3ZC4A

The structure of csa5 from sulfolobus solfataricus.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
157
Chain Sequence
PVAETISKRFWTLIKMLRFYVVLRRFGYIDPLIYSIDPKQIKDVLSEALREFVSYTSSSSSRSIVIYDDPKNPVTAQAPCLVVAKRDEIPQNFPSIYRYTIYKIDKSSEYCISPLVVNDKYATLITPNESVIKEFFDKLDSNIQYARVLASLAVGGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Archaeal Cascade Subunit Csa5: Relating the Small Subunits of Crispr Effector Complexes.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Immune system
molecule keywords SSO1398
total genus 52
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2012-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3zc4A01
3.30.70.2780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3zc4A02
3ZC4A
chains in the Genus database with same CATH superfamily
4RW8B 5FDLB 1M5HA 2WZ1A 4L6V3 1CVJA 1XR7A 4N6CA 4HI1A 1ZM9A 4CS7A 1TMMA 1I5OB 2XS7A 1I5NA 1LNQA 3EQLF 4WFYA 2MTLA 4A47A 2XM4A 5GMKa 4IDKB 4F67A 2H7OA 1HW8A 2MSTA 2KDOA 3O1LA 5KFCA 5T14A 3MAAB 4WE1A 3KJVA 5D6GA 2PMHA 5GAEU 3OFFA 3AG1C 4X62F 2MKCA 1DQAA 3M2UA 2L6GA 4TYAA 3WIUA 4CYUB 1D0EA 2G0CA 4LRAA 2DR8A 2QV6A 2L81A 1YDIA 2DGOA 4HR2A 4EI2A 3DOKA 3IXQA 2O66A 3DCAA 3NL0A 4PWWA 1CPRA 2EFVA 4PJNA 1QD1A 5H1SV 4CM2A 1BD6A 3C8GA 1XBWA 2DNPA 2PIIA 2DXFA 2N7YA 4J32B 4B3OA 2R05A 2DHAA 3T9ZA 3H20A 1S6QA 1RU1A 1T8EA 3HI9A 1AFIA 4KB7A 1NJWA 2HQFA 4N56A 3FFIA 3CCQS 5ADZA 4JVSA 1TR0A 2XLOA 2E1CA 1VQYA 2RS8A 4HT5A 1RB0A 2GX8A 1LPEA 2AP6A 2BL2A 3NNCA 4NLVA 2XRHA 3QVZA 2AD9A 5BR8J 1T03A 5E2QA 2DNQA 5KT3A 1RT1B 4DQSA 4U5GA 5DQZA 1GXLA 3HP6A 2BE9B 4KGXB 4O3RA 1APSA 3GPAA 3D2WA 3CC2S 2NYIA 3DU5A 2ZJPQ 2FVSA 2V4RA 3B6BA 2O3DA 2M4MA 2OELA 2QA1A 3MM9B 2CJBA 2GJ2A 4ELUA 3HNLA 2AZ3A 1UZHA 4PWDB 2BVZA 1NH7A 3M2RA 3CJKB 4KGKA 3NRHA 4URQU 2LQ9A 4B3TF 2CPIA 2UUCJ 4NC3A 5KOXA 3MR5A 1WHXA 4ILMA 1KVIA 4KFBB 4I68A 3EVOA 3ET6B 3LNRA 4DFKA 2AJ2A 1T7PA 4P72A 4DR3J 5L46A 5A8KB 4FXDA 1NLXA 4QPTA 2M2BA 2AJ4A 4I6WA 2G2ZA 1RTJA 1TKXA 1T0TV 3RH3A 3OL9A 1FF2A 1JLBB 3HJVA 4Q0BB 1WN0A 3RF3A 3ULHA 1EKSA 3ZQVA 4ZPVR 3Q2SC 2BKPA 5JVEA 2QTWA 2RDJA 5ETMA 2YPYA 5D15A 1FEEA 2E66A 2J7WA 3RU0A 2DNMA 2AZ1A 2F9JA 1VJQA 3C46A 3IBCB 3SNHA 5CCLA 1S1WB 2R7RA 4OYBA 5DS6A 1YLMA 4X4VA 4U5CE 2ZE2A 1JLGA 4R25A 2JEGA 4MVOA 1ORJA 2FB0A 1G7CB 3QSYB 1S4EA 3X3UA 2XSJB 3N2ZB 1IR0A 3BGRB 4F4XA 2BABA 3U3FA 2G0JA 1UWBA 4CH1A 5KYUA 3I5QA 5CIVA 3EX7B 1JLFB 2QA2A 4DV0F 1Z7Qc 3GIJA 2ZXPA 3OPKA 4B9NA 2EFOA 3IO1A 2MPUA 1RAEB 1Y5IB 2LU2A 2IBOA 4X62J 3ZO7A 4AL7A 1JJHA 4U9EA 1RGVA 2DH8A 3RB4A 1FMWA 4RBTA 3MMBA 4DV6J 3KK3A 2EI5A 3TR5A 4L74A 4HTIA 1RBAA 1RSCA 3LESA 1JLCA 5BYQA 3FZ2A 2XZTB 4DF8A 1UCNA 1PGZA 4QQBA 5JRAA 1M2OA 1T05B 2MHNA 4NCGB 4JI8F 1JKHB 3LQVA 4FS1A 9ATCB 2RB7A 4K2XA 4TU8A 4M95A 4DPYA 2JZ5A 3N5BA 1RXOB 3P6YC 1MMAA 2VPXB 1SQEA 3F0NA 4FPRA 4ZOSA 2VC1A 1M1GA 1KQFB 1OY6A 5EGYA 1CJKA 4CT9A 2I6WA 5A6BD 1SJ1A 4QYZK 2Y0SD 4DR1F 2E9RX 4UOGA 5DQTA 2MLXA 2HRUA 5CI9A 2JDJA 5ETQA 4GMKA 1HPZB 4OI6A 4R5PA 3V4IA 2PO4A 3SQGB 5MAOA 1JLEB 1KTMA 3I56S 1LS4A 4B3MJ 3VV2B 1HFEL 2C3MA 1H2UX 4HDHA 4LR7A 5ETNA 1BQMA 3H40A 3ZZUA 2Y3DA 2F1FA 1YJWS 1NDPA 2G2OA 1RI7A 3CZ6A 3MMBB 3M2VB 5DJBA 3MAAA 3HVRA 3DMJA 1O51A 3R7BB 1N5QA 4C0BA 1APCA 5CA5A 1IKVA 4NXMF 2O9XA 3WAQA 1FD8A 4ZLPA 1QSPA 4OZLA 1NDCA 4WXOA 4N4WA 2C22A 2W4DA 2HHHF 4CS9A 1H0HB 3DXBA 2HFIA 5HJYA 4HYKA 3MYFA 4CLLA 1A0BA 4AUKA 1U2FA 2RJZA 3PW0A 5F0WA 3LPYA 5H9FK 1GQEA 1K0VA 1AUSL 3VAKA 1X9WA 3D0GE 7AT1B 3ASNC 4WZQA 4ULVA 1ZOTA 3FVYA 5H9EK 3KLIB 1Q78A 5CD4A 4MJKA 1WTBA 3AGUA 3MFHA 4ZVTB 3QRPA 2VOPA 2C3YA 1TP7A 1NSKL 3VQTA 1UVLA 4MKVA 2PBEA 4L3NA 1XNQF 5ETPA 2NUTB 5KYNA 2CDRB 4MS2A 2JNJA 1E6VA 1U6ZA 1UFWA 1LKXA 1ULRA 3MFIA 4FKYA 1MMGA 3EJNA 4G1PA 1OR3A 1F2GA 5DDPC 3T1YJ 2DHXA 4IAOA 3B82A 3C19A 2I1RA 1LWXA 2BW7A 1UG7A 2R7UA 3R5JB 2Q9AA 3TUIC 3ZZOA 1NK5A 2HQCA 3DMJB 2M8HA 3DRPA 1JK9B 2VQEJ 4JI6J 2V2VA 2FLNA 5IT4A 1U89A 2NSBA 2L7AA 2JSXA 1E2XA 3FEZA 2QIFA 4OYIA 4K0DA 3DAGA 2BKOA 4AE4B 3GYGA 2KFZA 2PFDA 5D4NA 3D9BA 2YQ1A 2FVQA 5CYMB 1HIYA 4AX2A 2V6AA 3EMTA 1RTDB 4BC7A 4OLPA 2DIVA 1PO6A 3LF0A 3L8JA 1LI5A 3TJ9A 4M5GA 4YY3F 1U45A 4ID8A 4ZVRB 1H9TA 3UDEA 5COMA 4LT6A 3NS7B 3TZYA 2FC8A 4IO1A 4JI4J 1PC4A 2JFDA 3H5YA 1M56C 5TJ5E 2VL1A 2XHCA 3JYTA 2FZCB 2IYLD 3FBBA 4H4MB 2AU0A 2B6AA 1FRXA 3VZIA 3BBBA 2MKKA 3I5AA 4NMLA 1N36F 3HHLC 3PW2A 1VBZA 4TKTA 1OSCA 1HLWA 4MVMA 5IOLA 3R27A 5D3GA 1NB2A 3J81U 3KG0A 1NJXA 3BB5A 3ELHA 2XY6A 5DGAA 1LWEA 2KFNA 5C25B 4N7TA 4ZVHA 3AGTA 2P7VA 4OI3A 4CO5A 4R0JA 3N6NA 4B9LA 1LKZA 4LDRA 3IG1B 3E2EA 5LMNF 4CO3A 1WDDA 1WC4A 1NDKA 1F6TA 3E01B 1T3NA 3G6VA 2HJMA 4KSEB 4AYBD 3PM9A 1WOPA 1R0AB 2C3UA 4WU2A 5DLFA 4ED1A 1YSJA 5COFA 5KFEA 2Y9HA 4KT0C 1VBYA 2GDCA 3O6QA 4HL9A 3E9VA 1RAOA 2Z56B 2DNHA 3GIKA 4I69A 2XXAA 2C1EB 2QE5A 1ZAXA 1TTHB 5J2PB 3GCXP 2JEJA 3P8BB 1S77D 3QJPA 2LXIA 1VQLS 3ASOC 2HHHJ 4Z7YA 2ZJRQ 2E1PA 1U1KA 4PYDA 2HS0A 3OJSA 1IBLJ 1IJFB 3KMIA 3LWLA 2PP4A 4ZP6A 4NXMJ 1N48A 1H7IA 5EN1A 4F50A 2AGPA 5A2QU 1SJ4P 3IA0A 4C11B 1VK8A 1NZEA 4DPOA 2GGPB 1D09B 3PEJA 9RUBA 3KUGA 4KV8B 4WTYA 3PW5A 2K06A 3HD1A 2HSBA 3LAKA 3SXYA 2DRBA 1NB7A 4AT1B 3HHDA 2BQ3A 2DRDA 2EC2A 2ZD1B 4M5HA 1EP4A 3H5SA 3I9ZA 2YL1A 4OX8A 4R8UB 1V4AA 1JNRB 3FSIA 3TVZA 3PXGa 1X4EA 3PR4A 1FK9B 4O4GA 4QWAA 4DVYP 3K1HA 4K2JA 3DLGA 3W9JA 3ZTQA 1XERA 4XLNF 4OIXA 3SSQA 4ZIWA 3DRXA 3S8SA 2YWKA 2HHQA 3BKTA 4DUZF 3MUTP 4ZLJA 2OI2A 2H5IB 4FBUA 2MXYA 4WYLA 3MMCB 3UD3P 1YX2A 1RWKB 3TVYA 2QLAA 3QW0A 4GVBB 3AJMA 2DB4A 1ICEB 4LDQA 4Q44A 4CLWA 2R3VA 2DGQA 1XNRJ 4XEFA 1TL1B 1ST6A 1NFNA 1SI9A 2B0GA 2OPSB 1X4CA 4ZVEA 5BQIA 4NTBA 4K4YA 1T9VA 3TARA 3MM5A 4JI5J 3O44A 3ZFVA 4DV7F 4DR3F 3V5XA 1FVQA 3ET6A 4CLKA 5L39A 1GM5A 4CP5A 1IW7F 3TAMA 2X3GA 2CJXB 2CYYA 2EBGA 1RWWB 3T1AA 2LEPA 1C1CA 1RTJB 3FRZA 1W25A 3OQ2A 4QOTA 4USKA 5HROA 2O01C 5LT5A 1D1UA 4PYAA 1C0UA 3Q8YA 3TANA 2CG8A 4Y65A 1KHWA 5DQGA 1VQPS 4NCBA 1RT7B 3FQKA 3BKFA 5EWFA 1VQ4S 2DGWA 4EYIB 1T94A 1C03A 1LW2A 4MMOA 2DISA 3ZVRA 3D5MA 2XGQA 1IZMA 2M3DA 2XGPA 1M5SA 3A4TA 2UUTA 5IM0A 1SUQB 2HSEB 4P9FA 2NUTA 3F46A 2FTRA 4A8OA 4PEOA 4QWEA 2LP4A 4WFNQ 1SKSA 2VH3A 2R2TA 1A41A 1AYEA 1T6IA 3OR1A 4PR9A 1XZPA 1VC6A 2W8KA 2DNOA 2J9BA 5IC6B 3W7BA 1QSLA 3MEDB 1DTTB 2FDNA 2DYAA 4HLBA 4O6MA 2R42A 5KT6A 4FYDA 3MBGA 2HVIA 4Y28C 3ZZTA 2HLTA 4GO7X 1O0PA 3KYIA 2Y3BA 2IRXA 2FHKA 2SXLA 5DDRC 1QUVA 2W4CA 2BX6A 2CJKA 1RWMB 1GFWB 1RTIB 4PK4A 3IWNC 1RAHB 1E6YA 2A6OA 4OHVA 1FKOB 2CQBA 1U0BB 4Z37A 4X4RA 3M8SA 2P1AA 1X4BA 1XMOF 3VAYA 5KFIA 5CQGA 1PD0A 2GS8A 3EH1A 1AVOB 1V9OA 2ZOMA 2GO8A 2GC8A 3HSDA 4M1KA 1RT3A 3QMQA 2X1FA 3J7AN 2L48A 3FGVA 2WVNA 4OJGA 5KFJA 4LSNB 4A8XA 3ABMC 2BUNA 2DITA 3CAXA 4ANCA 3D0HE 2M0GB 3PZPA 3LP2A 1R8BA 2ZHAA 1ORYA 2QLBB 5DETA 3TA1A 3TQOA 1M1HA 4U5FE 4ELTA 1Q7LB 4ILLA 1NBEB 4DZDA 2OKQA 3EGXA 2XWYA 2XLIA 3LJBA 1HQUA 1S76D 3CXCR 5IY5C 4MVUA 4ECZA 4ED5A 2KRRA 4F25A 2O1PA 3CUNA 1N34J 4JRZA 2RUGA 1HPZA 3R97A 2V4JA 3KNGA 3SXZA 4ES1A 1KWMA 2MQMA 2OG2A 2BXJA 4OZ5A 2WSCC 2RF2B 4O6YA 4BWMA 2XULA 3KLGB 1RTIA 3B0PA 4LF7J 1XZQA 1S7HA 3ZSUA 1FRLA 4IRUA 1PYSB 3FK4A 3L3CA 3DJUB 4KO0B 1IKXA 4OYOA 3PR5B 2CVIA 2M4EA 2V8PA 2KG1A 2V8GA 1ZHZA 1GNKA 2BM1A 3IQCA 4I2PA 2J0WA 4Y2KA 1ZHWA 4KHMA 3H4BA 1TQLA 3IAM9 1FXLA 1QAJA 1TKNA 3MTJA 3FHDA 4DV5J 3EDRB 3CO0P 2E1AA 4JEAA 4CI0B 2PA8D 2HSQA 1TKXB 1RZMA 4OX9F 1JLAA 3D68A 4JI3J 4UQTA 2LU1A 3ZZYA 3LUTB 1T9XA 2ACMA 5J1PA 1Q0MA 4NLGA 4XPXA 2KI2A 3FRYA 4HACB 2COLA 1HMVA 2E5HA 3U9MA 4K59A 1VQKS 3ECSA 2Q4FA 2IAJA 3PV8A 4BJ6A 1E6VB 5KYYB 3M8PB 3THPA 1RWUA 3L95X 1H73A 2IM3A 4CCHA 1Q81T 3JSYA 1TL5A 4R8UA 3CT9A 1CC7A 2KN4A 3KHGA 1B0PA 1HBMB 2B0JA 2XL6A 2FJBB 5CI8A 4NLQA 4CYUA 3FEXB 3GM2A 1R8PA 3E3XA 1KBRA 2DGJA 1MROA 2V63A 4DQRA 2WVFA 2H5EA 3V5RA 1FCAA 5J1EB 3AG3C 2MSSA 3MM8B 1HWIA 1GMWA 1S9EB 5L1IA 4BJ5A 4J7TA 1CSJA 1UWBB 2E5LF 1FO1A 1RWNB 4NASA 2IRYA 1SH3A 5KG6A 3QT7A 2BV3A 4DFPA 2G9OA 2OEMA 2HVEA 1FKPB 4ZLCA 1IWGA 3NY0A 2HWTA 4QR2A 3MUMP 1UPMB 3M8WA 2BE5F 3D3CJ 1KKHA 3LOUA 3JS9A 1RTHB 4NE9C 1FRMA 5U47A 1UMJA 2ASJA 3ILJA 4UY8T 3QSIA 2ZNYA 3MMAA 2C3OA 2A10A 2BA9A 1VGYA 4KKOB 4B17A 5KFLA 3BPDA 2PA3A 3K5MA 1TL4A 4JI7F 2P61A 3NS6A 3GR0A 4CO4A 4ZP7A 1S0NA 1QDUB 4TY8A 3LTOA 3LEOA 1HNIA 1F1BB 1JMTA 3HT0A 1DLOA 1HNXJ 4B9TA 1VC5A 1TKDA 2BDPA 3RW0A 1QLEC 2EVZA 3DWWA 2W2MP 3UGPA 1Q0FA 1OCOC 1LWCA 1S4FA 3TUPA 1JQGA 1D9DA 3H5UA 2E5GA 2AYEA 3M4CA 3MCMA 2B51A 1T9KA 4AQYF 3G9CA 3SV4A 3B8HA 4NLDA 2W9CB 2D5RB 2E44A 1TMJA 3DGPB 1Z23A 5DM6Q 4KFBA 2A0UA 3M2RB 4WABA 3W2VA 2VODA 3BV8A 4DUZJ 1VRTA 2AF6A 5T7LA 5LSRA 1N32F 1SL0A 4JI1J 1OIAA 4GEHA 3BBCA 3B54A 1B4SA 4U8YA 3DFEA 3PACA 1ROFA 3BO3A 3GLJA 3MCNA 1NK8A 3SCIE 4YR2A 4AK9A 5KFMA 3QT5A 1SV5B 4DCOB 2OCCC 2IVMA 3K2YA 3KOAA 1D9AA 4DI6A 3Q8RB 2JD3A 2RD5C 4ANEA 1RU2A 3EFOB 5B0GA 3C8ZA 3QRRA 3J80U 4OHWA 4ZK7M 3N01A 1ZTTA 5IT9Y 3CD7A 1U47A 4FZVA 2FVPA 4I44A 5EUHA 4EU0A 3VALA 1NZ8A 1N5YA 4XEVA 4KY3A 4D3HA 2F9DA 1FDDA 2RHSB 1RMVA 3BQ2A 3DNCA 2Z4PA 2XL8A 3V5ZA 1RACB 2DY9A 3AOUA 2KFYA 3MURP 2ZZNA 2CQHA 3MM6B 1U25A 4A46A 4OQJA 4JE9A 1U2CA 1EARA 4ECVA 1RYSA 5J2QA 1E84A 3LLKA 1S6OA 2LQJA 4B9UA 2R7XA 1IUJA 1KQGB 5B7WA 2P0NA 4NI2A 2QRRA 2CQ0A 5L9NA 2BR0A 2WVCA 5F8LA 4NYPA 1MN7A 2QZ8A 1YBUA 1SKWA 3W2WB 2Q3PA 3WODF 3K66A 2KNHA 4DMZA 4P2FA 4J9MA 2C42A 3R6GB 2MWQA 1QAIA 2UUIA 4Y3CA 3S6EA 4EUKB 4JJFA 4Y0FA 3LS1A 3B9QA 1TU0B 2EINC 3NCQA 3NG8A 5BQGA 2KU7A 3J7A1 2ZH6A 1SVDA 2I9SA 2MKHA 4IARA 4NLSA 4F3MA 1XMBA 2YH1A 3PIPQ 2QFJA 2WB4A 4JI2F 4NRTA 3L34A 4ECTA 1QAYA 3WZ0A 4QU7A 3DN9A 4ECRA 4QIFA 3W8GA 1WF2A 1R89A 2W7PA 4QYRA 3MPUB 3G2XA 2VG6A 4NCGA 4RW4B 1X5SA 3P5TL 4U5EE 3CC4S 1U1PA 3IFEA 1RKEB 5G0RA 2KXNB 4ILRA 2HAFA 2M64A 3OXFA 2Z2LA 2FFHA 2E7XA 3EZIA 1S97A 1AFJA 3FFIB 1NHVA 2LIGA 1T9WA 3RQFA 4DCJB 2R7SA 3JZ0A 3TQEA 5KG5A 4AL1A 4NI2B 4ANDA 1CJUB 2BOAA 1QPUA 2WK4A 1NU7D 2AVKA 2BRKA 3J06A 2VFUA 2MGZB 2YNGB 2DBBA 3M8QA 4ER8A 1EZZB 4JI3F 3KL4A 1HA1A 3EVMA 3H7HB 3I0RA 5C42B 3GWLA 5A8WA 1DQ9A 2HMIB 3MEDA 3RBZA 3PDNA 1D1BA 2HZVA 1VYIA 1OWXA 1WKJA 3FCWA 4V1Ak 4N47A 2GV1A 4Q4ZF 2MZ1A 3NNAA 3MZIA 1YARO 2PC6A 2YVKA 3M9OB 4K4UA 2KXFA 3MM7B 3OVBA 1PJ6A 3CCLS 5AE1A 1SYQA 2F8EX 2HS4A 1IR1A 1H38A 3CE8A 3I4HX 2YWGA 2GW8A 2Z0GA 3O3LA 3M1VA 2Y3HA 2HRYA 2C2MB 2QLFB 1D0YA 4E0DA 2UUBJ 1NEEA 3AQOA 3GB0A 3ISND 4DR6F 4DR5F 4K50A 1Z63A 1BXNA 3I0SB 2EPOA 2XB2D 3MMJA 2CNKB 3M30A 5ETOA 1YZ6A 5EX0A 4GKJF 4XEKA 2RMLA 2XLWA 4M63A 2HQIA 4PUOA 3QNWB 5ETKA 2W9AA 4ALZA 3G96A 3BH6B 3KDOA 3MXHP 2GVDB 1MWYA 4WIQA 4FNIA 2VOOA 3UMKA 2CZ9A 5KFAA 1T01A 2HWHA 2K2PA 3J7YI 2GFFA 3NGRA 3OV7A 3BQ0A 4URGA 4USWA 5CZXA 3HHNB 2QSWA 3PEHA 1S9FA 3MECA 3H5XA 2U1AA 2ZXOA 1FWPA 5I42A 3UCZP 8ATCB 3A3PB 2LA6A 2HHSA 2YL0A 3IS9A 3R5GA 4Y00A 3KYLA 2EPKX 4YUDA 2Y1JA 4RD9A 1FTRA 1Q82T 1YJNS 3BGRA 4LF5J 1SC6A 1HY5A 4NTAA 3FJ2A 2R03A 2KT2A 3W5YA 3QFWA 4LFAF 2YBVA 2HHTA 4F26A 1C4CA 4TXSA 1D1AA 4ZCIA 2AKWB 3SI8A 3WHNA 4ATNA 3NKDA 2QN6B 2EPMX 3CJQA 3K1IA 2FLLA 1AEPA 3D28A 1WASA 1OJ4A 1RHUB 3D54A 1XR5A 4RUHA 3SYNA 3ZTZA 2UU9F 1VDHA 1X4DA 2HGNA 4WGYA 1T6QA 2B8QA 2J9DE 4LIRA 1WOLA 3NKEA 1BMQB 3MCOA 4YFUA 2WSFC 4F02A 4A2NB 5IT0A 1Q0GA 3POTB 4TU9A 1YRXA 1GMVA 2AGOA 1RT1A 4H4KC 4YHHF 2CWXA 4RWWA 1TFKB 2OSRA 4LFBF 2KTQA 5HN0A 2DRAA 1GMWD 3CCRS 3HVAA 1XTZA 2H54B 2MHRA 1ZYQA 4HE8D 4CNZA 1NZAA 1LWEB 2NSFA 4EWCA 2FUG9 2FGCA 2X0CA 4J9KA 1NK4A 3QGPA 2V8HA 2MB0B 2ZM6F 1C02A 3KMQA 1KLNA 3PIOQ 4ED7A 2G0IA 3ZWIA 2GIRA 1R0AA 1NBBA 1U8SA 5A8KA 1S9EA 1QAXA 2CDQA 1RCOB 2IJFA 2WW8A 6FD1A 1UVKA 2MJNA 3W66A 1C1BB 2RKIB 2ZKTA 4RW7B 5D0EA 1VYKA 5F8MA 3CDUA 1V5VA 2HNYB 4Y2CA 1BBHA 1UA0A 3IQ6A 2A2CA 3I5PA 4WXWA 1UVIA 2J9WA 1SH2A 3MDFA 1FRJA 2AEMA 1FEHA 1F5AA 3VAFA 1M2VA 5SUHA 3QIDA 3W62A 4GC7A 4R0EA 4FF2A 5LOQA 5G4DA 3ZTPA 5EWGA 5IT9U 4IG0B 1R43A 2EPIA 1PKUA 3IQ5A 2N82B 2KZZA 4KRWA 2PN6A 5IFMA 4UDVA 1HW2A 2OEJA 3N0TA 3L8IA 1LI7A 2HJ3A 2VJUA 3PYDA 5A6PA 5CYJA 3GV5B 3W64A 3D67A 4B9VA 3S27A 2MZQA 3UMIA 2XBPA 1VMAA 4OI2A 3HF5A 1T9UA 2H9ZA 2I15A 2JWNA 4C7OA 1ORSC 3FAJA 3F47A 3LAYA 2RS2A 1UJ4A 1Q86T 3LO3A 1WJ9A 4I7FB 2Z8QA 3IQTA 1HQUB 3JRTA 3F44A 4NOHA 4QW8A 4ZLNA 1KQKA 2UUCF 4IKAA 4EWTA 1OQ3A 4DG1B 1MN9A 1S1UB 2YXLA 3CW2C 2IA6A 3N79A 1UZDA 5DQHA 2AEJA 1GS9A 2OP5A 4DLGA 4OIQF 2KHDA 2W8LA 4BJTA 4B9MA 1RA6A 3HLUA 2Q9BA 2YWAA 1X31C 4YB7A 1X4GA 3KLGA 1RWPB 3GJQB 2CADA 2W9YA 1OKKD 3BGUA 1N0VC 4DU7A 4A4JA 3I32A 5EWEA 2OEKA 1OR2A 4IR9A 2VDHA 2M9KA 3RKOF 4E8UA 3R5CA 2RT3A 2HW3A 1JWWA 2OKUA 3A3OB 5C2GA 4WFZA 2BYCA 4UOFA 1LQ9A 5DDQC 2HRTA 1TL3B 3WQPA 4HEA9 3IP0A 4NA1A 1Y4CA 2ZNZA 4AE5A 3QW1A 3AOBA 1SUQA 2GIQA 1VQNS 4BLGA 2NUUG 4ZVPB 3QVYA 3UDCA 1I51B 3O2IA 4X66F 3LAMA 3PY8A 1JLEA 1FE0A 2VKRA 1IM6A 4L73A 3OLBA 5IM0B 1LXNA 2C2NA 2C04A 1S1XB 3EGWB 4DN0A 4RNNA 4DG1A 2VICA 1RBOB 5LMUF 5LL6d 3MFNA 2B9WA 2CZ4A 1IKVB 1F0XA 1UFLA 3BZQA 3MR3A 2DPIA 4G65A 4ED6A 2ZZMA 1JLBA 1MLAA 1OYEA 5IXUA 2Z30B 1KTQA 5FIIA 1E85A 3M9NB 3RRHA 4P9TA 2BJ1A 3W8PA 3MEGA 4TY9A 1AW0A 4EO8A 1FRKA 3CJRA 1SJFA 1LE4A 4XPWA 3UW1A 1VRUB 2R25A 3BGFA 3RB6A 1C4AA 4KPCA 4EIYA 3DI5A 1CJTA 1CLFA 2QMXA 1U0HA 1URNA 2ZBQA 3HKZD 3AB2B 2X7IA 1I3OB 1OQCA 1RTZA 2NXNA 1M5KC 1T95A 4X65F 2I2YA 1OPIA 3AD7C 3BR8A 2MZRA 1ZM2A 3C62A 1AB8A 5JXSA 4USHA 3BGOP 1FX4A 1NM2A 1D1CA 2F40A 5EK0A 3S84A 4LBHA 2ASRA 5B1BC 2AEFA 2OSQA 3BYPA 2VC0A 3HO1A 1S6PA 2Q43A 3DAFA 1F9EB 1Q7YT 2DK2A 3PNIA 2Q9CA 4FDFA 4PR6A 3HFZB 5AGFA 5F41A 5EDWA 3W1YC 1TKZB 3MOJB 4NYZA 3NDBB 2WOMB 3IWLA 1F5CA 1UAWA 1YKWA 3QJJA 2FPHX 2J76E 3RRKA 4N5SA 4DN9A 4A8YA 4JI6F 2V2KA 1LWCB 1PJ7A 3QJLA 3TW0A 3TOMA 1UP1A 3LP1B 4NX9A 4ZN1A 3MMCA 1NK9A 3HFKA 2ZWOA 2WSEC 2CQGA 3FDQA 2CJQA 1L3KA 3KJFB 3G4XA 1GX5A 2HYIB 2XS2A 3PCOB 1ZU5A 2B4UA 3I5CA 4NEYA 5GAEI 3KHLA 3CF5Q 4G7OF 1Q0KA 2EKYA 3QYYA 2OAUA 4DU8A 3C16B 3U1LA 2BANA 2HMQA 1UWAA 2C2KB 1N6QA 1U02A 4ZJLA 1GX6A 1U1OA 4F4BA 3AQPA 1TAQA 2DO4A 3ABLC 3QAEA 1E83A 1T03B 3TO8A 3LLIA 2RIJA 3HM9A 2EK1A 3H2LA 1WDTA 2HGLA 3CCMS 2DKOB 2XS5A 5F8HA 5C25A 2A0BA 5KFPA 4ENOA 2IYGA 3PHEA 2J6SA 4Q45A 2GMHA 2B7BB 3NBPB 2Y0BB 3G87A 1TZ0A 3K1IC 2CNLB 3AH6A 2HZCA 3THVA 2KO1A 2IOQA 1K04A 1R4TA 3N6MA 2OU6A 2ZZTA 4K4VA 3R5BA 1S49A 1F3FA 3OL6A 2D3UA 4YN3B 4MYTA 1RAAB 1AA1B 3E70C 2GCFA 1RT6B 2B43A 3CJKA 3N24A 2IBFA 4C3MA 1RQ0A 3V5YA 2L6FA 2DEIA 4ULWA 3VCDA 3MEEA 5GVQA 2CUYA 2J9VA 2ZPAA 3MM8A 5T1DB 1JIHA 3MPVA 3I9V9 4DV3F 1MWZA 3ZZZA 3EM1A 3RAQA 1HYSA 3OBIA 2BANB 2R9RB 2VPYB 4ETXA 5A0YB 1X4FA 4X4UA 1MG7A 4MK8A 1N1CA 5DQIA 4F8RA 2YWWA 2V8DA 2HVZA 2Q1LA 3KLHB 2DGXA 2V2QA 3JRMO 1LK5A 2HVHA 4MQ9F 4AXJA 5E7OB 3AA9A 4AL0A 1XWJA 3DGVA 2WVDA 4KHPJ 2D9PA 3F41A 1IKWA 1TFOB 4C3EA 1OCCC 1A7EA 1ZA2B 2LDYA 4RW6B 5I4MA 2XMKA 1ZTWA 2WB7A 5KFBA 1H6KX 4ZP8A 3S29A 4WE1B 1WGWA 3ILIA 3KJVB 1VYAA 4G7HF 2JL9A 1T3OA 4XK8C 3P45B 4OZNA 4FS2A 2UV8A 3WIVA 4OMFG 1X9MA 1VQOS 5M2PA 5KT7A 2KM8B 1UJ5A 2W1BA 3F56A 1KC8T 1TVRA 2W45A 3JQKA 3V6HA 5EX3A 1B64A 1CULA 3NMRA 4EBKA 3H25A 2Y8WA 3JQMA 1FTSA 1Q8BA 1LXJA 4OI1A 2OJ3A 1CJUA 2QLJB 3IM8A 4XDDA 2E1MC 5GMEA 4MTGA 3CCSS 4F3OA 3Q6MA 3T6GB 2FZKB 5KG7A 2V4JB 5K8PA 4O3NA 1KFDA 3I0RB 5C42A 2B4OA 2KGOA 5A8WB 1O5JA 3FBCA 3ILOA 4EZ9A 4ELVA 4WJBA 1NHKL 2R7OA 3MUVP 3SFUA 1XWLA 4G7ZF 5JUMA 3OJUA 5HQ8A 2EIKC 5KFVA 2R8IA 1IBLF 3HJCA 4AD6A 5DLJA 1IQZA 3HD2A 2PMWA 1DARA 1Y3KA 3I5BA 2FAPB 3GV7B 1JKHA 3N6LA 2HBZB 4HHJA 4C0OC 2DXEA 5KFXA 4OZ3A 4DJBA 5HROB 4DUYF 1YGYA 4OD4A 4FBTA 3ABKC 1C0UB 3V81A 4RUBA 4D4NA 1DFDA 3W3SA 3N5FA 3MI7X 3IEEA 1CJKB 2F4FA 3ENAA 2M8DB 2VA3A 3GR1A 2GQCA 5KTQA 1FJ7A 2DGTA 3AQCA 4RNOA 3IM9A 2YKMB 1IJEB 3TQ1A 4CS8A 3EPIA 3DOMB 4H4OB 4J9VA 5A8RB 1JLQB 1HBOB 4KBLA 1WOOA 4QIVA 4DLEA 2EFNA 4LF5F 1RT2B 4ES2A 3S9OA 4LQ3A 3C2PA 3EHMA 1T9YA 3L7UA 4KGZB 1DBDA 1B7YB 3CVKA 4FYWB 5HMZA 4P52A 4EO6A 3V4IB 2XQCA 2UXDJ 4USIA 3SQGA 4NWBA 4FVMA 3US5A 5MLCV 1NO8A 3G82B 1N8RT 2IIHA 3ZTRA 3GFXA 2HEKA 1R6VA 3C8GD 1R8AA 4IRDA 3TNVA 3A1YG 3D4JA 1L3SA 4ZPCA 2D69A 1R8CA 5CZVA 5L0GA 3EG9B 2YNIB 3K8VA 1Q8LA 4C8ZA 3OUYA 1SF8A 2YRFA 1HQEA 1I4ZA 5HV9A 3DKDA 1K1SA 4OZ2A 4ED4A 4X4OA 1FT8A 3L9ZA 1RJ9B 1BUXA 4YHHJ 2WAQD 3M05A 3UCGA 4C11A 4WWSA 1FRIA 2QFIA 2VZ9A 4OFZA 1TWGA 2JVOA 1VISA 4RW4A 4DUYJ 3KKBA 4TQRA 4J9QA 2ADCA 1Y3JA 3DDNA 1H3DA 3V2UC 3VAGA 3NOGA 4ZVFA 2AT1B 1TWCA 4YP3A 3HHLD 4Q5VA 2P8IA 2PI5A 2QT7A 3C15A 1NDLA 2VIHA 3KLIA 1HD0A 3HT3A 4J37A 2A1DD 3UFCX 4PG7A 1N56A 1WATA 4QIGA 4J7YA 4FPIA 2V9WA 2CKWA 2L9WA 2DY1A 2J7PD 3MD1A 1YZ7A 3KLFA 3X2QC 3PTWA 3RYLA 3L09A 2JLEA 2V9KA 1HBUA 1G5ZA 3FUYA 2ZXWC 2NG1A 5KYXB 1VQ9S 2IFXA 4AE4A 4PABA 3FSYA 3OL7A 4K1OA 2F4VF 1M5PC 1DAXA 4CH0S 4I3MA 3H2VA 2HNZB 3C66A 3ZTMA 1QUPA 2YKNA 1FMVA 3CJSA 1NK0A 2HBQB 1PAUB 2BC5A 3K5NA 4MW8A 3SCLE 2W24A 1R0CB 4L6RA 2YEVA 3S90A 5F9LA 2D3O1 3NAIA 2W4BA 3LS0A 4BEJA 2OMLA 5LSLA 2VQFF 4NY3A 4USTA 3OSNA 2BJ8A 3GMGA 2KJWA 2FLPA 1NSGB 3K7DA 2CJAA 1TK0A 3NAHA 3CGIA 3DLLQ 1TV6B 5AJ3J 2K1RB 2VFVA 1C1BA 3F73A 1NPKA 3K58A 4QIWD 1S1VA 2HHPA 4YB6A 3HULA 4B3SJ 4DRJB 4RW9A 3JYTB 2I0XA 4M5IA 2XYHB 2XHWA 1X4AA 2BMBA 2ZM6J 3QLHA 1U4BA 1IQTA 3M30B 5GAHU 3FQLA 2CJ9A 1YZCA 4PCQA 4G1QB 4O44B 1RK8A 4C3BA 5A69A 3SSRA 3TK0A 4PAAA 4LF6F 5KG0A 3MX3A 1J5EJ 5DG9A 1WKLA 1WI8A 1FJGF 4DL0C 7FDRA 3CJTA 1KRPA 2YNFB 3CSKA 1GH8A 1URRA 3ZIBA 2GWWA 3EZOA 3HPOA 4OHYA 3DDKA 1VTMP 1JMWA 3P5BP 2HAIA 1RE1B 3E01A 4DCPB 1FESA 5BYSA 1EQ0A 3EICA 3NEKA 3QGHA 1NJZA 3C7JA 4K4ZA 2DNLA 2ZC4A 3U8VA 1GAOA 1SXLA 2B56A 4OJ3A 2UU9J 1NKCA 2C2ZB 2WVOA 3HMJG 4B9SA 4IFVA 1S1VB 5K14A 2FVRA 2DYRC 3NMIA 5JP7A 3Q6NA 3MPDA 1YJTA 3K5OA 2DTJA 4DSEA 2J9EA 5T3TA 1RT3B 2OLWA 3CDAA 3HVTA 3IC1A 1U24A 3TVKA 4G6VB 4LR9A 1UVJA 1X60A 2YQYA 1Q8IA 2W7OA 2IDEA 4NL5A 2V3CC 3OXGA 3A8EA 2XL4A 3BSAA 3CDEA 5CHCB 2Q66A 2OFGX 2EKNA 1SJRA 3Q83A 1BR1A 3C18A 2OUGA 4XPYA 4IDKA 2MKIA 2V94A 3OHAA 2A68F 2CPHA 3ICLA 2YKQA 3I55S 4MTFA 1SQFA 1ZETA 1C0TB 2W2PP 3D6FB 4BBYA 1HHSA 2ZUGA 1IBMF 4WKRA 2MQPA 2F22A 4JW1A 1IBKF 3KJQB 1VIOA 3ATPA 3O6XA 1X0PA 5C24B 3I4UA 4JUZA 3X1LB 3FXHA 2EFPA 1DHMA 4FF3A 1CPQA 3PYFA 4IQXA 2W4PA 2KZMA 5KYUB 4JI5F 3EHNA 4IRKA 3MAQA 1NK6A 1FFTC 3LPEA 1LK7A 3NP5A 2NPIA 4UOCA 2DNYA 3TAPA 2MKJA 1PCXA 4ZLDA 4NTFA 1EAYC 5DS7A 4KO0A 4I1OB 5COGA 4OV6A 2PX3A 3TULA 3W65A 2JLFA 2OPPA 1FX2A 4C9DA 2A69F 3LNMB 1TL1A 2VFSA 3HKWA 5HMWA 4NPOA 2R7QA 1CQMA 1MNDA 2P9GA 5F0UA 2ETSA 4M5MA 3N0VA 2OJED 2F4VJ 1JJ4A 3DLBA 2Q00A 2A1BA 2JC0A 1OW6A 3HHKA 1JOGA 2ADBA 2ZKUA 1RLCL 3QFHA 3W9IA 4PQUA 4O23A 4Y34A 1JX4A 3NXZA 2B7CB 2CPDA 2HV6A 1JAFA 4RX6A 1OYDA 2LXUA 2ZVIA 4Y2AA 3SDEA 3H2UA 3CMQA 2JPUA 2LK4A 1HWLA 1M1KT 4ED0A 1RJJA 1HE9A 3M1VB 1WHWA 2V50A 4MVRA 5CABA 3VAMA 1M0SA 4TU7A 3ZG1A 1D8YA 4ZITA 2BJDA 2EFGA 3T5LA 4WIIA 1PJ5A 1S57A 1RT7A 3ZTSA 3T9OA 5H9EJ 2RD9A 1QSSA 1YDLA 1NUEA 5JT4A 2H5JB 2HQ3A 4RNHA 5I3QA 4YOEA 1HWKA 3TJ5A 2DT9A 1GTHA 2OTJS 1NJYA 3PX4A 2GA0A 4TLQA 1PYTA 2MEWA 3OXLA 2OIHA 2ALZA 1X9SA 1Z3IX 5F8NA 4IG3B 2OPPB 2IC3A 4U7UD 3BSOA 1Q5VA 5ETRA 4FKXA 3D66A 4F2SA 4DR2F 2FVCA 1S10A 1B70B 1UJ6A 4MW3A 2F65A 4F36A 4E0HA 4NA3A 1B3TA 2AGQA 1E86A 1MNEA 2ZEJA 2W2OP 1SL1A 3FMWA 3N9UC 3A9CA 3NYJA 5AC4A 1FKPA 5HVHA 3DXSX 4NXNJ 2Q6BA 1GEHA 2LMIA 4IH5A 4PXDA 3EE3A 1YLXA 4OX7A 3Q24A 4C97A 1A6LA 2ZHBA 3EZ5A 2B9EA 1QKRA 2ZDPA 4C8MA 1V3RA 3BPSP 2NZCA 3D6HB 5HATA 3Q0AA 3DRRB 1WC1A 2BE7D 1VC0A 2DD8S 4KKOA 4EBBA 3CCTA 2YWHA 4Q2MA 2EFQA 2HURA 3JSMB 3U7JA 4I2QB 2A18A 2XMJA 2BJ3A 1KONA 4CM0A 3ZXWA 3QRQA 4MKBA 4DQQA 2HBRB 2PD1A 1HNIB 2MYFA 3U27A 3WBZA 3EUNA 2GFHA 1NPPA 2KT3A 1S1TB 2WZGA 4U9RA 2ZBRA 4IWBA 2XLEA 4ZKAA 3J7ZT 2HV7A 3DLJA 5HK4A 1FWKA 4V19J 2R02A 2PFFB 4JTAB 2AYBA 4W90B 3EGDB 1UA1A 2VFTA 4G1QA 5GMDA 3EH2A 4J5OA 2RRAA 2UXDF 2OTLS 5HQMA 3UR0A 2OEVA 3JQJA 2AIRB 1J5OA 1I94J 5IZHA 3K7RA 5CYQB 2RSEB 1FDBA 1SR2A 5HP1B 4O3SA 2RF2A 2HHXA 4DR4J 4PWUA 3UD4P 1PD1A 3T1HJ 1FE4A 1O5HA 2HWIA 1T05A 5D8HB 4GO5X 4M5JA 3PX6A 4MFBA 2WCXA 4ZVGA 3UNYA 1B7FA 3AFGA 1BHNA 2QGFB 3U1MA 2ZXRA 4JV5J 3S28A 3RR8A 3PJXA 4LF8F 2C3PA 3BGLA 3NYMA 1Q5YA 4ZS6A 1YRUA 2MY7A 1JLAB 4JV0A 2XEXA 2QJ3A 1RT4B 5HLFA 4OI0A 3P49B 1PBUA 2DNKA 5A0YA 1GT8A 1G4WR 1CEZA 3GFZA 2TMVP 5BQHA 3R7NB 5KFFA 1K73T 4ITSA 1UETA 4KBIA 2ZITA 1SL2A 3ZTOA 3RVZA 1Q4RA 5KG3A 2XLJA 1Q0DA 5CAAA 3D6MB 1G8XA 2HZ8A 1D8ZA 1UW9A 3VF0B 1KNZA 3PFOA 1Z6AA 1BZ4A 5DO2A 4BJ5C 5L0IA 3UN5A 3QO9A 1J5OB 2QL9B 3I87A 4WKYA 4NQFA 3VAJA 8RUCA 2YX7A 4ZHRB 4RZRA 4U95A 3TX0A 1EB0A 1IBMJ 3JXOA 4QJVA 1JPJA 4YB5A 1HBMA 2ACYA 4EZ6A 1RYRA 4G3IA 4EEYA 4UZCA 1NNDA 3IS9B 4XO0A 2VONA 2IPOB 4WGZA 4CIOA 4N06A 2Z15A 1S6UA 4I7FA 1QZXA 2YPZA 1WWHA 2E1RA 3G8TA 1SPBP 4LACB 3S01A 5F9NA 1HMOA 4ZVOB 5HVGA 1D0ZA 4ZDNA 3PHF2 3KFWX 4CJGA 2ICWG 1CBKA 3DE8A 1LOUA 2V69A 2EPLX 2JRSA 4X4TA 5HJXA 4Q8FA 3D3BJ 3SBMA 1MU2A 3D1HA 3TJ8A 4Z7CA 1NJIT 3TD7A 4DFJA 4A8FA 2GGPA 2G1HA 3UVJB 3KK1B 4L72B 3KHRA 4GC6A 1IBKJ 5K5MA 1LFPA 4JI7J 2HVDA 4YK5A 1G1XA 1Y5NB 5I3PA 1TR2A 1HE1A 1BWVA 4Q0BA 2MY8A 1YIJS 1Y11A 5KT5A 2XMUA 1YJ9S 1M90T 2EXUA 2QG9B 2A0FB 2QA4S 4LRFA 1QM9A 1L3PA 3KUHA 1J2VA 3DZAA 4DXLA 2WW4A 4LF6J 1X5OA 2XLKA 2ATCB 1CC8A 1ZA1B 4UF4A 2CQDA 3GEIA 4B08A 4LRBA 4K7BA 3H59A 1Q53A 1U26A 4LFCF 1F9FA 5HBMA 1HMDA 3DGPA 3RRGA 2PGCA 2Z58B 1TQGA 4K4XA 4HHHA 1UTAA 5B0FA 4PQAA 2VBWA 4F0KA 5DZ6A 2DXDA 1Y9OA 2W2NP 1Q95G 5E5NA 2IA0A 3G82A 1YJUA 1OO0B 5F8IA 3IN5A 4X2BA 1ZAVA 3LA0A 3QGIA 3AHPA 3ZNJ1 4PFPA 4RLEA 1V5IB 4DBRA 1HYSB 4KC9A 1VFJA 1HNZF 1FFSB 1X0FA 1B68A 4NZ6A 3Q23A 2DVIA 4A8MP 2YQ3A 4DJ9A 4G1IA 2RKIA 1RKIA 1VLOA 5FD1A 4NA2A 1SV5A 2QLXA 2IM2A 2UXCF 2B6AB 1TWAA 4A8KA 1FTCA 3Q86A 3B29A 2CJYB 4QI2A 1RHJB 2BW2A 3FDSA 5FLXY 2LQGA 4DR7F 3PX0A 4P2XA 5A2QY 3NLCA 2A6MA 2VG7B 1M2VB 3CEXA 2ERRA 4E17A 1ZAWA 5DDOC 4UZBA 1M5OC 1X4HA 1ZU4A 3D1OA 1WF0A 3DM5A 4KPYA 3ADAC 3BN7A 5D92A 4PKDB 2RQKA 4KYZA 3U3BA 2UZAA 3ENWA 2QO3A 2YNHA 3MECB 4B3SF 2L9JA 1QE1B 4NLOA 3RQGA 3OTEA 2ROPA 3VGTA 2J9DA 4F7VA 3K8WA 2AYGA 3DM9B 1VQ7S 1RISA 1XMQJ 3W8IA 2PI4A 2HIQA 3HTKC 4F4YA 1WOSA 1I94F 2FY1A 4QI0A 3CO9A 3W2WA 4LLEA 2F63A 4N77A 4PPZA 3PCVA 2NREA 4LF8J 3NKYA 1O8BA 2D3ZA 3DE9A 2WONB 1N4LA 1EHWA 1UL3A 1RTHA 3X1OA 4CLSA 1LWFB 2GAGC 3NNHA 4N8OA 4LVNP 1JJ2R 1CGME 2JH3A 2KK1A 4D4XA 1EP4B 2HFZA 3ENQA 1XR6A 2HIYA 3D6TB 1J8YF 3PVXA 1R5ID 3T9NA 2KYXA 1OCRC 4LQ9A 4IR1A 1TUGB 2C2RA 1XQIA 2EW9A 1RHQB 2V34A 2LA4A 3IRXB 5J2NA 4CDAA 4DR5J 1VQSA 1G4US 1N5SA 4DR6J 3CB4A 3ZZRA 4P9SA 4GKKJ 1SC1B 4F3QA 4W92B 3UQSA 3UNGC 2EK6A 4RU2A 4NXNF 2EPNA 1YJ7A 1JLFA 3VAIA 2Q79A 2RSQA 3AA8A 2BEFA 4Q7AA 4XQ1A 3CCVS 4KIAA 4OYXA 2KJVA 2VFRA 1ZW3A 1I6JA 2G4BA 5A6JA 2Y1LB 2GAHC 4LF4F 3GJRB 3GYXB 3JAMY 3N28A 2VCCA 2VQEF 4JJGA 5L38A 1AT1B 2GMLA 3CDWA 4YT8A 4PACA 1DTQA 1H2VZ 3MM5B 3KUEA 5F28E 2BJ7A 1HR0J 2XYGB 1RT5A 1FHTA 2WB1D 3TEGA 4ICLA 5KYWA 4N76A 3S7RA 3C8YA 1RP5A 1R27B 2YY3A 4ZP9A 2EC0A 1T11A 2ZH9A 3R8YA 3UN3A 3OTCA 2YWEA 3JSBA 4ZIVA 1VLSA 2FJAB 2OD4A 4UUXA 5KFGA 2KVIA 4HDGA 4E2FB 1AZSB 4HI2A 4CZCA 3GONA 2LCHA 3FEYB 3MEGB 3I0SA 3DXJF 2ABYA 2J8AA 5A6AA 1RAJA 2L3MA 4RBVA 3NMAA 3M8RA 1CPZA 2Y3GA 4NZ0A 4XAKA 2GQQA 4FNHA 3FKBA 2KB2A 4E7SA 5L1KA 3NCPA 2GVDA 2OQMA 3H0PA 3SP1A 2QYCA 3NWRA 4P6QA 4N41A 4DEZA 1RA7A 1S0OA 3T3FA 2AQ4A 1BR2A 2ASDA 1K05A 1BWEA 2QLWA 2J0QD 2W25A 4ECYA 4W8KA 2BBEA 3G4ZA 2LKZA 3J80Y 3SCKE 5L1LA 4CDIA 4DL2A 3D0IE 4CTAB 4J90A 3M32B 2FHOB 1EKRA 2LXFA 5J2MA 1KVKA 3KYJA 4I6AA 4Q43A 2D7SA 4PG4A 1Z1ZA 3RAMA 2NUPA 4QR1A 5KT4A 1OXBA 1HNZJ 2PSZA 4RJVA 3Q7GA 3TZXA 2CNWD 2VC9A 3ZNUA 2C2EA 2YZSA 4JI0F 4ECXA 2VD3A 2CQ2A 1AUEA 1OXKA 4DV1F 3JT1A 1HNXF 3GWCA 1S72S 3MTKA 2ZH7A 5BJRA 2KG0A 4CO2A 4MTPA 5LJ3Y 2KJGA 1SBRA 1U6BA 4I6YA 3US6A 5F5HA 2W7AA 3L7PA 3VVTA 1UEVA 4C4WA 5E3AA 2ZH5A 4NLWA 3EXCX 1EKYA 5J2PA 2L08A 1N6QB 3A8KA 4O3QA 4W4MA 4UTGA 1WTFA 1TL3A 1DY3A 3CIZA 2CWKA 2JFKA 2GHVC 5HLFB 4JTDB 4CS9C 4MVQA 3KWMA 4YT5A 4RW8A 2HNDB 1U1NA 4YJWA 4FXVA 2XMMA 2ZD9A 4U8VA 4OZ1A 4LUBA 3DRPB 2Y1IA 3QAUA 3ZQYA 1QLNA 4B6IA 1HL6A 4X4SA 1HQ2A 3DM2A 2W2QP 3AJ2A 2MGZA 4DS4A 5L3QA 3M8QB 5LJ5Y 3IRWP 2RQCA 2HFOA 1KTVA 1N54B 2JEFA 5KFUA 1M57C 1HW9A 2E5IA 3CD5A 2DPJA 3TUJC 3DOMA 3DLKA 3AD9C 4XLPF 2ZH8A 2VG5B 1PIEA 1R3NA 2IVFB 3PJWA 5KT2A 4DSKA 4EHPA 3CWJA 2Y1RI 4USVA 2NXUA 5KFKA 1HHTP 3BREA 5AXLA 3GODA 3LP0A 4QPXA 2DCLA 4YWQA 3KG1A 1KN6A 2QYGA 2IXNA 1RKCA 3M15A 4OLOA 5KFDA 3QIPB 3WC2A 5LXRA 2CG4A 1WEZA 2M7SA 2VU5A 3TOQA 5L1JA 4RW7A 4UY85 1NG1A 2FC9A 1YYJA 3HHEA 4H4MA 1QVFR 1TKTB 4U9DA 3T4RA 1U0HB 1VQMS 2E5LJ 4DV4J 2WONA 4HFKB 1B0VA 4XTTA 1U1RA 1RJ9A 2IMWP 5B0EA 2ZH3A 3KLEA 3OEOA 1IKWB 1SMYF 3OFEA 4RKUC 2UUAJ 4B3OB 4PJMA 3SV3A 1VHFA 2AWYA 2XMWA 5LSOA 4JB8B 1U1MA 3NRBA 1WC5A 4U7CA 4JBCA 3DD7A 3OA1A 3OW2R 2LFVA 3ITHA 2XLHA 3AG2C 2OH2A 3OHBA 4QCLA 5DVWA 2XG8A 3GILA 1ZZFA 3IHUA 4MVZA 2NR0A 2XY7A 1R8HA 4QZVB 2JHEA 2NQPA 2HFNA 2XMAA 1RKJA 1N88A 2UUWA 4NLYA 4BPMA 5B1AC 3DKAA 3B0VC 1TVRB 2GA7A 3B78A 2WZFA 1WWPA 3HJFA 3PDMP 4MH8A 3BO4A 2KT5A 2VJVA 4OX9J 1NSPA 4NCQA 4R5PB 1S1UA 2DYSC 3ITFA 5IC4B 1HW1A 4LVOP 4MKYA 1VMBA 3OVSA 2ZFHA 3G50A 2Y8YA 3DC2A 3G8QA 3BS9A 4LDKA 1TL7A 2YX1A 5HSPA 3M4XA 2H7BA 2VQFJ 1WTYA 2I38A 3RTVA 2BRLA 4E7ZA 1RADB 5KYWB 4MYUA 3RB0A 1Y10A 2I8EA 4XDCA 1BDJB 2VKZG 3T5KA 1QTNB 3R3TA 2NUHA 4LF7F 5E41A 5CD4H 4CO1A 4LREA 3T1YF 3JCUQ 3V6JA 1AZSA 1CS4A 3U2LA 4NMXA 1JB0C 1NKBA 2W4MA 4JV5F 3H2UB 4NLUA 4O4GB 2ASYA 3C14A 1S7IA 1N34F 3C6TB 2D74B 4K0KJ 5HL7Q 4UOHA 1DLOB 3LALA 1OQ6A 1HNVA 4DL5A 2VCBA 4EFAC 1H2TZ 5A8RA 4C48A 4ID5A 1U2RA 2ASLA 3JTPA 1W2WA 3CPWR 3HK2A 5D78A 2B5JB 1REVA 3UI3A 2MKYA 1YBTA 5BXIA 2F8HA 1GQAA 4TNOA 2X1GA 1WUUA 1REGX 2D4UA 1RDRA 3MF5A 3NCRA 1NKEA 5AC5A 4IYQA 1QSYA 2AMCB 3M6UA 5K8NA 1RT6A 3HSZA 3GV8B 4LRCA 1V3SA 2OPSA 3H98A 2G1DA 2U2FA 1RLDA 2LEAA 3LANA 1GGQA 2YKZA 3JB9k 3RW6A 3RB3A 4DRHB 3AB4B 4ZHRA 3V7OA 1KNYA 4A8SA 3ZDLA 1NU9C 2F7VA 2YX4A 5HMYA 1YTYA 2NUPB 1OPZA 4Z9JA 2ZJQQ 4JV1A 4JURI 4DQPA 1WHVA 3DI6A 1V74B 3K0JA 3V6DA 1PC5A 4U6PA 1HD1A 2QTVA 3S0XA 5C7PA 4U5BE 2KRBA 2IVYA 5F3ZA 4ED3A 2X51A 2Z2YB 3BSCA 3DYAA 3DRRA 5A6WA 4IFVB 1ZM3A 4HH0A 4PG6A 5ETSA 4CLUA 3BN4A 4RBUA 2UV8G 1IKYA 4MIWA 3NMJA 3MPYA 2DJWA 5GPGB 4JYAF 1CJTB 1HARA 2O67A 2HG4A 5KFYA 3FC9A 2DH7A 2MQ8A 1REVB 5FJ4A 3TJAA 2BOPA 2F3JA 1NRKA 2J0XA 3SXMA 4ES3A 1VCTA 1FXRA 1NSAA 3IR5B 3KLFB 3OR1B 3CDBA 4N6HA 1KQSR 4OJHA 3EDQB 2OJQA 2QA4G 3H65A 2VA2A 3GJSB 4E98A 4BDPA 4CLTA 1YQHA 4PPDA 4Z9HA 3POVA 2J0SD 1VQ6S 3U0CA 3QZ8A 5HANA 1HMVB 1WHYA 2AV5A 2DNNA 3CULA 3GYNA 4HVZA 2DHSA 3DM2B 1SKUB 3CJ8A 2XMVA 1ZHTA 4ZJOA 2HHWA 5L8RC 5KYYA 4JI1F 2XO7A 5DG8A 2H3EB 1CJVB 3MGJA 1WKKA 3RIPA 2YKOA 4TN2A 1LW0B 3MPWA 1WG4A 3GG0A 3LP1A 3VQSA 3GFHA 4E0IA 2P6TA 3AY0A 2RE1A 1YA9A 3J81j 1ZZPA 2QY9A 4M94A 4MNDA 2AWCA 4DBQA 2CPFA 3M9MB 1ZZNA 1MROB 4USMA 3O39A 4DV7J 3LW5C 1UPPA 1R31A 6FDRA 1RHKB 3W4YA 3TUZC 3WC0A 2ZUAA 1IM4A 1WNEA 4LF1A 1NCLA 4ZN3A 3FMSA 1R7IA 5G0RB 3QGGA 4C0HA 3IBFB 1HI8A 1KVJA 3Q8UA 1VIXA 3IPMO 4P2SA 4QIEA 2RRNA 2KW3C 2XLVA 2R7TA 3DOLB 3VTIA 2F5GA 2B9YA 2UVVA 5IV3A 2YKMA 3NWGA 1UEKA 3CJ4A 3NOCA 4PJJA 2ZDOA 1L3UA 5JS5A 3CD6S 2E7WA 3DLHA 1UW4A 3HCXA 1CQNA 2KYHA 2OFHX 1TFWA 1KOHA 1CG2A 4CX9A 2D1CA 5AXMA 5GAGI 1TELA 1TUWA 4DX5A 3M6XA 1FFGB 3KJNB 4AQYJ 5E3CA 3W5XA 3M4BA 2O5DA 2KKHA 4LFBJ 1Y4ZB 4ECUA 3QZ7A 3ENVA 2NSCA 2V68A 3MR7A 4YN0B 2V4QA 4LIWA 4OYPA 4RL1A 5DM7Q 5CXTA 2FLOA 2JX2A 4KC5A 4RWXA 3T5HA 1HQEB 5ETVA 4FYVB 4IG3A 2CNWA 1ITPA 3MR6A 1S0MA 3QBCA 1CGNA 2CW0F 3ISNC 3K89A 1KU2A 1WC6A 2AJ0A 3SXLA 4WP9A 5CYMA 2IY5B 5B09A 3CCUS 3DMDA 4XWJA 1U0SA 2R2SA 3DOLA 3H4DA 5K9FA 2E9TA 3Q8PB 4WJ0A 1U7LA 4Z9IA 1N36J 3RGIA 3ETOA 2C2DA 4WYWA 4J30B 4PUOB 3HVTB 1P1LA 3M7VA 1HHQA 2JOQA 4OYWA 2HFVA 3MWBA 2CNNB 4DR2J 2CA9A 5BR8F 2AX0A 1Y7PA 1C1CB 1IN0A 3RBEA 1RABB 3PRDA 5LXYA 2MMYA 4ONSA 3KKFA 4CLZA 2Y39A 3R1HA 4RW6A 2OHDA 4DSJA 2P9EA 4NLRA 4Z2XA 3W5ZA 1LE2A 5D4PA 2KH9A 1C0TA 1I1GA 1JJCB 1QVGR 2PX0A 1F2HA 3PO5A 2QX0A 3IRXA 2Y3YA 2XM0A 4A48A 3WHIA 3PJ9A 4GQHA 1K1QA 1IWAA 3OSPA 3JSRA 3SCJE 3HX9A 5C24A 2YLDA 2OPQB 1ZBTA 2W01A 4OZ0A 3VGUA 4Q5SF 5BUOA 3L1MA 3IMQJ 2EILC 2DNRA 3D1QA 4L3KA 2R7VA 1YWXA 2ROEA 4DPXA 4WK3A 3G4SS 4CRJA 1WG5A 2AHOB 4MKAA 1WF1A 3JTOA 2PDAA 4JC7A 4K5SA 4G0HA 5IV4A 4IOAQ 3LP0B 4P10A 5BYRA 4FAPB 3OVAA 3ETMA 4CIPA 1Q0NA 3GIMA 2J9CA 1LVKA 3PFEA 4KNWA 1LV5A 1FD2A 2FJEB 2LSEA 4D3GA 5CCMA 3UCUP 2VASA 3LGNA 2OMOA 3WG7C 3QLHB 1N33F 2HS5A 2PEBA 5C5JA 4ZPWR 1BQNA 4HTJA 3SMZA 4ANJA 2VCAA 1KEKA 2DGVA 3K59A 4O44A 3UD5A 2E5JA 2YTCA 3LH2S 2HK3A 1S5ZA 2MYSA 1EA8A 4GVLA 4H4OA 2DGUA 4Q8EA 3CQZA 2J8SA 3FCVA 3HNIA 2BQUA 3HHLB 5B0DA 2ZC3A 2XSJA 1JLGB 2OGUA 3K57A 1O6XA 4WF9Q 3OR2B 1FK9A 2RAQA 4GRSA 2CPZA 1H74A 3O5TB 4J91A 5B0BA 1RXQA 3Q89A 1YVIA 2DHHA 4IOBA 4UT4A 4OZJA 2HPUA 4I0WA 1WG1A 1L5UA 3QO9B 3EGZA 2KM8C 5T41A 3FBEA 3MEKA 4DSIA 1HWJA 2K3KA 1KOOA 4FX5A 2HHUA 3M32A 1Y6DA 3SSSA 1S79A 5K14B 3EG9A 2YNIA 4IB4A 5DG7A 3R5DA 3SFGA 3LEVA 3PHTA 3R7CA 3GM1A 4PXCA 4PG8A 3KLHA 1JLCB 2QL5B 4P2MA 2MQQA 3IBWA 1QJHA 1LWFA 4USUA 3LUYA 1EQMA 4RDAA 1H7WA 3QWPA 4U96A 2FY8A 2WVEA 2XS8A 3BR9A 1RTDA 1IKXB 3TAMB 5GADI 3C6UB 2M70A 2CQIA 4JZAA 4UQGA 1VJWA 2YL7A 4URSA 4ZPTR 1OSDA 1GK8A 4C2MA 5M2RA 1WEYA 5K20B 2HGMA 4BJ1A 2H4YB 2ZOGA 2ZH2A 3HNKA 3HHLA 2N4CA 1W26A 4BHQA 3GSDA 4AXIA 1K40A 1FA0A 1WSVA 2B0HA 1EETA 4TQSA 4PXEA 3DHXA 4HKQA 1S9GB 4CLPA 2WVQA 4DV6F 3NGKA 5J2QB 3OTOJ 4DFMA 3B0UX 1EQ1A 4ED2A 1S1TA 4F04B 4DL6A 5B08A 2QC3A 4MIAA 2ZBPA 4HACA 3HZGA 3QPIA 2NPFA 3RUBL 1TKZA 1GXTA 3KDNA 1SC4B 1BGXT 4JI2J 2A3JA 2LFDA 4HHUA 4BEMJ 2VPZB 5EHHA 1FR0A 1K47A 4KH0B 4I56A 2IJRA 1K0TA 2UXBF 3VGSA 5F5FA 4M5DA 2OO4A 2WVBA 1BQMB 3BSNA 5AJ3F 2GZOA 2JC1A 3G8SA 3T6BA 4U5DE 4I1TA 4C3DA 2F8MA 1M6TA 2DHGA 2YKNB 4LBIA 3FOOA 1BQXA 1MMDA 1YA7O 1PBAA 3BH7B 1L3TA 5HAOA 5A76A 3RZAA 3GWNA 4O0NA 4ZCMA 1VLTA 2P6VA 3MYIA 1SQGA 2GHWA 2CIMA 2HMZA 2V8VA 1G3OA 2YQ0A 2HHVA 2VDIA 4DL4A 4OYAA 1HI1A 5DRKA 3EPGA 4RW9B 1KLMA 1X7VA 1FVSA 5LM7E 4TVAB 1F5BA 2YL3A 1HI0P 1S9GA 2PMZD 1H98A 4I1MA 3ONQA 3HSGA 4RBNA 1R6YA 2B9XA 3TA2A 3IAS9 3BRJA 2YWFA 5IWAF 3AOAA 4NRUA 3IGNA 3I4PA 1PV3A 1KS2A 1OW7A 3HLZA 4FVCA 3B71A 3HXMA 4DPUA 5KFZA 2FJWA 1IVZA 3NGDA 5CH7B 4OX6A 4ECSA 2J8WA 3AT1B 3Q7LA 1VBKA 2VV5A 4M5DB 2HMIA 1FI4A 4ZMMA 2VB6A 2OD6A 2R8GA 4BCAA 1DOWA 5HI7A 4O0IA 5D0RA 1Q8KA 3TJ6A 2YH0A 2VHGA 2QMUB 3DRSB 1J8MF 1D9FA 4CO0A 1DURA 3GORA 3I82A 4DV3J 1FNMA 4IJJA 1P1TA 1ZW2A 1O87A 1YJVA 4KHRA 4JV2A 2OPQA 3BF4A 3DDIA 1X8DA 3KXDA 4WTOB 5KFTA 2XS1A 1ZM4A 2IM1A 4M8LA 1LW0A 5DS5A 4FWVA 4DS5A 4WU3A 3GSIA 4LF4J 3AODA 2X1AA 1KLMB 4ER9A 5KFHA 2XZWA 5K0IA 4OV1A 4KHPF 2CQ4A 1TL7B 3OL8A 3OWTA 2ZH1A 5D4LA 3KHHA 3KLVA 2RDIA 4YR0A 1FNXH 4B3TJ 4GKKF 2RU3A 1YITS 3PYEA 3ZZPA 1FJEB 1TUVA 2XMTA 1N0UA 3PW7A 3AAWB 3AG4C 3TZZA 2A2DA 2PF4E 3QT6A 1JRAA 4F4WA 2FIUA 2G2YA 3IR6B 4N8NA 4DX6A 4DSLA 4RO0A 4OYMA 1VI7A 1TAUA 1VBXA 2DR7A 1S12A 1TK8A 2CNOB 5LMUJ 5I42B 1X5TA 3M79A 2XSEA 4M5LA 1RBLA 3P4UB 3JSEO 3CD0A 3C6TA 4QBUA 4DVZA 5SZTA 4QU6A 2DR6A 2IM0A 1WORA 1Y00A 2PEHA 4ZPBA 5T3WA 5GAHI 4ZJQA 1WEXA 2AU5A 2BE2B 3DLEB 2B4VA 1QVXA 1VB5A 3GIRA 2IXPA 4TYBA 1H7XA 4CSAC 3OTBA 2R2RA 3BQ1A 3S1TA 4CJOA 4CBEA 4C7OB 3OR2A 3KPHA 2J7UA 1TFYA 4WBFA 4DRIB 5KFOA 3KNAA 1NLKL 2MQLA 1OY8A 5J1EA 1KP6A 3QIPA 2LEBA 3M2VA 4O3OA 2H7VC 1RWOB 1XC9A 1CGOA 4DZ6A 1G4CA 1OCZC 2AJQA 2HUJA 1RT4A 5L9XA 4TLRA 1BE4A 5E3PA 2H48B 4XIUA 3NYLA 2FJDB 4YT4A 4Y6IA 2XO6A 2C2OB 4K0KF 5C2CA 4PQUB 3CEDA 5D0GA 3A8JA 3RBXA 3J7Z5 3BO2A 3NGSA 1QQ3A 3PRBA 3VWSA 2QEXS 4AL5A 1S1WA 4LF2A 1WD6A 1F9HA 2A6HF 4YL3A 3MOZA 2NYHA 3PG9A 4WP8A 3OT9A 3CMAS 3RG6A 1VRQC 1UFKA 4A4AA 1RWVB 4X4PA 2J6UA 2D9OA 1KHVA 3O55A 2ZBIA 4YDXA 3AQBA 3HZEA 2GO9A 2WTFA 2ROGA 7FD1A 2OPRB 2K3IA 4V19X 4PJLA 3R5AA 2YKPA 1VK5A 1VOMA 2CPJA 4KH1B 3W8HA 1V54C 4LMZA 4GVBA 1I4YA 3EZHA 2DI3A 2VH7A 1B99A 2EWHA 1J27A 1BLUA 2MZTA 2I8BA 3BYRA 2RRBA 3VYWA 2Z2MA 4OJ1A 3UDVA 3WX4A 3IGVA 2FHJA 4F4KA 5HO4A 2LD6A 2HNYA 2E9ZA 1ZYRF 4X4NA 5KOWA 1VQ8S 5KFQA 1PSDA 3EGNA 4DR7J 5D0HA 1NU4A 1MMNA 3TYTA 5HSWA 4P7TA 4J9OA 1S99A 5FZTA 3GANA 4I64A 4U67Q 1C17M 1XK8A 2KQ9A 4FF4A 4KJIA 2FGYA 3TI0A 1GTEA 1M5VC 4I2PB 2UUAF 2XWXA 1MMLA 5AXKA 4JKVA 1BQNB 1S48A 4C8OA 1VRUA 1NFOA 4ERDA 4ZCLA 4FN5A 3M6VA 5DZ7A 4Y2MA 4J9LA 4X0RA 3CJ0A 3FBFA 2JEIA 3D7SB 3UN2A 4EBEA 1W2IA 4P71A 3EGVA 4LFCJ 3K17A 4KGMA 4ID5B 1Z5ZA 4RPFA 4CLYA 2FHMA 4JCHA 2Q7RA 1W7WA 4PWDA 3DHWC 2J6TA 2K7JA 3EGDA 2HNZA 3UGOA 3T19A 1HNWF 1WACA 4S0MA 4MVSA 3VAHA 4K4TA 3CJ5A 1WC3A 1H72C 3G6ES 4X84A 1S6PB 1YRTA 2VF3A 4QYZJ 5E3QA 1U6HA 1RT5B 3SYZA 3DI6B 3Q2TC 4OIPF 2WOMA 3SIPB 2Z57B 3UO0A 3M1CB 3SZ2A 5L0DA 5JUAA 3SEOA 1NPRA 2H4WB 1JXEA 5AXNA 2FQQB 2V2ZA 3P96A 4WCEQ 3DYAB 2K1RA 3MAHA 1XJWB 4W8PA 4EBDA 4DV1J 2IBKA 4EGLA 5F3TA 2XSFA 3V81B 2GVZB 2V0NA 1F60B 1FNOA 4LSLB 2RNEA 4LR8A 5I3UA 4DV2J 1ELOA 2YKAA 3G71S 3T5JA 3EWGA 3CMES 1Q79A 4LSNA 2JX0A 4DXWA 1V6HA 3W63A 2BM0A 1BR4A 1HBOA 2VG6B 2YNHB 4DHVA 3G6YA 1RHRB 1QE1A 5RUBA 1YK9A 4RR5A 2AJFE 4Y2IA 1N52B 3M6WA 3C16A 1Y0HA 4OHXA 4KI2A 2J5AA 2IMOA 3KK2B 1EIYB 2E87A 2GAQA 2EBEA 3J81Y 2GHPA 4FXWA 2E29A 1R0BG 2AJ1A 3AJ1A 5KFRA 4R32A 4WPAA 2R8KA 2MZSA 3WX8A 4C3LA 3G86A 3RR7A 1D0XA 1YYXA 3L0IA 3IR7B 3T1HF 2WZLA 4LRDA 4NLXA 3MD3A 1WELA 3ISZA 3VM6A 2B3TB 5ITHA 4C8LA 1EI7A 4CIHA 2ZVSA 5E0OA 2AWZA 5D4OA 4ZVSB 4NLTA 1RHMB 2H8AA 2RDDA 3TA0A 4RNMA 1FKAF 1HKAA 1WSRA 1ZVZA 1XNRF 1SJQA 3GEEA 1P8GA 4PXBA 4PG5A 2NCKL 4K4WA 3K5PA 2XLMA 2DO0A 5ETLA 5HVFA 4O6NA 1KSPA 4O79A 1MU2B 1W2BR 3MM7A 2N7CA 4XPEA 4EBCA 2POKA 5L0HA 2RQ4A 2QL7B 1XEZA 2L6HA 5KAKA 1YBAA 1S6QB 1LM3B 3L7OA 3C8GB 3MHYA 4P7VA 3O8WA 2M52A 3GE9A 1A9NB 3AJDA 3VGVA 4H4KA 1Q1KA 2NXJA 2UVUA 4CSAA 1YG0A 3UVJA 3KK1A 2UUHA 5DLGA 3KK2A 2JVRA 3OFGA 2HZAA 3GJTB 3Q8QB 1TWHA 1CS4B 5GADU 4KQZA 1S05A 3I6PA 1EX8A 5B0AA 3EFOA 3H90A 5KYXA 4XTKA 3HDSA 2CXEA 3RVYA 4DPWA 3GZ7A 3R9LA 5D3GB 4JYAJ 1LW2B 2AW0A 4ZLLA 4CDYA 3CCES 5KFWA 3DLKB 3L4BC 3GIIA 3FMBA 3M8PA 1ZH5A 3SXKA 1FXDA 4OL8A 2LQBA 2CPYA 4ZVUB 4FP9A 4O7GA 1FERA 3UMHA 4X65J 3RBDA 2R7WA 2G3VA 3UR3C 2XZDB 4W98A 1G6BA 3H8YA 2D3OR 4X4QA 1SZIA 2ZBCA 1CULB 2J9UA 3T41A 6AT1B 4IFYB 1DTTA 4HEAJ 1U6FA 2XYPB 3O10A 3CC7S 2RH3A 4YEAA 4EBJA 4EYHB 1XN9A 2DEJA 2N4DA 1VQ5S 1U49A 256BA 4QW9A 4H54A 1SH0A 5AE3A 3I31A 5HMXA 5IS2A 2QMWA 1FFWB 4DL3A 1SJ3P 4IO9Q 4CT8A 4GYTA 2J7KA 3QT8A 3KLEB 5L3VA 5B3SC 5IQ6A 4O4RA 1VHIA 3B4MA 4IQMA 1Z4UA 2HKVA 2CAJA 3RJMB 3U2MA 3SQOP 4KNVA 4CQ1A 2LCWA 3BBFA 3GEHA 5K8MA 3VF0A 2ZD1A 2B4PA 3RW7A 1XMQF 4PFOA 1JXLA 4B3RJ 4DDFA 4USJC 1JPNA 4RU9A 3CCJS 3HKKA 3W9HA 3R6LB 4IH6A 3T6JA 2MJUA 4ETZA 4C8YA 4CTAA 3NMKA 2ZE2B 2XCPA 3PRVA 1F1MA 2DB1A 3OD2A 1S0VA 2XLDA 1SCJB 2L9DA 4J9SA 3GQCA 4PZVA 5M2UA 2QNLA 4ZCKA 1RCPA 3MEEB 4IH7A 4NLPA 5F8JA 5H9FJ 3OTDA 1FDAA 4I67A 4QWCA 2MLYA 4L76A 3THTA 1PG5B 3RQEA 1YI2S 2UXCJ 1LFWA 4B3RF 3CTRA 1CJVA 4YR3A 2BQRA 8AT1B 3PMRA 5KG2A 1NMEB 3GU0A 4BS2A 2EG2A 4DV4F 4DOZA 2KXHA 1VS3A 2J7PA 3OUYB 1HWUA 1A0OB 1HBNB 2V67A 4A8WA 3UDLA 3PW4A 3KMSA 1L7CA 3JSMA 1MW7A 5K8OA 3U5SA 1S59A 2HFUA 1TK5A 2FGOA 2DNGA 2ILYA 1BC6A 2CPXA 4OYZA 1UVNA 1OMSA 2GVZA 4LSZB 1XMOJ 1PILA 4EKWA 4X64F 1X5PA 4EK2A 3VR1A 3VHQA 4DX7A 2M88A 1MQVA 4P73A 3BKUA 1DJ0A 2P5VA 1YVFA 4B3MF 3ZC4A 2DNZA 5JVGQ 1XIQA 4YQWA 1U1QA 1V3ZA 4M5KA 3DJNB 3IG1A 4MK9A 2H51B 2P6SA 2X3DA 2FZGB 2C03A 1Y5LB 2B5JA 4F4AA 4OIOF 3NS5A 2GNKA 3JTLO 4JP8A 4MAKA 3A13A 1DTQB 2QE9A 1DQ8A 5CYQA 3BDEA 5HP1A 2DR9A 3FCHA 1T9TA 3U1NA 2UVRA 1T02A 2H65B 1OS5A 1KD1T 3DRYA 3WDOA 2WBMA 3A12A 4Q7CA 1FFHA 1O3UA 4J9RA 2HS3A 2CYDA 3Q8SB 3K5LA 4K8RA 3TRGA 2KYZA 2IM8A 1RAIB 1HBUB 4CLFA 2UVWA 2HK2A 2RHQB 4MFBB 2GMJA 2NS1B 3KH2A 4AFFA 2WL8A 4C8NA 4DQIA 1HBNA 1G2EA 1MWQA 2DH9A 2FHJD 4LF9F 3CNQP 4BJ6C 3Q22A 4LF9J 5KG4A 4RUAA 2GQ2A 3JYYA 5L0FA 3ZZ0A 4LFAJ 2QSFA 2KC3A 4KV8A 2BJEA 2V5HG 3KG4A 5THWA 1SIWB 2ZH4A 5FDLA 1Z2ZA 1RUSA 2LECA 3C6UA 1RAGB 4DF4A 3BDPA 2XCAA 1JLQA 4JEBA 3AOCA 3LWMA 4AL6A 4J9PA 1YHQS 2R8JA 4DV0J 3RFYA 2H1YA 2BKNA 1FJCA 4B02A 3K33A 2ILZA 3HNJA 3EGXB 3HFVA 4P75A 4M5NA 1A7VA 3A11A 2NXCA 2IC3B 3CCWA 3R2PA 4FF1A 2V26A 4MT1A 3EJMA 1AXQA 3POTA 3QTHA 4O3PA 2EIJC 2UXBJ 3LGMA 4MK7A 4X64J 3BEHA 2JJ4D 1UEUA 3OLAA 3TP2A 1J5EF 2LQ5A 4QWDA 2R2UA 1MSWD 4GKJJ 2G62A 3TWZA 2I5JA 1Z2LA 2EEYA 2YNGA 1N32J 4EUVA 1SC3B 2RU9A 3LGHA 2Q6CA 1N5TA 4E18A 1ACMB 3E8OA 3HVWA 4IGGA 3QATA 3VVUA 4F2RA 1RWXB 3AXMA 2MLZA 4FESA 4OHZA 1GMUA 3FNNA 3MLGA 1SKRA 1DZ5A 2ZHOA 1GXUA 2XC9A 4DV2F 3R2DJ 3SZRA 3C15B 4QWBA 3FSXA 5IWAJ 4C6AA 2IHR1 3BEGB 1SB6A 4K5RA 4L75A 4NCAA 3CCZA 2HQDA 3QMKA 3C14B 4LBPA 3EPVA 3MR2A 1WC0A 4WK1A 5J2NB 2APOA 4CWBA 1HNVB 4DUTA 3V6KA 3M8ZA 2NZ4A 1BY9A 4LSLA 3IWXA 1NSQA 2HQGA 2XTJP 4EMDA 2IRUA 4J9UE 1YZAA 1FNTc 3E51A 1PYOB 1IXKA 4I4BA 2HNDA 3EXYA 2OEXA 5FCLA 3TEHB 4NEZA 4C98A 2J46A 2NPUA 2I5JB 4YL1A 1NK7A 1HNWJ 3GP9A 2R9LA 5JLIA 4HH1A 4KR0B 1FDNA 2PE8A 2CRLA 2XI2A 2L41A 4DR4F 5D77A 1N5YB 1K8AT 5HBMB 4ICLB 3R2CJ 4DL7A 3DRSA 3EZUA 1EJ7L 1B0TA 2A6EF 1NH8A 4LJMA 2RQMA 2LDIA 3J7YU 2GJIA 2KL8A 2VG5A 4UW2A 3W60A 3MM6A 2OPRA 3R7SB 1P6TA 4JTCB 2MKSA 3B4DA 4ZPAA 2IJNA 1TV6A 2Q3TA 2FJVA 2UUBF 3NG1A 2ALYB 4YMEA 2XXAB 2CCYA 3OTOF 1LIHA 1TKTA 2E7VA 3CJ3A 2LQ8A 1HR0F 4WFBQ 2HKEA 3H42A 4DSFA 4ZPDA 5JVHQ 4BWJA 4JIOA 3U8PA 4YL0A 2YHSA 4P74A 2CQPA 1N33J 2Y69C 3FOPA 2VG7A 1KFSA 2XY5A 2FD2A 4CS8C 2QUPA 4Q2LA 1A7DA 5LMNJ 3P3DA 1SIZA 2MQNA 4X66J 2B8PA 3M8YA 1NXIA 3Q8VA 2CQ1A 5J1NA 4JOUA 2P2CB 3VRCA 2L9NA 3GG1A 2CVEA 4XPCA 3MMAB 2R8HA 2RUSA 2ATLA 1NAQA 3SDEB 5DGBA 4JCZA 2YNFA 2IXMA 2WHOA 5J2MB 2MDAA 2RILA 3UPFA 2LFFA 1EETB 1K44A 4HFFB 4DV5F 1VR6A 4RUCA 3DLEA 3DLGB 5KFNA 1UVMA 3CJ2A 1U48A 1P9YA 3NBPA 1ZPWX 1JR8A 2G3KA 2G13A 2VBXA 3R1LA 1LS1A 2W9CA 2LYVA 3U9JA 2BACA 2K7KA 1ZHYA 3PKMA 1UKUA 2AP3A 3W2VB 5B0CA 5JMNA 3HSJA 4OINF 3PYGA 1T5OA 4IAQA 3DU6A 5T7LB 2RVJA 4LERA 3KK3B 1U1LA 1FWLA 1JXVA 4YS2A 3NGUA 3ILLA 3KTQA 3A3NB 2UP1A 1C2PA 5GAGU 4CH7A 4DX8H 1VRTB 1NHUA 2WRMA 5IQQA 4F4ZA 2C28A 4ECQA 4OD5A 2VUGA 1T6UA 2DCUB 3MCSA 1RCXB 3TZWA 4A8QA 1PCAA 3W61A 1H6GA 1A7GE 4KAIA 2CFXA 5A6BA 3EYZA 2IDLA 5AE2A 3RAXA 1WI6A 4NZ7A 3TOLA 4IG0A 4YDDB 2AYMA 1YAUO 2KSFA 2IAJB 4ED8A 4IOCQ 2VBZA 3JSZA 5I3UB 4IUFA 2HBYB 4C3KA 2XNQA 3UE2A 2PNOA 4K4SA 2Z2ZA 4JI4F 4U5HA 5FLXU 3TX8A 4ZVQB 2N3OA 4ZA1A 1VK3A 3AXKA 2D41A 1DRZA 3K6BA 3MM9A 2K8GA 1AROP 2ZWPA 2LVWA 4QR0A 2PT0A 2J45A 1AUDA 1OKKA 2XI3A 2FJXA 5F8GA 4FYYB 5HQLA 2LLZA 1XNQJ 4MTOA 2YVSA 4ECWA 4JI8J 1QTMA 3V4MA 4PRFA 5L0CA 1ZS6A 1UFBA 1VLYA 2NXEA 1N5VA 2KHCA 3A8IA 5E3RA 4DPTA 4C8KA 4RNFA 2BJ9A 1OY9A 4U7UK 5L0JA 3EVWA 2MQOA 3H2VE 4IRCA 3TAQA 3BJYA 1D3WA 4DR1J 4F0HA 2HFSA 4P6IC 2W9BA 1FKOA 3V6DB 1YJGA 2JLGA 2CZVC 3N4WA 5DS4A 2OOCA 4NYOA 2GIFA 3AD8C 4G78A 2XNRA 3G6XA 1E6YB 2VBYA 1JNZB 2IXOA 4LLCA 2ZOFA 1IKYB 3JAMU 2YLGA 2DR5A 1IBCB 1Q16B 2NSGA 3QQCD 4OI4A 3ITHB 3PKYA 3OFHA 1K9MT 3FAPB 4C7QA 2WBRA 4QDLA 3JTNA 3CIMA 4TY8B 1DOVA 5JJBA 3QZCA 1RKEA 1ZHXA 4WFXA 2KVQE 1F3VA 3GFYA 2DIUA 3UWTA 3LP2B 3C63A 5D91A 2BZ2A 4YB1P 4CDVA 4KTQA 2GJFA 4YT2A 2M5YA 1H9GA 1KDNA 2R4FA 3I96A 4F0MA 4HT7A 1S1XA 4CNYA 5KG1A 3PO4A 4UUWA 2MZJA 1RT2A 2EG1A 3BM7A 5ETTA 2CQ3A 3GCWP 5E33A 4MIBA 1L3VA 1KR4A 2N3LA 4J7CA 2CQCA 1PAEX 2AX1A 1V55C 2CGEA 2YLIA 2W9BB 2IYIA 3QWUA 1FRHA 5JSLA 4JI0J 2BE2A 3GM3A 4K7QA 1U09A 4WFAQ 4J9NA 3GTYX 1QY7A 2X1BA 3C3LA 4WZMA 1FJGJ 5A6KA 1P27B 2NLWA 4WP3A 2CPEA 1IR2A 3U02A 3M2UB 1OW8A 4BC9A 4KE5A 3NGTA 4FYXB 3VZHA 4BG0A 2DGSA 4IFYA 3JYHA 2XM3A 2MHEA 2HLUA 2FYXA 1ZPVA 4I2QA 5KFSA 3DOKB 1P9QC 2VPWB 1FAPB 4YY3J 2EIMC 3FZBA 4OIRF 1YJRA 1S7ZA 5B3IA 4KGVB 5AT1B 2P9CA 4DWIA 1U8WA 1LEOA 1RAFB
chains in the Genus database with same CATH topology
4GKJF 1H98A 4RW8B 4I1MA 3ONQA 2RMLA 5FDLB 5KFFA 1K73T 4ITSA 1M5HA 4RBNA 4M63A 4L6V3 2HQIA 4PUOA 1CVJA 1R6YA 1XR7A 2B9XA 1UETA 4KBIA 3TA2A 2ZITA 2W9AA 1SL2A 3IAS9 4HI1A 4ALZA 2YWFA 5IWAF 3G96A 1ZM9A 4CS7A 2XS7A 3MXHP 1Q4RA 4NRUA 5KG3A 2XLJA 1MWYA 3IGNA 3I4PA 4FNIA 2VOOA 1KS2A 3EQLF 3HLZA 4FVCA 3UMKA 1G8XA 1D8ZA 4WFYA 4A47A 5KFZA 3VF0B 3HXMA 2FJWA 3NGDA 5KFAA 2HWHA 5GMKa 1KNZA 2K2PA 5CH7B 4OX6A 4ECSA 3PFOA 4IDKB 1Z6AA 2GFFA 4F67A 3J7YI 3OV7A 5DO2A 3BQ0A 4BJ5C 4URGA 2H7OA 3QO9A 1HW8A 2MSTA 3Q7LA 1J5OB 2KDOA 3I87A 2VV5A 4WKYA 4M5DB 2HMIA 3VAJA 5CZXA 3O1LA 3HHNB 4ZMMA 2QSWA 2VB6A 2YX7A 2OD6A 4ZHRB 3PEHA 5KFCA 5T14A 1S9FA 4WE1A 4RZRA 3KJVA 4BCAA 2R8GA 5D6GA 5HI7A 4O0IA 3MECA 3H5XA 2U1AA 2PMHA 2ZXOA 5I42A 3UCZP 2YH0A 5GAEU 2LA6A 3OFFA 2HHSA 3AG1C 1J8MF 3DRSB 3IS9A 4QJVA 1JPJA 2MKCA 4X62F 4YB5A 1DQAA 4Y00A 1HBMA 1D9FA 2ACYA 1DURA 3M2UA 4CO0A 4EZ6A 1RYRA 4TYAA 3I82A 3KYLA 4G3IA 4EEYA 4YUDA 2Y1JA 1NNDA 3IS9B 4RD9A 1FTRA 1FNMA 4IJJA 1Q82T 1P1TA 1D0EA 2G0CA 4XO0A 1YJNS 1O87A 3BGRA 1YJVA 2VONA 4KHRA 1SC6A 2DR8A 4CIOA 4N06A 2QV6A 2L81A 2Z15A 3FJ2A 4JV2A 2OPQA 1S6UA 3BF4A 4I7FA 1QZXA 1X8DA 2KT2A 1WWHA 2E1RA 4LFAF 2DGOA 5KFTA 1ZM4A 3G8TA 2IM1A 4M8LA 1LW0A 5DS5A 4FWVA 2HHTA 3DOKA 1C4CA 4LACB 3IXQA 4TXSA 4WU3A 1D1AA 3S01A 4F26A 4ZCIA 2O66A 5F9NA 3DCAA 3SI8A 2X1AA 3NL0A 1KLMB 4ATNA 1D0ZA 3NKDA 4ZDNA 3PHF2 3KFWX 4PJNA 2EFVA 1LOUA 2JRSA 5KFHA 4X4TA 2XZWA 4OV1A 4Q8FA 2FLLA 5H1SV 3D28A 4KHPF 1BD6A 1MU2A 1XBWA 3D1HA 2DNPA 2CQ4A 1NJIT 3OL8A 2PIIA 3OWTA 3D54A 2ZH1A 3TD7A 2N7YA 5D4LA 4DFJA 1XR5A 3KHHA 3KLVA 4RUHA 2RDIA 4YR0A 1FNXH 4A8FA 4J32B 2GGPA 4B3OA 3SYNA 4GKKF 2DHAA 3T9ZA 3H20A 1S6QA 2RU3A 2UU9F 3KK1B 4L72B 3KHRA 4GC6A 1YITS 1T8EA