3ZC4A

The structure of csa5 from sulfolobus solfataricus.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
157
Chain Sequence
PVAETISKRFWTLIKMLRFYVVLRRFGYIDPLIYSIDPKQIKDVLSEALREFVSYTSSSSSRSIVIYDDPKNPVTAQAPCLVVAKRDEIPQNFPSIYRYTIYKIDKSSEYCISPLVVNDKYATLITPNESVIKEFFDKLDSNIQYARVLASLAVGGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SSO1398
publication title Structure of the Archaeal Cascade Subunit Csa5: Relating the Small Subunits of Crispr Effector Complexes.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Immune system
total genus 52
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2012-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3zc4A01
3.30.70.2780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3zc4A02
3ZC4A
chains in the Genus database with same CATH superfamily
2XY5A 1X7VA 1B7FA 3U9JA 1N5VA 2YNHB 1ZHYA 2QT7A 4OI0A 1FWPA 4URQU 3UNGC 2XLOA 3HO1A 2OPPB 4TVAB 3LS0A 1LKZA 1Q4RA 3BBCA 4DPYA 1GTEA 3VF0B 2CAJA 3DMJA 4E18A 3M9OB 2RS8A 3DYAB 1UETA 2DXDA 2GJ2A 3EPVA 2YLGA 4M5DA 3DGVA 1XN9A 4JP8A 1FT8A 3N6LA 4WE1B 4J9VA 4IAQA 3MEEA 1TR2A 3N79A 1E85A 2O5DA 1LV5A 4A8KA 4GKJF 1RWXB 2CIMA 3I4UA 3I55S 1LKXA 4KJIA 4MVRA 2JJ4D 2DT9A 5CI8A 2YWKA 4MJKA 4NLRA 1M90T 4FYDA 4C0HA 1GMWD 4OV1A 1N56A 1BR1A 1PYTA 4DR4F 1N0VC 3OQ2A 4QR2A 1U1MA 1F9FA 3KLEB 4MVMA 1HYSB 3D6HB 1J5OB 3T1AA 2NXNA 3EGDB 4OHYA 4QBUA 4ED8A 3GE9A 4B3TJ 4U9RA 4RW4A 2W9BA 1KVJA 4RNFA 3VQSA 9ATCB 2VL1A 2XWXA 4K4TA 1VYAA 3D0IE 3HHLC 3DI6B 1OYEA 2RQKA 4I3MA 1RWOB 3R2CJ 4XTTA 3TULA 3DKAA 3SP1A 2E29A 2YKQA 3OFEA 2A68F 5FDLA 4C3EA 1GX5A 2ZZNA 4XTKA 1K40A 4KYZA 2GIQA 4O23A 4O4GB 3W8IA 4BHQA 1NBEB 1RAEB 4ER8A 3BPSP 3M8WA 2DCLA 5ITHA 1Z23A 4HR2A 2B7BB 4OJ1A 5B0CA 1YJ7A 2XLKA 2J0QD 5IOLA 2RF2B 2D9OA 2RRBA 5D3GB 4W98A 2NLWA 1KFDA 2PFFB 4N8OA 4X65J 4UY8T 3T6JA 2BE2A 4O3RA 5T7LB 5KFHA 4V19X 5CH7B 3CD7A 5B0EA 1KLMA 4P9FA 3LALA 1Z6AA 4EYIB 3TOLA 4X62J 2CNWD 1KQGB 4PK4A 3D6MB 5CYMA 2F9DA 3PTWA 3CO0P 5C42A 2CPXA 2KU7A 1QTMA 2QLAA 3K5LA 3GV8B 1Q16B 1U24A 4B08A 2FLNA 3PW5A 4BC9A 4CZCA 2CQ2A 2MTLA 2IAJA 3P4UB 2EPNA 3B4MA 4H4OB 3ZVRA 3K66A 5A2QU 3GQCA 3JT1A 3KK1B 5DG8A 4ZPAA 4B9UA 1VIOA 1ZA1B 1ST6A 2HZCA 3GM2A 3MOJB 3BSCA 1OQ6A 3KG0A 4J37A 5KG5A 1LK5A 4P7TA 5EN1A 4DRIB 2X1BA 3O10A 1IBCB 1UCNA 1LPEA 1L5UA 2ACYA 1KVIA 4N77A 2HGLA 4HDGA 2FZCB 2FIUA 3J80Y 4R32A 4OX9J 3OFGA 2CPIA 1T05A 3FBCA 3CC4S 4BJ6C 4AE4A 1JIHA 1G7CB 4F7VA 2M5YA 3AQPA 5IT0A 2KNHA 2W7AA 4GC7A 1T5OA 4MVQA 4ZCLA 2J9UA 1DQ9A 3BREA 1A7VA 3Q7GA 2YKNA 2ZNYA 1JNZB 2CYYA 1U0BB 2OFGX 3OD2A 1TAQA 2YKMA 3EHMA 1QSYA 1KLMB 4CO4A 3FGVA 2NS1B 4ZPWR 1SJ4P 3UMIA 3EFOA 4B3OA 1X4HA 1Y0HA 2MKKA 3UDLA 4YY3F 5CYMB 4BBYA 1D0XA 3IEEA 2NXCA 1H72C 3W5YA 2RAQA 1RZMA 4JV0A 1MWQA 1WOOA 2R25A 3U5SA 5HJXA 2KFNA 1FI4A 3EE3A 5D92A 2XMWA 4NLWA 1S0NA 2AMCB 1T9UA 4DQRA 1X9WA 1ORJA 1OW6A 3Q0AA 4H4KC 2Y1RI 1HW9A 2QFJA 3P8BB 3NMJA 5KFQA 4Y2IA 1U4BA 3D1OA 1SV5A 3TANA 1T9WA 2CJ9A 3U3BA 1RA7A 4U9EA 4MW3A 2PMWA 4MVZA 2XG8A 3MEGA 1W2WA 1ELOA 5A6WA 2FJWA 2N7YA 2Y8WA 4FZVA 5LMNJ 3TO8A 1FEEA 1HBMB 1AZSB 2FHOB 1TK8A 1K0TA 3ONQA 3J81j 1YX2A 1T05B 2XXAB 4IFYA 5HV9A 4QWCA 4AE4B 2XSFA 3LH2S 2W2OP 4HT5A 3CSKA 1VQ7S 3FCWA 1L3PA 2HPUA 3JCUQ 5BUOA 2PO4A 2WONA 1QLNA 1KU2A 4XQ1A 4RBNA 3C16A 4ZVPB 1FFGB 2GW8A 3HNIA 5B1AC 2F4FA 5GMKa 1N5YA 2IJNA 5F8JA 5HLFB 4D4XA 4J7TA 4ID5B 5F8NA 5IQQA 2F22A 1RT2A 1TL3A 1BD6A 3EFOB 2XY6A 4B3OB 1K05A 1JB0C 3ZIBA 3IGVA 1ZS6A 3OT9A 4CT8A 3QNWB 1T6QA 3RIPA 3AXKA 1URNA 1VC0A 5JVGQ 4AT1B 1UFBA 2CQHA 4L3KA 3UN2A 4ID8A 4A8MP 1HD1A 4Z7YA 2R9RB 3SQGA 5CCLA 4CO3A 3JS9A 2PIIA 3BQ1A 3S27A 4HVZA 3R97A 4NLQA 2IMWP 1VOMA 2HIQA 1NJIT 4MFBA 1P8GA 1R8AA 3G6YA 4YR3A 2ROPA 1FRXA 5HSPA 4K0KF 5KYYA 4JZAA 1BQNB 4CLPA 1X5PA 5CAAA 1R8BA 1PYOB 2BOAA 3FKBA 2EFNA 4I69A 2MY7A 3E01A 2HV7A 4IQMA 1N4LA 1D0EA 1YITS 2LEAA 4DRJB 2CVEA 2I0XA 2VFTA 2Q4FA 1GQAA 2OGUA 4M94A 4IFYB 5K14A 4DV6J 3MM7B 3AOUA 3KHLA 3DOLA 2IMOA 2HHHJ 3RQEA 2ZM6J 1C02A 1TKXB 4MTGA 4OX8A 3OSPA 1L3UA 5COGA 4DV1F 1VQOS 5D4LA 1N5TA 4E8UA 2VQEJ 4HACB 4MIWA 1R0AB 3KOAA 4UOGA 2GWWA 2CFXA 4E17A 1YZAA 1N5YB 1WATA 3DI5A 4TU8A 4DI6A 4AUKA 3MFHA 1A41A 3ECSA 3LOUA 1VC6A 2FVQA 4CS8A 1YAUO 4DL2A 2ALZA 3A8EA 4KV8B 1HBUB 2E1RA 4EI2A 1C0UA 3I82A 5B3SC 2ZZTA 1HNWJ 3ZWIA 2IC3A 3K17A 2BKPA 4JJGA 1VJQA 3KLHA 2Y3BA 2JLFA 5KFLA 1T94A 2GS8A 3K1HA 8AT1B 4ZVOB 1I6JA 4LF8J 1V55C 4WP8A 5C24A 5J2PA 1GMUA 4IDKA 2CJQA 3D6TB 3LUYA 1BY9A 2ZH9A 3ILJA 2QSFA 2LQ9A 5KYYB 1C17M 4O3OA 3VTIA 3R2DJ 4HLBA 4P6IC 1H2UX 3BSOA 2ZOGA 1KBRA 2EPOA 1Q8KA 1FKPB 4LSLA 1Y5LB 2W7OA 1X60A 1WC5A 1EQMA 4C98A 4B3RJ 3TD7A 4ZA1A 4U5BE 3D66A 1RDRA 3GMGA 5RUBA 2BJDA 3DOKB 1G4US 2HMZA 4NOHA 1B7YB 5I3PA 3V6DA 2K1RB 3DOMB 1HI1A 2DH8A 1RU1A 2DR6A 3DM2A 3KMIA 4YL1A 4I2PA 3PR5B 2ASLA 4LF2A 5F9NA 2EIKC 1S48A 4ECVA 3WIVA 2R8JA 3QVZA 4KC5A 4G7OF 2BW2A 6AT1B 2E9ZA 1T8EA 3BJYA 3W65A 3DE8A 2G1HA 4LACB 2P9CA 4ZVUB 2D41A 1H0HB 3TUPA 3CCWA 3HD1A 2VHGA 2HNYB 1FRKA 1NK4A 1HE9A 4ZLDA 4DR3J 2B4PA 4X4TA 5T3TA 3NGSA 2H5EA 4W4MA 3L7UA 2NG1A 3MR7A 2EXUA 2XCPA 3RQFA 3LESA 2C04A 2L08A 5JT4A 3G2XA 4J9QA 1FJCA 3EZUA 1GEHA 2Z8QA 1HHSA 1F2GA 2W2MP 3FFIB 5J2PB 2HNDA 4RKUC 3OSNA 4IDKB 5THWA 3QIPB 3DDNA 5KT4A 4D3HA 2UXDF 1BZ4A 3T6GB 2FJXA 1RUSA 5KT6A 4OIOF 3UDVA 1NDPA 2GJFA 4Y0FA 4YHHF 2FZKB 4EZ6A 2GQQA 4Z37A 2YLDA 2GGPA 4KE5A 2QO3A 4NXNJ 1N6QB 1HNXF 2DR7A 3GONA 3I5AA 4MK8A 3V7OA 4CS7A 2B9XA 2QSWA 1A0BA 2Y1JA 3MXHP 4XAKA 1KHVA 2J9CA 1IKWA 1L3KA 1YDLA 2WSEC 1UKUA 3HMJG 2XL6A 3GFZA 2ASYA 3FQKA 5A6BA 1P1LA 2LCWA 1ORYA 3HJFA 3T1HF 2KVIA 2CADA 4I67A 3B82A 1RAGB 3K6BA 5F8GA 4MVSA 1NSAA 3S90A 1JX4A 2KG0A 4EFAC 1S1VB 4S0MA 5EK0A 1VBZA 3H40A 2P9EA 4IG0A 1T3NA 2GA7A 2HIYA 1JMTA 4NMLA 2EPLX 3G8QA 1V3ZA 2F8HA 2H65B 3M30B 3MAAB 3LLKA 1KHWA 4P6QA 2ZH3A 2DYAA 2KB2A 3VAGA 3UCZP 3CJKB 3FOPA 3WBZA 5L0JA 2XC9A 1P6TA 3AAWB 4FPRA 2HNDB 2KRRA 4CDYA 1LWXA 4ERDA 4KH1B 1M1GA 4YDDB 1TKZA 4Q5VA 4Q0BB 1NDCA 2WBRA 5LJ5Y 3NLCA 1GH8A 4U6PA 2C28A 2VH3A 1QZXA 2HMIA 2V68A 1X4CA 2ICWG 1S6PA 4XLPF 2WW8A 2C2DA 3Q8RB 2V94A 3K5PA 4I56A 4MIBA 4J91A 1H3DA 5KTQA 4OI4A 2M4MA 3Q23A 2NUPB 2W1BA 1X0FA 4JI8F 2BUNA 4MTPA 4JI1J 1K8AT 3AJ1A 1HHQA 1X8DA 2VG7B 4JV1A 1IKWB 1HBOA 2JH3A 4DCPB 3R7SB 2DNZA 1EQ0A 2MHNA 4JIOA 3JQKA 5DJBA 1RWNB 2VC1A 4RJVA 4FVCA 2C03A 1Q0KA 1ZHXA 4ZVFA 1KWMA 4KRWA 4PYDA 2OHDA 4CO2A 5KFDA 3V5YA 3A11A 3QGIA 2VFUA 2OKQA 3SV3A 3SV4A 1WF0A 2LA6A 1YHQS 1F1MA 4IG0B 4JI7J 2ZKUA 2F5GA 2CYDA 5LSRA 4LQ3A 5L3QA 5J1NA 1UMJA 4X66J 1SQEA 1K0VA 1M5OC 3GWLA 2ZXWC 1YJUA 4W8KA 1K9MT 2R7SA 2VD3A 2OEJA 1RE1B 3EJNA 3W62A 1HPZB 4EBJA 2HZVA 1S79A 3WZ0A 4DR1J 2YWAA 2IHR1 2PN6A 1PG5B 4E0IA 3PFEA 4ZP9A 4NLXA 4HT7A 3QRQA 2UP1A 4IARA 3D1HA 4Q8FA 1NJXA 1G5ZA 1Q8IA 2W2NP 3WC2A 4U96A 2MYSA 4WFNQ 4KHPF 4CT9A 3ISZA 3CCLS 4N76A 2L9JA 5CD4H 3W2VA 2YNIA 4DXLA 5HN0A 2QG9B 4AD6A 2FJVA 3TAMB 3HLUA 4EO8A 2XYPB 3BBFA 2U2FA 1IR2A 5JUAA 4FWVA 1B0VA 1C1BA 3T1YF 2ADCA 3MM5B 1LWFA 3QT8A 5M2UA 1NKEA 4G1QA 1K73T 3QFWA 1IM6A 1KNZA 2C3UA 4KAIA 5KYWB 1VGYA 4E0HA 2ILZA 3KG1A 2KT2A 2ZJQQ 2HBQB 4DV4J 1SC1B 2DO0A 3U1NA 3M1CB 2OPQB 2ZJRQ 3K8WA 4I2QB 4USIA 2YTCA 3HFZB 3ITFA 3IS9B 3LGNA 1FA0A 2D4UA 3VAFA 3Q8YA 3ENWA 3C62A 2FHJA 1WEZA 1Y10A 2JDJA 2MKHA 2RHQB 2P6VA 2LD6A 3CD0A 3P45B 3QSIA 5JMNA 4TN2A 3BSAA 4IRKA 2QFIA 4JI2J 4FDFA 3S9OA 2Z2YB 3MPUB 1C1CB 3D28A 5KFXA 4R0JA 4RW9A 2AGOA 3J81Y 1ZETA 4YB7A 4EHPA 4PG4A 3S1TA 3B71A 2XCAA 3J7ZT 4CLSA 3GFHA 4DUYJ 4DS4A 4LDRA 5IM0B 1S6QA 3L3CA 2XBPA 2M2BA 2PNOA 4K59A 3RGIA 3WHNA 4DR2F 2W01A 2CJKA 2NXEA 2W9CA 4DUZF 1EQ1A 4RR5A 5LOQA 3LP1A 5KFYA 3QYYA 2XS1A 4FXVA 1E6YA 5A8RA 3A9CA 4FYXB 3SCKE 1FXLA 5AGFA 2HVIA 4JCHA 4L6RA 2KVQE 3I4HX 1SBRA 4ZDNA 3RRHA 3HNLA 5L0CA 4TY8A 2GMLA 2C2ZB 1U2CA 4QWBA 1F3VA 3UWTA 3KJNB 4G1QB 4K4VA 3ICLA 1X5TA 5SUHA 2OSRA 3Q89A 3SMZA 5CZVA 2RQ4A 3NMAA 3D9BA 5LM7E 1CQNA 5B0BA 2GA0A 3L8IA 3T4RA 4RU9A 1QM9A 2MY8A 1QUPA 1YRUA 4HH1A 1NZAA 3FCVA 4L6V3 2LU1A 2UXBF 5HQ8A 4CLYA 5IY5C 5H9EJ 2X3GA 2LKZA 1VLOA 1N5QA 2RD5C 2E9RX 2M52A 2L7AA 2UVWA 1HFEL 1RK8A 2I9SA 4JTCB 1RTJA 3FJ2A 3IPMO 2DHGA 1X4AA 5C7PA 1I51B 3C19A 2FY8A 2B4UA 2D7SA 2QA2A 4LIRA 4CH1A 1HARA 1CG2A 3MM6A 5D0RA 2CUYA 4OZJA 3MM9A 3PCOB 1K44A 2IVYA 3GANA 1Z2ZA 4JEBA 1FXRA 1JLQA 4DL7A 4HEAJ 1CLFA 3QW1A 2DIUA 3GYNA 4OD5A 3QLHB 3BR9A 2DGOA 2L9DA 1FJGJ 2C3YA 2WCXA 3TARA 2C2NA 4EBDA 1E6YB 3GEEA 5L8RC 1EI7A 2DGQA 3QTHA 4Q8EA 2ZD1A 2N7CA 5A8RB 4Z9JA 2OD4A 3ZZOA 4KFBA 2CPEA 4EUKB 4X4VA 1L3VA 1RACB 4PQUA 4G7ZF 4BWJA 1S59A 4DXWA 3E3XA 4U5HA 1IUJA 5KT7A 2HVHA 3A3NB 1Q8LA 4PACA 3I0RA 2SXLA 4G78A 2RJZA 1TL1A 1JLAA 2MZJA 4GKJJ 4ILMA 2GCFA 3PX4A 2UVVA 3BGRB 4QCLA 2HJMA 4HHUA 2MDAA 3BQ2A 2QJ3A 5KG0A 1CVJA 1QJHA 2Q9BA 2CVIA 4DQSA 4P7VA 1U2FA 3OVBA 3CTRA 1RT3A 1H6GA 2CWXA 2CXEA 2BJ3A 4PXDA 4WU2A 3AG4C 3CCZA 1BHNA 2GVZA 2D74B 2VFSA 4DVYP 1KQFB 2HV6A 3JXOA 3BGUA 1JXEA 1YJVA 1N52B 2NXJA 1VQ8S 1A7GE 2Z15A 3LNRA 1JLCB 1HQ2A 1S9FA 1NMEB 1VQYA 2R7RA 1XR7A 4LDKA 3M9NB 2MHEA 1TQLA 3KLFB 4PR6A 1NSPA 3V5RA 3V4IB 1MU2B 3MM9B 3O1LA 2XLIA 4J9KA 4LR7A 3HZGA 2GFHA 3HVTA 2MQQA 2CNLB 1JLQB 2RE1A 4V1Ak 1VCTA 1YJRA 4F50A 4QYRA 3POTB 2WZFA 5DG7A 4NLYA 2BYCA 2HMQA 4MH8A 2M64A 3KYIA 3U9MA 3P3DA 1TK0A 2AZ1A 3NY0A 3CCVS 4PRFA 3HTKC 2ZD1B 4KFBB 3BGFA 2UUWA 2IJRA 3VVTA 2HKEA 2B51A 2MSSA 5DRKA 5DS4A 4MK9A 1N1CA 4RD9A 1J8MF 1HI8A 3KLIA 2OKUA 1REGX 2OOCA 1VC5A 2QEXS 3I0RB 4CDAA 4JI6F 2YL0A 1GK8A 3AJMA 4I1OB 2LU2A 1HR0F 1TL1B 2AHOB 2G2YA 4LFCJ 5GAHU 4ANJA 4C97A 5D91A 2XNQA 3RUBL 1RT5A 1RXOB 2AV5A 4C2MA 4DR6F 2DB4A 2YKZA 1JAFA 2AJ4A 1QTNB 3PM9A 1YVFA 3C66A 3KUGA 4PG7A 2N3OA 2OCCC 4MYUA 1CEZA 1JPNA 2PMHA 1ZU5A 2FVPA 3RTVA 2R3VA 2YPYA 1DARA 4ZVRB 4UQGA 4I1MA 4NPOA 4XPEA 1H74A 1U0HA 2K3IA 3H20A 2B56A 1TTHB 3PRDA 4RW6B 1TKDA 2HSQA 3GFXA 3AOAA 2YRFA 3QO9B 3K5MA 2F3JA 2RMLA 1EKSA 1DQ8A 3HKWA 3W61A 1I94J 1M2OA 3MMBB 2IYLD 4FAPB 5ETPA 4X4PA 1LM3B 2YL3A 4PFPA 3QGHA 1R0CB 1UTAA 1P1TA 1Z63A 1T6UA 2KDOA 4MK7A 3V6HA 4JI4J 3M8SA 4ZVTB 2OMOA 1T03A 4DFPA 2KH9A 1F6TA 3K2YA 3OXGA 2VBZA 5B7WA 5AXNA 3DFEA 4OV6A 3MFIA 1S7HA 4RUCA 3THVA 5D0HA 1K1SA 2ZFHA 1S1UB 3N28A 2RVJA 1S77D 3LA0A 2MKCA 2OTLS 2CGEA 4NLGA 3VZHA 3MM8B 2M4EA 3RJMB 2GHVC 3CCMS 2WSCC 1VYKA 3RB4A 1GFWB 3U1LA 4YDXA 3VZIA 1LW2B 1UP1A 5DQZA 1WWHA 2XM0A 5MAOA 2KXNB 4URGA 2OPRA 2IIHA 1RT5B 4ZP6A 2ZBPA 3IXQA 2JRSA 1P27B 2BANB 2Q79A 1FCAA 1WNEA 3NRHA 1JXVA 3BEGB 4BJ5A 2E5LF 1RSCA 4DRHB 3WDOA 2KM8B 2EG2A 2WBMA 2VBXA 4ZPVR 4WTOB 2YWWA 3HXMA 4U7UK 4NTBA 1FKOA 1NJYA 4ALZA 4UZBA 2AW0A 3UFCX 4BJ1A 1S7IA 1U0HB 4Y2CA 2ZC4A 3HSZA 5C25B 2R8IA 3UD3P 4Y2MA 2IXOA 1X9MA 2B0HA 3MUVP 3G6ES 1D1CA 4OYMA 4RW7A 5F3ZA 4FN5A 5GPGB 1ZH5A 1RCOB 3K1IC 1M57C 2Z56B 3CT9A 1KQSR 4ZKAA 2GZOA 3MR6A 3MEDA 1Y6DA 2V9WA 3CPWR 2LFDA 2DNNA 1FFWB 1E86A 3PW2A 4PEOA 2OU6A 1T03B 2HLUA 3I5CA 4WGZA 2D3ZA 2RU3A 3MLGA 2G4BA 2GO9A 1RTIA 2WVDA 2F8MA 4PG8A 2ZHAA 1HBNB 3CAXA 1M5SA 3P6YC 2R7TA 2GX8A 2YWHA 2I38A 1YBTA 2BR0A 2A69F 1WC0A 2ZUAA 3D68A 4YWQA 2H7VC 3NKDA 3A12A 4Q43A 3AHPA 1RQ0A 2MYFA 3TJAA 3IM8A 2G0JA 2DH7A 4A4AA 2OPRB 4OQJA 2XLMA 2Z2MA 1R31A 3N5BA 1PAEX 1H98A 4QZVB 4G65A 2EK6A 2QLBB 3OTDA 5IC4B 5SZTA 3KTQA 3AJ2A 1HNZF 3ZTRA 1REVA 2CWKA 1CJUA 1RBAA 4LF6F 3BGLA 1HE1A 4LF5J 3SZRA 1OCRC 1LW0B 4F25A 3DLEA 2LLZA 3CC7S 4KI2A 4NL5A 4K0KJ 3A4TA 3EG9A 1RWPB 4USTA 1PJ7A 4AL5A 4YT5A 1U6BA 5A8KA 3KYJA 1TUGB 3CJ2A 3RRKA 3EGVA 1RBLA 2MPUA 1JJHA 2ZXPA 3EH1A 5T1DB 2HRTA 2LEBA 2CZ9A 3MEDB 4OHVA 3OL6A 2J7PD 2KZMA 3HJVA 3C2PA 3RZAA 3Q83A 3UVJA 4XPYA 3TP2A 2B0GA 3IAM9 1M1HA 1G6BA 3AQCA 2WAQD 1RTIB 1R0BG 3UD4P 3UI3A 1BWEA 4DV1J 1OW8A 1VISA 2ZOMA 3P96A 1EAYC 1OPIA 1U6ZA 4X64F 6FDRA 4RBTA 5AXMA 5LL6d 1E6VA 3QJJA 1IM4A 2R7VA 3JTLO 1JLBB 1M56C 3AB4B 2WB4A 4M95A 4ANEA 5FCLA 4C3BA 1RTDA 1YQHA 5CABA 2V8DA 2O66A 1VK8A 4JCZA 5ETOA 3EPGA 4CIOA 4B3SF 4CSAC 1IR0A 3GILA 2D69A 5K8MA 2LIGA 2DXEA 1VR6A 3G4ZA 2VKZG 2LQJA 4Y34A 4KIAA 4YT4A 1OMSA 1Q0GA 1RA6A 2UV8A 4LR9A 2W45A 2BX6A 3GCWP 5DGAA 5JRAA 2FLLA 5LT5A 3IFEA 5B0FA 3UE2A 3PV8A 1UWBA 3UMKA 3MECB 1D8YA 1TUVA 2MGZA 3EG9B 4NCGA 1EKYA 2XRHA 3DGPA 4WK3A 3LPEA 5AJ3F 5ETRA 3IBWA 4WKYA 3M8QB 3NGDA 1JLFA 1RT4A 1NLKL 3PVXA 4DQQA 1S9GB 3MMCB 2YHSA 3LANA 3TOQA 3TA1A 3KK3A 4K4WA 1F1BB 1EARA 3H5UA 1TL5A 5J1EA 3FAPB 3DZAA 3MWBA 3R27A 3CNQP 3MD3A 3KH2A 1RAIB 3N0VA 5IS2A 5K5MA 3TJ9A 2AWZA 3C6UB 2A6HF 4PFOA 2C22A 1VMAA 2H7OA 1UZDA 4U95A 5C2CA 5CYJA 4M5JA 1FX2A 1YGYA 3OFHA 2DNRA 1NO8A 4RU2A 4PPZA 3VCDA 1BQXA 1QKRA 3HJCA 2AJ2A 4QW8A 3QFHA 1TKTA 4JC7A 4FF4A 3PG9A 3R8YA 3CJ4A 4ATNA 5EX3A 1RLDA 1Y5IB 5ADZA 2I8EA 4AQYJ 4NY3A 1HQUA 2BJ1A 1VQPS 5DS7A 2DH9A 5HANA 2RILA 3S29A 3ET6B 2X3DA 2VPYB 2DITA 2LFFA 2CQPA 1CJKB 5B0GA 4A47A 1G4WR 2QUPA 2UUIA 3OUYA 2CPYA 3NEKA 2UXDJ 3LP2A 3U02A 1PC5A 3NGUA 2VB6A 1UWBB 4Y2KA 2ZH8A 5I42B 4N06A 3MPDA 2IYGA 4HH0A 5DQIA 3BS9A 4Q5SF 2HS4A 5DZ7A 1JLFB 2F65A 4CQ1A 4E7SA 3AOCA 4J32B 1LEOA 1DBDA 3K57A 3KK3B 2BVZA 2JLEA 3GIMA 2VUGA 3VV2B 1RJ9A 3F44A 3BQ0A 1W2IA 3FMWA 2HBRB 1LNQA 4DDFA 4OHXA 1BQMB 3MTKA 3DLHA 2EK1A 4F26A 1IR1A 2UUHA 4F4XA 4Q2MA 5E3CA 2V6AA 1QSPA 1S1XA 3T1HJ 1XWJA 3OR2B 4AFFA 4C8YA 2E1AA 3VYWA 4B9NA 2HHVA 4MAKA 2VFVA 2CNKB 3EGXA 5F41A 3SQOP 4LBHA 3VR1A 1JQGA 3OBIA 3TAQA 2VZ9A 3UDEA 2ZITA 3EX7B 2V4JB 3HNKA 2QYGA 1JJ4A 5DLJA 1WDTA 3AT1B 1SI9A 3ZQVA 3LF0A 4C7OB 1HQUB 3FSIA 2R2TA 1I5NA 1OY9A 2HHWA 3FOOA 4YT2A 2VICA 4NX9A 4UOFA 4RWXA 3GEHA 3M6VA 1FRLA 5F8HA 4A46A 3FEYB 2LYVA 4DPUA 1CPQA 2EINC 3L8JA 3MCSA 4BDPA 3TOMA 5CA5A 2Q6BA 1ZZFA 1GXLA 2VDIA 4OX6A 4KSEB 3DAFA 4EBEA 4IH7A 3T9OA 3HNJA 3H4BA 4NZ7A 1VQ9S 1WC1A 1S97A 3LQVA 5AC4A 2XS2A 3T9ZA 1NLXA 1CBKA 2ROGA 1WI6A 1N33F 2YNFA 1Q8BA 3AODA 4OI3A 1Q5VA 3Q7LA 1H38A 3HVWA 4DL0C 256BA 5KG2A 3JSMA 1NHVA 1ZM4A 3BO3A 3RAXA 1OCCC 1RKCA 4IKAA 1S1XB 5HVGA 1YTYA 2J45A 3CB4A 4ZPTR 2IVFB 3R7NB 1HNVA 5KFJA 3R2PA 3CJ5A 3VWSA 1UJ5A 1IJFB 2HNZB 3MGJA 1CULB 3ENAA 2GAGC 3HI9A 4JI0F 4DQPA 3UD5A 2DGSA 4DF8A 4GRSA 3P5TL 3GIJA 2CQIA 3ZDLA 2PSZA 1N36J 2Z4PA 5IT4A 4NI2A 1NK6A 3ATPA 3B29A 3CDEA 1LWCB 2KT3A 2NXUA 2ACMA 3UGOA 4MTFA 3D0HE 3G96A 7AT1B 3TVZA 1U6HA 4OIPF 3IR7B 3J7AN 5FD1A 2G2ZA 3PR4A 3GPAA 5KT3A 3U3FA 1VBKA 3EDQB 1U6FA 2VIHA 2P5VA 4LR8A 4OMFG 1D0YA 5T3WA 2O9XA 5FLXY 1HMDA 4CP5A 4B9MA 1IJEB 3L7OA 4OZNA 2C1EB 2AYMA 3K89A 1HMVB 4KH0B 1M5KC 4DSLA 4ZLPA 3C14B 3T1YJ 2AX1A 3O44A 4C11B 3G50A 1JRAA 3DHXA 2QNLA 1NPPA 1ZYQA 3Q6MA 2DISA 2L81A 3U27A 5KFIA 3JSMB 1TAUA 3GORA 1UPPA 2UUTA 4DV7F 2C2RA 2W9YA 4DR5J 1OXKA 2P0NA 4DMZA 5KFTA 5T41A 1UW4A 4ONSA 2A3JA 1RCXB 1N34F 3W9IA 4QPXA 1RT1A 2BV3A 2IM0A 4GMKA 3JQJA 3KLGA 1LK7A 5IT9U 2FUG9 4NLUA 2ZJPQ 4NXMF 2DGVA 3TUJC 1NJWA 1LVKA 4ECTA 4CX9A 3DLKB 5L3VA 4FF3A 3FAJA 2V4QA 5KFKA 2JSXA 3PX0A 3TWZA 5JSLA 1KTMA 3VAJA 3OFFA 4KHMA 2KO1A 3OTCA 4DR2J 4Q44A 3KG4A 1OCOC 2I2YA 5A6BD 4DR7F 3CJ3A 3LAMA 4K5RA 5DS6A 3U0CA 1K04A 2FZGB 2LVWA 3DCAA 1HA1A 2H4WB 1ZVZA 3A8JA 2LMIA 4BLGA 3F73A 4LVNP 5GADI 2ROEA 4KNWA 5LSOA 4OINF 4ZS6A 2HBYB 2AEMA 1YI2S 1Q0MA 2DNYA 3NRBA 2Z58B 3BV8A 2WRMA 3N4WA 4CS9A 4OD4A 2V34A 2V26A 3BB5A 5BQIA 2YY3A 4DV5F 2RDJA 2J7UA 2XMKA 4PR9A 3MR3A 2CDRB 3I0SB 3GSIA 1FJEB 1KTQA 2C2EA 4XK8C 4KBIA 5U47A 1FO1A 4OIQF 1U8SA 5DZ6A 3FK4A 3O5TB 5A8WA 3DC2A 2AT1B 5ETVA 4C8OA 2Z30B 3AG1C 4ZMMA 2UXBJ 2QLWA 1TMJA 2X0CA 3U1MA 1WG1A 3CD5A 1WC4A 4WIIA 3E8OA 3KLGB 4IWBA 4CYUA 3ZQYA 1JKHB 4O0NA 3Q6NA 3LWMA 1RISA 5HMWA 3QJLA 3GCXP 4BJTA 1MNEA 3O55A 4LSZB 3MZIA 1S72S 1H6KX 3AG3C 2NUTA 2HQCA 3L9ZA 4OIRF 2R8GA 1VLSA 1SXLA 4X4NA 3MFNA 1RHUB 2WZ1A 4IFVA 3GJRB 3M8PA 4PYAA 5DGBA 4CLKA 1Z1ZA 2V63A 3PEJA 2OH2A 3FEXB 3NBPA 2QL5B 4JUZA 3TZYA 2WVFA 4LERA 1CJVB 1JLEB 2E66A 3EZIA 2MLZA 4O44A 5DLFA 1D1UA 3K58A 3BO2A 2W4PA 1RAOA 1V74B 3B4DA 4FP9A 3B54A 2MZQA 3JAMU 1JXLA 1HI0P 2A6MA 4M63A 4PJJA 4IO1A 2K06A 3HT0A 2CQ1A 3AQBA 3CJTA 3HKZD 1RJJA 1L3TA 2ZWPA 2RRAA 2FAPB 1RT7B 1YBAA 3H5SA 2ZNZA 2J9EA 1R6VA 1KRPA 5F3TA 3IWXA 4LMZA 1ZZNA 3NKEA 1X4BA 5CCMA 3KMQA 4NLSA 2EBGA 3LW5C 2WTFA 3K8VA 2RD9A 2HWTA 1U45A 1MMDA 2DI3A 2I5JB 5A8WB 5A2QY 5I3UB 1RKJA 3AD8C 3QT6A 1WF1A 3X3UA 4M1KA 3MMJA 3NP5A 4FS2A 2CQ3A 2VPXB 2KQ9A 5E7OB 2HAFA 2KKHA 4MVOA 1UPMB 2DY1A 4YB6A 2HURA 3ELHA 1M1KT 1R43A 1QAYA 3MUMP 4CRJA 2UUCJ 2Z2ZA 1O6XA 3JRMO 2ZE2A 2IJFA 1AROP 3QAUA 3NS6A 2VFRA 2EEYA 4LQ9A 3C15B 1IBKF 4ELVA 1UZHA 2ETSA 5E41A 4QWDA 1DTTA 2JEGA 4JTAB 2H7BA 3M8PB 4BG0A 2HSEB 1CS4A 1WC6A 2FQQB 1Q0FA 2HVEA 4N56A 1B64A 3PRBA 3NBPB 3T3FA 5ETQA 1YBUA 4IRCA 2IXPA 3KUEA 3TA0A 2L41A 3V6KA 1PAUB 2XHWA 2A6EF 1FK9B 3CIZA 2R8HA 2VG6A 1SJ3P 4BS2A 4ELTA 5DVWA 1DJ0A 3K5NA 5HROA 1SC4B 5DG9A 1N54B 2CQBA 4JI3F 3VAMA 4ECSA 2OELA 5T14A 2QV6A 3VGTA 1KFSA 3R5JB 4C8KA 4NA3A 2GNKA 2LCHA 2PD1A 1SUQB 1IQTA 4H4MB 4ICLA 1KOOA 4JI6J 2Y3HA 4OL8A 1HR0J 1T9KA 5FIIA 4FESA 1S0VA 1T01A 4OYXA 4ZLJA 5L0IA 1M2VB 2V5HG 4MQ9F 1NUEA 3AD7C 1Q0NA 4DR6J 1MROB 1WSRA 4KNVA 5DDOC 1W25A 5HBMB 4MNDA 4NEZA 1G2EA 5LXRA 2OPSA 2PFDA 1Y4CA 1XBWA 4BPMA 1JOGA 2AKWB 4TQSA 4LF7F 4MIAA 2KG1A 4B02A 2ZE2B 1L3SA 2KFZA 4CWBA 4DSFA 1FD8A 1FE4A 2FYXA 2MKIA 3PJ9A 1AT1B 4EUVA 3NYJA 3A3PB 1LWEA 4X62F 4C8ZA 3M1VA 2A0UA 4AXIA 4ITSA 4F0KA 2AU5A 2UZAA 1DTTB 2NCKL 2EC2A 4F8RA 5J2MA 2P8IA 2VCAA 4QR0A 2DR8A 3H2UB 2VU5A 1CS4B 2AGQA 2VC9A 3W3SA 2BEFA 3UMHA 2BJ9A 4F4KA 1UA1A 4QYZJ 4M5NA 2QLXA 4ED4A 3PY8A 1HQEB 3RBXA 4AE5A 3DLGA 4DS5A 4QIGA 5DS5A 5GAEI 4QIVA 4C6AA 3F41A 2G62A 5A6KA 3UCUP 3JTOA 2L6HA 1DHMA 3HSJA 2BDPA 2KGOA 4RUAA 1ZU4A 2PEHA 2V50A 2WVBA 2HQFA 5L39A 2B9EA 4QDLA 2OO4A 5K8PA 3MMAA 3CMAS 1XMQF 3LWLA 1ZW3A 2JPUA 3CJSA 2OEVA 3P5BP 1FFTC 4B3MF 2JC1A 3SSQA 2QMWA 3JRTA 2Y8YA 3Q2TC 4NZ6A 4CLLA 2K8GA 4YP3A 2VJUA 1NU4A 4M5KA 4Y2AA 1VLTA 1TWCA 1EKRA 4WIQA 1RWMB 4ELUA 1LXNA 3MI7X 1S1TB 2GVDB 1TQGA 1K1QA 4A48A 3VGVA 1T7PA 4LF9F 1AYEA 2OSQA 4M5IA 3TW0A 2RQMA 2FJAB 1PJ6A 3IR6B 2XMUA 2XM3A 3M9MB 4R8UA 2P7VA 1VQ4S 3IC1A 3OR1B 4QQBA 1T9VA 5H9FJ 1ICEB 1JWWA 4O6YA 4PUOA 3JTPA 1EETB 3N6NA 3EM1A 2K7JA 4B17A 1MWYA 3C46A 2YH1A 1AFIA 2FFHA 3W64A 2PA3A 4CLTA 3MCNA 3GJTB 3FC9A 3HZEA 2MKYA 3I32A 4USUA 1O0PA 3CGIA 3DMJB 4DLEA 3JSBA 4KKOA 1D0ZA 4NLTA 3G82A 5JVEA 3S7RA 4M5DB 4IGGA 3CDBA 3I87A 1X31C 2UXCF 5EWGA 4ES3A 1U1OA 3B6BA 2APOA 1MMNA 3MEEB 2HEKA 1BR2A 3C6TA 2M9KA 3HF5A 2DRBA 4J90A 4OZ3A 2UUAF 1NK9A 1MNDA 3WIUA 1TVRA 1XR6A 2QLJB 3GU0A 1JR8A 3MMAB 2L3MA 2WK4A 2E7WA 4Q2LA 2FGYA 4I4BA 3MOZA 2O01C 3D67A 4CLZA 5LMNF 3W2WA 1TL7A 2VASA 2A2DA 2HK2A 2NZCA 3EGNA 1NKBA 3GTYX 2XULA 2JHEA 4ECWA 1TV6A 4ZVHA 1GT8A 1WSVA 4IH5A 4PWDA 2R05A 1D1AA 1RB0A 4RW4B 2W9BB 4UUWA 3WODF 4HTJA 2Q66A 3Q86A 3Q8SB 1VRTA 1HNZJ 4OYZA 4I6AA 3DM5A 2FB0A 5HP1A 3QJPA 3M15A 3OL8A 2Y0BB 5FDLB 4TLQA 2H48B 1XJWB 2DEJA 1H9GA 2WL8A 2V8VA 1CJTA 1U02A 1Q95G 4DX7A 4KGZB 4PWUA 1C2PA 2ZDOA 3ITHA 1CC7A 1PCXA 5CIVA 4RUHA 2IRYA 3ABMC 4N8NA 4JI5F 4PKDB 2QE5A 3TX0A 3TQOA 2BACA 1YZ6A 3PJWA 3ABLC 2KYZA 4CO1A 3M2UA 2Y39A 4K4YA 3G82B 2BE2B 5C5JA 1C0TA 2NPIA 2MB0B 4F0HA 3RG6A 1UAWA 4LBPA 2HQ3A 3IRXA 1OKKA 3OTEA 5M2RA 5A6AA 4W92B 2AEFA 1OR3A 3SNHA 1LE2A 2DNQA 4JB8B 1DOWA 2HLTA 2XLDA 2R7WA 1GS9A 3C6TB 1QAJA 1Y7PA 2YPZA 3H90A 1TVRB 5C42B 3KUHA 2PI5A 4X64J 2HKVA 4N6HA 3D5MA 3R6GB 2KXFA 2TMVP 3K7RA 2ERRA 2XSEA 3R5GA 2AX0A 5K8NA 5CD4A 2IAJB 4ECRA 2XO7A 2HFSA 1RAFB 1KR4A 1UA0A 1U89A 4B3SJ 2B8PA 2C2KB 4ULWA 3NCQA 4JJFA 3AOBA 2HHHF 3H98A 5HSWA 5CYQA 2ZM6F 4NC3A 2MZ1A 2AJFE 2WW4A 1RKEA 4AL1A 4YN0B 3VVUA 4K2XA 4JYAJ 4ENOA 1Y3KA 5HP1B 3CJQA 2W4CA 4WP3A 2VC0A 1X4DA 2NSGA 2J46A 1G3OA 3CQZA 4E7ZA 2CQ0A 1ZPWX 2XB2D 5KFSA 5KFCA 1ZM3A 2M3DA 3NS5A 1NK0A 1KDNA 1RABB 2JEIA 1UVJA 4C9DA 4ED1A 2HHTA 3AA8A 5AXKA 2C42A 1D09B 1MQVA 4OIXA 3M2UB 1RHMB 2YKNB 3D3CJ 4OX7A 5K8OA 4J9MA 5COMA 1CQMA 4DZ6A 4JOUA 3EVMA 3DU6A 3IRXB 2YKMB 2GHWA 1Q86T 1VK3A 1TP7A 2QC3A 4O7GA 1YYXA 3M2VA 5J2NA 3ZTMA 2IBOA 5HATA 2VQFF 3LS1A 3D6FB 4G7HF 2YX7A 2COLA 2JD3A 4B6IA 3OV7A 1U49A 1RYRA 4O6NA 2PBEA 3MR5A 5B3IA 2J5AA 3H2VA 1HWUA 3UN3A 4B3RF 5D4OA 1XZQA 4H54A 3EXYA 2XWYA 3F46A 1IWAA 2ZUGA 2HGMA 5CYQB 2I6WA 3M4CA 4XEKA 1SV5B 4RLEA 5C2GA 4DLGA 4MMOA 1Z3IX 3RB6A 2E1CA 3MEGB 1VS3A 2XS7A 2DXFA 3ETOA 4F3OA 3KJVA 2HW3A 3RQGA 1TMMA 4OI2A 4ZK7M 3AFGA 1NFNA 3L7PA 4XEFA 2JX0A 2W2QP 1S6OA 3KFWX 1U1PA 5JXSA 4RZRA 3HT3A 4ILLA 4A8XA 4DR3F 4WFAQ 3CCSS 4JE9A 2G2OA 2WONB 2DPJA 3LP0A 3WQPA 2EBEA 2ZBIA 4HTIA 3ZTPA 3C16B 1G8XA 4ECZA 4P74A 3OEOA 1WTYA 2AJ1A 1XERA 2E44A 4DBRA 3PYDA 4K4UA 4BWMA 5I4MA 1E83A 1RT2B 1TL3B 2HS0A 2GJIA 2A1DD 3NYLA 3AG2C 2R4FA 3PKMA 5J2NB 2MKJA 2ZEJA 3PMRA 2DJWA 2F9JA 3EJMA 1S10A 4DQIA 2VOPA 2AVKA 3UR0A 3FSYA 2DK2A 2MQOA 2DKOB 5ETNA 4MVUA 1RTZA 4G3IA 1W26A 3SQGB 4GVBA 1U1KA 2XGQA 4IJJA 1SB6A 3DRSA 3TVYA 3N9UC 4MFBB 2LXUA 4Q7AA 1WASA 1IN0A 1BC6A 1WWPA 2YX4A 3IR5B 3BDEA 3GV5B 2MHRA 2Y3GA 3H65A 3CCTA 4PAAA 2JFKA 1WHVA 3M7VA 3RU0A 1X0PA 3I6PA 3W8HA 4IG3A 3E01B 4PG6A 5IQ6A 2PX0A 5F9LA 1S9EA 4QU6A 4X0RA 2IXNA 3EUNA 1OCZC 3H25A 2R7UA 2W4MA 2HQGA 1VQSA 1IBLJ 1EB0A 4OYBA 1QVFR 4FNIA 5K14B 2VJVA 5L0DA 1VHFA 2J9BA 2XYHB 3DOLB 2YX1A 4P9TA 2ZXRA 1QDUB 2MJUA 1LFWA 1NSGB 2B7CB 4Y28C 3T5KA 1S49A 1YWXA 1SKRA 2V8GA 2E1MC 2NSBA 2KI2A 4DN9A 1VQ5S 2ZH2A 4U5GA 4L76A 2V2KA 5G4DA 1N33J 3JYTA 3TJ8A 3ZTZA 1AUEA 3THPA 2GFFA 3LLIA 4LRBA 5E3PA 5IC6B 4IOBA 4X84A 1RWKB 2C2MB 2RSEB 3HHLA 2GAQA 3AGTA 3NWRA 1EZZB 1C0UB 3OTOF 3OL7A 3ZC4A 3E9VA 2IC3B 1TUWA 4UOCA 4USMA 3KLHB 2GMHA 1SJRA 5H9FK 3F56A 5KG4A 1LXJA 4EK2A 4HHHA 2W7PA 1FDDA 1WD6A 1XQIA 4C0OC 1U1LA 4WKRA 3TJ5A 5C24B 4JI0J 2AF6A 4ECYA 4JI1F 2EFVA 4CTAA 2QYCA 2DNKA 2YQ3A 1VIXA 5A76A 2Q9AA 1X5SA 3DKDA 4U5DE 5IWAJ 3UN5A 3NMKA 2HQIA 4HFFB 3UW1A 1PYSB 4LSLB 1VQKS 4DG1A 3A13A 4P73A 3OWTA 1WOLA 2B6AA 5F0WA 3GFYA 4ZIWA 5CXTA 1N32J 2P6SA 4LREA 3KWMA 1WHYA 3V6DB 4K7QA 1PIEA 2I1RA 1ZHTA 4LBIA 2QLFB 3DM2B 4DUTA 2BKOA 4I2PB 3ADAC 3B0VC 3PXGa 3B0UX 3PX6A 4CJOA 1SJQA 1G1XA 3D2WA 5GMEA 2A18A 3M79A 3OA1A 2ZH4A 1O87A 4KHRA 4EEYA 2LK4A 3TYTA 4YK5A 3BKTA 1HMOA 2H3EB 1IW7F 4AXJA 1JK9B 1U09A 2J6UA 2XY7A 4MKAA 1A6LA 3BO4A 3RBZA 2HS3A 4AL0A 4P72A 3JTNA 2YH0A 1FNOA 4ED7A 4A8FA 2MZTA 3W9HA 4LDQA 3ZZUA 2W4DA 1OQ3A 1RGVA 1N34J 1OSCA 3IG1A 2VCBA 1SJ1A 2H1YA 1FTRA 3ZXWA 2EC0A 1WHXA 2YL7A 4DSJA 4BJ6A 4LIWA 1Q53A 4OJHA 4CTAB 1OJ4A 3PO4A 4ULVA 4NRUA 1BBHA 1DZ5A 5K20B 3FBEA 4DHVA 1MW7A 4P9SA 3C8GA 1U47A 4FYYB 4DV2J 2GGPB 1RTHA 1HNIA 1J5EF 3UCGA 4RNNA 4DR7J 1HW1A 3BYPA 4IUFA 3SDEA 5KYUA 3PIOQ 1S1WA 4ANDA 2MQNA 2AYGA 2AJ0A 3ZTQA 4OJGA 4JI2F 3GR1A 1NHUA 3DRXA 1TK5A 2HRUA 2J8SA 4C8NA 5I3QA 4P2XA 4DUYF 1EP4A 2OJED 3Q8PB 3PYEA 2C3MA 2HFUA 4QI0A 3PJXA 3O8WA 4CM0A 1SJFA 4H4KA 1DOVA 2IYIA 2YNGA 2IM3A 3J7YI 1ACMB 1SKSA 1LS1A 2WHOA 3IA0A 2YNHA 3X2QC 1SF8A 4HKQA 2OPPA 2WVCA 3I9ZA 5L0FA 1S0MA 4ZIVA 1SMYF 3TZXA 2V67A 4GEHA 2MSTA 4PZVA 3VF0A 5E5NA 3CC2S 3DYAA 3N01A 1YYJA 3I5QA 4GKKF 1YJWS 5EGYA 2DNHA 2KK1A 2G3VA 4JV2A 4WABA 4WE1A 1OY6A 2D9PA 1YVIA 3IM9A 3Q8VA 5KG3A 1IQZA 5BJRA 4U5CE 2BJEA 2CJYB 1TKZB 3ZZTA 2W8KA 3MDFA 1TFWA 3KJFB 1HW2A 1R3NA 5JLIA 2HYIB 4CCHA 4WWSA 3LGMA 2DEIA 3TRGA 1VHIA 1RKIA 3VALA 4JV5F 2P2CB 2HMIB 2ZH1A 1GQEA 5CI9A 1S6PB 3GLJA 2DD8S 4W8PA 1SKUB 1VK5A 3CWJA 1FJ7A 3KLEA 3MAQA 3D7SB 3N24A 3IAS9 5KFVA 1ZAWA 2ZPAA 1J5OA 4X4RA 3ZZZA 4DFKA 3EGDA 5KYUB 1S1WB 1ULRA 4XDDA 2FVCA 4ANCA 2FVSA 2R2RA 4FBUA 4KY3A 1NSQA 5AT1B 2JVRA 5ETSA 4NTAA 3DI6A 3KXDA 4NCAA 2VV5A 2KTQA 3HX9A 1HBOB 1AFJA 2B8QA 2HUJA 2A0BA 2RS2A 1LQ9A 4XEVA 2H54B 3IGNA 1SC3B 5DQTA 4YMEA 3GV7B 2YQYA 2Q43A 2QIFA 1O51A 4GVLA 1M5HA 5CHCB 2YKOA 3QGPA 2PI4A 3W8GA 2IA0A 2GV1A 1Z7Qc 4O4GA 1FWKA 5K9FA 3KKBA 2BE9B 2DCUB 4EWTA 5KYXA 3QBCA 4DSKA 3VAHA 4O3SA 4CLWA 1AVOB 2EFQA 1YRXA 5KOXA 2LQ8A 2RF2A 5D3GA 1GXTA 3CDAA 2VOOA 2EKNA 2W8LA 5T7LA 1VQLS 2KC3A 3QRRA 3JSYA 1ZAXA 5LXYA 5KG6A 1TFOB 2AZ3A 1IBKJ 3L34A 3CF5Q 2JVOA 1OXBA 5K0IA 2O1PA 4P52A 3BYRA 2V0NA 4LF4F 2YZSA 1HIYA 1H7XA 3K33A 4R0EA 4K1OA 4IRDA 5GADU 1S4EA 1CC8A 4DWIA 2LQGA 3W2VB 5H1SV 2YNIB 2LXFA 3PIPQ 2J76E 2RKIA 1TL4A 1YA9A 3IRWP 3PRVA 3BRJA 4H4OA 1WG5A 3CJ8A 2V3CC 2F7VA 2KXHA 3MPYA 2N4CA 3HPOA 1C1BB 4DV0F 1FR0A 3KK1A 1LWFB 3CCQS 3QMKA 1FD2A 4JI3J 5ETKA 2NREA 1SYQA 2CDQA 4WF9Q 4LFBF 1CGNA 1B99A 2DRDA 4Y00A 4MKVA 2J9VA 2RUGA 4EBCA 2VBWA 1VB5A 1R4TA 4O3PA 2OEXA 4ETZA 5J2QA 1U1NA 2EVZA 3HSGA 4M8LA 4PJNA 5LSLA 3GWCA 3BBBA 3RFYA 3POVA 4I44A 3QWUA 1SL2A 3KYLA 2QA4S 2B9WA 3IQ6A 2M8HA 5KYXB 1SPBP 2H5JB 3FBBA 2VPZB 3QT5A 3SXZA 4RW9B 2V69A 2IVMA 2WOMA 4A8YA 5IFMA 4RDAA 4LF7J 1NRKA 5F5FA 3BPDA 1S6QB 2DNLA 2AWCA 3DJNB 2E7VA 2OUGA 1WDDA 4TLRA 5HMYA 4LFCF 2PP4A 2W9CB 2Q3TA 5EUHA 4MKBA 3AH6A 3H2LA 2RNEA 3LP1B 4F2RA 4I68A 3N5FA 9RUBA 3QQCD 2RQCA 4OFZA 4ZVQB 2AQ4A 2J7PA 2BE5F 1P9QC 2DVIA 2YQ0A 3PKYA 5IZHA 1H7WA 2CCYA 2EIMC 2CPZA 4DPTA 4XPCA 2RKIB 3V81A 4Z2XA 3SIPB 1SQFA 3GIIA 4ZCKA 1NB7A 4TY8B 2EWHA 5BR8F 2IBFA 2FDNA 2D5RB 4F04B 1IWGA 1U0SA 2XMAA 1T9XA 3S84A 2MEWA 3CCES 1V4AA 3V6JA 1ZTWA 4XWJA 3R6LB 4MYTA 2Q1LA 3UQSA 5GAGU 1TWGA 2POKA 2CQ4A 2GO8A 1XMQJ 2QL9B 3LNMB 2RSQA 1I94F 3RBEA 4KGMA 5L1IA 1R7IA 2OJ3A 4DR4J 3MYIA 4B3MJ 3QAEA 5J2QB 3PYFA 1HBMA 1AZSA 4IH6A 3G4SS 4WPAA 2XSJA 3CULA 1XMOF 2OP5A 2ILYA 4JI4F 2XXAA 3FRYA 4JBCA 4PJLA 2XZTB 1S76D 3CO9A 3OHAA 1RTJB 3TA2A 1SH2A 4OZLA 4LF9J 3G6VA 3MM6B 2B4OA 2WOMB 5G0RA 3SSSA 4I1TA 1NJZA 3C7JA 1PGZA 2HHQA 1WG4A 5HLFA 4ZCMA 4ID5A 2GIFA 4XLNF 4OHWA 1TWAA 5D15A 3SBMA 3BH7B 1V3RA 3PHF2 5BQHA 1V9OA 1WTBA 2N3LA 5L1KA 3JSRA 3RVZA 1MMLA 4QJVA 2Q7RA 1RYSA 2XMTA 4ZJLA 4Q7CA 3NNAA 4PQUB 5KFBA 3V81B 1V5VA 4J5OA 3VAYA 4AL6A 5JS5A 1YG0A 2FJDB 4R25A 2UXCJ 4NCQA 2Q9CA 5KFPA 3TUZC 3RB0A 5KFMA 4GO5X 2DY9A 4NASA 1JLAB 1WKLA 1E2XA 2LA4A 3V4MA 2W9AA 1R5ID 3CUNA 4QU7A 1BQNA 4TQRA 1AUDA 2CPDA 2UUAJ 1N88A 3FMSA 1SKWA 3TZZA 4WJBA 4ZITA 3ASOC 3EZHA 5KFZA 1KNYA 1R6YA 1E84A 1NZ8A 1OW7A 1J27A 2MJNA 1RT3B 2G0CA 2PEBA 4URSA 2W24A 1FNXH 2XSJB 3HFVA 1HWJA 2GVZB 4WZQA 2OEKA 3E70C 3MM7A 1XNRF 3C18A 4LLCA 3EVOA 3NYMA 3W1YC 2DR9A 5KT2A 3EZ5A 1TKXA 2J9DA 5JVHQ 2V9KA 3S0XA 4WFBQ 3NMIA 3OLBA 3HM9A 4HACA 4ZP8A 4USJC 1HD0A 5G0RB 1R0AA 5ETLA 2V2QA 1TU0B 3HVTB 5AE3A 2IM8A 1X4FA 1FF2A 5ETTA 5M2PA 4D3GA 4DU8A 1WKJA 1PILA 2AIRB 1UFKA 2HG4A 5GAEU 4KV8A 1HBUA 1QLEC 1TZ0A 2Y1LB 2GHPA 1SL1A 1M0SA 2YBVA 1H9TA 2GAHC 2JEJA 3CE8A 1OO0B 4A8QA 4JI5J 4C8LA 1FEHA 3N2ZB 2VF3A 3LUTB 4WFYA 3W9JA 2HVZA 5L1JA 3SEOA 1XEZA 3KLIB 4KR0B 1U25A 2IBKA 4LF5F 1Y00A 3ZZYA 3TK0A 3ENQA 5DO2A 3ZZPA 4M5HA 3BN4A 3MD1A 4DPXA 1Q5YA 4X4OA 3AJDA 2IPOB 3D3BJ 1UL3A 2JFDA 2V8PA 2EFPA 4YY3J 1YZ7A 1UVMA 4J9PA 1FTSA 3H5YA 4DFJA 3ZZ0A 4QW9A 3FSXA 1N0UA 1OQCA 3ILIA 1WOPA 3W8PA 1FKPA 5KFNA 4W90B 2DTJA 3EWGA 4P2MA 2LXIA 3R7CA 2DNPA 4CDVA 2L9WA 5F28E 2M0GB 3JQMA 1Q7YT 1RBOB 2HHPA 3DOKA 3W4YA 2AYEA 3R3TA 4K5SA 2K1RA 3DOMA 5JP7A 3MX3A 4WFZA 2L6GA 1SQGA 2DRAA 5AE2A 2E9TA 4XPWA 3SXYA 3CJ0A 4WCEQ 5HQMA 2WVEA 3BH6B 1I5OB 1CSJA 4NYOA 2Y3YA 4OYIA 2UVUA 5E2QA 3N0TA 3MUTP 3HHKA 1YZCA 3HHNB 3WX4A 2A0FB 3DNCA 3L1MA 2HNYA 4FXDA 2DHHA 4RNHA 4E0DA 2XLHA 1T9TA 1KN6A 2KFYA 1YKWA 2HVDA 1MN7A 3IP0A 3KKFA 4M5MA 4ECQA 1EJ7L 3FZ2A 2YXLA 2QE9A 2UUBF 1SH0A 3HK2A 3FFIA 4P71A 3LTOA 3L4BC 3NDBB 3QIPA 2HFVA 3M4BA 1M5PC 1V5IB 4IAOA 4ZP7A 2KHCA 4U5FE 2KHDA 3LAKA 4YJWA 5D78A 3I31A 3HVRA 2K7KA 2XLWA 1F0XA 4WYWA 5COFA 2ZZMA 2VQFJ 2QMUB 2RT3A 3J80U 1EHWA 1N6QA 3OTBA 4WBFA 1URRA 1UFLA 3GR0A 1YLMA 1YARO 2EI5A 2BM1A 1FVQA 3NS7B 1JJCB 2AD9A 2HQDA 4Z9IA 2H8AA 1SL0A 1FKOB 1GMVA 1UWAA 4YN3B 3NAIA 2CPFA 2G0IA 3H2VE 1YJ9S 2E7XA 3S28A 1QE1A 4A2NB 3US6A 3A3OB 1HWLA 4OYAA 3VGUA 1RWWB 1TWHA 3M8RA 1JLGA 2YLIA 1QVGR 4Q4ZF 4RW7B 1L7CA 5HO4A 4PXCA 2I8BA 2NZ4A 3DXJF 4WXWA 2GC8A 1S0OA 1SC6A 1S1VA 1KONA 2FHMA 4C8MA 4QPTA 4AL7A 1FFSB 3GB0A 1PSDA 4NE9C 3G9CA 4AQYF 2EG1A 4LRCA 1XC9A 2ASJA 4P2SA 4LFAF 4IR9A 1U7LA 3QRPA 3GYGA 2PA8D 3M30A 3MAAA 4JRZA 5L0HA 1Y4ZB 4U7CA 2KRBA 2KW3C 4AX2A 5DLGA 5LJ3Y 2CRLA 4TYAA 3PW7A 3CJKA 3UPFA 1LOUA 5H9EK 3FDSA 3IO1A 3LAYA 3UR3C 3A8IA 4OLOA 5FJ4A 4NZ0A 4Q0BA 3OPKA 3PHEA 1B4SA 5E3RA 1K47A 1TKNA 5AXLA 3CEXA 4WGYA 1AB8A 1UEKA 3NG1A 4UDVA 2QL7B 4FKXA 4LLEA 2NUUG 4KTQA 4ZLLA 2W4BA 2HHUA 4UOHA 1M5VC 4ED5A 1REVB 1PD1A 1CJUB 4ZPBA 5D6GA 2NUPA 3ENVA 5DM7Q 3HVAA 4ZJOA 5BYRA 4CO5A 1NEEA 3DLEB 2VG7A 4K2JA 1RHJB 5LMUF 5KAKA 2OMLA 1QE1B 5KT5A 1CPRA 1FX4A 1ZOTA 3DWWA 4TKTA 1VDHA 5A8KB 1WUUA 1OKKD 4UTGA 1ZW2A 1JLGB 2XS8A 2ZBCA 2J6TA 1JPJA 4F3QA 3ABKC 1T9YA 4UY85 1ZAVA 3VHQA 2HFZA 2YEVA 5E33A 3UVJB 1Z5ZA 4O0IA 1RWVB 2V2ZA 2LQBA 2D1CA 1A7DA 3GZ7A 4C0BA 2X7IA 3M6WA 3H8YA 3DM9B 1QPUA 3KDNA 2CA9A 2W25A 2YWEA 3KJQB 3LEVA 3S01A 2XZDB 1HL6A 2AYBA 4DEZA 2MQLA 2KM8C 1X5OA 5AC5A 1LE4A 1HPZA 1E6VB 2CG4A 5B0AA 2P6TA 2PX3A 3DLLQ 1HLWA 4L73A 5TJ5E 4JTDB 2HRYA 3U2MA 4F0MA 3NCRA 1Q79A 1NG1A 3EQLF 1PBAA 1RTDB 1S57A 4GYTA 2IDEA 3M4XA 2DNMA 3C8ZA 2PGCA 3OTOJ 1UEUA 4HEA9 3HFKA 5IT9Y 3G87A 3AB2B 3NAHA 2HK3A 3HD2A 1BE4A 2WB7A 1U48A 2YL1A 2DYRC 4RPFA 3TAMA 3NL0A 2IDLA 1LI5A 4YQWA 5F8LA 2XS5A 4OZ1A 3TX8A 3MM5A 1S5ZA 1AUSL 3NGRA 2ZBQA 1KC8T 1OR2A 1KQKA 3PNIA 3D1QA 5HMZA 2MGZB 1KP6A 1NM2A 5KYWA 4NCGB 4J9OA 3DGPB 1OY8A 4YL3A 1D3WA 4YHHJ 1YDIA 1NBBA 3H5XA 3TI0A 3I4PA 1H73A 2OPQA 1MLAA 1RT4B 4J9UE 2CW0F 4I2QA 4F4WA 1FNMA 2NPUA 1GTHA 1JJ2R 3FVYA 3IS9A 1HNXJ 2AP3A 1V3SA 1VRQC 5J1EB 2HHXA 3PYGA 3KDOA 4WZMA 4FBTA 1OS5A 2J0XA 3EGWB 3T5JA 4C3KA 5DETA 4K4XA 4DU7A 1C1CA 4NCBA 1IKVA 1N36F 1S6UA 5D0GA 1WI8A 3NG8A 1TFYA 3H7HB 4UQTA 2VONA 3QGGA 4TXSA 4BJ5C 5IM0A 4HHJA 2XMMA 3U8VA 4GC6A 4K4SA 2QA4G 3FMBA 2DGUA 4QR1A 3TJ6A 1TKTB 4JW1A 3SXMA 2XZWA 3MPVA 5F0UA 1P9YA 3NWGA 1WJ9A 2CJAA 2R2UA 2KZZA 4I0WA 2YKAA 3Q2SC 3V5ZA 5D4NA 4ZN1A 2LEPA 4B9LA 1FKAF 3TVKA 2LP4A 2XEXA 4OZ0A 1M6TA 4LJMA 4U67Q 1F5CA 2HGNA 3WX8A 4J7YA 3KHRA 3OL9A 3A8KA 3C63A 3OUYB 2PC6A 2CJXB 3CCJS 4LT6A 2EFGA 3ISND 2C3OA 1FRHA 3LP2B 4KPCA 1NFOA 1EA8A 2BL2A 2GMJA 3QPIA 4QOTA 2MQMA 4LUBA 4IOCQ 5DDRC 1Q7LB 4DR5F 2WVNA 2OJQA 2HSBA 4J7CA 1J5EJ 2OTJS 1F9EB 4F67A 5A6JA 3JAMY 4LF1A 3GSDA 1RJ9B 3ASNC 1WGWA 4RBVA 2H51B 4OHZA 2Q3PA 4JI8J 1ORSC 2QA1A 3FNNA 2MXYA 4YUDA 3D54A 4ZCIA 3US5A 2LDYA 4A8OA 4ZLNA 5DQHA 2XM4A 1T0TV 1IKVB 4F2SA 3QT7A 2A2CA 7FDRA 3W66A 4F4BA 4ZPDA 3B0PA 2OLWA 2ZDPA 3QLHA 3SYNA 3GJQB 3M8ZA 3EGXB 3FXHA 2VCCA 2IOQA 3KNGA 5E3AA 3K5OA 5DDQC 5BYSA 3PDMP 2CQCA 4J9SA 2IA6A 5L38A 3M05A 3S6EA 3HCXA 3OJUA 4A8SA 1XZPA 1TELA 2F4VF 4G1PA 1IBMF 4FF2A 3ZFVA 3K1IA 4YOEA 3V5XA 3RAMA 1EIYB 4ED2A 4I64A 4F3MA 4GKKJ 2QMXA 2HZAA 2B43A 5JUMA 1S12A 5A6PA 5GMDA 2EKYA 3OVSA 4ILRA 3TEGA 4B9TA 2FC9A 2E5JA 2H5IB 4NYZA 4ZN3A 1RHQB 4FYWB 1H2TZ 3BGRA 3VQTA 5F8MA 4PCQA 4JV5J 4YS2A 1YRTA 3K7DA 4KHPJ 2MZSA 4C3DA 3HHDA 1NCLA 1NKCA 2LDIA 1ZTTA 5CQGA 3HHLD 3C3LA 1XTZA 4CIHA 3BGOP 4WU3A 1VRUA 2ASDA 1IKYA 4XPXA 2YNFB 1MWZA 2XO6A 1APCA 1GMWA 1VYIA 2G1DA 1JLCA 3EVWA 1FESA 3KLFA 1U2RA 3T19A 3V4IA 1MU2A 3BKUA 2GIRA 3Q8UA 1YSJA 3MR2A 4U5EE 4CIPA 1HNVB 2NUHA 1DFDA 1F9HA 3POTA 4JVSA 3UNYA 1C4CA 4C48A 4CM2A 1QSSA 4QWEA 4EGLA 2IY5B 2C3PA 1F5BA 2U1AA 4DSIA 1FTCA 1N8RT 4F4AA 3CCRS 3R7BB 5L46A 4NI2B 3TR5A 2DHXA 1XR5A 4P2FA 1LFPA 1RAHB 4CJGA 1YIJS 2M70A 5KFOA 2ADBA 5BYQA 3FCHA 3I9V9 1QVXA 3DLBA 2J8WA 1KSPA 3QIDA 3JZ0A 4DUZJ 1C03A 3SFUA 3FUYA 1XNQF 4DVZA 3R1LA 4LF4J 3IQCA 3B9QA 5MLCV 4GQHA 5EDWA 3JB9k 1VI7A 1RHRB 3GP9A 4N47A 3L0IA 2CNWA 5E0OA 1I3OB 5F5HA 2VPWB 1UG7A 4BCAA 3G6XA 4LVOP 1VRUB 2UUCF 1SVDA 2EPKX 4NEYA 1IKYB 1SIWB 2HS5A 4DV0J 2M88A 5IV4A 3K59A 4RWWA 2HHSA 4KB7A 4CSAA 1Q78A 4IR1A 2RDDA 1DTQA 1PO6A 5D77A 4NLPA 4LFBJ 1VQMS 2CNNB 2XMJA 3J7YU 3JSEO 4RW6A 1ZM2A 2OAUA 3RVYA 4OYWA 2WZLA 3QO9A 2EPMX 2EPIA 2ALYB 1ITPA 2F63A 3MMBA 5HK4A 3QZ8A 4YT8A 3RW7A 4YR0A 4B9SA 2JC0A 3ZTOA 4NA1A 1RT1B 3W5ZA 4U9DA 2EW9A 3C8GD 1PBUA 1MN9A 4DV3F 2B3TB 3CCUS 2Y0SD 1WHWA 1WF2A 2CZ4A 3JYYA 3DAGA 3DN9A 1IVZA 2R8KA 1RT6A 1YJGA 3OW2R 1S1UA 4KPYA 2BOPA 3SXKA 1DAXA 1J2VA 3I96A 3NNCA 3MM8A 2DGWA 3AA9A 1NPKA 3TQEA 4NTFA 2R9LA 2KJVA 2CNOB 4WXOA 1LW2A 4CLFA 4ZHRA 2OG2A 4TNOA 5HAOA 4Z7CA 1W7WA 2RU9A 3AY0A 2LQ5A 2BANA 2DO4A 2Q6CA 3DJUB 4ZVEA 4K8RA 2D3OR 3KPHA 3BZQA 4YB1P 1KLNA 1FMVA 1WC3A 4DX5A 1I1GA 3B78A 4HI1A 2W2PP 4LRAA 3MCOA 1XK8A 4O3NA 4O3QA 1BDJB 2J8AA 1ROFA 2OFHX 5BR8J 1KEKA 2R2SA 5A0YA 3J81U 5L1LA 2J9WA 4KGKA 3DD7A 1D8ZA 2UU9F 2ZHOA 1I4ZA 2J6SA 1DTQB 5C25A 4JURI 3SI8A 4LSNA 3JYHA 2HFIA 4XO0A 2HWIA 2QRRA 4X4UA 2ZOFA 3OXLA 3R5CA 2NR0A 3E51A 3O2IA 2VH7A 4EZ9A 3ETMA 4C7QA 2A10A 4CNZA 4V19J 3H59A 1FE0A 2ZHBA 2JOQA 2IM1A 4CBEA 1XMOJ 3WAQA 3I5BA 3HSDA 1J8YF 1F60B 4CYUB 1S99A 3MBGA 3I5PA 3TQ1A 4EIYA 3D4JA 1FDNA 3RBDA 4N41A 2NQPA 3SXLA 2NUTB 5KFRA 2ZD9A 3Q24A 1D9DA 1HBNA 1RT6B 1NNDA 4RO0A 3PACA 4IFVB 3WHIA 5IXUA 2JZ5A 2PMZD 3V2UC 2R03A 4IQXA 3G8SA 4YL0A 1B68A 1XWLA 2ZH7A 5KFFA 4ZHRB 2XHCA 2AP6A 1R89A 1S05A 2MMYA 3HLZA 4O44B 1RHKB 4DF4A 1UJ6A 4B3TF 1T3OA 4N6CA 4PXBA 4PG5A 4DFMA 5DM6Q 2FHJD 1WEXA 3QW0A 2XQCA 2ABYA 4XDCA 1NAQA 2I15A 1AA1B 3GG1A 1CGOA 2E5IA 4RW8A 1NHKL 1LW0A 5A0YB 3EPIA 2DIVA 4RL1A 4L3NA 2E87A 2P61A 2BE7D 4LSNB 4DCOB 3T5HA 4NA2A 1DLOA 4FNHA 1U1RA 4DJ9A 1KVKA 5KFGA 2RRNA 1MMGA 1IKXA 5IV3A 1A7EA 3OJSA 1D1BA 1I4YA 1TFKB 4X2BA 5JJBA 4X65F 4RBUA 4USVA 1O3UA 2DGXA 2FY1A 4IO9Q 1XNRJ 1XIQA 2VA2A 1UVIA 3B8HA 4O4RA 4I7FA 2B4VA 1S4FA 2GQCA 2GDCA 3CEDA 2BABA 2BKNA 3BKFA 2AGPA 1FXDA 2J9DE 1JLBA 1ZZPA 3KL4A 4PQAA 2X1AA 4AYBD 3F47A 2MKSA 1AEPA 2KJGA 3SZ2A 2VG6B 2V4RA 4U7UD 3UO0A 7FD1A 5HROB 1PC4A 2BXJA 3FBFA 1YLXA 3PW4A 3TAPA 4MKYA 8RUCA 2RUSA 1N48A 4EMDA 1R8PA 4MS2A 1LI7A 1HKAA 1PJ5A 2AJQA 3PO5A 3RRGA 4EBBA 3BM7A 3J7A1 3W5XA 2RDIA 4RW8B 4ICLB 1JNRB 3NOGA 2QGFB 3DU5A 3M2RA 4A8WA 3MECA 1H2VZ 3M32A 4OX9F 1RAAB 1DLOB 3W7BA 3M8QA 5KG7A 1UVLA 2G9OA 1S9GA 3MMCA 2LFVA 3W60A 3GWNA 5KG1A 5AE1A 2E5LJ 1IKXB 4JEAA 3U8PA 3QSYB 4ZLCA 2XNRA 3J7Z5 1HWIA 2OPSB 3BSNA 3ULHA 1QSLA 3GM1A 2DHAA 1HWKA 2F40A 2VDHA 3D0GE 4ZPCA 2RB7A 2FLOA 4F4ZA 3C6UA 2MWQA 1LWEB 2FC8A 4J30B 4HFKB 4BEJA 1G4CA 3M1VB 1PKUA 4I7FB 1FAPB 3IWNC 3T5LA 2H9ZA 5J2MB 4UF4A 1RI7A 3GEIA 4ES2A 4WP9A 4OLPA 4PABA 4U8YA 4EO6A 3R5BA 1RP5A 2A6OA 2PF4E 3ZNJ1 4ER9A 3CDUA 4DZDA 1DRZA 2OEMA 5EWEA 3R9LA 4NYPA 4NRTA 1T6IA 2R7XA 1OIAA 2XI3A 4CS9C 1WORA 3DLGB 5KFWA 2CZVC 1YJNS 2XL8A 3MTJA 3KMSA 4PJMA 4OYPA 1SR2A 2ZKTA 4TY9A 1VTMP 1FMWA 2G3KA 4QIWD 1VQNS 1FWLA 2ZVSA 2E5GA 1FRMA 3ET6A 4KGXB 2X51A 4OZ5A 2YWGA 1WEYA 2UUBJ 1GXUA 4HL9A 2L6FA 1CJKA 3U7JA 4JYAF 2R02A 2WZGA 4YFUA 4EBKA 5HL7Q 4CI0B 1IZMA 3PFOA 4ZOSA 3E2EA 3M2RB 3PHTA 4CNYA 4QI2A 3M32B 2XLEA 1F2HA 6FD1A 4NLDA 2VBYA 5I42A 2F1FA 3QZCA 2ATCB 2IXMA 2ZVIA 1GM5A 1YA7O 5HQLA 5BQGA 3G8TA 3RW0A 2CQDA 1D9FA 3G71S 2BRLA 1WTFA 3AGUA 4Y65A 2YVSA 3VRCA 2XL4A 3DMDA 1VJWA 4DL6A 4LF6J 3NGTA 3EXCX 2AU0A 1BQMA 4R8UB 1U26A 5GVQA 4MT1A 4FS1A 3BN7A 4OYOA 1ZBTA 2KJWA 4USWA 4PUOB 4AK9A 4O6MA 2PE8A 3IHUA 1HY5A 1Y3JA 2AWYA 1EX8A 3WC0A 2JNJA 4HDHA 1GAOA 4KT0C 4KGVB 4ES1A 3OR2A 4WJ0A 4DL5A 1ZM9A 3U2LA 5D8HB 2AEJA 1OYDA 1ZHWA 3EDRB 4YR2A 3KHHA 4UT4A 2ZBRA 3SFGA 4K0DA 4KKOB 5ETMA 4ZJQA 2BMBA 2V4JA 2NYIA 5DDPC 2FGCA 2FGOA 3HP6A 3EHNA 4C7OA 3C8YA 5BXIA 4DBQA 3CMES 2KYXA 4LFAJ 5FZTA 3SCIE 3HKKA 1O5JA 5HVFA 2EIJC 3GG0A 1FFHA 3DRYA 1UFWA 3DDKA 2FPHX 2Y69C 2QX0A 3H0PA 4DJBA 1ZPVA 1B3TA 2BM0A 4U8VA 3N6MA 4NLVA 3CDWA 1U1QA 5L9XA 1NK7A 3W2WB 1TL7B 2CKWA 2BQRA 3RF3A 1WOSA 4K50A 4IYQA 1NXIA 2OIHA 4DV6F 1Y11A 1TV6B 2KL8A 3TNVA 3M8YA 4PWDB 2WB1D 2XTJP 3DE9A 2X1FA 4KQZA 4C3MA 1Y9OA 4WYLA 1NH7A 4J9NA 2FVRA 1VRTB 3RR7A 5B1BC 3NOCA 2VODA 3MYFA 1RAJA 2VQEF 1FRIA 3O6QA 4CH7A 3Q8QB 2N4DA 2CJBA 2Y9HA 1NSKL 4CH0S 2N82B 2DHSA 2DNGA 2B5JA 3P49B 5LMUJ 2DGJA 4K7BA 3EMTA 2RHSB 2PDAA 5AJ3J 1CJTB 2BRKA 1A9NB 1V54C 3ITHB 1HNWF 4L72B 1R8HA 3LPYA 1O5HA 5KYNA 4IOAQ 3GYXB 3TEHB 4Q45A 1QAIA 4OI1A 2HNZA 3NCPA 5F8IA 4LF8F 5D4PA 1CULA 3TUIC 1C0TB 2OQMA 1F3FA 4HYKA 4C3LA 2QTVA 1GNKA 3VAKA 1T02A 3VAIA 2DGTA 1T95A 3PDNA 1SH3A 5KFUA 1R27B 4A4JA 3UDCA 2O3DA 5D0EA 4O79A 1LWCA 1RWUA 4FPIA 2DBBA 1MSWD 4YEAA 1X4EA 1GGQA 3GM3A 4BC7A 3A1YG 3X1LB 3H42A 1CGME 4OI6A 1Q82T 4ED3A 1FDBA 3LJBA 1NDKA 2FD2A 2BC5A 3DRRA 4RX6A 1OPZA 2FJBB 1Q0DA 2HFOA 3O6XA 2PT0A 1BWVA 1BXNA 1IBLF 1WKKA 1UJ4A 2Z2LA 4KBLA 3AD9C 3QMQA 4USKA 4Z9HA 5HVHA 2BQUA 4JKVA 2V8HA 3UGPA 4ED0A 3O39A 1VBXA 1HMVA 1RKEB 1UW9A 2KT5A 3IN5A 3DLJA 3C14A 2JX2A 4G1IA 4C11A 3PZPA 4RNMA 3QWPA 4DN0A 5EWFA 3KNAA 2VKRA 3CMQA 3DDIA 2B5JB 3PEHA 5B09A 3KHGA 1NDLA 1WN0A 3ILOA 3OVAA 3BEHA 1MG7A 3MHYA 3GIKA 4PPDA 3NXZA 3I56S 4PWWA 1APSA 2KN4A 1IXKA 3KK2A 1NZEA 2V2VA 1SZIA 4FX5A 4UW2A 4MW8A 2RH3A 2XMVA 1Z4UA 1D9AA 2MZRA 2QY9A 1AXQA 2DYSC 3RYLA 1Q1KA 3DLKA 1FRJA 4R5PA 4CO0A 4PXEA 3SCJE 1B0PA 4I6WA 3CIMA 3KLVA 3M2VB 1VBYA 2OI2A 3SYZA 3FRZA 3IWLA 2R7OA 1WACA 5IWAF 1SCJB 2ZWOA 4TU9A 2CPJA 4NXNF 3EYZA 1NB2A 4GO7X 2LECA 3NNHA 2QTWA 2HBZB 2XI2A 3MCMA 1B0TA 1BGXT 3DRRB 2HAIA 3VGSA 1LS4A 2R42A 3R5AA 2DR5A 3FHDA 3CJRA 4E2FB 1N32F 2BW7A 2KYHA 4ED6A 4YB5A 3DRPA 2VG5A 3VM6A 4QYZK 2XGPA 1OSDA 4NQFA 2J0WA 3GIRA 4L74A 3MPWA 3KJVB 1RLCL 4DL4A 1HHTP 2HJ3A 3RH3A 1T11A 4LRFA 4J9RA 4UZCA 2JWNA 4EU0A 3R1HA 3I0SA 1WELA 1TR0A 1PV3A 4DSEA 2IRXA 4QWAA 2EFOA 3O3LA 4TYBA 1FVSA 2X1GA 2DPIA 4FF1A 3ZSUA 3T41A 4HE8D 3LP0B 2D3UA 1BLUA 3KK2B 2YVKA 3MURP 1NH8A 4BEMJ 3NMRA 4C4WA 1JKHA 1JMWA 1Q81T 4IRUA 3ZO7A 2G13A 3QVYA 2CQGA 4N7TA 3OHBA 2IRUA 4WK1A 4Y6IA 4F02A 4LRDA 1Z2LA 4R5PB 1GX6A 1ZA2B 3RR8A 5EX0A 5HMXA 3W63A 3AXMA 4X4SA 4EYHB 1ZHZA 1NU7D 1UEVA 4DV2F 2M8DB 4RNOA 4DX8H 1B70B 5A69A 5L0GA 3HDSA 1S7ZA 1CJVA 2CPHA 1JLEA 3IQ5A 2JL9A 4GVBB 3OXFA 3G4XA 1BR4A 1BMQB 2WSFC 2E1PA 3DRSB 5E3QA 4D4NA 4E98A 1RADB 2ATLA 2F4VJ 3FEZA 2JLGA 4OZ2A 4XIUA 1IBMJ 3J06A 3DRPB 5HI7A 2NSCA 2BBEA 2VG5B 3EH2A 3WG7C 1N5SA 2HZ8A 2NYHA 1RT7A 4IG3B 2FJEB 1QAXA 3NGKA 2NPFA 1S9EB 4CLUA 1KD1T 4JI7F 3EGZA 3IBCB 2F8EX 2I5JA 3DXBA 2HWHA 1YK9A 5I3UA 4F36A 3IBFB 4DPWA 3BR8A 2GQ2A 4X66F 3K0JA 3JSZA 4ECXA 1FHTA 2E5HA 2H4YB 4N5SA 2L9NA 2P1AA 4KC9A 3JYTB 1HW8A 4G6VB 2BJ8A 3C15A 1V6HA 2YWFA 3FZBA 4I6YA 1XMBA 1QUVA 3SSRA 4FXWA 4DR1F 2Q00A 2LSEA 2VA3A 3RB3A 3EICA 2FTRA 1W2BR 2M7SA 1U8WA 3HHLB 4DV7J 2DB1A 5HJYA 2Y1IA 2J7WA 4F4YA 1CPZA 1VFJA 5J1PA 2D3O1 3R5DA 3L95X 4FKYA 3MEKA 4L75A 4ECUA 1FERA 1DURA 4NLOA 2Z0GA 4DL3A 4MTOA 4K4ZA 2ZXOA 3TZWA 1FK9A 3L09A 3HULA 3CW2C 4DCJB 1QD1A 2XLVA 1VMBA 1PCAA 3S8SA 4NXMJ 8ATCB 2MQPA 1KKHA 3RAQA 5EHHA 2FLPA 3CD6S 2QN6B 3Q22A 2KSFA 1FDAA 3IMQJ 5CZXA 1ZYRF 3LGHA 4B9VA 4KO0A 3ZG1A 2QZ8A 2FHKA 2BJ7A 1RXQA 4EKWA 1RU2A 3X1OA 1UVKA 2K3KA 4DV4F 3ZZRA 3DXSX 4P75A 2MLYA 1SUQA 2BA9A 4H4MA 4HI2A 2OD6A 4USHA 3CVKA 4IB4A 3H4DA 2YQ1A 2XLJA 1NU9C 3GODA 3G86A 1LIHA 1M2VA 2P9GA 1DQAA 3RW6A 1XNQJ 4DG1B 4FYVB 1X4GA 3SCLE 2NSFA 1NK5A 2L48A 5GAGI 4DX6A 2WVOA 2MQ8A 2YKPA 2B6AB 1MROA 2K2PA 3T6BA 1RCPA 5HBMA 3BDPA 2ASRA 1X9SA 4QIEA 2IFXA 3OLAA 4M5GA 1MMAA 1NK8A 4Y3CA 2O67A 4TU7A 2CG8A 3M6UA 5L9NA 2Y3DA 4CDIA 1NPRA 4DV5J 3ILLA 4DPOA 1QY7A 3PCVA 2UVRA 4ZVGA 3MAHA 4FVMA 2BQ3A 1YJTA 3PW0A 3CZ6A 4M5LA 1UVNA 4DOZA 3H2UA 4OJ3A 1KOHA 3FQLA 4G0HA 4NWBA 2HFNA 3IG1B 1HQEA 1VLYA 2B9YA 1BUXA 5FLXU 3ZNUA 2C2OB 3HHEA 3DHWC 2J7KA 4DV3J 2R7QA 1QQ3A 1SIZA 1KTVA 2WVQA 3LO3A 3RKOF 1OWXA 2ZC3A 3CXCR 1RMVA 3BF4A 2ZH5A 4UUXA 4KO0B 1DY3A 4WTYA 1R8CA 3LEOA 5KFAA 2DNOA 5B0DA 2BZ2A 5B08A 3FDQA 3ISNC 3C8GB 2EILC 1FNTc 1RTHB 1HNIB 3MF5A 1KS2A 3GJSB 2J0SD 1HYSA 3EZOA 1C4AA 3SDEB 5GAHI 1Y5NB 2UV8G 4P10A 4EWCA 1AW0A 3ZTSA 4CS8C 2JEFA 3NKYA 3M6XA 4QIFA 1S1TA 2GVDA 1VQ6S 5KOWA 1A0OB 3QZ7A 3QATA 2B0JA 3T9NA 5DQGA 4RUBA 3AQOA 3IQTA 3F0NA 2A1BA 1F5AA 3OR1A 1EP4B 4ETXA 1O8BA 1PD0A 4J9LA 4ZVSB 4N4WA 4X4QA 2UU9J 3THTA 2Z57B 1EETA 4WFXA 4NMXA 2ZH6A 2IM2A 1FJGF 5KFEA 2MLXA 2RIJA 1H7IA 2YNGB 2XYGB
chains in the Genus database with same CATH topology
3OEOA 2V9WA 3CPWR 2AJ1A 2XY5A 1X7VA 1B7FA 1XERA 2DNNA 2A2CA 1N5VA 2E44A 4DBRA 3PW2A 2YNHB 1ZHYA 2QT7A 1T03B 4OI0A 2HLUA 4URQU 3I5CA 7FDRA 3UNGC 4F4BA 2D3ZA 4ZPDA 2RU3A 3MLGA 3HO1A 3B0PA 2OPPB 2G4BA 4K4UA 3LS0A 2GO9A 4BWMA 2OLWA 1LKZA 1Q4RA 2ZDPA 5I4MA 1RTIA 3SYNA 3QLHA 1GTEA 3EGXB 3VF0B 1RT2B 1TL3B 2F8MA 2HS0A 4PG8A 2GJIA 3DMJA 2A1DD 3M9OB 2RS8A 2ZHAA 3DYAB 1HBNB 1UETA 2IOQA 3NYLA 3AG2C 2R4FA 3KNGA 5E3AA 2GJ2A 3K5OA 5DDQC 3EPVA 5BYSA 1M5SA 5J2NB 3PKMA 2MKJA 3P6YC 2R7TA 4M5DA 2GX8A 3PMRA 2DJWA 1XN9A 2CQCA 2F9JA 2YWHA 2I38A 4J9SA 1S10A 2IA6A 4DQIA 2VOPA 2BR0A 5L38A 1FT8A 3N6LA 3M05A 3FSYA 2A69F 4WE1B 3UR0A 2DK2A 3S6EA 2MQOA 3OJUA 4A8SA 3MEEA 1TR2A 3N79A 2O5DA 1LV5A 4A8KA 4G3IA 4YWQA 4GKJF 3MEDA 2H7VC 2CIMA 4G1PA 2F4VF 3NKDA 1QSYA 3I4UA 4Q43A 1IBMF 4FF2A 3ZFVA 3I55S 3AHPA 1RQ0A 1LKXA 2MYFA 4YOEA 3SQGB 4KJIA 2JJ4D 3RAMA 2DH7A 4ED2A 2OPRB 4I64A 4OQJA 2DT9A 5CI8A 4F3MA 2YWKA 4MJKA 2QMXA 2Z2MA 1R31A 3N5BA 4NLRA 4C0HA 1U1KA 1M90T 4FYDA 2XGQA 4IJJA 2B43A 1SB6A 5JUMA 4OV1A 1N56A 1BR1A 5A6PA 1H98A 3DRSA 3TVYA 3N9UC 2EKYA 2LXUA 4MFBB 4QZVB 4DR4F 1N0VC 3OQ2A 4QR2A 4Q7AA 3OVSA 4ILRA 2EK6A 3OTDA 1F9FA 1U1MA 4B9TA 2FC9A 3KLEB 1IN0A 1BC6A 5SZTA 3KTQA 2E5JA 4NYZA 3AJ2A 1HNZF 1HYSB 2YX4A 1J5OB 3IR5B 3T1AA 1REVA 1H2TZ 3BDEA 3BGRA 3EGDB 4LF6F 4OHYA 4QBUA 4ED8A 3GV5B 3GE9A 3VQTA 2Y3GA 5F8MA 3BGLA 3H65A 3CCTA 4PCQA 2JFKA 3SZRA 1WHVA 4U9RA 3RU0A 1X0PA 1YRTA 3K7DA 3I6PA 3W8HA 4RW4A 1OCRC 4IG3A 2W9BA 1KVJA 3E01B 4RNFA 4PG6A 1LW0B 3VQSA 2MZSA 4C3DA 4F25A 3DLEA 3HHDA 2LLZA 5IQ6A 2LDIA 2VL1A 1NKCA 2XWXA 2PX0A 4K4TA 3D0IE 3HHLC 5F9LA 3CC7S 1S9EA 1ZTTA 4KI2A 5CQGA 3DI6B 4X0RA 4QU6A 4NL5A 2IXNA 3EUNA 1OCZC 3HHLD 3EG9A 3H25A 3C3LA 2R7UA