3ZC4A

The structure of csa5 from sulfolobus solfataricus.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
157
Chain Sequence
PVAETISKRFWTLIKMLRFYVVLRRFGYIDPLIYSIDPKQIKDVLSEALREFVSYTSSSSSRSIVIYDDPKNPVTAQAPCLVVAKRDEIPQNFPSIYRYTIYKIDKSSEYCISPLVVNDKYATLITPNESVIKEFFDKLDSNIQYARVLASLAVGGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Archaeal Cascade Subunit Csa5: Relating the Small Subunits of Crispr Effector Complexes.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Immune system
molecule keywords SSO1398
total genus 52
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2012-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3zc4A01
3.30.70.2780 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3zc4A02
3ZC4A
chains in the Genus database with same CATH superfamily
5H9EK 3POTB 1OPIA 4CO5A 1UFBA 1MMNA 4IOBA 3RG6A 2FHMA 1FK9B 3WIUA 3QW1A 2IFXA 5HL7Q 1B7YB 4KGVB 4EHPA 4JI5F 1GMVA 2MLZA 3GR1A 4K59A 4ZVEA 4ZVOB 4A8FA 1PBAA 1FNXH 2JOQA 5JRAA 3QATA 1N88A 3G6YA 4JI4J 3KLFA 1VC6A 2MGZB 2MPUA 5CABA 4K7QA 3CJ3A 1Q0DA 3AH6A 1LK7A 1JLCB 4J9SA 1IKWA 1KD1T 5KFYA 1TELA 2KRRA 1VC0A 1TU0B 1JLFB 2BKNA 4U5HA 2FVRA 4CRJA 2RUSA 4WBFA 2MMYA 1BR4A 3GB0A 5JVGQ 1TK5A 4C0OC 1R8BA 4NZ0A 2IY5B 1NPRA 1FD8A 5KFZA 2J0XA 4Q2MA 3IRXA 2XS5A 2WBRA 4O3OA 1NCLA 4UT4A 1ZM3A 3QW0A 2GO8A 3NKEA 2BJDA 1U0HB 3BH7B 1V55C 3MLGA 1Z7Qc 4NLDA 5CYQB 4MTPA 2ZZTA 1KC8T 1T9YA 3GORA 2OPPB 1LI7A 5E3AA 1EETB 2PSZA 4QR2A 5CAAA 3LALA 2UXBF 2FC9A 3B9QA 2RRNA 3EGXA 2C3OA 2B5JB 2M2BA 4A46A 2KH9A 4G7HF 2HQDA 2YLIA 2PMHA 4WPAA 2XS1A 2JD3A 1LW0A 4KNVA 1LKXA 1SJ1A 4ZVTB 1L3SA 3KTQA 5H1SV 1QVXA 4BWJA 2MZTA 1GMWA 4QIWD 5GAEU 1NDPA 1N8RT 1W2WA 5BYSA 4RW7B 3K5PA 3F73A 3TRGA 2O9XA 3UI3A 1SPBP 2M8DB 4GYTA 1WC5A 3IR7B 4J7CA 4N47A 3PZPA 4DR4J 1ZAWA 1Z6AA 3MEGB 5GMDA 2CNLB 2P6TA 5AE1A 1HI8A 5L0DA 1RTHB 1CJKA 1ROFA 5B09A 3T9OA 3SV3A 4NTBA 2FD2A 1SV5B 2V26A 1U6HA 5EWGA 1R3NA 2JEIA 2ZH8A 2OUGA 4X66J 2RMLA 3CZ6A 2EPLX 2DT9A 4URQU 1KNYA 4JYAF 2LCHA 4DV4F 1REGX 3DRPB 5COFA 1TKNA 3VR1A 2ZXPA 3M1VA 2KKHA 3I0SA 1HNZJ 4OL8A 3TJ8A 1D09B 1ZHZA 2EVZA 4M5KA 2HRUA 4IQMA 2AV5A 2HURA 3KMIA 3CJQA 2J6SA 2V69A 4C6AA 3CEXA 5GAGU 4DV1F 2CNWD 1FR0A 3LP2B 3UQSA 1NKBA 4LDQA 5D0RA 2W9BB 3OJUA 5L0JA 3EICA 1HL6A 1GEHA 2HS5A 2EFPA 3MPUB 4KC5A 5HJXA 4CO0A 4AE4A 3DN9A 3TD7A 1F9EB 1MNEA 1NFOA 2KI2A 1FE4A 1VQOS 1M0SA 5KFKA 4ZJLA 3U0CA 4ZVFA 1OKKA 1YI2S 4NA3A 2DGJA 1HPZB 3PV8A 2YNGB 3THTA 2IM8A 4ICLA 3HHLC 3A13A 3DMJA 3KFWX 2VH7A 5A2QY 3PKYA 1VRTA 2GX8A 1RBOB 3R5GA 1EKRA 2QA2A 3KJNB 4KKOB 1AZSB 1T94A 1VJQA 1U2CA 2EFVA 1RTIA 2B9XA 1BQNB 2UUCF 1PD0A 2HMIA 3K5MA 1SJQA 2OLWA 1HBNB 2FLLA 2DPJA 2Y3YA 3DOLB 5CD4H 3K7DA 3T1HF 2B4UA 3AAWB 3LQVA 3RBXA 2QFIA 1CJKB 2KYHA 2DTJA 3BGOP 3R7SB 2D9OA 3TUZC 3EDRB 3OTOF 3H98A 4M94A 4F4ZA 1S9GA 5A8RA 3KXDA 2XSJB 3E01B 1DRZA 1RT2B 3HO1A 2KYZA 2P6SA 3L7UA 5SUHA 1Q8IA 2E7VA 4EI2A 3MCOA 2RJZA 4DL2A 1LWCA 3DRSA 3CCZA 5FZTA 2GC8A 2DGQA 4RZRA 4PPZA 4LF2A 3FCWA 3MD1A 3MR7A 1YJRA 4F04B 2AJ0A 4PJNA 2X0CA 1VK5A 4KYZA 3MM5A 2YEVA 1RTIB 2BW2A 2DHSA 3S9OA 3DJUB 2H54B 4EBKA 1FJGJ 2DNZA 5F28E 1QY7A 4X4PA 3L34A 3NRHA 3W3SA 5KOWA 1A7VA 4USMA 4K0KJ 2MWQA 4RR5A 1VQKS 2DH9A 3RW7A 2R2TA 1UPPA 1V4AA 2Y3BA 3EUNA 3LEOA 3PRVA 3T1YF 3J7AN 1YITS 1ZH5A 4RW7A 2ZJPQ 3MEEB 4K5RA 4KNWA 3S28A 1TL1B 2ZJRQ 1WEXA 2IOQA 2E5LJ 3MWBA 4K0KF 3E2EA 1CJUB 1SKWA 2YKAA 1YRTA 4KGZB 2WHOA 2R4FA 5KFSA 3MMBB 3BV8A 4UOHA 4DG1B 1BXNA 4KHMA 3JZ0A 1DJ0A 5D4OA 4O3RA 4S0MA 1RTJB 3ZQYA 5HLFA 2YHSA 2NPIA 1FDNA 1I94F 5HO4A 4LSLA 3WX8A 3H59A 2BL2A 1FCAA 2BJ8A 1Q95G 3QIPA 2CQIA 1NHKL 2HS3A 1CQMA 4K4ZA 4MKYA 3TVZA 3BBCA 4Q45A 4F7VA 2YQ1A 1FI4A 1WJ9A 1S1WA 1DAXA 1RAIB 1FFSB 5K14B 3SQOP 2KFYA 5K20B 2E44A 3PRDA 1M5VC 1HNIB 2Z2YB 2VD3A 3HVAA 3I4HX 1C1BB 4LMZA 2D1CA 3NY0A 2DR8A 1DQAA 1Q5VA 1IN0A 4NCBA 5A6BA 3PW4A 2IXPA 2OPRB 3A9CA 2R7TA 7FDRA 4AE5A 2J9VA 3H65A 3PHF2 2LSEA 4MFBB 2MYFA 1NSPA 3MUVP 3MTKA 2HWHA 2J9EA 1H6KX 5CYMA 3V5ZA 1YBUA 1SC3B 3G6ES 1T9XA 4DFJA 3DLEB 2DGSA 3LJBA 3KNAA 3E70C 5BR8F 2FZCB 2F8EX 4LBPA 3CJKB 4P2XA 3AJDA 3F0NA 1N56A 5C25B 4P6QA 1X31C 3K1IA 4E2FB 2MDAA 4RW9A 3C8GD 2MKJA 4CDVA 2KT2A 2H7VC 3OXFA 4NXNF 2Y8YA 1TFYA 1SJFA 2UVWA 1HE1A 2DB1A 2XS7A 4DR1J 3M30A 2Q1LA 4RPFA 2W7AA 3PMRA 4HLBA 4DVYP 2DJWA 1U25A 4FYVB 2C2DA 4ZLDA 1NB2A 3I96A 3DKAA 1VISA 2Q66A 1JPJA 2D7SA 1Z23A 3TO8A 4LF5J 3M1CB 3VF0A 2VU5A 2YL0A 1L3UA 1KNZA 2M88A 1C17M 3IR6B 5HN0A 5B0GA 1E6YA 1QLEC 2R7XA 3C14A 5E5NA 5LMNF 3GIRA 2QGFB 4PKDB 4DLGA 2OO4A 2YL3A 1NK6A 3M79A 3C7JA 1CBKA 2VA3A 4U95A 3I5QA 1F6TA 4RW6B 3DCAA 3G4SS 1SIZA 3BR9A 4ZPCA 2DY1A 2CAJA 1X5TA 3RGIA 4F3OA 1T02A 2V2VA 3TAMA 1S0OA 4D3HA 4U5FE 1VQ8S 4ID5A 2J5AA 1FFTC 3K5NA 4FAPB 5A8KA 2OJQA 1BLUA 4LQ3A 1GFWB 2XWXA 4CJOA 4N6CA 2RE1A 4OX7A 3Q8YA 3S0XA 4C3DA 2ZH5A 2J9DE 1QD1A 4MFBA 1FNOA 1WHWA 5FLXU 4F4YA 1RT1B 2LYVA 2RT3A 2RU3A 4XPCA 2V5HG 4LSLB 1SKSA 2W4PA 3H2UB 2Z0GA 1UVIA 4IH6A 3PX6A 4WGZA 2OQMA 4TXSA 2F4FA 1VFJA 4YWQA 3OT9A 5KFXA 2FYXA 4I2PB 4R25A 3TAMB 4JTAB 1N6QB 2XGPA 1FKPA 2WVNA 3CT9A 1FVSA 1B4SA 3QSYB 3PFEA 4JI3F 3R2CJ 1JLBA 4KV8B 3FJ2A 3ADAC 2DNHA 2VFRA 2NUTB 4N06A 4YS2A 2PIIA 3AA9A 2QNLA 2K7KA 4ECQA 2ZH1A 3T1YJ 3R97A 2ALYB 2A0BA 5T41A 3GU0A 4WTOB 2BEFA 1IM4A 2HVZA 4DX5A 3LLIA 2FQQB 1XMQJ 1U6BA 3QLHA 2HS4A 3NCPA 1H9TA 1D1UA 2B7BB 1U1QA 4U9DA 2PA8D 1EIYB 3OSPA 2D74B 4CO1A 2BANB 3HLZA 3CCRS 2EIJC 1RAHB 2UXDJ 3VVUA 1C1CA 2H7OA 1RGVA 3NMRA 3ZZTA 1Q0GA 3TX8A 2OFGX 2B5JA 4FS1A 1LW2A 2AX1A 1IKVB 1RHMB 1KQSR 2NXUA 2YBVA 2XSEA 2NUPB 4M63A 1NB7A 3QT8A 4XAKA 4WFYA 3T6BA 1S0VA 3EZIA 1AFIA 1NZAA 3M32A 4Z2XA 5CQGA 1FJEB 1K40A 4CM0A 5COGA 2KXHA 4HI1A 4HEAJ 4JVSA 2FGOA 5J2MA 3UVJA 4DR6J 1B3TA 3BKFA 3FSYA 3E01A 2QC3A 4LERA 3T19A 1XK8A 2AEFA 4R8UA 2OGUA 3TUJC 5F8IA 4ECVA 4FBUA 4CO2A 1JLQB 1HNVA 2P6VA 3C15B 1UVMA 3JSBA 1U0BB 5HMXA 2LP4A 3OXLA 2HFUA 3NGKA 3KLGA 4QW9A 4ICLB 3KH2A 3ZXWA 1RJ9B 2C3MA 5L1LA 2A1DD 5GMEA 5IWAF 2KGOA 3JCUQ 2AT1B 1S59A 3IG1A 3OHAA 2YWEA 1Q0FA 4DU8A 2IRUA 2B0JA 1PGZA 4E8UA 5L3VA 1RA7A 2M70A 2V9WA 1O51A 1Q81T 4LRDA 3CD7A 3MM9A 1MN7A 3VQSA 3ILLA 4J9NA 1S1VA 1KTMA 2UXBJ 1YZAA 1DFDA 2GWWA 2FY1A 3W8GA 4G6VB 1C2PA 4ZHRA 1RTZA 1M56C 1H7WA 2Z56B 3MUMP 4JI5J 1BD6A 3DMDA 1UPMB 3TA1A 2MSSA 2ZXWC 2V4JB 3HFZB 4PQAA 2CYDA 1RTJA 2XL4A 1A7EA 3TUIC 4OZ2A 1ZHYA 2HIQA 1D1CA 1NSAA 5DS5A 3A3NB 3U1MA 5A0YB 2DRBA 4JEAA 2ZXOA 1TK0A 2DH7A 4DR3F 2XM3A 3RTVA 1IKXB 5A6PA 3NNHA 2C2OB 2NZCA 3TZWA 4I2PA 2RVJA 4Q5VA 1E84A 4Z9JA 3KUHA 2CVEA 5ETPA 2F3JA 4DV3J 2A69F 3I9V9 3E3XA 2CQPA 1CVJA 2DVIA 1ZAXA 1N1CA 1J5OB 2VASA 3W62A 2CPDA 5B0FA 4MQ9F 4O6YA 3CIMA 4OHYA 1WWPA 3IR5B 4BEMJ 4PG7A 4OFZA 2KC3A 1T9TA 2BJ1A 4MKAA 2IM1A 4DF4A 2MYSA 4AL5A 4G78A 1TWGA 1HBNA 3N5FA 2CWXA 4X65J 3OL8A 2FUG9 3PW0A 4GMKA 2DGUA 2UVVA 2WSEC 2IJNA 1UW9A 2QYCA 1FJGF 5CCLA 2RSQA 4YL3A 3LPEA 2CG8A 4OJ3A 2X7IA 2KJVA 1OR3A 5C25A 5C42B 2LEAA 2L9NA 3PJWA 3J81j 4PABA 4Q0BA 2VB6A 3BQ2A 4ZJQA 4F2RA 4USUA 4N8OA 3ZWIA 2XM0A 1CG2A 1QAYA 1RDRA 2AEJA 3R5BA 2B4OA 1T8EA 3D54A 2FB0A 3CE8A 1NKEA 3GEHA 4X4RA 2OIHA 3EH2A 5K5MA 2QL7B 1YK9A 1NSGB 1OPZA 2MTLA 4OJGA 1R43A 5JJBA 2HNYA 2I38A 3KLHB 5C7PA 5KFLA 1YLXA 1YJ9S 3W8HA 3POVA 4J9LA 4GVLA 4X64J 4Q8EA 3ETOA 3U8PA 4U5DE 5KT7A 5LSRA 1RBLA 2QJ3A 3C14B 4B3MF 1NU7D 1S6QB 1CJUA 3DRYA 2QZ8A 2XMTA 3BO4A 2OKUA 1ZM2A 3DU6A 4XLPF 2PDAA 3KLVA 3P5BP 2PMWA 4Y65A 5EHHA 3T9NA 3C6UA 2DHGA 4ZLLA 4DL6A 4YFUA 3MAAA 5LL6d 4ECYA 1ZYQA 3K8WA 3MMCA 1Q82T 4TKTA 2NR0A 4TQSA 5C24B 2WB4A 4B3SF 4KH0B 2QLBB 2Q4FA 4YB1P 1UJ4A 4IR1A 4YOEA 1ZTWA 1U09A 4U6PA 4DWIA 3FBCA 4CTAA 2Z2ZA 2OMOA 3EG9B 1LQ9A 1Y9OA 5A8WA 3TK0A 5A6KA 1T05A 3D0IE 4YMEA 3IA0A 1X60A 2DBBA 4TU7A 4ED7A 1E85A 3J06A 2KO1A 3OVBA 5A8RB 5BQHA 2OSRA 4CO4A 4ZPWR 1S1TB 2O01C 4OYPA 5A6JA 2U1AA 5KYWA 2CA9A 7AT1B 1XR6A 3P6YC 3CCTA 5IQ6A 2WK4A 1KVJA 4CSAA 1U4BA 3PHEA 1IBLF 3H5SA 4OI6A 1X0PA 2FLOA 1RWMB 1Y6DA 5GAGI 4K7BA 1M1GA 2RF2A 2YPYA 1HARA 4DR2J 4JI3J 3SMZA 3LTOA 1Q53A 3PO5A 1OW6A 3ENVA 3HJFA 5FDLA 1OW7A 2CW0F 1SC4B 2DIUA 1D0ZA 2QV6A 1SH0A 2GFFA 2XG8A 3TZZA 1B64A 4J9QA 3G6XA 4Z7CA 3MGJA 1VCTA 3EGZA 1UA1A 4J7TA 1UVJA 3NYJA 5KYXB 3VAGA 2YX7A 2LQ5A 4C7QA 2MEWA 1C4AA 4JV2A 4PPDA 5K8PA 2LK4A 2N3LA 3ASNC 5ETNA 1QSSA 3EGNA 3SDEB 3PCVA 1X5PA 1S05A 2RB7A 3W1YC 2BOAA 2EC2A 2GIFA 5HROA 3ZDLA 1CSJA 1IBKJ 3D9BA 3K66A 4QOTA 2BBEA 5G0RB 4PXDA 3PJ9A 5BQIA 4G1IA 4KTQA 4CYUB 1FAPB 5KFUA 4EU0A 4OIXA 4QPXA 3D2WA 4PWDB 3I87A 4LVOP 3VGSA 3RFYA 1KVIA 1JLAA 2HZAA 2MKYA 4DR5F 4K4WA 5IV4A 3FFIA 2LA6A 2Q6BA 1YBAA 1F9FA 1TKXB 2MZSA 4ITSA 4C7OA 3US5A 4Y28C 3CJSA 2DR9A 5LJ5Y 1Y3KA 2R8GA 1VQPS 3V5RA 2DGVA 1WEYA 1RWOB 2XZWA 3FSXA 1L3PA 1NXIA 1VLYA 5DZ6A 4HFKB 2KM8C 1HW8A 2YQ0A 1X9MA 1S72S 1C1CB 1DTQA 1S76D 3ISND 3M4XA 3PXGa 3RB6A 1RT1A 1FFHA 2B4VA 1BR1A 2YQYA 1PC5A 3AD8C 1UVNA 4Y2IA 2J8SA 3VAFA 5ETRA 1EX8A 2DCUB 2KVIA 4X2BA 4IO1A 2VG7A 4OI1A 4EEYA 1LWEB 4V19X 1WC4A 2MZJA 4JI6F 5E0OA 1I6JA 4BHQA 2BVZA 1YTYA 2ADCA 4KH1B 2FZKB 2LVWA 2ZZNA 1NJZA 2XY5A 2AD9A 3UN2A 5KYWB 3ENAA 4MAKA 1OCOC 3CD5A 4NLXA 4H4MB 3DC2A 1RP5A 3VZIA 2HFVA 3C8YA 2ASYA 5LMUJ 3OUYA 4ED6A 1JB0C 4AQYJ 1IR2A 3A3PB 5BYQA 3MM7A 1FF2A 4Z7YA 3EPVA 4RWXA 3HD1A 3C16A 2B4PA 3K1HA 4LVNP 1FTCA 3W2WB 3RB0A 2A1BA 3GJTB 4X65F 5JS5A 5DJBA 1MWQA 5AXKA 2LLZA 4KGKA 3MZIA 4X4SA 2EG1A 4BJ1A 5A6BD 1XERA 3W2VB 2CJ9A 3ENQA 1U1OA 3R7CA 1CJTB 2JX0A 1BGXT 4M5DA 2CPZA 4LFAJ 1FRXA 1NJYA 1ZM4A 1GNKA 3S01A 2J0WA 1O8BA 5KG4A 1P8GA 3AB2B 2J7PD 1HMVA 2NSFA 1S6PB 1RTHA 2QA4S 2ZBIA 1NK4A 2HQGA 2MKSA 1RT4B 2JNJA 3D0GE 1VRUB 1R89A 1Z2LA 2K3IA 2IYLD 1HWJA 3R7BB 4M5IA 3O5TB 3DMJB 4HTJA 5I3UA 2Y1RI 2E66A 3P4UB 2VJVA 3SDEA 4QCLA 3SP1A 4WU3A 4JW1A 4DV1J 1FDDA 3MEDA 1HD0A 2G2YA 1PYTA 3UPFA 3OSNA 2W4CA 2VC9A 4EO6A 1SQEA 5HV9A 3UCZP 2VZ9A 3EJMA 2WB7A 1VQYA 2GMJA 3GFHA 3V6KA 7FD1A 1N34J 3HFKA 1K44A 1WOOA 2A2DA 4DL3A 2ATLA 4R5PA 5KFDA 3DLJA 3TJ5A 2ZBQA 3DOMB 2XRHA 3CGIA 1LS1A 3FEZA 1ZW3A 4ZOSA 4PR9A 2DYSC 2JLEA 3UR0A 3JTNA 3MM9B 2NXEA 2KZZA 4OI0A 4ZVSB 4FWVA 2VHGA 3J7A1 3KK1B 1RZMA 4N56A 3AY0A 3MOZA 1SL0A 2R7OA 2DY9A 1V6HA 4PQUB 3MMAA 1S1WB 1XN9A 4WU2A 1RAFB 4DSJA 2FGYA 4JTCB 1S7ZA 4WTYA 4RW4B 4F8RA 5J2PB 3MM5B 2YXLA 4OZ5A 3D6FB 2EPOA 3SYZA 3ZO7A 4BPMA 2L81A 1VRTB 2YKNB 2V8VA 5EX0A 1K1SA 4DEZA 1YJVA 2D41A 1Z2ZA 1LWEA 4F50A 1N36J 4L76A 1S4EA 1UJ6A 2XCPA 3NG8A 4AL1A 4LSNB 2WVOA 3MECB 4DPYA 1FVQA 3I6PA 5EUHA 1D1BA 5KFTA 3ENWA 3DM9B 3ILIA 1OKKD 3QAEA 1VQNS 1WKLA 5EX3A 2VBXA 4CH7A 4DG1A 3M4CA 3DM2B 2OPPA 3DM5A 1Q8LA 3CXCR 3HNIA 4PJJA 4AUKA 2KNHA 1URRA 3QYYA 3J80U 3BN7A 2V0NA 3QVZA 1XMQF 4DV6F 5E41A 5EWFA 3DI6A 2YKNA 4DQQA 3ZTMA 4WFZA 2QLJB 2J45A 4QWCA 4FKXA 1SL1A 3PNIA 1S1UB 4UDVA 2EFQA 4AL6A 4AK9A 4USKA 1QSPA 3KK2A 1UL3A 1W7WA 2L9JA 3GIKA 2DXFA 3M6WA 5E2QA 3Q0AA 2FVCA 3FEYB 4A8SA 1KP6A 1X4DA 3KDOA 4AL7A 4IJJA 4KHPF 2B0GA 2AMCB 3UDLA 3MI7X 2W2QP 2W2MP 1HWKA 4CIOA 3TULA 1FMWA 1FRKA 3WHNA 3AJ1A 1NU4A 4J90A 1HQEA 3LAMA 3KLFB 3IAS9 1ZZNA 1SQFA 3DU5A 1SH2A 1W2IA 1NAQA 2HKVA 2Q00A 4OIOF 2ASLA 1RWPB 3LS0A 2A2CA 4F67A 4DHVA 4E0IA 2ZUGA 3ZTRA 1V3RA 3MR3A 3DXSX 4V1Ak 2LECA 1WD6A 4P52A 1NKCA 4RLEA 4OI3A 3H5UA 1MWZA 1WC3A 4JBCA 1SYQA 2EIKC 4XWJA 1HWUA 2K06A 4Y34A 2HYIB 2MKCA 1HFEL 1YJTA 4NI2B 2HHQA 5A6AA 3CEDA 4ZPVR 3V81B 1ACMB 3CO0P 3MFIA 3GANA 2MQNA 4GO7X 3KLIA 4O4GB 1KEKA 2QUPA 1H9GA 1FERA 1MLAA 3NP5A 4LF6F 4WIIA 3FBBA 3ASOC 2NG1A 3QJJA 4H54A 2I1RA 4KI2A 3DOKB 2ROGA 1CULA 2JL9A 2HSQA 3PIPQ 1BE4A 4NX9A 2QRRA 1RT6B 2H65B 4MKVA 1H74A 2I6WA 1H2UX 2JWNA 3ET6A 1WATA 1MROA 3ILOA 3JQKA 4RNMA 2EW9A 4TYBA 2H3EB 4K8RA 1KHVA 1MU2A 1U47A 2FHJA 4JI8J 3GEEA 1ZM9A 2R7QA 3RAMA 3ZZPA 2R7WA 1RWKB 3AG4C 1SL2A 5BXIA 3PW7A 2FHOB 5JXSA 1HMOA 3JRTA 5IZHA 1UWBA 3V6DA 1B0TA 3K0JA 2XQCA 5L3QA 4K4TA 4DV0J 2V8DA 5HANA 2XEXA 3J81U 3DGPA 4W8PA 2DISA 1RHQB 1XEZA 3M9MB 1YGYA 3K59A 2PI5A 4U8YA 4A8OA 4QWAA 4PFPA 4Y6IA 4F4BA 4TYAA 2IPOB 5KAKA 1YDLA 5B3IA 3KHRA 5FIIA 1E6VA 4DJ9A 3FDQA 2MKIA 4LBHA 2GAGC 2CJYB 1G6BA 4JZAA 1CULB 2EILC 2R3VA 2AJ4A 1JLCA 2E1AA 3NYMA 2E5JA 5L0IA 2DHHA 1JLEB 3W63A 1AFJA 2C03A 4XDDA 2ROEA 3W5XA 2HZCA 3HTKC 4QYZJ 3DNCA 1YIJS 4DQIA 1S49A 4L73A 4CX9A 4P2SA 2OH2A 3PYDA 2EKYA 3NNCA 4G1QB 3SZ2A 2Z4PA 4GKKJ 2KB2A 3QRPA 4JTDB 2PX3A 1OIAA 2V9KA 3M9NB 3DGVA 5KFEA 1QAXA 2EI5A 5D92A 3MAAB 1UFKA 2MKKA 2SXLA 1U8SA 3MURP 2HMQA 2MLYA 4EK2A 1RBAA 2W4BA 5AJ3F 3MHYA 5C24A 2BMBA 1YA7O 2B0HA 1Z4UA 1N5QA 2M64A 4MW3A 4DZ6A 3CJ0A 2OEXA 3KNGA 1RAGB 4KRWA 4Z9IA 4CYUA 2XLWA 1VQ6S 1Y4ZB 4H4OA 1VBYA 3AOCA 2GZOA 3DDKA 3MEEA 4F4WA 3PX0A 4J30B 4LUBA 2V68A 1WG1A 4WZMA 3QGHA 2YL1A 2ZBPA 2A6MA 2XMAA 4XO0A 2WOMA 4LF9F 1PO6A 2AVKA 1KKHA 1B7FA 2PE8A 1I94J 2XMWA 4N6HA 4YHHJ 2XBPA 5ITHA 2HRYA 3V6HA 3IGNA 1JXVA 3VF0B 1PAEX 4ES1A 4KC9A 2CPFA 4HH0A 3VAJA 2D69A 3H8YA 4PRFA 1TFKB 3B8HA 3Q7LA 2ZVSA 2ERRA 4DPOA 3BPDA 4FBTA 2GIQA 4F0HA 5F8HA 4WFBQ 4PJLA 4A8XA 2FAPB 5HJYA 2HMIB 4DXWA 4CLKA 3GV8B 2VPZB 3VGUA 4Q4ZF 3ZQVA 5IC4B 3BDPA 3SNHA 4XLNF 1QJHA 1VK8A 5IS2A 2CCYA 4IO9Q 2AEMA 2OTJS 3GWNA 5MLCV 4LR9A 1RWUA 2DITA 2HBRB 2VG7B 4NCAA 2HHHF 3G50A 2LDIA 2G62A 1F5CA 3HHLA 4LFBJ 1M5PC 5HLFB 1X4AA 5CI9A 4CS8A 1MU2B 5KFBA 1BDJB 4JYAJ 4RBVA 3MXHP 3N0VA 2Q3TA 1PAUB 2L3MA 4IARA 2CPHA 4RNOA 4P73A 4ELTA 3Q6NA 2D9PA 1YZ7A 1UETA 3TX0A 2BRKA 5B0EA 1EP4B 1TVRB 2W9BA 4B9VA 4CLSA 2PGCA 3JSMB 1KTVA 1YG0A 5AJ3J 1U1RA 4AE4B 1VQMS 3M32B 2XTJP 2AHOB 5I42B 2Q9BA 4PXBA 2BX6A 2DK2A 4WYLA 4OI4A 4QU6A 2OOCA 1SUQA 2F8HA 3PYGA 4ZP9A 3DE8A 3BBBA 3W8IA 1F2HA 2LKZA 2BA9A 4CS7A 1YYXA 4RBUA 3T5KA 3DLGB 3JSRA 5KG2A 4KHRA 1RHRB 4IG0B 3D67A 4UQTA 3KYIA 2HVDA 3FXHA 3O39A 1Q0NA 4MW8A 1GAOA 2JFKA 1ULRA 4DRJB 4J9VA 2BM0A 4OHWA 4BLGA 5CD4A 5K0IA 2VIHA 5H9EJ 2Q7RA 1WOSA 2R9RB 1JR8A 1KU2A 2B3TB 1T95A 4J7YA 2RNEA 3JYTA 2HGNA 4DR7J 2X1GA 2P2CB 3NS5A 2V2KA 2JEJA 3TNVA 2MJNA 5EDWA 2XO7A 3BEHA 2EPKX 2J9BA 1WHYA 3H2VE 4TQRA 2NUPA 4RBTA 1S9GB 1CJVA 4KT0C 1D9AA 2IRYA 5KFNA 3OLBA 2ZOMA 1I3OB 2MLXA 2DNMA 1XMOJ 2AYEA 4F4AA 3TWZA 3MR6A 3BBFA 4Q7AA 3GODA 1BBHA 4TY8A 2M8HA 3L3CA 1T6UA 1TKTB 2X3GA 4YY3J 2RD9A 4RU2A 4EFAC 3W4YA 1U02A 3LGNA 2XC9A 2QIFA 3DI5A 4K4VA 2XYHB 5F3TA 1S9FA 1H2VZ 1FWPA 1QE1A 3ILJA 2C1EB 1EP4A 2XNQA 4CNZA 2HHWA 2IC3B 1KWMA 2D4UA 2X51A 4UZCA 2DEJA 2QLXA 1APCA 3MEKA 3AG1C 2JJ4D 2YQ3A 4B02A 3H5YA 3MUTP 3J7ZT 1DBDA 1V3ZA 3HSDA 2EIMC 3KHGA 1NSKL 4H4KA 3QRRA 1UEVA 2KSFA 4JI1F 3CJ5A 4WYWA 1B0PA 3TJAA 1S6QA 4J37A 2W24A 1RK8A 1YVFA 4Y0FA 1E83A 3FMBA 1UVKA 2EEYA 4U7UD 1J8YF 3IQCA 2WW8A 1CPQA 3H90A 3QIPB 2MQLA 3MBGA 3LUTB 3RW6A 4DPUA 3K8VA 4QBUA 1RYSA 4WGYA 2F65A 4MTOA 1ZZFA 3EGVA 3CC4S 2F1FA 4RUCA 3OL7A 3T6GB 2RS8A 4BJ6A 3BM7A 3R2PA 1JPNA 3I0RA 1LWFA 1REVB 4PYAA 4F3QA 5A0YA 4JJGA 2RAQA 1LVKA 3L09A 4QJVA 2AWZA 2BV3A 1S1UA 2JC0A 4ZP7A 3CD6S 2ZHAA 3D0HE 2W9AA 1IZMA 5F8GA 2JPUA 3HNKA 3LWMA 1CQNA 1IQTA 3P8BB 5J1PA 1OS5A 4LF7F 1DQ9A 5IOLA 2HNYB 3IS9B 2NREA 4ONSA 4AYBD 2Z2MA 5L1IA 2VA2A 4M95A 3HSJA 4USJC 3U27A 1S0MA 1RWXB 3MAQA 2YLDA 1SB6A 4DDFA 1TR2A 2AIRB 1R5ID 1OR2A 3GG1A 5DDQC 2DNRA 2XULA 3N6NA 3SCJE 4USWA 5IT0A 1MROB 2MSTA 1H0HB 2CPIA 5KFQA 4DL7A 3HHEA 2KXNB 3DRRA 3O55A 1KQKA 2LIGA 2LXFA 2MZQA 2ZHOA 2CQ1A 5HQMA 1U8WA 5HAOA 3EVMA 4I3MA 3FKBA 3AG3C 2DNPA 1J5EJ 1TAQA 3HULA 4KFBA 4C8KA 4JUZA 1U48A 2JX2A 2P1AA 3ZVRA 5FCLA 4IRDA 2CADA 3IRXB 2ZBRA 3CD0A 3O2IA 2GVDB 4B3OB 1U1KA 3CDUA 5CIVA 2G0CA 4AX2A 1G1XA 1ZTTA 2MHRA 2ILYA 5HSPA 1K47A 4XEVA 1R0CB 2NXNA 4CTAB 4GEHA 2XO6A 3BQ0A 2CPJA 3BEGB 2HNDB 4DF8A 4YL0A 2QMWA 4RUHA 4PR6A 1PG5B 1UAWA 1VS3A 2JHEA 5KFHA 3OR2A 3IQ5A 2AYBA 3A3OB 4URGA 3EHNA 5DM7Q 2JFDA 4EZ9A 2CIMA 2HFIA 3C18A 1T11A 3R9LA 1LK5A 3THVA 4HYKA 4IR9A 1SR2A 3IG1B 3CF5Q 4ECWA 1AYEA 2FVSA 1WWHA 3Q86A 2XWYA 4IFYB 2YKPA 3G4ZA 2CUYA 2N82B 2R9LA 4UUXA 5K8MA 2YKMA 2AU0A 2AP6A 2PA3A 2FLPA 2VKZG 3H7HB 4NEZA 3K33A 3W60A 1LWXA 4K4SA 3VAHA 1RAJA 4XDCA 1W2BR 4FESA 2J7UA 1BUXA 4LF8F 1X4EA 5KG1A 2UUWA 1W26A 2PI4A 3L9ZA 3G6VA 3HHNB 2BOPA 2GAQA 3DWWA 4WP3A 3HK2A 4P10A 1HYSA 2Z57B 2QG9B 5G4DA 1E6VB 3K2YA 3JS9A 2HFZA 4C0BA 1WHXA 5D15A 3EXYA 5AC4A 3EG9A 2DHAA 4G7OF 5DDPC 3HSGA 3EX7B 3TANA 1SIWB 3ZIBA 2CQ2A 1HBMA 4DV4J 2D3UA 4KO0A 4KB7A 4C97A 1QUPA 2PD1A 1VQ5S 1NG1A 1TVRA 3IM9A 4KY3A 4UY8T 1WORA 3DLKB 4DFKA 2DGTA 1TK8A 5F8JA 8AT1B 4F4XA 2U2FA 3H0PA 3D7SB 5J2NB 5KFCA 2JVOA 2M0GB 3UDEA 1D8YA 4PEOA 1WOPA 4N8NA 4QR0A 4LREA 2DRAA 3I5PA 3A8EA 1FRHA 3FQKA 4WP9A 1NZEA 3KLHA 1NZ8A 1SZIA 3QVYA 4X62J 3ETMA 3N6MA 2VUGA 1EQ1A 2G4BA 4OHVA 2YNFA 5IXUA 5HMZA 3VM6A 2FVPA 4YEAA 2DYRC 3T1HJ 2C04A 2YWWA 3K89A 3JSZA 2Z2LA 3FEXB 1PJ7A 2W4MA 2YVSA 4CT8A 1XNQF 5DZ7A 1HY5A 3T5JA 1NRKA 4A8KA 4BG0A 4C8OA 4TVAB 2WCXA 2ZUAA 4LF1A 4CI0B 3UN5A 3JAMU 5IT9U 3K5OA 1R8AA 2J7WA 1N0VC 2YPZA 4LFCF 2HQ3A 4ZVRB 2DI3A 3KOAA 3EQLF 1BQNA 4C3BA 1RXQA 3M9OB 1QSYA 3VHQA 1MMLA 1JLBB 4KV8A 1RQ0A 1U89A 2QSFA 4DCPB 4LF7J 3DAFA 4XK8C 4M5DB 3JQMA 5D77A 2HW3A 5F3ZA 4O44B 4EYHB 1MN9A 4HL9A 1URNA 2ZITA 2XCAA 2YKQA 2HV6A 5K9FA 2R2UA 3D3CJ 1IBKF 2P61A 2XZTB 3QWPA 3G86A 2BACA 2OEJA 4IDKB 1U24A 4NE9C 2NQPA 2GMLA 2ZM6F 1T5OA 2YZSA 4ZVPB 4ANDA 3DOKA 3M05A 4IWBA 1WI8A 5MAOA 5AGFA 2DGXA 3GZ7A 3LEVA 4EWTA 3OR2B 2QYGA 3VGTA 1HHSA 1X7VA 4DR1F 2HV7A 1AVOB 4USIA 1KRPA 3ZZUA 4ED0A 3P45B 3NGTA 2N4CA 3B0VC 4ES2A 2AZ3A 3OTBA 1S48A 3TQOA 3IO1A 1L3TA 4JI1J 3OD2A 1WN0A 2H5EA 3AXMA 4KKOA 3GJQB 1WC1A 1VBZA 1WG5A 2AP3A 1FXLA 3UCGA 3D6HB 2XI3A 1HD1A 5LMUF 3JB9k 1P1LA 4G1PA 2E87A 1OWXA 4DFMA 1ZVZA 3IBWA 2QN6B 5IT9Y 2Y8WA 4B6IA 4KBIA 1YRXA 1AT1B 4BJ5A 4P72A 4CCHA 2YVKA 3RQGA 1FJCA 3LWLA 1BY9A 1KR4A 3FCVA 5H9FJ 3G71S 2JH3A 3O6XA 1T7PA 4LLEA 4B3TJ 2O1PA 2H7BA 2OFHX 4ED5A 5BJRA 1REVA 3I5AA 1QPUA 4HHUA 4NRUA 3KK2B 2E1CA 2ZH9A 3RF3A 1JOGA 2YTCA 3R6LB 1DLOA 4OQJA 5KG5A 5TJ5E 2XLHA 3BSNA 3HT3A 2GAHC 5ETQA 1OQ3A 1N0UA 3U8VA 3KUGA 4EMDA 4FXVA 1OYDA 4MT1A 3W9IA 2PN6A 2DNKA 3AB4B 4EBCA 1GQAA 3BYPA 2CDQA 2N7YA 2RDJA 3ZTQA 4C9DA 4ULWA 1C4CA 3CB4A 2GJFA 4R0JA 3F44A 5LOQA 4H4OB 4RWWA 1OSDA 5DVWA 1P27B 2B8QA 2KQ9A 2DIVA 4MVQA 5KOXA 1M5OC 1Q16B 4OJ1A 2UUAJ 2FZGB 2KHDA 2UVRA 1JKHB 2ZH7A 4QW8A 1UCNA 1NMEB 2CVIA 1U0HA 3EZ5A 2OEKA 5E3PA 4DUZJ 4JV5J 4K1OA 1TZ0A 3CJKA 1CEZA 2ZC3A 5JT4A 1S6OA 2W1BA 2EINC 2HBZB 3L0IA 2OEVA 4QWBA 4TLQA 2OMLA 5LM7E 4P9FA 5BR8J 5LMNJ 2B6AB 2RDIA 2M4MA 3PEJA 1K1QA 5DO2A 4C3MA 3H25A 5IC6B 2ZD1B 4IOAQ 2AGQA 2GGPB 1BHNA 3I0SB 3PR5B 2C22A 2DXDA 1O0PA 2JVRA 3ZZOA 9RUBA 4MK9A 3FQLA 2IC3A 3W9HA 4U5BE 2D3OR 5JMNA 4ZIVA 1Z3IX 4ED3A 4OHXA 4U5GA 1I5OB 2G2OA 4ZIWA 1FWKA 1RU2A 2XMVA 4M5HA 4TNOA 3LAKA 2PMZD 4C7OB 2GFHA 4KHPJ 3UMIA 5C42A 3DHWC 3U3BA 4NLTA 3BKTA 4BWMA 4OZ3A 3SEOA 3TJ6A 3MTJA 1S99A 1KS2A 2WTFA 3DRRB 4C8ZA 2ZDPA 1XMOF 6FD1A 5B0BA 4AXIA 5GPGB 2WZGA 4LT6A 1UA0A 3VAKA 3NMIA 4OYWA 2QLWA 3H4DA 3TAPA 1UVLA 3TA2A 2W45A 3L4BC 5AXNA 2VQFJ 1UP1A 3CMAS 1PCAA 3M8QA 1S1TA 2A3JA 3FNNA 2VKRA 2DNQA 1RAAB 3EPIA 2ZWPA 4ECZA 1F3VA 2KJWA 3GCWP 2NS1B 1ELOA 3BO3A 1XTZA 4OYOA 4EBEA 4U5EE 3WG7C 1NFNA 1QKRA 2HEKA 2COLA 2ICWG 2LQGA 4KPCA 3ZZZA 1IKYA 1S9EB 2VODA 4PWUA 4Q7CA 3GM1A 3CC2S 3LP1A 3DRSB 1E2XA 4OHZA 3HF5A 2CQCA 3ONQA 1GXLA 3SCLE 3T41A 4YQWA 1UZHA 2K7JA 3SXMA 3N4WA 2W2NP 3TI0A 2Q6CA 3RRKA 1LE4A 2AF6A 2GQCA 4HEA9 1YJUA 1S7HA 3HVTB 1C1BA 3GWLA 2AJ2A 2LQJA 1YDIA 1RT7A 2ABYA 4Q43A 2MZ1A 3CJ2A 4ZS6A 5K8OA 1TL3B 2FHKA 5DQGA 1OCCC 2F9JA 2FJDB 3AODA 1LIHA 4HH1A 3HMJG 3AA8A 4A47A 5B0DA 2XS8A 5GVQA 2PBEA 1HR0F 4D4XA 4Q2LA 1NUEA 3FBEA 3LESA 1FMVA 4TLRA 3KKFA 1NEEA 2J7KA 1H7XA 4CNYA 4E98A 3QFHA 4Q44A 3C15A 1SQGA 5C2CA 4LRFA 1R0AA 2CKWA 4CH1A 2BJ3A 1CS4B 5LT5A 5L0FA 2F9DA 2H4WB 3H5XA 2UXDF 1B70B 1PKUA 2BC5A 4YK5A 2XLEA 3GLJA 3G4XA 1IUJA 4ZDNA 2I2YA 2HK3A 5FLXY 3WHIA 3PVXA 2GO9A 4UQGA 4O3PA 3M30B 1T9KA 3EFOA 4IFYA 3PEHA 1UWAA 2GNKA 4OINF 2Y1IA 2UUBF 3SXLA 4OZ0A 1AW0A 2MQOA 4ZP6A 1SV5A 3ZG1A 1V3SA 2P8IA 4PXCA 3F46A 4HDGA 3A1YG 4P7TA 4UOFA 2CNWA 3ZNUA 2VF3A 3CDWA 4U9EA 3NOGA 2HZ8A 4F36A 3LANA 1U2RA 3D5MA 5KYUB 2BJEA 3BGUA 3CO9A 2L41A 2HHXA 3Q8SB 2XL6A 3CAXA 4WWSA 3DRPA 3AGUA 3BZQA 9ATCB 1IR0A 4P2FA 3MMBA 3DJNB 3OXGA 2J9WA 1G2EA 2L6GA 4PJMA 4OIRF 3FSIA 5KFWA 2EK1A 4O4RA 2EKNA 2O66A 3KHHA 3RH3A 4OZNA 3SI8A 3HPOA 1RWWB 3SIPB 3ABMC 4RW4A 3OV7A 3P3DA 5AXMA 2Q79A 1KHWA 4R5PB 2DD8S 3NGUA 5KTQA 4DV3F 1R0BG 2A0UA 2NXCA 3DLKA 3H42A 2A0FB 1LOUA 2VDHA 3OQ2A 3U2LA 4ZLNA 1KN6A 1D9DA 1RWVB 1TQLA 4WK1A 4AL0A 1HQUB 1NDLA 3DYAB 3EHMA 4IYQA 1TUVA 2EPIA 2L6HA 5GAHI 3IBCB 2AW0A 2CJKA 4ECUA 5FJ4A 5KFAA 1S7IA 3AQPA 3IS9A 3P96A 4ATNA 4EZ6A 3GG0A 3QSIA 4MS2A 1GQEA 2HFSA 5JVEA 5B1AC 5L0CA 3H2UA 2FJAB 4NLPA 1VJWA 1WNEA 4CLLA 1FT8A 1U2FA 2ZD9A 3UNGC 2MZRA 5HVFA 1ZZPA 3OBIA 2QTWA 1HPZA 2E1MC 4ZCIA 3BQ1A 1VYIA 1ICEB 2NCKL 4HACB 3N24A 3RAXA 1S97A 3FMWA 1MQVA 3SQGB 4HI2A 1S6PA 1YLMA 4JI7J 2Y3GA 4URSA 1TQGA 2LEPA 2OKQA 2R03A 4PG5A 4RKUC 3HVTA 3R1LA 3TP2A 1DTTB 3NL0A 1QM9A 1WELA 2IXMA 1TKTA 4YT8A 1T3OA 4ERDA 1PBUA 3RQEA 2Y69C 4TN2A 2GMHA 4IG0A 4H4MA 5KG0A 4ANJA 1ORYA 2E1PA 1RISA 3RRGA 4X4TA 1F1MA 3SCIE 1R8PA 3BO2A 3VTIA 4IB4A 4MYUA 3TARA 3FOPA 3LPYA 3G82A 1S10A 2G3KA 2XSJA 5A2QU 2C28A 4D3GA 2Y0SD 1JXEA 3VRCA 2FHJD 4KIAA 2AQ4A 4XEKA 4M5LA 1S57A 3SZRA 1N32F 4YL1A 3KJFB 1LWCB 3CCMS 2MHEA 1VB5A 3F56A 3QT6A 2XMMA 3I9ZA 5IM0A 1Y4CA 4B9TA 2L7AA 3U1LA 3JRMO 1EARA 1FRLA 4B9LA 2HWTA 5D91A 1JRAA 1XBWA 2CQGA 4JI4F 4A8QA 3EGWB 4LLCA 1Q5YA 2EXUA 1SKRA 3OTDA 3MX3A 4NOHA 4P9SA 2ZOFA 2HSBA 4IFVB 2XHCA 2DR5A 3NGRA 3ULHA 3EXCX 4NZ7A 3AOUA 4ANCA 5HMYA 3OPKA 1TL5A 1C0UA 1RAOA 2CYYA 1BR2A 3DLGA 3JQJA 2MKHA 2RILA 1WTYA 3PFOA 4W92B 4OYXA 2W8LA 5JLIA 4WZQA 1T01A 3IC1A 3FRYA 2F63A 4DSKA 4A8MP 3A8IA 1SBRA 4I6WA 3VCDA 2VBYA 3TW0A 1RCPA 3O3LA 2QL5B 3A4TA 5AE3A 3Q6MA 2ROPA 2B51A 4XIUA 2DR7A 3KG4A 3KDNA 4USHA 3HCXA 3DLBA 2L08A 4B9SA 3OLAA 5HATA 5KFFA 4DR5J 3M2VB 1HNIA 3IAM9 5F5FA 1T6QA 1XZQA 5E7OB 3D1QA 1FK9A 4I0WA 1FXRA 4GRSA 4OZLA 1SH3A 2AWCA 1HMVB 1UEKA 2DH8A 4X4QA 2E9RX 3FUYA 3R5DA 5CHCB 1OW8A 2NYHA 1F2GA 2VONA 1F5AA 1HWLA 2V94A 2KM8B 4NWBA 4L72B 1MW7A 4MIAA 2RHSB 1ZOTA 4NY3A 1RT2A 2NXJA 4JC7A 2ASRA 2J8WA 3M4BA 2YX1A 5I3UB 2EG2A 2Z8QA 3PW5A 4CS8C 3QJPA 4FF3A 4I7FA 5GADU 1F60B 3D3BJ 4N5SA 2Q9AA 1IR1A 2DO0A 3R6GB 2E9ZA 4NLYA 3MMJA 4BC9A 1R8CA 4OIPF 1FKOA 5GAEI 4OX9F 1LW2B 3O1LA 3I55S 1JLGA 5ETMA 1OJ4A 2Y3HA 1T03A 4W4MA 3ABKC 2VV5A 2WONA 3IEEA 2IIHA 3KUEA 3QO9B 4NYZA 2BKOA 2O3DA 4O6NA 3QFWA 2PT0A 3TOMA 4J9KA 3QBCA 4O23A 3NYLA 1XQIA 1SJ3P 4LFAF 1R8HA 1TKXA 5CXTA 2RUGA 1CC7A 4DV2F 4MIBA 4B08A 4RO0A 2ACMA 4QU7A 1L3VA 3RB3A 2XI2A 2CQBA 2YNGA 1UG7A 3M8YA 1YJGA 3SCKE 2QLAA 1RKEA 1IBMF 5HK4A 2FIUA 5I3QA 3SYNA 5BYRA 1V9OA 3QAUA 2UXCF 4ZPTR 2HZVA 2JEFA 3NS6A 2XMKA 1DTQB 5CH7B 3DLLQ 3MMAB 2I8EA 2EFNA 2XXAB 1F1BB 2C2NA 3S7RA 1WGWA 3CDBA 1J2VA 3Q89A 1OMSA 3US6A 3DAGA 3EM1A 2HQCA 3DXBA 2RKIA 1BWVA 2UV8G 1I4YA 4MYTA 1P1TA 4LRAA 1VMBA 3MPWA 4K50A 1U1NA 1NBEB 1KONA 3ITHA 3GR0A 3L1MA 5BUOA 3LUYA 5KYUA 4KQZA 2RU9A 4DCJB 3PM9A 2QLFB 1VOMA 1TL7A 3R3TA 1UJ5A 4C8MA 3HZEA 2XLVA 2CWKA 3D6TB 3G8SA 3KKBA 2H1YA 3P5TL 2KT3A 2IAJA 1S1VB 2HHSA 4YHHF 1NH7A 1SXLA 1PYOB 4AT1B 3OFGA 3S29A 3A8KA 2DRDA 5GADI 3PW2A 1RYRA 3MF5A 2QFJA 3VAYA 5J1EA 1ZPWX 1VYKA 3T9ZA 3MM7B 4R32A 1WDTA 3K7RA 2OD4A 4JI2F 2YKMB 1G5ZA 4J32B 1ZHXA 3M8RA 1ZA1B 4L3NA 1FTSA 2RQCA 3SFUA 2X1AA 1ORJA 3AJ2A 3UCUP 4RUBA 3UW1A 1JJ2R 2F22A 4NRTA 2PF4E 4ETZA 2JZ5A 5I4MA 3OWTA 1NK7A 1CGOA 1FFWB 3NDBB 1WOLA 3M1VB 3L8JA 3S27A 2VBWA 2G3VA 4C4WA 3TEHB 2DXEA 3MCSA 1ZU5A 4WFNQ 3CCQS 1LXJA 3CPWR 4LRCA 3VV2B 1TFWA 2BE2A 4I1TA 3PY8A 4PFOA 1T9WA 1YWXA 3FHDA 1P9YA 1RT4A 3EGDB 1QTNB 4QR1A 2MY8A 2OJED 4CLYA 2POKA 5DM6Q 4FNIA 2PO4A 4O3SA 1HLWA 2AJFE 1FNTc 4PK4A 3BGLA 1JK9B 3Q8RB 4L6V3 2RDDA 3QQCD 4E7SA 1R31A 2VQFF 1FESA 4RL1A 2G13A 3JTLO 4GVBA 5D0EA 4LF5F 1T9VA 2UXCJ 2CQ0A 3SQGA 2VDIA 2R25A 3SV4A 1JAFA 3KMSA 3QMKA 4B3RJ 3HSZA 1FXDA 2KFZA 3M8SA 5KFGA 1QAIA 5ETKA 4DX6A 1XJWB 4IG3A 2RQMA 2Z15A 2W9YA 4ED2A 2XY7A 1U6ZA 1FD2A 4BBYA 3RR8A 4M5MA 5F8MA 3ITHB 2DEIA 4FKYA 4MIWA 5D4NA 2H5IB 4NYOA 3THPA 3ZTSA 4DR2F 5KFRA 4FP9A 3M8PA 4YB5A 1X0FA 4C11A 3OA1A 1S5ZA 3EDQB 3AD9C 5DDOC 3V4MA 2BQRA 1N48A 1J5EF 5IV3A 3DXJF 5A76A 4NLVA 2IDEA 4LF4J 4DMZA 4DV6J 1APSA 1GH8A 5EWEA 2KK1A 1GK8A 3W66A 3VZHA 4MVZA 4EKWA 3ZTPA 1HQEB 2IYGA 2C42A 2G1DA 1KLMA 4F4KA 4CJGA 2HAIA 2V4QA 3RVYA 4U5CE 2VFVA 3KHLA 5LSOA 2KHCA 4NA1A 4GKJJ 4O0NA 3NMJA 2ALZA 3DRXA 1O5JA 1FFGB 4MMOA 2W01A 2AJQA 1CGNA 2OEMA 1ZETA 3UWTA 4NTFA 4KGMA 1DY3A 2C3PA 3NXZA 4KJIA 2FJBB 2ZPAA 2NUTA 2V2ZA 3GIJA 1WF0A 1Q0KA 3DD7A 1HI0P 3VAMA 3M6XA 1UTAA 3GE9A 5HSWA 5JSLA 5A6WA 3G8TA 1JMWA 3KLIB 4ECXA 2YWKA 1NJXA 1Y5IB 3I0RB 1PYSB 5HROB 2MY7A 1Q8KA 3U3FA 1A9NB 3DE9A 1XWLA 4FF4A 2IJFA 4KGXB 2GA0A 3V5XA 3IXQA 1WSVA 2Y1LB 4HTIA 2IHR1 5AT1B 4NCGB 4NCQA 3QGIA 3BSAA 1U6FA 5K14A 4LIWA 4YN0B 5L1JA 4LSNA 3BN4A 2V3CC 1W25A 2VG6B 4NMXA 1PC4A 2P9GA 1EQMA 1PSDA 4O0IA 4WIQA 5FDLB 4LF6J 5GAHU 3GIIA 1RA6A 2FVQA 3JAMY 1RLCL 2H4YB 4MNDA 1QTMA 2E7WA 1NNDA 2WB1D 3DFEA 2DGOA 3PO4A 1PIEA 1TKZB 3WX4A 4DBQA 2RSEB 2PC6A 3EMTA 2LEBA 4N4WA 3LGMA 1RCOB 4MKBA 2YKZA 2HVIA 2CGEA 1Q79A 1MG7A 3KK3A 3PRBA 1Q4RA 1EETA 2RD5C 3G87A 1EKYA 1GXUA 1P6TA 2W25A 2C2ZB 4TU9A 3OFFA 3PDMP 3POTA 4HE8D 4LQ9A 1RJ9A 4LRBA 4I56A 3R5CA 3X1LB 2DGWA 5KFVA 2VC0A 3QJLA 4PUOA 3DYAA 2YH1A 1Q7LB 5T14A 2B7CB 1SUQB 3TJ9A 2IXOA 3KYJA 1BQMB 5A8KB 5L9NA 4ZMMA 2UU9J 4QYRA 2CFXA 1BZ4A 2VICA 3HFVA 1M2VA 6FDRA 4U96A 4I68A 4E0HA 2NSBA 4FN5A 2HNZA 3D1HA 4UZBA 4MK8A 2WSCC 4NMLA 2XXAA 3Q7GA 1X4HA 2BJ9A 1N5YA 3GV5B 2OJ3A 3LS1A 4ILLA 5T3WA 1RAEB 3SSSA 3Q24A 4FF1A 1UMJA 4GC6A 1MWYA 5DDRC 3D1OA 4Z9HA 4JI8F 2EFOA 3OL6A 1S1XA 5T7LB 3U5SA 2BE5F 5HMWA 3VWSA 5DGAA 2LA4A 3C46A 3NNAA 3FRZA 5D3GA 4B3RF 3IM8A 4JP8A 5KFOA 4OV6A 1QSLA 3EVOA 4B17A 1YJ7A 4DPWA 3EYZA 5F41A 1FHTA 1C0TA 3ITFA 1XNQJ 1CPZA 3W7BA 1XZPA 1ZS6A 3M2VA 1BMQB 3AOBA 5DLGA 1L7CA 2XLDA 1RTDB 3FZ2A 1KTQA 4XPEA 2PEBA 3H20A 1ZW2A 3PCOB 2EBEA 3UFCX 2LFVA 1FKPB 5IM0B 5EGYA 2R7RA 1Y5LB 1RXOB 4JB8B 1TWAA 1RI7A 1Y00A 2Z58B 3UGPA 1EHWA 4I1MA 3RB4A 4RJVA 2WVEA 2QA1A 4NCGA 4JI0F 3EZUA 5L0GA 4DR6F 1TWCA 1M6TA 4EUVA 4FDFA 4RW8A 2XLJA 3QGGA 4M5NA 2PEHA 3U7JA 4X0RA 3ZTZA 1RTDA 5B7WA 1FTRA 3QWUA 1C0UB 4PWWA 2WW4A 1SVDA 4QQBA 3LGHA 4AD6A 1M2VB 3DLEA 2ZXRA 5CYQA 5EK0A 1RACB 4J9MA 1LXNA 3OL9A 3V4IB 3BJYA 1X5SA 1JLQA 1HNVB 3GTYX 2MJUA 2F7VA 3E51A 3MOJB 4FPRA 1SF8A 2W2OP 5LXYA 4WFXA 1N33F 3QT5A 1I5NA 4GKKF 3WC0A 2V8HA 2GDCA 3KJQB 4JEBA 2WAQD 2C2KB 1QQ3A 2XLMA 3T3FA 2W4DA 3R2DJ 2WZLA 3FDSA 4NL5A 1L3KA 3TVYA 2RS2A 4IQXA 1YA9A 3OR1B 3LAYA 2HFNA 2FFHA 3QMQA 4QI2A 3JSYA 2W7OA 1DTTA 4X4NA 1HNWF 4W90B 1XNRF 3KL4A 4G65A 4ZK7M 4XEFA 4MJKA 2HRTA 4EUKB 4O3NA 4HHJA 4O3QA 2VCCA 2ZJQQ 3T5HA 1TL4A 1GS9A 4NZ6A 2ZC4A 4WP8A 2LCWA 2CRLA 4A2NB 1NSQA 3GONA 2YWFA 4MVUA 2NUHA 3LP1B 3CCJS 5JP7A 1ZAVA 3AGTA 1B99A 2BZ2A 1H2TZ 2QO3A 2J6UA 1Q78A 3ZSUA 5DQIA 1AROP 4CT9A 1PILA 2OG2A 2LU2A 4DOZA 4YR0A 3T6JA 1F5BA 4USTA 4IH7A 1WF1A 1T6IA 5KG3A 3GQCA 2ZE2B 3CCWA 4L75A 4F0KA 3GSDA 1Q86T 1JQGA 3RKOF 4ZVHA 1C0TB 1GTHA 2MGZA 2OU6A 1S0NA 1SC1B 4M5GA 2UUAF 3BSOA 3HJCA 3PJXA 1UEUA 4AFFA 1RKCA 1IKWB 4HDHA 1T3NA 3S8SA 1DOWA 1HKAA 3FOOA 1FO1A 4DRHB 3GFXA 5JUMA 4RNNA 1F3FA 3I5BA 3AQCA 2HFOA 2WVFA 1NDCA 1VHFA 3Q8UA 1OY9A 3IHUA 2BABA 2WBMA 4ELVA 3TQEA 2DKOB 4ZKAA 3I5CA 5KT5A 4P75A 1S77D 1NU9C 3QTHA 1RHJB 2Q9CA 4WF9Q 1WC6A 2YWAA 3H2VA 2HWIA 3K5LA 4LBIA 3Q2TC 1NLXA 1KDNA 4CM2A 1JIHA 1WKKA 2CNNB 5I42A 3TR5A 1AZSA 1HIYA 4PG6A 1FKAF 4DU7A 5DLFA 3PYFA 3AFGA 4ID5B 4JCZA 3IN5A 1EI7A 1ZU4A 2R7SA 3NGDA 1AUDA 4C48A 1KSPA 3B4DA 5HQLA 3NMAA 2EWHA 4HR2A 1HNXJ 2HHTA 2QE5A 4Q5SF 3GCXP 4MVRA 1ORSC 4UW2A 4OIQF 1EB0A 2IVYA 2HVEA 3GYGA 4W8KA 4ZLCA 4FXDA 4JCHA 2V8PA 2ADBA 3EPGA 4DR4F 3H40A 4X84A 2I8BA 3T5LA 4JI6J 3B29A 3BREA 2CJXB 1TUGB 1LFPA 2KU7A 2F5GA 4E7ZA 1FEHA 1M57C 1RHUB 4Q8FA 2IM0A 2QMUB 2P0NA 1WHVA 3KMQA 1N33J 4CLTA 3MEDB 3MFNA 3TZXA 4NLGA 3R27A 2ZZMA 3VGVA 4JKVA 3RBZA 3GFZA 4R0EA 5IFMA 1U7LA 2UV8A 4ZN3A 2HMZA 3C8ZA 1CLFA 3FC9A 4EGLA 2YNIB 4DUYF 2UP1A 3J7YU 3ZFVA 3SSRA 4RNFA 2IBOA 1FRMA 1Q7YT 3W8PA 2Y3DA 1N36F 4K5SA 4NPOA 1OQ6A 4XPWA 3BDEA 2HVHA 3ATPA 1VI7A 4DBRA 4HT5A 1SJ4P 5HVGA 4HHHA 3IWLA 5EN1A 3C3LA 2GHWA 3RW0A 1JJ4A 2IRXA 2LD6A 5CYMB 4DV2J 3C66A 1EJ7L 1DHMA 4F2SA 5G0RA 2HNDA 4I6AA 2K3KA 3FAJA 2TMVP 1FDBA 4RDAA 2VQEF 2VL1A 4ID8A 3EJNA 3MCNA 2KJGA 4KBLA 5L46A 4OX9J 3V2UC 4LF4F 4DV5F 3IWXA 3MECA 2DNGA 2NYIA 4UTGA 2YNIA 2A18A 4AQYF 3IFEA 5DG9A 1U49A 3VVTA 2LQBA 1N54B 3TYTA 3CWJA 3A12A 3DGPB 3CVKA 1TL1A 2N3OA 3D4JA 3MM6B 3CDAA 4I44A 1RT5A 3IGVA 4I2QB 2R8JA 2LMIA 2D3ZA 5LSLA 2HHVA 2LU1A 1G4CA 1V5IB 1XR7A 2CPXA 1RLDA 4ZCMA 2UVUA 3CJRA 4NLSA 3SFGA 1D0XA 4DV5J 2HGLA 3UDVA 3N0TA 2R42A 3JYHA 3HP6A 1RT3A 3BGFA 2IVFB 5J2PA 4ZVQB 2LXUA 1T9UA 3A8JA 1H6GA 2IXNA 2ILZA 2WONB 3OTOJ 3QO9A 4G1QA 4ZP8A 2CPEA 1WI6A 4GVBB 4MK7A 2QX0A 1JLFA 4BJ6C 4PWDA 3CIZA 4A48A 4IH5A 2OD6A 2C2EA 5E33A 2LFDA 2UUIA 2E29A 1JX4A 3S90A 4K0DA 3AG2C 1D0EA 3L7OA 3G9CA 2JC1A 4K4XA 1UW4A 3M15A 4XPYA 2OHDA 4N76A 4LDRA 4OZ1A 3LO3A 4LR7A 4DS5A 1RT3B 2FJEB 4JI7F 3JXOA 4ER8A 4Z37A 4CZCA 3GM3A 1RU1A 3K17A 4LDKA 2XGQA 5HVHA 3KYLA 2WOMB 3ZNJ1 5D4PA 2FTRA 3WODF 2GGPA 4OD4A 4XTTA 3CJTA 3HM9A 1XC9A 4WXWA 4GKJF 3HNJA 1Z1ZA 4CH0S 1VIXA 2LQ8A 2A6EF 1NLKL 2Y0BB 2E1RA 1K0TA 4NXMJ 2FY8A 1BC6A 4A4JA 3IWNC 4FZVA 4DUZF 1H38A 2BXJA 2K1RB 4J9UE 2PFFB 1HNXF 4K2JA 4CLPA 1HW9A 2CNOB 3DKDA 2RIJA 1SKUB 4ED8A 4PCQA 3LP2A 3D68A 1E86A 4M8LA 1Z63A 2XM4A 1D1AA 4G7ZF 1OY6A 2OTLS 1X8DA 2WVQA 1TAUA 4L74A 3D66A 1X4FA 2KW3C 3WC2A 3R5AA 4GQHA 2RQKA 1X9SA 3V4IA 4RBNA 3L95X 1O6XA 1H98A 3ZTOA 1R4TA 4DSIA 1VLOA 1EKSA 3TOQA 1PD1A 4E17A 2HHUA 4DQRA 1D8ZA 2Y9HA 4ECTA 3LNRA 2K1RA 2ACYA 3NRBA 3JYTB 4L3KA 3TA0A 2BYCA 2P9CA 3R5JB 1DOVA 1V74B 2K8GA 5IQQA 1R6VA 5KT6A 2GJIA 3OTCA 3NWRA 3K6BA 3FCHA 3WQPA 1GX5A 3QGPA 4YT4A 2GHPA 5B08A 3DOLA 3VALA 5DG7A 1T0TV 3ISZA 2BDPA 2DB4A 1MMGA 5ADZA 3IQTA 3RRHA 2IM2A 2BE7D 5SZTA 1U45A 3HNLA 1YQHA 2ZDOA 4WE1B 2KN4A 1RT6A 4JV1A 3BYRA 1N5SA 4KO0B 1BWEA 4NTAA 1WC0A 1NJWA 3MM8A 4N77A 2J9UA 1LWFB 3I31A 1MMAA 2VH3A 4QIVA 2HQIA 2JEGA 1N52B 3BPSP 1WACA 1S1XB 1NK5A 3C6UB 3BGRA 3RBDA 2KYXA 3HXMA 1LV5A 3RAQA 2GQQA 3G8QA 1QDUB 3BS9A 4UF4A 2I0XA 3AQOA 1GMUA 2W9CA 2ZH3A 2UZAA 4U67Q 1BQXA 2VG6A 4HACA 4NC3A 1PV3A 5KT2A 5DQZA 1U0SA 2HLTA 4DV0F 3R8YA 2F4VF 4GO5X 2E5HA 1WG4A 5AXLA 4U7UK 1B68A 2DNLA 2BE2B 5J2QB 4ZHRB 4KE5A 2HIYA 1KBRA 2IA6A 1T03B 1HWIA 2JRSA 1TL7B 1N4LA 3UVJB 2QE9A 2F4VJ 3QLHB 1GGQA 1Y11A 4ZCLA 2APOA 3HDSA 3TZYA 1AUEA 3Q8VA 3KK3B 3LOUA 2ZKTA 4ZITA 4QZVB 1SCJB 4ECRA 3QZ7A 1FE0A 3ET6B 1OQCA 1SJRA 2AJ1A 4B9UA 5CZVA 5U47A 2EPNA 4WKRA 2ZH2A 4I6YA 4P2MA 2OCCC 4OV1A 2ZH4A 5COMA 4Y3CA 1TMMA 3L8IA 4FVCA 2BKPA 4GC7A 3V6DB 2CDRB 4ILMA 1KLNA 5ETVA 4DL4A 1IWGA 4ENOA 4ZCKA 3PIOQ 1QUVA 5L39A 1CC8A 3FZBA 1IBMJ 4AXJA 1AB8A 2E9TA 2IYIA 4TU8A 5KFPA 5DS6A 2X3DA 3QZCA 2XZDB 5B1BC 4ZPBA 4EIYA 2L48A 4KPYA 3N6LA 1LE2A 4IKAA 2XMJA 1SMYF 4EWCA 2AWYA 2IMOA 4JV5F 3CCVS 2IBFA 1VQ9S 1QLNA 3VAIA 3OVSA 1C03A 1TFOB 4YJWA 4L6RA 1LW0B 5CCMA 3J81Y 4IAQA 3W9JA 4HT7A 1GM5A 1SI9A 2J8AA 2AU5A 1ZHTA 1HNWJ 1O3UA 1V54C 4NXMF 4EBBA 5ETOA 2M9KA 3RZAA 1UKUA 3HI9A 3ELHA 1H72C 4FS2A 2HBQB 2OELA 4JE9A 3D28A 3W61A 5IT4A 1FA0A 3VYWA 3M6VA 2DNNA 4B3TF 3JT1A 2PFDA 3BR8A 1XWJA 2EFGA 3PDNA 2OPRA 1RKEB 4WJ0A 2RHQB 2VBZA 3DDNA 5DQHA 3C16B 3U9JA 4ULVA 3LF0A 4BEJA 2D5RB 3M6UA 2AX0A 3PKMA 2ZWOA 4LACB 4MH8A 4QIEA 5AC5A 1N6QA 4ELUA 3RBEA 4OYIA 5KYNA 3MM8B 2XYPB 2HS0A 1X4GA 4MVOA 1ZBTA 4P6IC 3Q83A 1BQMA 2WZ1A 2B9EA 1X5OA 5IWAJ 4ZN1A 2ZD1A 1JMTA 3AOAA 3NKDA 2CQ4A 1PCXA 3GV7B 4ZVGA 1R7IA 1VQSA 2V63A 2J7PA 2IJRA 5ETLA 4WCEQ 2H8AA 2EK6A 2H48B 4DXLA 2BQ3A 2V67A 1YARO 1UFLA 1D9FA 1Y0HA 1JNZB 2MQMA 4YR3A 1N5YB 3GEIA 3ZC4A 2B9WA 1ZA2B 1N5VA 2AZ1A 3HKZD 2EPMX 2J46A 3AQBA 2OPQB 1YZCA 2NSGA 5THWA 2OP5A 3W65A 4ED4A 2GIRA 3Q8QB 2AGOA 1XNRJ 4ALZA 4Y2MA 1LKZA 2HPUA 3UMKA 3KLEB 3GYNA 1HHQA 2O67A 4FNHA 5JUAA 1O5HA 4DFPA 2XSFA 4USVA 4HKQA 3B78A 2YL7A 3C62A 1YVIA 1RWNB 2AYMA 4LFBF 4ZLJA 1N34F 1H73A 4NI2A 1P9QC 4QWEA 4RD9A 3OEOA 1OXKA 2BR0A 4Y00A 4YR2A 2KT5A 3WIVA 1VIOA 5F9LA 4CP5A 3U02A 3W2VA 1RE1B 1RHKB 1KOOA 2W7PA 4I64A 4FX5A 2CJQA 3HVWA 3AHPA 3GFYA 2WRMA 4UY85 3FAPB 2I5JB 2JLGA 3JSEO 3IBFB 2I15A 5KFJA 2VCBA 3TEGA 2NPUA 2LDYA 1YKWA 3NWGA 4F3MA 4U9RA 2HUJA 1G3OA 1HR0J 1A7GE 3G82B 1NH8A 3IMQJ 2VG5B 1RJJA 3L7PA 2DNYA 2FJVA 1I51B 1TKDA 5E3CA 3IP0A 3U9MA 2ZOGA 5T7LA 4DL0C 4X4UA 3CNQP 4EO8A 1EZZB 1AUSL 3C63A 4DX8H 5L38A 2VFTA 2CQDA 2ZE2A 2UUTA 2ASJA 2DYAA 5KG7A 3EE3A 4QWDA 4G3IA 1IW7F 3S84A 2ETSA 3G2XA 3WBZA 4YUDA 4CWBA 4IRUA 3DHXA 1OY8A 2PX0A 2MB0B 4JRZA 8ATCB 1UWBB 2ZEJA 2QY9A 3I32A 2VFUA 2WL8A 1DURA 4JJFA 3R7NB 2YKOA 1VYAA 1VQ4S 2F40A 2A68F 4JURI 1FDAA 2L9WA 4PZVA 1R6YA 3PACA 1NO8A 1WKJA 1KQFB 2QTVA 4CLFA 5J1NA 2AYGA 1SC6A 4PYDA 1VGYA 4FYDA 1X4CA 1EAYC 3AT1B 2YNFB 1IJEB 2Q43A 4P7VA 4DN9A 1M1KT 1M5KC 4NEYA 1LFWA 4TY8B 5KT4A 1HE9A 2ZBCA 2QSWA 1HQ2A 2NSCA 2ASDA 2Z30B 3CJ8A 2E5GA 3ECSA 3G96A 1U1PA 4BDPA 4ZJOA 4ECSA 5KYYA 2QL9B 1IXKA 4ES3A 4P9TA 1VRQC 2N4DA 1ST6A 3RJMB 3T1AA 2FC8A 1FRIA 2VOPA 3AJMA 4N41A 3CMQA 3OJSA 4DQSA 3R1HA 4B3OA 3MM6A 4CLZA 5CZXA 3N01A 4X64F 4RNHA 1FX2A 3QT7A 3F47A 5HQ8A 2JDJA 1A7DA 3C6TB 4EBDA 1F9HA 4IRKA 2N7CA 3DM2A 2UU9F 2GVZB 2MHNA 3M2RB 1RSCA 4P71A 2HHHJ 4Y2KA 4DL5A 2WZFA 4EBJA 4C11B 3UD4P 1IBLJ 1YRUA 3LA0A 1K0VA 1S12A 2LQ9A 2HG4A 1QVFR 2YY3A 3FVYA 1RCXB 4CBEA 1IKXA 1H7IA 1E6YB 4IUFA 2CNKB 4WKYA 4DS4A 2DR6A 4N7TA 3OR1A 4YDXA 2MQQA 2QA4G 2CXEA 4A8WA 4CS9C 2Q3PA 4ZLPA 3O8WA 4OX8A 2YWGA 1Q1KA 2L9DA 4CLWA 4ANEA 3FFIB 1K73T 4IG3B 4CLUA 3PG9A 4PG8A 3E9VA 3TVKA 4IGGA 3J7YI 1IM6A 3SXKA 2RH3A 3UDCA 1MSWD 2W8KA 5DLJA 4C98A 5B0CA 3C6TA 4DV7J 3OFHA 1KVKA 3I4PA 3NCRA 3MPDA 3FGVA 3SSQA 1HW1A 3W5ZA 1FX4A 1Q0MA 3UD5A 4YN3B 1Q8BA 2IVMA 1VC5A 4HVZA 5J1EB 3UGOA 2J76E 1HYSB 5M2RA 5F0UA 3GSIA 5D78A 2I5JA 1O87A 4NLWA 4O79A 3RU0A 2X1FA 2DCLA 1LM3B 1NM2A 3B4MA 3JTOA 2H51B 2GJ2A 5E3RA 5LXRA 2UUCJ 1WTFA 1X9WA 2A6OA 1WTBA 5D0HA 4RW6A 2G1HA 3B54A 3J7Z5 1HBOA 1I1GA 4NLRA 5K8NA 2RQ4A 4PACA 2GQ2A 5KYXA 2R7UA 3BH6B 1IWAA 1K05A 1VTMP 5DG8A 1NPPA 3UR3C 3BGRB 1G7CB 5T3TA 2ZNZA 4LFCJ 1CGME 5DQTA 2B9YA 4LF8J 3S6EA 1EQ0A 2OPSA 4O4GA 4DUYJ 3PYEA 1IJFB 2VPXB 4KSEB 3N5BA 2PP4A 1TP7A 1A41A 4FXWA 2K2PA 4RW8B 4WJBA 1VDHA 3CDEA 2M3DA 2ZVIA 4NA2A 3MYFA 4RW9B 4QI0A 3TUPA 4I67A 4CDIA 3CSKA 1HBOB 5KYYB 1M5SA 5A69A 2GHVC 4O44A 1YBTA 1HNZF 1Y7PA 2WVBA 1DZ5A 3HKWA 1LPEA 2A10A 2C2MB 3GILA 2M4EA 2WVDA 4LJMA 2H9ZA 3Q23A 5J2NA 3HX9A 5B0AA 2R2SA 4CIHA 3NBPB 5DS7A 3GM2A 2DNOA 2WVCA 5HBMA 4LF9J 2LXIA 4MTFA 4JOUA 3NAIA 3N79A 4FPIA 3U1NA 1FWLA 1NDKA 3M8QB 3MEGA 3UE2A 4D4NA 3KG1A 3JTPA 3Q2SC 1Y5NB 3PHTA 1TWHA 5L9XA 3V81A 1TTHB 2ZM6J 4WABA 3X2QC 2HNZB 4OI2A 4IOCQ 1VRUA 3EVWA 3EGDA 3DDIA 1AA1B 1CS4A 3FMSA 4OLOA 2C3YA 5F0WA 4DN0A 2QEXS 3C2PA 2QMXA 2NPFA 1HW2A 2HAFA 2KL8A 4OYMA 4ER9A 2HBYB 5HI7A 3PTWA 3H2LA 4O7GA 4DQPA 2RRAA 2ZH6A 1TUWA 3N9UC 4OMFG 1VLTA 5H9FK 3PR4A 2KG1A 3NKYA 3Q8PB 2XNRA 4PQUA 2KXFA 4K2XA 2CG4A 3OHBA 4OYZA 2PNOA 1WF2A 1VR6A 1NHUA 2GVDA 1JLAB 4F25A 3NCQA 4J5OA 3DZAA 2R05A 2VPWB 1GX6A 4DR7F 5F9NA 1LEOA 3HVRA 3LP0B 4B9MA 2MXYA 1YJWS 2HJ3A 3AXKA 6AT1B 1M5HA 2XLOA 2BUNA 3O6QA 1QAJA 3OUYB 4KR0B 2BRLA 3M8PB 3WAQA 3MAHA 4IDKA 3MR5A 3B0UX 1G4US 4RUAA 2HLUA 2GV1A 2DHXA 5HP1B 2VCAA 2FGCA 4CDAA 2HHPA 2ZFHA 1U26A 4XTKA 4R8UB 4BC7A 4C8LA 4U7CA 4WE1A 2P7VA 2KZMA 5C2GA 1G8XA 1DARA 3B82A 1M1HA 2YNHB 4KAIA 5T1DB 3AD7C 4FYWB 1AXQA 4WK3A 3HD2A 1RADB 3GP9A 1J5OA 3HZGA 4YT2A 4A4AA 5CI8A 5GMKa 1FJ7A 3U2MA 2H5JB 2XLIA 2YWHA 4JI2J 3CCSS 3CCUS 2V4RA 4C3KA 2NLWA 2CPYA 2IA0A 4X4OA 3B0PA 3SXZA 1JLGB 2YH0A 3PX4A 2VQEJ 1QZXA 1RT5B 4HFFB 4ETXA 2D3O1 3K57A 2GS8A 4JIOA 1UFWA 1TMJA 2HQFA 1XR5A 1YAUO 3C8GB 5E3QA 3B71A 3UNYA 5B3SC 2LFFA 3SBMA 4BJTA 1RUSA 3HHLB 4EYIB 5D4LA 4ZPDA 2BJ7A 2OPQA 4I4BA 1I4ZA 1YYJA 2R02A 3DI6B 4A8YA 4RU9A 3KLEA 1K8AT 4G0HA 3IRWP 1NJIT 1DQ8A 1RABB 2V2QA 3OVAA 5F5HA 3Q22A 1FKOB 4X4VA 3CC7S 2J0SD 2W9CB 2V6AA 2BE9B 1OYEA 2CQ3A 5D8HB 5BQGA 4C0HA 4YT5A 1WASA 3I82A 1D0YA 5KT3A 5C5JA 3KPHA 3NBPA 3W5YA 4F02A 5DGBA 1NPKA 4YY3F 2XL8A 1TKZA 4CQ1A 3HKKA 4JV0A 4DZDA 2M5YA 4DJBA 1CPRA 4V19J 2XB2D 4P74A 2HK2A 2IAJB 3QZ8A 1YZ6A 4UUWA 3I4UA 1JNRB 4DX7A 2X1BA 3M2UB 1N5TA 4DI6A 1NK0A 1Z5ZA 5F8LA 1U1LA 1R27B 1HMDA 3MMCB 4NLOA 4OYAA 3JYYA 5CYJA 2O5DA 1HBUA 1VQ7S 4DRIB 3MPYA 3WDOA 2XMUA 1DLOB 2RKIB 3OW2R 1TR0A 2VFSA 1KOHA 4FYXB 3QPIA 1J27A 2CZ4A 2R2RA 2B56A 3NAHA 2R7VA 2EBGA 3GYXB 3HT0A 3NG1A 2V4JA 1OXBA 4QIFA 1J8MF 2M52A 3CMES 2BM1A 3S1TA 2A6HF 1N32J 3KWMA 1VK3A 1B0VA 5L8RC 4UOCA 4QPTA 1A0OB 1OCRC 2CZ9A 1NBBA 4X62F 1YHQS 256BA 3MDFA 3BB5A 4U8VA 4NLUA 3KJVB 3M2UA 1XMBA 3LH2S 1LNQA 2AKWB 2C3UA 4JI0J 1KQGB 1V5VA 3V5YA 5F8NA 2L6FA 1IKYB 1S9EA 2KTQA 1OCZC 2HGMA 3HJVA 1WEZA 1JJCB 1JXLA 3EWGA 5DRKA 4BCAA 3CCES 2FDNA 1TL3A 3LW5C 1WUUA 2GCFA 4DSFA 3GIMA 4QYZK 2FJXA 4DVZA 3UO0A 2J0QD 1IKVA 2OPSB 1EA8A 4M5JA 2DPIA 2VPYB 2XYGB 1S4FA 2IBKA 1KFSA 2V8GA 5KFMA 2G9OA 4NXNJ 3NLCA 1OSCA 3UN3A 2NZ4A 1G4WR 2JSXA 4E18A 5ETTA 3X3UA 2YRFA 3EZOA 2FLNA 2MQPA 2M7SA 3KJVA 1AEPA 2GW8A 3EZHA 2XLKA 2B8PA 3WZ0A 4DSLA 4NQFA 2CQHA 2FPHX 2XY6A 5L1KA 4J91A 3C8GA 2HJMA 1D3WA 1LI5A 4UOGA 1VLSA 4PG4A 2GVZA 3M2RA 4QDLA 1JJHA 3LNMB 1C02A 3NEKA 4LR8A 3BSCA 4KFBB 3CCLS 3EGXB 4DV7F 3BF4A 5IY5C 2IM3A 1UZDA 3C19A 1HBUB 2RF2B 1K04A 1X4BA 1LS4A 3JSMA 3HHDA 2ZNYA 1FNMA 2BANA 2XHWA 3BRJA 2ATCB 5LJ3Y 2YLGA 4C3LA 3RVZA 2HKEA 2CJAA 1PJ6A 2BQUA 2KRBA 1FRJA 3GPAA 4YB6A 2GA7A 3V7OA 2VJUA 3VQTA 2KDOA 2XS2A 4BJ5C 3QIDA 5J2QA 4ZVUB 3MR2A 1YSJA 1ZHWA 1KFDA 4DLEA 3ZZRA 4Y2CA 1U1MA 4J9PA 3RYLA 3HHKA 1NK9A 4B3MJ 4CSAC 5DETA 4WFAQ 4LIRA 4F26A 1GT8A 1OO0B 3W64A 1HHTP 3ABLC 2QT7A 4B3SJ 3X1OA 1HI1A 4MVSA 4YDDB 2G2ZA 1IBCB 2P5VA 4J9RA 4Q0BB 4X66F 1RMVA 4Y2AA 1XIQA 5I3PA 2ZKUA 1H3DA 4OX6A 4OLPA 1MMDA 2BW7A 2IDLA 5M2UA 2I9SA 3RUBL 3ISNC 4I7FB 2AGPA 4QIGA 1IQZA 4I1OB 2E5LF 4OD5A 3E8OA 1VQLS 3EFOB 2OSQA 1HQUA 1NHVA 2UUBJ 4YP3A 4TY9A 4ZPAA 3ICLA 3KLGB 3MD3A 4WXOA 4IAOA 5JVHQ 3A11A 3QRQA 1IVZA 3KG0A 5HBMB 2WSFC 3F41A 3RR7A 3M7VA 1RT7B 5D0GA 2Y39A 1CJVB 2CZVC 3GJSB 5CA5A 1Y3JA 2E5IA 4E0DA 4FYYB 4NASA 3TAQA 2KVQE 2DO4A 5D6GA 3TOLA 2UUHA 1GTEA 3GWCA 4DPXA 4IRCA 4DSEA 1TV6A 2YX4A 4PXEA 1ZPVA 2F8MA 5RUBA 3O10A 1WDDA 1YX2A 2B43A 1WSRA 3P49B 4CDYA 1GMWD 3N2ZB 4CO3A 3MPVA 3I56S 4OJHA 3ZZ0A 2YNHA 4H4KC 3D6MB 3CUNA 4RX6A 1VMAA 5L0HA 2VG5A 5AE2A 4MVMA 2ZHBA 2FJWA 3OFEA 4K4UA 4M1KA 2Y1JA 3K1IC 1Y10A 4YB7A 1L5UA 2J9DA 1A6LA 2VOOA 4F0MA 4W98A 1QE1B 3SXYA 3GJRB 2R8KA 1S6UA 3NMKA 1A0BA 1RB0A 4ILRA 4DCOB 1YJNS 4J9OA 2J6TA 3GMGA 3DOMA 3LP0A 4DPTA 1JWWA 4MTGA 3NGSA 1FEEA 5A8WB 2R8IA 4ZA1A 4DR3J 1S79A 4C2MA 1VHIA 1TV6B 1CJTA 3OTEA 4I2QA 3O44A 4O6MA 3NS7B 2J9CA 2CJBA 5KG6A 3TQ1A 2RRBA 3BKUA 3J80Y 3FK4A 1PJ5A 2G0IA 5M2PA 3M8WA 2E7XA 4CIPA 2MQ8A 5KFIA 2IMWP 8RUCA 2G0JA 2VC1A 4K4YA 1QVGR 1JKHA 4LSZB 4CS9A 3V6JA 1RKIA 3H4BA 4ED1A 4I69A 2OAUA 3EH1A 3HHLD 5ETSA 2C2RA 4C8NA 1MNDA 3RIPA 3W2WA 3DLHA 4B9NA 3UD3P 1M90T 3RQFA 4PUOB 1RKJA 3NOCA 2B6AA 5DS4A 3T4RA 5D3GB 3QNWB 3IPMO 2V50A 5J2MB 4PAAA 1VBXA 4C8YA 1M2OA 2NUUG 3ZZYA 1ZYRF 2KG0A 2KFNA 1NK8A 2EC0A 3N28A 2HSEB 4XPXA 3KK1A 1K9MT 3M8ZA 4IFVA 1T05B 4XQ1A 3UMHA 1VBKA 1JLEA 2W2PP 4OYBA 4FF2A 1R0AB 1F0XA 3CTRA 3CQZA 3FBFA 4NLQA 4OZJA 5HP1A 4BS2A 3LLKA 3B6BA 1KLMB 3MCMA 4DUTA 2P9EA 3MYIA 1GXTA 4NYPA 3CJ4A 1ITPA 3IQ6A 2OI2A 3CW2C 4C3EA 3MFHA 1HA1A 2V34A 1HBMB 5FD1A 3CULA 4FVMA 2R8HA 3K58A 3HLUA 2JLFA
chains in the Genus database with same CATH topology
3LNRA 2K1RA 3ABMC 2ACYA 4RW4A 3OV7A 3NRBA 5EX0A 1K1SA 3P3DA 5AXMA 2Q79A 3JYTB 3POTB 1KHWA 4DEZA 4R5PB 1OPIA 2DD8S 3TA0A 1YJVA 4CO5A 2D41A 5KTQA 1Z2ZA 4DV3F 1MMNA 1LWEA 2BYCA 2P9CA 4F50A 3DLKA 4IOBA 2FHMA 2K8GA 1LOUA 1FK9B 2IFXA 5HL7Q 3OQ2A 5IQQA 1KN6A 1UJ6A 4MKYA 2XCPA 5KT6A 2GJIA 3NG8A 3OTCA 1D9DA 4LSNB 3K6BA 2WVOA 1TQLA 3FCHA 4WK1A 3MECB 1GX5A 3QGPA 4YT4A 1HQUB 4JI5F 1FVQA 3I6PA 5EUHA 3DYAB 2GHPA 5B08A 3EHMA 3DOLA 4IYQA 3GR1A 1TUVA 1D1BA 2EPIA 4K59A 3VALA 5KFTA 5DG7A 3ISZA 3ENWA 4ZVEA 5GAHI 2BDPA 4A8FA 3DM9B 3C2PA 2AW0A 2CJKA 4ECUA 1MMGA 1OKKD 5FJ4A 5KFAA 5ADZA 3QAEA 3RRHA 1FNXH 2JOQA 1VQNS 2IM2A 3AQPA 5EX3A 2VBXA 3IS9A 5SZTA 3P96A 4ATNA 1U45A 1YQHA 4EZ6A 4CH7A 2ZDOA 4DG1A 4WE1B 2KN4A 1RT6A 3GG0A 4JV1A 1GQEA 1N88A 3DM2B 5B1AC 3G6YA 2OPPA 3KLFA 3DM5A 1Q8LA 3CXCR 2MGZB 1VC6A 1N5SA 2MPUA 4KO0B 1BWEA 4PJJA 4AUKA 2KNHA 2FJAB 1URRA 4NLPA 1VJWA 1NJWA 3CJ3A 3MM8A 1WNEA 1FT8A 3QYYA 4N77A 3AH6A 1LK7A 2J9UA 1LWFB 1U2FA 1JLCB 3BN7A 3I31A 4J9SA 1MMAA 2VH3A 1IKWA 2V0NA 1KD1T 5KFYA 2KRRA 1XMQF 1VC0A 3UNGC 2MZRA 1JLFB 4QIVA 4DV6F 4U5HA 2HQIA 5E41A 5EWFA 2JEGA 3OBIA 3DI6A 2YKNA 1HPZA 1N52B 2E1MC 4DQQA 4WFZA 2FVRA 4ZCIA 2J45A 1VYIA 1WACA 4QWCA 3BQ1A 1S1XB 1SL1A 1NK5A 2MMYA 3PNIA 3C6UB 1S1UB 3BGRA 3RBDA 1BR4A 2KYXA 3HXMA 1LV5A 3GB0A 2EFQA 3N24A 5JVGQ 2GQQA 3G8QA 3RAQA 3RAXA 4AL6A 4C0OC 1S97A 1TK5A 4AK9A 3FMWA 1R8BA 3BS9A 3KK2A 4NZ0A 1UL3A 2I0XA 3AQOA 2W9CA 2ZH3A 2UZAA 4U67Q 1FD8A 3SQGB 1BQXA 2VG6A 2J0XA 5KFZA 4HI2A 5KT2A 5DQZA 1S6PA 2L9JA 3GIKA 3M6WA 2HLTA 4DV0F 2Y3GA 2F4VF 4URSA 4GO5X 5E2QA 2LEPA 2E5HA 2OKQA 2FVCA 4Q2MA 3Q0AA 3FEYB 3IRXA 4A8SA 2XS5A 2WBRA 1X4DA 4PG5A 1WG4A 4O3OA 4RKUC 3HVTA 5AXLA 4AL7A 4IJJA 1ZM3A 2B0GA 3R1LA