K4WA 2L9WA 2GMLA 4CJGA 4CLFA 1OSCA 4LF4F 1HMOA 1IR0A 1RTJA 2MJUA 4DFMA 3K57A 1GMWA 2B4UA 5KFKA 2IHR1 3OFGA 1Q1KA 1WC5A 4UY85 4DR4J 3H2UB 5T7LB 4NXNJ 5JS5A 3DD7A 1LE2A 5KFXA 3M4CA 5A6WA 3TVYA 3K1IC 3M7VA 5B7WA 4MAKA 1RADB 2MPUA 3UDEA 4WFZA 2YBVA 4KV8A 3B0VC 2AD9A 1J27A 1FO1A 5JSLA 1VBZA 2XEXA 1RBAA 2CNOB 2V69A 3F0NA 1Z63A 4P74A 1YZAA 4DCPB 2Y3DA 1Q0NA 3MEEA 3NP5A 4X65J 3J81j 1X9SA 2AW0A 2V9WA 1RYSA 1OO0B 1S72S 2DGJA 4I69A 4FESA 1WG4A 4USJC 2RU9A 1RUSA 1U0HB 1OS5A 2FVPA 2RAQA 3FGVA 4F26A 3LLKA 2BJEA 3DM2B 2LA6A 1E83A 3V5XA 2HMQA 4BJ5C 2X7IA 4UQTA 4PCQA 2OPSA 3I56S 3M8WA 5F8JA 2EINC 3P6YC 4J9VA 2G2YA 3HFKA 5CQGA 2IRYA 6FDRA 2KHDA 5A6AA 1WTBA 2MLYA 5DQZA 5D0GA 2OFGX 3N6NA 3GFXA 1B68A 2Y3GA 3M32A 1HNXJ 1YG0A 2JHEA 3MECA 2VBWA 4C6AA 4EFAC 5DGAA 5KT5A 4XPEA 1NU7D 2BJDA 2VICA 2MZQA 4MH8A 1CGOA 2E5GA 3AOUA 4LBHA 3QO9A 4DV4F 2HAFA 3WHNA 4ZITA 4Y3CA 3ZZ0A 3OSPA 3HKZD 5CZXA 2BQRA 1UP1A 3DRPA 1EQ1A 4QWBA 4DV3F 4DV6J 1C0TA 3FJ2A 3ZTSA 1F3FA 2A6MA 3D54A 2OPPA 3HP6A 1OR3A 2RHQB 2XSFA 2H8AA 3MR2A 5KYXB 1IBLF 2DNLA 2QE9A 2YL0A 4BS2A 3H90A 4DL3A 2RIJA 3NMRA 3EX7B 2F8EX 3SV4A 4CWBA 4ZPBA 2LEBA 3NMAA 2HQIA 4UW2A 3ITHA 4DXLA 4LLCA 3FMSA 3C8ZA 2VCBA 1Q79A 3IR5B 3VGUA 3I5BA 2JVRA 5AXNA 2EFNA 4A8FA 1ST6A 4J9SA 2LK4A 4EO6A 3E3XA 4AT1B 2DHHA 3KNAA 3NGTA 2KM8B 3KLVA 4O4GB 5H9EK 2V67A 4DV5F 1KP6A 3ELHA 3R7NB 3E01B 3AB4B 1RTHB 4QWEA 2E7VA 3J80U 4YY3F 3FRZA 5COGA 2XLVA 5L0FA 4UTGA 2H7OA 1OY9A 3CDEA 4IKAA 4DSJA 2EIMC 3PCOB 2ZM6J 4BWJA 2I5JA 4RO0A 1NLXA 2P2CB 3W61A 3HDSA 2AU5A 3V6DA 2MSTA 4GQHA 3SZRA 2R8KA 4CO5A 3AXMA 3RH3A 3PJWA 2WL8A 4AXJA 3TAPA 4JI1F 3MAQA 2RRNA 2PEHA 4ZVGA 4OX7A 3C66A 3VAMA 1TK8A 3ZZRA 1Z1ZA 2ZBPA 2DISA 3SCKE 6AT1B 1QUVA 1VRTB 2DY9A 3Q24A 4I4BA 2DNQA 3FBCA 3UD3P 4IB4A 2CPDA 1FDNA 1FEHA 1FRXA 4J9RA 1Q0MA 2R8JA 4OHZA 4DX5A 3IMQJ 4P7TA 4RNMA 3M30A 2W7AA 4OIQF 3QGIA 4RWWA 5A6JA 1UJ4A 1XMOF 4C7QA 5E3CA 1JLEA 2J9VA 2XWXA 2FJWA 5A8KA 1JQGA 2V8GA 1UFLA 2MZTA 3NGSA 5KYUA 3MCSA 1OYEA 3DLGA 3Q8VA 5F8GA 2UU9J 3G6VA 2Q9BA 3B0UX 4JUZA 1M5VC 1GX6A 2IC3A 2OUGA 3MFHA 1WGWA 3ZZUA 5HSPA 2UXBF 5I3UB 1DHMA 4JYAJ 4AD6A 4KIAA 2HZVA 4DR2F 4O3QA 3OL9A 1NPPA 3BREA 2V2KA 1U89A 3NBPB 5KOWA 3QWPA 1CULA 2C2ZB 3DRSB 4DUYF 2J8SA 3MMBB 4MW3A 3MFIA 2HFVA 2AZ1A 4DPOA 2XGQA 2F65A 1T6UA 2HMZA 4W8KA 5KOXA 4ANEA 3N28A 3GYGA 1R0BG 1WTYA 4D3GA 4FYVB 1RT7B 2Z8QA 3PKMA 3I0SA 1TV6B 3UN5A 4UDVA 4EBCA 2M8HA 3R6GB 4NI2A 2VU5A 5C25B 2Q1LA 2FLOA 3MGJA 3QIDA 2FTRA 4DF4A 5BQGA 1PJ5A 5SZTA 3CMAS 4U6PA 1DJ0A 3PW5A 2DNRA 3ENVA 4JI0F 2XBPA 1MMDA 1XBWA 4F8RA 3CT9A 2EIJC 1UL3A 4JRZA 2CRLA 4KHPJ 2Y3YA 2LCHA 5HVHA 1KRPA 3UQSA 4TLRA 3PRVA 5LSRA 2VQFJ 1WUUA 3KLHA 1BQNB 4IJJA 2ROGA 2XXAB 3IA0A 1NK6A 1DBDA 2F9JA 1T6QA 2WVFA 3Q6NA 3CCZA 4BPMA 5KFFA 5EWFA 3UFCX 4RUCA 3T5HA 4CSAC 1Q7YT 1U26A 3DOLB 4LACB 4A8MP 1XNRJ 1Y5IB 1A7GE 4JURI 3V6KA 1D1BA 4PZVA 1HWUA 2AP6A 3ADAC 4Q44A 1F60B 3ABKC 3UR3C 1NMEB 4JW1A 4TYAA 4FVMA 3G2XA 4EBDA 3GONA 3QT6A 1HW2A 4LRBA 2RQCA 3M8QB 3PO5A 2UUCF 1RCXB 5EK0A 4G65A 1V5IB 1NK7A 1PJ7A 2C03A 3HHLA 4H4KC 1U6HA 4XWJA 3UE2A 1RZMA 2YQ3A 1PYOB 2UXCJ 2YX7A 5F0WA 4P2SA 3OJUA 2DEJA 2K1RB 2M0GB 4BJ6C 1WOPA 4M5GA 3W8HA 2C3PA 2B9EA 2Y9HA 3GWCA 4CLWA 3UCUP 1LS1A 2MSSA 1T9XA 2RE1A 4MVQA 2DPJA 4ZVFA 3W4YA 4PRFA 1R43A 2CCYA 2GIFA 1RT6B 2KNHA 2VFSA 2EPMX 3GODA 2VCCA 3GILA 2DI3A 3EXCX 3GCXP 5JXSA 2R8GA 3DLEA 4USHA 5F5FA 5EX3A 3SDEB 1X9WA 3FMBA 2YTCA 5E3QA 1KNZA 4Z2XA 5LMNJ 1LI5A 2YQ1A 4NYZA 2M5YA 1O3UA 3NLCA 5E2QA 3U27A 3GIMA 2MQPA 2JZ5A 1LW2B 1X5PA 4CLKA 2A3JA 3VV2B 4NYPA 2IXOA 4L75A 1GXTA 2W2NP 3EGDB 3HMJG 2EPKX 4CT9A 3VAHA 4EK2A 1LWEB 2BM0A 1SC1B 5GAGI 1RHMB 1RBLA 1DZ5A 3N79A 1IQZA 4C48A 4GKJF 3ZZOA 2FHJA 3NWGA 4NLPA 1SIWB 2QEXS 3TJ9A 1YBTA 4TY8A 2B5JB 5L46A 3QRRA 4KFBB 3H2VA 4CDIA 5HSWA 4PKDB 9ATCB 1NG1A 2DBBA 1D0YA 3ZXWA 2ETSA 3GSIA 4P7VA 1YJNS 4YT5A 1HARA 2DNKA 4K4UA 4NLWA 2VFRA 1P6TA 3H2UA 2CQGA 3H7HB 4B3SJ 5T7LA 3JS9A 3A1YG 1LQ9A 2G2ZA 2E1MC 4BG0A 3MTJA 3EDQB 1UWBB 4DS5A 2DD8S 3B78A 3UN3A 1FXDA 1Q78A 2ZBQA 1QZXA 3OJSA 2YWAA 1KBRA 4NA2A 3AG2C 4U96A 5KFEA 5HMXA 2HRYA 1TK0A 2KT5A 2HVHA 1CJTA 2RQMA 1JK9B 3LESA 2ZKUA 3KHLA 4HACA 4WWSA 2HFOA 3OA1A 1LFPA 2GIRA 2KU7A 2MB0B 1PAUB 2F8HA 2F8MA 3T1AA 1RKEB 4L3NA 2HSQA 4AUKA 1PV3A 1S99A 2PEBA 3SXYA 3DAFA 1R0CB 2LQGA 2YNIB 2P0NA 1U0HA 3VZIA 1SC3B 2H4YB 3CCTA 2RS2A 3AOBA 3DM2A 1ORJA 3PHTA 5JRAA 5F8NA 3DAGA 2DT9A 3M8ZA 1Y9OA 3FCHA 1S1XA 5DQGA 2C2EA 2YLDA 4Z9JA 5KFSA 4I67A 2EC0A 4C2MA 2HWIA 4O3PA 2ZH9A 2WHOA 2ZEJA 3BB5A 3C8GB 2C2MB 3T5LA 1XZPA 3CJQA 2WRMA 2KZMA 4A8OA 1ZHWA 5DDQC 2FHJD 1YGYA 1M5OC 2KT3A 5L8RC 3EGNA 4DN9A 2AJ1A 1HE9A 2C22A 1IBMF 1R6VA 1SYQA 4ELVA 1S76D 1L3UA 2OEJA 4NEZA 5IT9U 3CPWR 3EGWB 4K0KJ 3EM1A 2IMOA 1G4WR 5IQ6A 2G0CA 4JJFA 2VASA 3EVMA 1J5OB 1D1AA 1TVRA 5L3VA 3CJKB 4A48A 4CX9A 2E1RA 4U5BE 1O5JA 5GMDA 4LF4J 2N82B 3LUYA 3TA1A 1D1CA 2B0GA 2J0SD 4IOAQ 3CDUA 1WDDA 1W2BR 2BL2A 4DRHB 4JP8A 3VTIA 2M7SA 1RWPB 2MY8A 5KYXA 4HDGA 1HQUB 3BO4A 4IYQA 3ZZPA 4DRJB 2K7JA 4J9UE 5D4OA 5LT5A 5KFBA 1BMQB 5JT4A 4ULWA 2QRRA 2CUYA 3OFHA 4A8QA 3NMKA 2JLGA 2NYHA 4ILRA 3IBWA 4DPYA 4PWDB 3FSIA 4ECRA 2J8WA 1KLNA 4ELTA 1A7EA 2IJNA 2HS4A 1M6TA 3T9OA 1HWIA 4DN0A 5LL6d 1UW4A 2CG8A 4XEVA 4QIEA 4KYZA 5CD4H 1T9UA 4O4GA 4FPRA 4CLZA 1VC6A 1CPZA 2ZDPA 1TR0A 3QZ7A 2QL5B 3E01A 1RTHA 1SC4B 4PG6A 1PC4A 4Q5SF 1M2OA 2FJEB 4C7OB 4A4JA 5DS5A 2H9ZA 5IZHA 2E66A 2G3KA 4PR9A 2VBZA 4LF6F 2NREA 3SNHA 3NYLA 1S6OA 3T3FA 4OINF 2NPUA 2MMYA 2HHVA 1WD6A 1H3DA 4PUOB 4ALZA 2J5AA 3T1HF 2MXYA 2HV6A 2CPFA 2XY7A 2UV8A 2H65B 1BQMA 5KG1A 4B9LA 2DHSA 3QT8A 4WKRA 1QLEC 4QIGA 4G7ZF 1VB5A 4QIVA 2HSBA 2HW3A 3TO8A 1DRZA 1ELOA 4J37A 4PWWA 2EBEA 2BE7D 5CYMB 3VVTA 2XRHA 2X0CA 4KB7A 4CIOA 2IDEA 3FQLA 1S79A 5HBMB 1HD1A 3ITFA 1K05A 4X4VA 4JBCA 5GAHU 2O9XA 4F4ZA 3EXYA 3DLHA 4CDYA 1BY9A 4WFAQ 2ZXRA 1R6YA 4W98A 4DV4J 2Y3BA 3LGNA 2W2MP 2MYSA 4Q7AA 4OI6A 5L1KA 2EKYA 4PJJA 1P27B 3SFGA 4DV3J 3TOLA 4NLSA 4ELUA 4NTAA 4F0MA 2R7TA 3OW2R 3IR7B 4BEJA 4E98A 1IBLJ 2CQCA 4NCBA 4DL2A 4ZP8A 3B29A 5L0JA 1S7IA 1NBBA 3I82A 5K5MA 1NB2A 3G82B 1B3TA 1KHWA 5I3UA 1A41A 4H4OA 4OYWA 1YHQS 4KHMA 4W8PA 3BJYA 1FRKA 2HEKA 3V81A 3PHF2 3NBPA 3CDAA 2K3IA 1IKVB 5HMYA 3DRSA 1LNQA 3GTYX 4RNHA 1FFSB 1X5SA 3MMBA 3JSRA 1WF0A 2LQ9A 3NGDA 3QJLA 3BGUA 3H25A 5GAEU 4NQFA 3R1HA 3PYGA 1Q0KA 4WYWA 4MFBB 3JT1A 4TN2A 1BR1A 4N76A 1AFJA 5KT4A 1CEZA 5BYSA 1TV6A 2HHUA 1FNMA 2AYBA 3JSZA 3L8IA 2WONA 3PEHA 3PW2A 2PP4A 2NR0A 2OHDA 4PG7A 2Q43A 5C25A 1APCA 1B70B 2MKSA 3AQPA 2CADA 3L34A 3MFNA 2HNZB 4F4XA 3EZHA 2IA0A 3DDIA 2RQKA 2A6OA 3RAQA 3OR2B 1L3TA 1FRIA 1YTYA 2GW8A 2NXCA 1U49A 2VQEF 5ETMA 4A8WA 5KG5A 4LDKA 2XC9A 5AE1A 3POTB 1TAUA 2K7KA 4DR3F 4CIHA 1AXQA 1BQNA 2J6UA 1RI7A 2XXAA 3S01A 1RT4B 1FD8A 4RUAA 4EIYA 3ZG1A 2PIIA 1E84A 1URRA 1Q4RA 1WELA 5KFQA 2Z56B 5DZ6A 2HZ8A 2ZZMA 2GHPA 3ATPA 2XWYA 2KO1A 3DOLA 5CABA 4L73A 2E9ZA 5C5JA 2FFHA 2B4VA 4YS2A 1FTRA 4QWDA 4P72A 3JSYA 3DOMB 4L72B 5ETSA 3NOGA 3M8QA 4DSLA 3Q8UA 3V5ZA 4L6RA 4KRWA 2Y8YA 2PC6A 3W9IA 2JPUA 3EZ5A 1NJYA 1CC7A 1D8YA 8ATCB 2CYYA 1Z2ZA 2XCPA 2UXBJ 3EVWA 3U9MA 2K1RA 2VD3A 2YWEA 2HLTA 2EI5A 4DR2J 3TX8A 1JLQB 3KJVB 4OZNA 1E2XA 5BJRA 4LRDA 3BH7B 3QGHA 2FZKB 2XSEA 3MR7A 3A8IA 3IO1A 2L48A 3FQKA 4HLBA 1RT6A 3WZ0A 4E0HA 3M9MB 2EFGA 2KDOA 4X4QA 4EHPA 2CXEA 2KRBA 5A8RB 4YR0A 2B56A 3RB6A 3SDEA 5DS4A 1DOWA 1TWHA 1Y3KA 4R0EA 3CC4S 2MKJA 3D28A 3C3LA 5D3GB 2E5LJ 4IOCQ 1VJWA 3I87A 3LP1B 3EGDA 4PXEA 3KYJA 3KKFA 5D4NA 1JLBA 3OTOJ 2MQMA 5DM7Q 1LWEA 3NYMA 3D6TB 3CEXA 4JI0J 5BQHA 2G1DA 1HWKA 4NLOA 4PJNA 2R7UA 1ZZFA 4LVOP 1B7YB 4M5DA 2HSEB 2MKKA 4OJGA 2HWTA 4A8YA 3AH6A 4IQMA 1KSPA 4F0KA 3MM5B 3RW6A 1KS2A 1S1TB 1ZBTA 3U9JA 4Z7CA 1CG2A 3OD2A 4RBTA 4YWQA 2G13A 2ZOMA 2G9OA 3I4PA 1H0HB 5CI8A 1H73A 4OMFG 2IRUA 1S7ZA 4E0DA 2CWXA 2RHSB 2M4MA 3I9V9 4CS8A 1WOLA 3MOJB 3PW7A 5B0GA 3KJQB 3TJ8A 1U1KA 4YR3A 4FF2A 1RJ9B 1PILA 4B9SA 3PJ9A 2OI2A 2O5DA 1UWBA 1MMGA 1G7CB 2DGQA 2LYVA 3US5A 5B0FA 5AJ3F 5K8MA 3ILIA 3CJ3A 3CCMS 1N54B 1Y5NB 3BKUA 1VQ4S 2VG7B 2UUCJ 3D0IE 2XG8A 1C2PA 4BC9A 1RQ0A 3KK1B 5A2QU 3CCLS 4USMA 3NWRA 1HNVB 3KG0A 2XM4A 3P4UB 4PPDA 1RKEA 1TFWA 2PMWA 2W2PP 4EBJA 4AE4B 1KLMB 2DNNA 4HI2A 2YNIA 3DM5A 2QV6A 4JIOA 2O01C 2N4DA 4IO9Q 5FD1A 3A3PB 4KC5A 2IYLD 4OQJA 1IR2A 1WEYA 4J7TA 1VR6A 4OD5A 1NK9A 7FDRA 3C8GA 2I38A 4OIOF 4ZVHA 1RKCA 2N7YA 1RACB 4Y34A 5F3TA 3G86A 2QYCA 4KSEB 2EBGA 4YT4A 5C42B 3MBGA 1I1GA 1OW6A 4LQ3A 1HNIB 1S57A 1VIXA 4NLTA 1N5YB 3QT5A 1S48A 2E1AA 2HFZA 1WASA 1OPZA 2AJ4A 2HBQB 3DGPB 4X4SA 1M1KT 3E51A 3NKEA 4HDHA 4GKJJ 4ZJQA 3O5TB 2ZZNA 2D3ZA 1WSRA 1J5OA 2E1CA 3HHDA 3CJKA 4YN0B 1JNRB 5HQMA 2Q3TA 1HBOB 5D8HB 4OX6A 2RD9A 2EFPA 1H9TA 3RQEA 1QVFR 4AL6A 1R7IA 2E87A 1NH7A 1B4SA 1RWWB 3AD8C 1YJ9S 4CDAA 2HKVA 3CGIA 4Q8EA 1U45A 4WJBA 3ZDLA 4O4RA 1IKYB 5F0UA 1HQUA 2ASYA 1D0ZA 4KI2A 1NDKA 4DZ6A 4CRJA 5HLFB 1S9FA 2R25A 3GYXB 1SKWA 2NCKL 2DGWA 4C4WA 4X66F 1C4CA 3K66A 4PWDA 3I4HX 2DHXA 2VG5B 3HSZA 2QL9B 1H6KX 2NSGA 1NNDA 3TVZA 2WCXA 5L0CA 3HM9A 3QAUA 1VDHA 3HSJA 5H9FK 4PR6A 1MN7A 1RGVA 3MMJA 1PYTA 1V54C 3BRJA 4ZHRB 1I3OB 1Q82T 5KFLA 3NG8A 2KVIA 5M2PA 2QUPA 3C8GD 3M6UA 5D78A 4C7OA 3MHYA 4M5HA 1TFYA 5HROA 3K7RA 5LJ5Y 3KK3B 3IFEA 3OEOA 2HK2A 3MR3A 1WG5A 3O6XA 2B4OA 1N0VC 2BUNA 4OI3A 4HKQA 5D77A 2OELA 3HHLC 1U8WA 3P45B 2JEJA 4QI2A 4V1Ak 3GV5B 2B8QA 3AD7C 4LSZB 1A0BA 5KFCA 3KFWX 1JJ2R 4CLTA 3PO4A 4HI1A 1GMVA 4PG4A 2ZXOA 4G7HF 2XL4A 1W25A 1FX4A 2MLXA 4R25A 2R2TA 5B0EA 3NGRA 1T6IA 4OJ1A 1RMVA 5IQQA 2AGQA 3D7SB 1U2CA 3NOCA 1IBMJ 3X2QC 3PRBA 2FDNA 5CYMA 3HJCA 1GQEA 2XLHA 1V3ZA 5HBMA 3GORA 2EPNA 2DY1A 3VYWA 4LDRA 4Y2KA 2U1AA 4DG1B 1Y11A 3QQCD 4LF9F 2HUJA 1B7FA 4DMZA 4J9MA 3PIPQ 2K06A 4M94A 1N4LA 4LRFA 3LTOA 2YWHA 2BKOA 3ILLA 1MMAA 2JEGA 1WHXA 4NCQA 4K4ZA 3EJNA 2V5HG 1CJUB 1S7HA 4JCHA 3G82A 4I6AA 3AY0A 1L3SA 3ZVRA 3FCVA 2B4PA 2X3DA 2HHPA 2OFHX 1TKXB 5E5NA 4EBEA 2Z30B 2DHGA 1IKVA 3LS0A 2W9BB 5L0IA 2H48B 1Y10A 3TQ1A 1YQHA 3K59A 4P6QA 2F3JA 1IJFB 5HP1B 3H98A 3AQBA 2FVQA 1LK5A 2CJBA 5E33A 3RIPA 2ALYB 2V8VA 5DJBA 1UAWA 2GO8A 3DC2A 1RCPA 1VK5A 3QIPB 4D4NA 4WBFA 4WXOA 2U2FA 3E8OA 4LF6J 2UVRA 2JEFA 3MM9A 6FD1A 2DGSA 2WVOA 1GXLA 4B02A 2LD6A 2OJ3A 4CTAB 1TL7B 4JV5F 4Q2MA 2GDCA 4NMXA 4DR6F 3V6HA 2NQPA 1NDPA 1WKLA 3IM8A 3FSYA 3T1HJ 2W24A 1QSPA 3CCVS 1K0TA 3POTA 3EPVA 1HWJA 2DGOA 1ZM2A 3IN5A 2JL9A 1RT4A 2L3MA 2V2ZA 4JI6F 3L7UA 4K4SA 1IWGA 3EGZA 2MEWA 1S77D 2CPHA 3B6BA 1BZ4A 1NKBA 1KQSR 3B71A 2FYXA 4ECYA 2WB7A 1IKXB 2W4MA 1D0XA 2JSXA 3R7CA 1UVMA 2CPXA 2FB0A 1LEOA 3M6XA 2VL1A 4TLQA 3C7JA 1YZ7A 3CCQS 3K1IA 3VGVA 4WPAA 1YBAA 1EX8A 3ZQVA 3ONQA 1YRXA 3DXJF 4N4WA 2IJFA 2IBOA 3DOMA 3OBIA 3BR9A 2IOQA 3S29A 1ZA1B 3Q8RB 2VDIA 4HHHA 3GIRA 4B3OB 3LALA 3PR5B 2BANB 1GAOA 2HPUA 3UO0A 2MKHA 1SJ4P 3UMKA 4LVNP 1XR7A 1JLQA 4ZVSB 3KJVA 3CMQA 1BQXA 2EVZA 2D74B 3KLGA 5C2GA 4MNDA 2AVKA 2W8LA 3Q8PB 2Y0SD 1QAJA 3CVKA 3SSQA 3F46A 3U1NA 1Q0FA 5A8RA 1Q0GA 1Z2LA 2JLFA 3D68A 1YZCA 3K5PA 2LQJA 2P6SA 1CPQA 2OEXA 1HQEB 4RW7B 3JSEO 3OUYB 3S8SA 3ABMC 3MM8B 3LEVA 3G6ES 2XL8A 2J9CA 3T41A 1SCJB 1ULRA 2HBYB 2K2PA 5AT1B 2O67A 5ETOA 3ZIBA 2YKZA 5D3GA 1TU0B 2E5JA 4XO0A 1M90T 2ASLA 3M9OB 4W92B 1YWXA 1RDRA 3EDRB 2YL7A 1N52B 4ZCLA 4OYXA 5K20B 2XB2D 3BH6B 5KAKA 2V8HA 1FE0A 5G4DA 3OXLA 2KM8C 1JB0C 1IM6A 2P7VA 2XYPB 1XZQA 1UW9A 1WHVA 2VQEJ 1R8PA 4HT5A 4QYRA 4EUVA 2A1DD 2OG2A 4KHRA 4DR3J 3PHEA 5KFTA 1WEXA 2IMWP 3QVZA 3BEHA 1ZHXA 3IQCA 3M05A 3AG3C 4OJ3A 5L3QA 3MM5A 1QUPA 1S1TA 2KG0A 1FJEB 3J7A1 1F2GA 3H0PA 2BV3A 3EFOB 4C3MA 1FAPB 1F1BB 3QSYB 1CGME 3GFYA 3UI3A 3QW0A 3R97A 3QT7A 1KU2A 2JRSA 4Z7YA 1PIEA 3PVXA 2DTJA 5IT0A 1QLNA 3V6JA 5E0OA 4QOTA 1YYJA 3PFOA 1WWHA 2YX1A 1RJ9A 1S9GB 3A8EA 4G3IA 1FKOA 4JV2A 1RAOA 4NTBA 2WAQD 2DYRC 1EQMA 2DB4A 4WTOB 4KBLA 4RZRA 4X64F 2OD4A 1OXKA 1BD6A 2VG7A 5DS6A 1I6JA 1WC3A 5LXYA 2EEYA 3KK1A 3U02A 4YB6A 2V9KA 2KFNA 1EARA 4CDVA 1HNVA 4USTA 1RJJA 1MN9A 2BJ3A 3HF5A 2WB1D 1DLOB 3HVAA 3OL6A 1MNDA 2APOA 3N5BA 1KLMA 4AE4A 3VF0B 4A4AA 4JEBA 1SUQB 3KLIB 2BJ8A 3LOUA 5HANA 1REGX 4ETZA 1ZZPA 2HMIB 1S97A 1I51B 4X84A 2J9BA 3TAMB 1MW7A 2A6EF 2BE9B 4ED6A 4XLNF 1U0SA 4OYPA 2HRTA 1FJCA 3O8WA 3R2CJ 1KHVA 3GJRB 3TARA 4LSNB 3TRGA 4O3OA 3S28A 4L74A 4OYBA 2M64A 4K7BA 5C42A 1KQFB 1HNIA 1N5YA 1P9YA 2BA9A 4IGGA 4ANJA 3LNRA 1T3NA 2GA7A 3NGKA 2PDAA 3U0CA 3DGPA 2HFUA 3NRBA 4F04B 4NXMF 2ZH3A 2OJED 2XMMA 1VBKA 1HMVB 1T7PA 4KBIA 3EJMA 3VM6A 2UUAF 1HBOA 2YPYA 4AK9A 1YJUA 3OTBA 2LA4A 4ECXA 1UVKA 3O44A 2L6FA 1Q81T 4CS7A 5HO4A 1OR2A 1N32F 1IKYA 4ZLLA 4IOBA 1X4CA 3AD9C 1UJ6A 5KFAA 3MPYA 5HLFA 4Q0BB 2H4WB 2P5VA 1FFTC 1ZOTA 1PBAA 2HNYB 3QFHA 3BV8A 4DLEA 4B08A 1XIQA 1FDDA 4JI8F 1R31A 1C0UB 2NSFA 3VGTA 3ASNC 1JAFA 3N5FA 2FLNA 1SC6A 3MEKA 5AJ3J 2VG5A 2FC8A 2CZ9A 2VC0A 2VDHA 4O3NA 2PA3A 1RB0A 2BQ3A 3X1OA 1D1UA 4CLLA 4ZHRA 2R7OA 3UMHA 1RT5B 1P9QC 2QLWA 4IG0A 1W2WA 2N3OA 1JNZB 5DS7A 3ZZYA 3FZBA 3PX6A 2W4BA 2ATCB 2C3MA 1SL0A 3N0VA 3KK3A 3E2EA 1NFNA 1P1TA 5T41A 2R2RA 2WW8A 4I56A 1QKRA 1RT3B 2NZCA 1BXNA 5KFMA 3B0PA 1AUEA 4O3RA 3BEGB 3D6FB 2QZ8A 1CS4B 2VHGA 2A18A 4LF2A 1TQLA 1GQAA 4EUKB 3H8YA 2PSZA 2A2CA 1UG7A 4ECQA 2R7QA 3LEOA 2GC8A 2GHVC 4LREA 4I2QB 3W66A 3S84A 4HH1A 1AB8A 1U6BA 2HGLA 2R2UA 2YH1A 5FDLB 1O6XA 4CNYA 3A13A 4Q5VA 1UVLA 2I8BA 1S1UB 1VRUB 3P3DA 1T9WA 1BWEA 4DX8H 4CSAA 2YL1A 4OI4A 4YL3A 2RH3A 3GM3A 2XS1A 4MQ9F 5G0RB 1TQGA 4DG1A 2HURA 2WOMB 3H2LA 3I0RB 3LGHA 2KB2A 2DR5A 3CULA 1RAGB 1Z3IX 2W01A 3SSRA 1EKYA 1VLSA 4ECSA 2IM8A 1IM4A 1O0PA 1YJVA 5T1DB 3LJBA 2NUPA 1BUXA 1HKAA 3FDQA 4LFAF 2W7PA 2OOCA 4GMKA 1CJUA 2DKOB 1FERA 1OQ3A 3G8SA 1T9VA 5MLCV 2ICWG 3ZTRA 4YB5A 1YVIA 4BBYA 3LP0B 2ABYA 2YL3A 4BJ6A 3QATA 3GM2A 4X66J 4B6IA 4IRCA 2IA6A 3J7AN 1U2RA 2DNMA 4WP8A 4DSEA 4DFJA 2W9BA 4JVSA 3LAKA 3QBCA 4ER8A 4NLRA 1RT1B 1VISA 4DUTA 3BDEA 2YZSA 1HLWA 1NK8A 4IQXA 3MR5A 4CS8C 3VQTA 3KOAA 4PFPA 2VA3A 4ZIWA 4JI5F 1DFDA 5HP1A 3LNMB 2J46A 2QIFA 4C8LA 4F02A 1FK9B 4DL0C 1JRAA 4I0WA 3GWLA 3D1HA 4XIUA 1XMQF 1SJ3P 1NO8A 3QIPA 2J7PA 2QLFB 4NLXA 1UFBA 2DPIA 1O51A 2Y69C 3V4MA 2HVZA 2F63A 3MCOA 1UEKA 4CTAA 1TL7A 5KG0A 1OW8A 3PR4A 2XY6A 2VKZG 1PBUA 1IR1A 1OWXA 1Y0HA 2V94A 1TKNA 2OP5A 4RUBA 3HVTA 4DV0F 4EGLA 2CIMA 4ZJOA 1Q8IA 1FNTc 4CCHA 4OZ2A 1IKXA 1RWXB 2ZJQQ 5J1PA 1UVJA 4DSKA 2QSFA 2IXPA 1U4BA 3UDVA 4LF9J 5KFJA 2ZVIA 1F9FA 2XLKA 2R7RA 4WIQA 3TZXA 2FY8A 1IKWB 2ZH2A 1XNQF 3J7Z5 4C98A 5KT7A 3HNKA 4B3OA 3NS6A 3O55A 2BANA 3ASOC 5JVGQ 4OX9F 2HG4A 3KLEA 1GH8A 1LXJA 1T5OA 4JTDB 4KH1B 1F9HA 4RW8A 5AC5A 2MY7A 4RUHA 1DTTB 3JTLO 1YJWS 2MTLA 1TL3B 4ED3A 3HSGA 3MCNA 2PO4A 1XC9A 5KFVA 3VAGA 1U48A 3CO9A 2J7PD 1R8HA 4OHVA 4K2JA 2Q9CA 3G9CA 4F4KA 2CGEA 3PY8A 3UGPA 2V6AA 2D9OA 1GMUA 1UWAA 2EG1A 1LWXA 1DQ9A 2YRFA 1HQEA 4MKVA 4F67A 1NEEA 3IR6B 2VKRA 4RW7A 1Z23A 2OH2A 4DDFA 2C28A 1S59A 2DJWA 2IBKA 1TMMA 3BSNA 2M2BA 3SMZA 3LW5C 2D41A 3FBBA 5GAHI 1RXQA 3DNCA 2Q6CA 1JMTA 1S1WB 3DLBA 2RMLA 2GNKA 2Y1RI 4JV5J 3M2UB 3BPSP 4DR6J 4YEAA 2DXFA 2QTVA 1JLFB 1IVZA 3ISNC 1QVXA 1CJVB 1WG1A 2W8KA 1NZAA 2ZPAA 2AHOB 3RFYA 2HFSA 1G5ZA 3FEYB 2I1RA 1XEZA 4JI6J 3SXZA 3EFOA 4NYOA 2KFYA 1YI2S 4AX2A 4ID5B 3UCZP 1NPRA 3MMAB 2OMOA 2Y1JA 4FNHA 3MMCB 2CNKB 2FJVA 1M5HA 4LR7A 1RAEB 1H74A 2CJXB 3Q2SC 3PEJA 3SXLA 4DX6A 4IAOA 3A3NB 4W90B 1S9GA 2WVQA 3GIIA 2C04A 3PIOQ 3G4XA 3KDOA 1VBYA 5EWGA 2BBEA 3RVZA 1EA8A 2C3YA 2QA4G 1M5SA 1D8ZA 4ILMA 4ANDA 3LWMA 2TMVP 4K4VA 3M8RA 2PMHA 4QDLA 4M5LA 5A0YB 4PXBA 3RB4A 4OIXA 3KNGA 2FGYA 3D0HE 1DLOA 2C42A 4AYBD 2JNJA 3HTKC 3EE3A 2VG6B 3VF0A 4GC7A 2HQGA 1OYDA 1GK8A 1SUQA 4G78A 3KLIA 4F4WA 5IFMA 3EGVA 4RW6A 1H9GA 2W1BA 2HMIA 1U8SA 1N6QB 3TAMA 4ZP6A 3W2VB 5GPGB 1ICEB 2DR6A 2KZZA 3GYNA 2QA1A 4LBPA 3JB9k 5CA5A 4IR9A 3I5QA 3CCSS 1SIZA 4NA3A 4LSNA 3CD6S 1FWPA 2QFJA 5L1LA 5E3AA 4J9QA 4ZPVR 4BJTA 3V4IB 1YA7O 1QSYA 1LM3B 2YHSA 4ZN3A 4MK9A 3ZTMA 2AEJA 5J2NA 2VFUA 3GJQB 3WQPA 5KFOA 3FFIB 3Q7LA 2VOPA 3KYLA 2Q79A 2FQQB 3Q0AA 5F9LA 5CHCB 2YNGA 1U1MA 1SKUB 3SSSA 4K2XA 3MAAB 3GFZA 3UGOA 3D6MB 5F8HA 5F41A 2KL8A 1OCZC 2ZBIA 1CC8A 3ENAA 1C1CB 3TANA 4TNOA 4ZKAA 3FCWA 4KQZA 3GMGA 4Q0BA 4IWBA 3BKFA 2HNYA 2POKA 4DV2F 2DNZA 2W9AA 1C0UA 2AT1B 4C8NA 4X64J 5DZ7A 1OKKA 3C6TB 3FUYA 2GIQA 4FF3A 1OCRC 3U2LA 2Y3HA 1F0XA 2O66A 2UUHA 1YSJA 2KXFA 4KR0B 3LPYA 3TZZA 2EG2A 2HS5A 4M95A 3QWUA 1OY8A 1RT5A 4QR2A 8RUCA 4PG8A 2IAJB 3OHAA 1S9EB 4ED0A 2ACYA 2NUHA 4G1PA 5AXKA 1HQ2A 3RB0A 1CSJA 3ECSA 4ECUA 5T3WA 4OIRF 3J80Y 2WVNA 3BO3A 4MTPA 3DJNB 2Z2YB 4LIWA 1RT3A 4HTJA 2B6AA 2GZOA 1HW1A 1HY5A 1ZHTA 1CS4A 2QFIA 3W5ZA 2MGZB 2HJ3A 2P9CA 4NMLA 1N36F 4DCOB 5F8IA 2Q00A 1A9NB 3GJSB 3KHRA 3C16B 4DWIA 4NLVA 3BGLA 2DYSC 3N4WA 4A8KA 1AZSB 2DNGA 1WORA 4I2QA 3R7BB 4ZK7M 4JV0A 2LMIA 1BBHA 2I8EA 5ETLA 5FDLA 5IS2A 3EZOA 5J2PB 3Q22A 4ZLJA 2KTQA 1YIJS 1S1UA 3VAIA 1VRUA 1RXOB 1VGYA 1RTDA 3OWTA 1N56A 4NXMJ 3TJ5A 5G0RA 1FJGF 2F4FA 2BACA 2IM1A 3I0RA 2YKOA 3MPVA 2UUAJ 1SI9A 1HI0P 2CFXA 3GB0A 5D0RA 3Q83A 2V4RA 4ICLB 3UDLA 5EHHA 1OKKD 4ID8A 1FDAA 4MKBA 1N32J 3I55S 1SQFA 4TY9A 1JX4A 1GMWD 2CNLB 4OI0A 4WZMA 4DR7F 3S0XA 4USUA 4FXVA 4RU9A 3KUGA 3TJAA 3GU0A 3HLZA 3LP0A 2HFIA 3THVA 4JI8J 4KE5A 4ZPCA 1B0PA 1SJFA 3OLBA 2OTJS 1HHTP 5CYQB 3P5TL 2L9JA 4U5HA 3W8GA 3L95X 4DR5F 1EETB 1C1BB 1RT1A 2WSFC 2XLEA 5T14A 1NJWA 4JI7F 3CCES 2F9DA 2WVEA 2XYGB 3IG1B 4X62F 2Q6BA 3FRYA 1ORSC 3W1YC 1KNYA 1JJCB 1H38A 3C8YA 1YX2A 2GO9A 2VOOA 1XMBA 3G6YA 2HHQA 3PW0A 2VC9A 4MKYA 2QO3A 4YP3A 4PXCA 3K58A 2YVSA 3AT1B 4PAAA 5E3PA 3G87A 4DOZA 1Q8BA 2ZC4A 5B09A 1C03A 4C9DA 1VIOA 2Z57B 4OYOA 3CNQP 2OCCC 5LM7E 5L38A 3ETOA 4N8OA 3GG0A 1HNWF 3Q7GA 3OVBA 2NXEA 1ZETA 3HLUA 4V19X 4OHYA 1QDUB 3HKWA 3PZPA 3D9BA 4NEYA 1RLCL 1M5PC 3K17A 5LJ3Y 1XQIA 4CM0A 1SJ1A 2KKHA 4C8OA 2X1AA 3NDBB 4O0NA 1WI8A 4Y2MA 1SZIA 4IR1A 4IAQA 2PX0A 4LDQA 2BEFA 1KKHA 2OEVA 4BLGA 4P9FA 1XWLA 4JI3F 4WIIA 1YYXA 5L1IA 1ZW2A 2PD1A 2XLJA 1PO6A 1FCAA 1GTEA 1TFKB 2PI4A 3CDBA 3KDNA 1ZPWX 1IKWA 5T3TA 4TKTA 3S7RA 5A6KA 1NHUA 4LFAJ 2LEPA 1AUSL 1DURA 4F0HA 4ULVA 1U02A 1ZHZA 2LXUA 3BQ2A 1K1SA 2MDAA 1M5KC 3R5JB 2WSEC 2RSQA 4K4XA 4WJ0A 1N33F 1Z5ZA 2ZNYA 3AJDA 1VQKS 2NLWA 2X1BA 3D1QA 1RHUB 2BX6A 2H51B 1GGQA 1DTTA 3M2RB 3JSMB 5BUOA 4TVAB 1VMBA 2J76E 2QMWA 2RSEB 4ZLPA 2CQ3A 2BZ2A 2CQHA 3E9VA 1Q16B 4AL7A 1X8DA 4KGVB 1KEKA 2FAPB 2HRUA 1IBKF 1S49A 2YKQA 4FKYA 5BYQA 4I1OB 5FLXU 3DRRB 3S1TA 2LDYA 1X4GA 2HIYA 2LVWA 4JI5J 3WDOA 3JQMA 2RNEA 2PBEA 1X0PA 1K9MT 1LV5A 1FF2A 4XPXA 2FLPA 2W45A 1H72C 1XMQJ 3D66A 2KQ9A 1K73T 1D9AA 2HS3A 5LSOA 2LIGA 4BCAA 3HHNB 5IV3A 1S1WA 1RA6A 2PFFB 4YDXA 1U25A 1D09B 3G8TA 1G2EA 5KFPA 1QM9A 3M2UA 4ZPAA 1FA0A 4YN3B 2W9CB 2V63A 1JKHB 3L1MA 1KDNA 1HNXF 4CQ1A 1G3OA 4O3SA 3BPDA 2D4UA 3NMIA 4EZ6A 3RJMB 2E7XA 4DV0J 2YVKA 2MWQA 3NY0A 4ID5A 1R27B 4XTKA 4PFOA 3MMAA 3BQ0A 1E86A 3MMCA 5KFIA 2GMJA 2HKEA 3IC1A 5DQHA 1MMNA 4XLPF 4OYMA 3IS9B 4X2BA 4K7QA 2QGFB 4P75A 4U67Q 4LIRA 4LF1A 2ATLA 3EQLF 2QC3A 4U5DE 2RUSA 2DR7A 1S6UA 3NCQA 3GG1A 1XNQJ 1GT8A 4GEHA 3WX4A 4DV7F 1KQGB 4IFVB 2ADBA 2EXUA 4OHWA 2HHSA 1U6ZA 2A0UA 5A0YA 1A6LA 4RKUC 4M5MA 1N0UA 2UP1A 3X1LB 1Q53A 3GV8B 4OX9J 3P49B 1OW7A 4JEAA 1LOUA 1R0AB 1G8XA 3FAPB 4YT8A 3B82A 4MK7A 4N41A 3RG6A 3TULA 4FKXA 3SBMA 4YJWA 4F7VA 3H59A 2VG6A 2ZH8A 5A76A 4KGMA 4P2FA 2YNHB 1ZAWA 2KGOA 3TR5A 1X4AA 4P73A 2ZUAA 1YAUO 1OCCC 4IDKB 4PQUB 1VLOA 2RF2A 3W2VA 4YOEA 2OTLS 4LRAA 1WN0A 2L7AA 4NPOA 2XHWA 2ZM6F 3NCRA 1TUGB 5KG6A 2MHEA 5LOQA 5A69A 4BDPA 1X31C 2EWHA 2AQ4A 2V0NA 3WC2A 2J6SA 2OPSB 2UXDF 3K0JA 5GVQA 3O6QA 2WW4A 2MKCA 3BN4A 1QAYA 4OZ3A 4C8ZA 3O10A 1DAXA 3NKYA 1JXEA 5B1BC 1HIYA 1M0SA 2DR8A 2EILC 1M2VB 2MHRA 1FMVA 4JE9A 4R8UB 5KT2A 3JYHA 4PK4A 1BLUA 4ZVUB 5M2UA 5AXLA 2QG9B 2VH7A 3FFIA 1FMWA 2YWKA 5IT9Y 3PCVA 1YJ7A 4G0HA 2UVUA 4ETXA 1XERA 2R02A 4YL1A 4LLEA 1FKPB 3MAAA 3MURP 4I64A 3DFEA 2KN4A 1NSQA 2BE2B 4YB7A 1UMJA 4Q2LA 3CCWA 1C1CA 3WHIA 2JLEA 1C02A 4EEYA 3CC2S 1JIHA 3AB2B 4TXSA 3SQOP 4HVZA 3R9LA 2DGTA 1CJKB 2AIRB 1HR0F 3KG4A 3UNYA 3V2UC 2DH7A 1NZ8A 4F2SA 3CJSA 5JMNA 3ZNUA 1TR2A 2OPPB 2BYCA 3KWMA 5L0HA 2KVQE 2EK1A 4PJMA 1NPKA 3IGNA 5CD4A 2H7BA 1HFEL 3GIKA 1YDIA 3C6TA 3KJNB 4F25A 1VTMP 4CH0S 3PMRA 2ZUGA 3U1LA 3HHLD 3TVKA 3C19A 3NAIA 1V5VA 4M63A 3R3TA 4EU0A 2DNYA 1DY3A 1U6FA 2V4JB 2IAJA 4LRCA 1UPMB 1A7VA 2DIVA 2CPEA 3AODA 2DCLA 3DCAA 1FHTA 3BF4A 2NXNA 2EFVA 2QLAA 4ZVEA 4YUDA 1D3WA 3DLKB 4G1IA 1MROB 3QVYA 3VVUA 1HL6A 3D1OA 4FVCA 4NZ7A 4DQPA 5K8NA 1JLGB 1Y7PA 4NZ6A 4NCGB 2FHOB 3C16A 3HT3A 2OKUA 1AZSA 2CZ4A 2QSWA 3IWLA 2F5GA 8AT1B 2E5IA 2YPZA 3ZTPA 3O1LA 5J2PA 5DLGA 1KFDA 2IRXA 4LSLB 3J7YI 1REVB 2LQ5A 5AE3A 1HA1A 1OIAA 3AOAA 2KJWA 2BQUA 3KLFB 3RZAA 2KW3C 2WVCA 5KFWA 2LECA 2FPHX 4ES3A 5K0IA 2DXEA 4QW8A 3IBCB 2I6WA 4ED4A 5KFUA 5BQIA 2ZBCA 1XNRF 4ICLA 3RW0A 1SPBP 5D15A 1V74B 2YEVA 1CPRA 2LXIA 4XPCA 5A8KB 2ZBRA 1U09A 4DV2J 2H5JB 1WNEA 1O87A 1XTZA 2N4CA 1FI4A 5CYQA 1ZU4A 5DG7A 4EMDA 7FD1A 2R9RB 1YBUA 1EETA 3GPAA 3R27A 2GAQA 2ZH6A 1RU2A 4QU6A 3NMJA 4RD9A 3EYZA 4K50A 1SR2A 3W65A 4P6IC 3QW1A 2VFTA 2Z0GA 2YX4A 3VAFA 1WJ9A 2J7WA 1ZM4A 1N48A 3BSCA 2KYXA 3JRMO 3IG1A 4RNNA 3VCDA 1CULB 2LDIA 3VHQA 4PXDA 2G0IA 2R03A 2XZTB 2Z2LA 2I15A 3R5BA 1BGXT 2XZDB 1X5OA 2AWYA 1U24A 1TTHB 2B3TB 2PE8A 4DVYP 3FBEA 4F36A 3MD3A 3M6WA 1VQSA 3IBFB 1N36J 1NZEA 4MTGA 3PTWA 3G4SS 2IXNA 2C2KB 5KYWB 3AXKA 2J8AA 7AT1B 2UUWA 4D4XA 2IVYA 2WVBA 2GFFA 2XS7A 4LFCF 1NU9C 4DR1F 1VQ8S 3M6VA 2ZC3A 4FF1A 3PX4A 3CJ2A 4KY3A 1BC6A 3H42A 2Y1IA 4F2RA 2AWZA 5HJYA 3L3CA 3B9QA 4ZLDA 2FVCA 2AJQA 2P9EA 3HZEA 2MQ8A 4I1TA 2CJ9A 3CWJA 1R8CA 4P71A 2JDJA 4DPUA 2DCUB 3Q8SB 1ZTWA 1RCOB 3A11A 1VRTA 1Y3JA 3ULHA 4B3SF 4CS9C 2BM1A 3MM7B 1G6BA 5ETPA 4CM2A 3PJXA 1H98A 5HJXA 4IARA 2XLOA 4DR7J 3SFUA 2BABA 3IQ6A 4IRDA 1RAAB 3K8VA 3JXOA 2RB7A 4K1OA 3BYPA 1AROP 3FMWA 1S6QB 4B3TF 3UDCA 1U1NA 4NLGA 3F41A 3OQ2A 1J8YF 2QY9A 4MVRA 3M2RA 4WP3A 3JSMA 3CJRA 3MOZA 1PJ6A 3BGOP 4DFKA 4JTAB 1H2VZ 5L0GA 5DDRC 4R32A 2VBYA 4DR5J 1TL4A 2DO4A 2DEIA 1O8BA 2XLMA 3CEDA 4NWBA 4E17A 4ENOA 2PI5A 3JZ0A 3DRRA 3H5SA 2RRAA 4JI7J 4WABA 4CO2A 1LXNA 3CIZA 2DB1A 3I5CA 4ZMMA 4KNWA 4C3EA 1MLAA 2FVRA 3NYJA 3SCJE 1FWLA 1CQMA 1LWCB 3K5NA 4P9TA 2FZCB 3EVOA 4NA1A 4GKKF 1WWPA 2HQFA 3K33A 3AOCA 3CC7S 2RDDA 3W9JA 1N5VA 4KJIA 4AL5A 4P52A 5BXIA 2G62A 3H5XA 1S0OA 3M8SA 4U5FE 1XK8A 3VWSA 1MWZA 1BWVA 4J32B 2QJ3A 1JKHA 2YKNB 4DV5J 3T4RA 4DL5A 2WZGA 1HNWJ 4U9RA 1RE1B 3GEHA 5DDOC 3MUMP 3U3FA 1W26A 4YY3J 1UFWA 1RT7A 5KFRA 4CLPA 4UT4A 2ZZTA 2EFQA 2DGUA 1K04A 3RVYA 2Y1LB 1RWKB 3QMKA 2CNNB 3DXBA 1RHQB 3MUVP 3N6MA 2OD6A 2ADCA 2E29A 2EIKC 3QRQA 1WF2A 2VPWB 2AX0A 4EZ9A 2W4DA 3DYAB 3DRXA 3AG4C 1NK5A 1TWCA 3RU0A 3TOQA 2AJ2A 1EJ7L 4JI3J 3IS9A
chains in the Genus database with same CATH topology
2C3PA 1UA0A 2GC8A 3PDNA 5LSLA 2GHVC 3GWCA 4DQQA 4I2QB 3UCUP 1LS1A 2MSSA 2W25A 4HH1A 2RE1A 2DPJA 1U6BA 2HGLA 2ZITA 3H40A 4ZVFA 2R2UA 4PRFA 4GO5X 2VB6A 1R43A 1KR4A 2HQ3A 3OR1B 5FDLB 3CD5A 2YH1A 2KHCA 1RT6B 4CNYA 1YITS 2DIUA 4WE1B 1IUJA 2KNHA 4Q5VA 4QIFA 2MHNA 2VFSA 1UVLA 3QJJA 1JJ4A 3JTPA 3GODA 3HVRA 2I8BA 1S1UB 1WI6A 4IFVA 2AJFE 1VRUB 1LK7A 3P3DA 1BWEA 1KTVA 2N7CA 4DX8H 4CSAA 4OI4A 4BC7A 2RH3A 3CTRA 3H20A 3GILA 2IXMA 4RBVA 4MQ9F 2RRBA 3EXCX 5JXSA 5G0RB 2R8GA 3DLEA 4USHA 1T03B 3EH2A 5F5FA 1MWYA 5EX3A 3SDEB 3RBEA 1X9WA 5J2MA 3TP2A 3QGPA 4DG1A 3FMBA 2YTCA 5E3QA 1KNZA 2WOMB 4Z2XA 2XI3A 5J1NA 3RW7A 1R0AA 2OKQA 3H2LA 2OAUA 4I7FB 4YMEA 5A2QY 3I0RB 4NYZA 2KB2A 2M5YA 2DR5A 2WB4A 4OL8A 3NLCA 5E2QA 3CULA 2HVIA 3U27A 1Z3IX 3GIMA 1R89A 2MQPA 1NKEA 2F7VA 2JZ5A 1LW2B 1X5PA 3SSRA 4NLQA 2A3JA 4Q45A 4ECSA 4URSA 4NYPA 1IM4A 2IXOA 3IEEA 3TYTA 5IT4A 4I44A 1O0PA 2ASJA 3KH2A 2CQBA 3HO1A 1GXTA 3HMJG 3EGDB 2IVFB 1YJVA 1DTQB 5T1DB 3LJBA 2NUPA 2YNHA 3CJ4A 4AFFA 2FHKA 4O0IA 2KXHA 3ZZZA 3FDQA 4LFAF 4CT9A 3VAHA 4OV1A 1LWEB 2W7PA 4GMKA 4X62F 2BM0A 3NNAA 4IDKA 5GAGI 1T8EA 3L09A 1DZ5A 5B08A 3N79A 1FERA 4PQUA 2R4FA 1IQZA 2O3DA 4GKJF 1OQ3A 4N06A 1ZH5A 4XAKA 2M3DA 4NCAA 3ZZOA 4OFZA 2FHJA 3NWGA 3G8SA 4NLPA 1N5QA 5MLCV 1SIWB 2ZH4A 2QEXS 3IWNC 2MJNA 4O44A 4YB5A 3OVSA 3OXFA 4BBYA 4TY8A 3LP0B 2ABYA 2B5JB 2ZD1A 3K8WA 3M8PB 1FTCA 4Y6IA 4BJ6A 3W2WB 3HVTB 4WK3A 3LWLA 3CF5Q 2J6TA 4B6IA 3NAHA 2QA4S 4IRCA 4CH7A 2AF6A 4KFBB 2IA6A 2VPXB 3L0IA 3NCPA 1VK8A 1S1XB 5HSWA 4PKDB 1U2RA 3V7OA 3OTEA 1NG1A 2DNMA 2DBBA 3OFEA 5DLFA 1D0YA 3F73A 3EPGA 4CI0B 2A2DA 2HZCA 4DSEA 4DFJA 2W9BA 3CSKA 3CIMA 4P7VA 2KT2A 4JVSA 1SV5A 3G96A 2LSEA 1RYRA 3LAKA 2OO4A 3CD7A 3QLHB 3QPIA