3NMIA

Crystal structure of the phenanthroline-modified cytochrome cb562 variant, mbp-phen2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFAILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Porous protein frameworks with unsaturated metal centers in sterically encumbered coordination sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 45
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3nmiA00
2XLEA 4WGZA 3HNJA 4CDAA 1CPRA 2YL1A 2YLDA 1YYXA 3DE8A 1CPQA 1E84A 2J8WA 3QVZA 2XLHA 3NMKA 3NMJA 3NMIA 1S05A 5JUAA 2CCYA 4L6RA 2XLMA 5B3IA 256BA 4U9EA 1A7VA 3IQ5A 1LM3B 2YLIA 4CIPA 1YYJA 2XLDA 1CGOA 2QLAA 1M6TA 1YZAA 2YKZA 3L1MA 3ZWIA 5JLIA 2BC5A 4ULVA 3M4BA 3DE9A 3M4CA 5JVEA 1NBBA 1JAFA 5JT4A 4CDVA 4JEBA 3ZTMA 2XL8A 4CX9A 3C63A 1BBHA 4IAQA 4CJGA 4IARA 1GQAA 3TOLA 5JSLA 4D4XA 3C62A 4JE9A 5AGFA 1YZCA 2YL0A 4D4NA 2J9BA 4WGYA 4CDYA 1CGNA 3QVYA 1APCA 5JS5A 1E83A 4N4WA 3QW1A 2XLVA 4ER9A 4JKVA 3HNIA 3M15A 3FOPA 2XLWA 1RCPA 3ZQVA 1E85A 3FOOA 3HNKA 3HNLA 5JRAA 2XM0A 2XL6A 2XM4A 4JEAA 4N6HA 3ZQYA 1QQ3A 4EIYA 1MQVA 3ZTZA 4IB4A 4CJOA 2YLGA 1E86A 5JP7A 3QW0A 3TOMA 4NC3A 1QPUA 4U9DA 2YL7A 3U8PA 2YL3A 3IQ6A 3VRCA 3M79A 2XLOA 1EKYA
chains in the Genus database with same CATH superfamily
3NKEA 3EZHA 1K04A 3PHF2 4JURI 5BQIA 1S7ZA 1R4TA 2AVKA 2LP4A 4O7GA 3N24A 2FAPB 2BE5F 1ZZPA 2YL1A 3I5QA 4MW8A 4DRJB 4MVMA 1G4US 3I5PA 2MYSA 3FXHA 5DS4A 3GM1A 1BR2A 2J9UA 1NLXA 2JX0A 2WVNA 3K6BA 4MVRA 4KNWA 2NUPA 2NUTA 1MNEA 2W45A 1LE2A 1Q0FA 2ETSA 2XLHA 2Z15A 3ABMC 2YVKA 2O9XA 1FTSA 1B68A 3FAJA 3H2UA 4FESA 5F28E 1F1MA 3C7JA 2KQ9A 4XPXA 1LI7A 1Q0MA 4NCQA 4GYTA 5KYUA 1BZ4A 4NQFA 4PFOA 4JCZA 1FAPB 2Q3TA 4K7BA 1Q0KA 2XLMA 4CS7A 2Q9BA 256BA 1WWPA 2F22A 5KYYA 4G7OF 3C8GB 2ZD9A 1A7VA 3UMKA 4YT2A 3G4ZA 3EZIA 1FFTC 2LFDA 3JYHA 4CS8C 3UR3C 4NTAA 5B1BC 4EUKB 2LK4A 4QDLA 1V4AA 4YL3A 4LACB 2R03A 4N06A 1M57C 1YZAA 2YKZA 3L1MA 3RQFA 3ZWIA 2J0WA 4KC9A 4BEMJ 4I1MA 2NUPB 2NUTB 4O6NA 3DMDA 2DI3A 4MVUA 3M4CA 3O10A 4CS8A 1JAFA 3U9MA 2GA0A 5D91A 3C8ZA 4E0HA 3S9OA 3T6BA 4JEBA 4IAOA 1N1CA 4PJMA 4EHPA 4DBQA 2VCAA 3O6XA 1SR2A 4OIOF 1M2OA 3AG1C 1MMDA 3C63A 4LDRA 5A6BD 2LCHA 1TFOB 2QUPA 1LIHA 1QLEC 2LIGA 1GQAA 3GWLA 4LERA 1LVKA 2GDCA 2UUHA 1D0YA 3LLIA 5E2QA 3AG4C 2LQGA 3W8IA 4YJWA 5KYYB 3UNGC 1YZCA 4ZLDA 2A0UA 2VCBA 2NG1A 1H7IA 2AWCA 1ZHTA 2ZXRA 4JVSA 4OD4A 1V54C 4HFFB 3ZG1A 2G3KA 4JJFA 4U5DE 1C03A 1BDJB 4D4NA 2FGYA 2J9BA 2GFHA 4LLCA 4B6IA 4PK4A 1NU9C 4YT8A 4U5FE 4XWJA 5L0DA 1Q0GA 4XPYA 4IGGA 3KMIA 3DI5A 3DD7A 2W4BA 3GM3A 3QW1A 1T5OA 1LS4A 4IJJA 4EBKA 1DOWA 3IPMO 4DRHB 2R7TA 2A0BA 4XTKA 1EA8A 2OOCA 3LEOA 3LUTB 4PACA 2PX0A 4P9TA 3TJ6A 2R7VA 3PDMP 2HSQA 2VH3A 1OXKA 1XWJA 1JMWA 3FOOA 2A69F 1HY5A 2J9WA 3HNKA 4YT5A 1WTYA 4O6YA 3ZQYA 2HV7A 3EJNA 2OU6A 3BRJA 3RFYA 3MLGA 3X2QC 4E18A 2CGEA 4EIYA 4HFKB 5F5FA 1IW7F 3U9JA 3S27A 5KYXA 2KYHA 4JIOA 1E2XA 2OCCC 4P6IC 4BJ5A 3ASNC 3B0PA 2JPUA 4C3DA 1VK5A 3IEEA 4U9DA 1OKKD 4YWQA 3JCUQ 2GWWA 4NY3A 3M79A 2WVQA 3GODA 3W2WA 2B0JA 3A11A 3K66A 4MTFA 1ORSC 3H65A 2L7AA 4C3BA 4AX2A 2V3CC 3L34A 4WGZA 1EKYA 4EKWA 3EQLF 2IXPA 2EPOA 3K33A 1CGME 2CDQA 1VTMP 4A2NB 3AOUA 2OEXA 2OKUA 2UUIA 4JTDB 1XZPA 3SP1A 1JRAA 1Q0DA 4AL0A 2L6FA 4Z9HA 1OCRC 1J8MF 1FNTc 2G3VA 1YYXA 1Z7Qc 1MNDA 3R2PA 1CPQA 4FAPB 2HMZA 1D1CA 3ZC4A 2L6GA 3NDBB 4I3MA 1ORYA 1C02A 4O6MA 1O3UA 1ZU4A 2IXOA 3GEIA 3UMHA 1NSGB 2H7OA 3DJUB 5DQTA 4CS9C 4U5CE 1EI7A 2H7VC 3GORA 2EPLX 3GANA 2R25A 4JRZA 5KYXB 1H9GA 1VMAA 1YA7O 3SXKA 2RD9A 3EFOA 2Q9AA 1RXQA 5FCLA 2P6VA 1T01A 4EBJA 3BEHA 4CS9A 4C3EA 1NG1A 1TR2A 5GPGB 4U9EA 5AC5A 3HKKA 3LS0A 4E0IA 1G8XA 4EWCA 1JOGA 3NKDA 2A6HF 4JTCB 3SEOA 3VAYA 4DVYP 1VLSA 2QY9A 3ABKC 3E9VA 1YYJA 4PR9A 5CIVA 4XPWA 2XLDA 3VF0A 3S29A 1JR8A 1T6QA 1M6TA 5BUOA 3LAYA 2G62A 5KYWA 4RBNA 2YEVA 1V55C 3M4BA 3WG7C 4DOZA 5JVEA 1NBBA 3DZAA 2OJQA 3DAFA 2XSEA 1WATA 1OR3A 2R9RB 2A1DD 4AL1A 3HLZA 2I8BA 4MTOA 3MYFA 4OINF 3RF3A 2J0XA 1ZHXA 4CX9A 3MYIA 1QSPA 1DOVA 2M64A 2YHSA 2HUJA 4XEVA 4YN0B 1Z3IX 2QE9A 3R7CA 3EFOB 3TOLA 4BPMA 5JSLA 4PJNA 3MBGA 1AUEA 2WZFA 3C62A 2EIMC 1ZU5A 5AGFA 1ZHWA 3FAPB 1JPNA 3KYIA 3ASOC 3GM2A 3JSEO 4JZAA 3WHNA 4W8PA 3DKAA 5A6KA 2M4EA 2J46A 1SZIA 2L9JA 3JT1A 2HZ8A 2P0NA 2ZPAA 4G7HF 1A7DA 3QMKA 1ZHYA 4MVOA 5KYWB 3SXZA 5L0FA 3HJCA 1A0BA 3O55A 4NTFA 5EGYA 4PFPA 2EPMX 3H2VA 5A6BA 1E83A 2PX3A 1TWCA 3I4UA 2KSFA 2XLVA 1PV3A 2P61A 1T9KA 1MMGA 3LLKA 4FWVA 4JKVA 2HJMA 3M15A 3TQOA 1ZYRF 2WVOA 5KYUB 3DAGA 2XLWA 4Z9IA 1AEPA 2CNWD 4DRIB 5HSWA 4K0DA 4JCHA 5L0GA 2CYDA 2C03A 1UG7A 2RSEB 4MW3A 3POVA 3N2ZB 2XL6A 2IOQA 3ABLC 2OQMA 1QQ3A 2VASA 4I44A 1MQVA 3SXMA 4MVQA 1TWAA 2BL2A 3CAXA 4IB4A 3ZTZA 2EINC 4CJOA 1D1AA 4ANJA 3RQEA 2R05A 1OW8A 3TOMA 1QPUA 2KGOA 3VYWA 3S84A 3A9CA 4MTGA 2YL7A 3U8PA 1R5ID 3IQ6A 3VRCA 3TJ5A 4CIHA 1OR2A 2LSEA 1G5ZA 3K1HA 3RKOF 2X0CA 4HE8D 3G50A 2YRFA 3RQGA 2KC3A 1ZW2A 2NSGA 4DJ9A 4Q5SF 2Q00A 3HNJA 3F47A 4CDAA 3RVYA 3WODF 2HKVA 1CPRA 3ZIBA 4MNDA 3AJMA 3AG2C 2X51A 3LNRA 2YLDA 3US6A 1HE1A 3DE8A 2R7XA 3MX3A 4J32B 2EPKX 3NG1A 3QVZA 2KK1A 3RH3A 3NYJA 3Q6MA 2LD6A 5HV9A 2Y3HA 1OKKA 2YQYA 3O39A 1MMAA 3LNMB 1NZEA 3RW0A 3TULA 3EPVA 4I1OB 3U0CA 3Q6NA 1H9TA 3V7OA 1S05A 1LS1A 1YARO 4JTAB 3DWWA 2KNHA 3EGXA 3IHUA 1LPEA 4PJJA 2CCYA 2E87A 3MFNA 4MVZA 4L6RA 3U2MA 5B3IA 2WL8A 3LJBA 4ULWA 2H8AA 1J8YF 1TQGA 1YJGA 4JW1A 5EHHA 3NRHA 3IQ5A 3LS1A 2EPNA 3W4YA 2YZSA 2YWAA 2IM8A 5A6JA 2Y39A 3LEVA 2B0HA 3JSZA 1SF8A 4OD5A 1QKRA 1TWHA 4CBEA 3S90A 2J7PD 3T6GB 2Q7RA 1OW6A 2DGJA 2QLAA 2XL4A 1Z23A 1OCCC 1AVOB 1NFOA 3U3FA 3OA1A 4JC7A 3EH1A 3S28A 3U8VA 5JLIA 4ULVA 5CI9A 1IZMA 2C04A 2J9VA 3DXJF 2Y3GA 1I4ZA 3B0VC 1PD1A 4YL1A 4BEJA 2AP3A 1FFHA 3JTLO 3FDQA 5DVWA 5JT4A 2HS5A 3L8JA 4JJGA 2R7UA 2PFDA 4K1OA 2DYSC 1I5NA 5E33A 5KYNA 3W8HA 2XL8A 4AE4A 3NYLA 1BBHA 2W9YA 3F46A 4XLNF 4BJ6C 4WABA 4KI2A 3B71A 3U2LA 4CJGA 2VC9A 3ITFA 4E7ZA 3DM5A 3EGXB 1OCOC 4D4XA 1L3PA 4E17A 2QTVA 4F4BA 3T9OA 1M56C 2QNLA 2CW0F 4JE9A 3T6JA 5A69A 5DQZA 4XLPF 3JRMO 5L0HA 1OQCA 2A68F 4H54A 1D0ZA 3AQCA 2ASRA 3AG3C 3SZRA 1BR1A 5F5HA 2XXAA 3FHDA 1HE9A 1A7EA 1ZVZA 4QI0A 4XQ1A 4BG0A 4UDVA 1MMNA 4MQ9F 4U5EE 1PCXA 1ZW3A 1TFKB 3KKBA 2ZXPA 4G0HA 4GEHA 4XEFA 1XZQA 2Y3DA 2AWYA 3UMIA 3WAQA 4CDYA 4LDKA 3QVYA 1APCA 3E70C 3EG9A 1Y4CA 5D92A 1T6UA 3EH2A 4RDAA 1D1BA 3N0TA 2HSBA 2WZGA 4ER9A 3B0UX 2R7WA 2OG2A 4M63A 4FX5A 3Q7GA 4G7ZF 1Z5ZA 1GGQA 3C8GD 1QZXA 1M2VA 4U5GA 1RCPA 2FFHA 3ZQVA 4AE4B 1E85A 2TMVP 3JRTA 1YDIA 1G4WR 1OCZC 3TK0A 1UFBA 4YK5A 3QTHA 3HNLA 2DB4A 3KH2A 1Z6AA 2AU5A 2XM4A 4W8KA 4JEAA 2OJED 4N6HA 5DS6A 1WN0A 3X1OA 1LE4A 1HW2A 2YLGA 3FMSA 1Z63A 3AQBA 5JP7A 4N6CA 1E86A 5DS5A 2HFIA 4IWBA 2VB6A 1D0XA 1K05A 3L8IA 3DM9B 2XXAB 1YAUO 2WZLA 2PF4E 4YL0A 2EIKC 2XLOA 3J06A 1H6GA 2P1AA 3RVZA 2CNWA 3Q7LA 3LESA 1HMDA 2XLEA 3EG9B 3SXYA 3EGDA 1YLMA 3T4RA 3K1IC 4J30B 3DJNB 1GM5A 1L7CA 1VYKA 2MWQA 1M2VB 3JZ0A 1E84A 2J8WA 1KNYA 1U0BB 3CZ6A 4OIQF 5K0IA 3V5XA 3QZCA 4IRUA 2J45A 3K1IA 4U5BE 5COFA 4E7SA 2P7VA 3KL4A 5BQHA 3NMKA 1RMVA 2ZXOA 2HJ3A 2XRHA 3NMJA 4GQHA 4MVSA 3NMIA 3ATPA 2R7SA 1TKNA 5L0IA 2XS8A 4J7YA 4LLEA 3ZSUA 3HTKC 1TWGA 2I15A 4A4AA 4BJTA 4BJ1A 3L0IA 4H4KC 4KNVA 1C17M 3JYYA 5JUAA 2R7QA 4MS2A 3RIPA 5L3QA 4OIPF 2GAQA 1Y6DA 4PJLA 5COMA 1SYQA 4O79A 5L3VA 1LM3B 2YLIA 1RJ9A 3EGDB 5CI8A 4AK9A 1O5HA 2D5RB 3AGUA 4ZLCA 3EHNA 3NYMA 4CIPA 2NPUA 3G4XA 2IXMA 1CGOA 1T6IA 2R02A 2MHRA 2Y3BA 3OWTA 5TJ5E 2BC5A 4Z9JA 2L81A 3B9QA 1VB5A 3KPHA 2Y69C 2PP4A 3AGTA 4P9FA 3RYLA 3GEHA 3DE9A 4RD9A 4YT4A 2KW3C 1OXBA 2H7BA 1NU7D 2JD3A 5BQGA 1O87A 2EIJC 4LDQA 5T1DB 3TD7A 4CDVA 5IY5C 4QI2A 2IYLD 2IXNA 3S0XA 3ZTMA 3PCVA 3UGOA 1RKEA 4NTBA 2XS1A 4IAQA 4X0RA 4Q7CA 4ONSA 4IARA 5DLJA 1HMOA 1JPJA 2IBFA 1VOMA 4BJ5C 2VCCA 1KTMA 2J7PA 3ECSA 1FMVA 1PD0A 3OEOA 5E3AA 4OIRF 1U6HA 3C18A 3M1CB 3V5YA 3KYJA 2R7OA 5L0CA 4C7OA 2V26A 1LI5A 4Q4ZF 4WJ0A 2A6EF 1RJ9B 5L0JA 1RKCA 3CSKA 1ZHZA 2YL0A 2Q9CA 5T3WA 3V5ZA 5B3SC 4DXWA 2R7RA 4DBRA 3VM6A 4WGYA 2DYRC 2KJGA 1CGNA 3K7DA 3ZDLA 1OW7A 3UGPA 1A41A 1V74B 4J7TA 3ZVRA 4XEKA 3PMRA 3CQZA 5JS5A 4DVZA 1QVXA 5T3TA 3GWNA 2OEVA 4N4WA 5AC4A 3FVYA 3IQTA 4U5HA 2EILC 3EHMA 3SYNA 1GS9A 1ORJA 3HNIA 5FZTA 3FOPA 2D4UA 3CEXA 5E3CA 2NSFA 2ZXWC 1WGWA 1EQ1A 3IQCA 1RKEB 4KBLA 5B1AC 4CSAC 3B29A 1LKXA 1HW1A 2L6HA 2Q4FA 2HMQA 1U89A 1YA9A 3U3BA 1W2WA 1WOLA 1BR4A 1I4YA 1FR0A 1VLTA 4HEAJ 5JRAA 2XM0A 5COGA 4BJ6A 2PBEA 4R32A 2WB7A 2HV6A 4G78A 4CSAA 4C7OB 3QW0A 1FMWA 1WASA 4NC3A 1KU2A 1ST6A 4EBBA 5EK0A 3GEEA 3SNHA 1YVIA 2YL3A 1SMYF 1VYIA 2PNOA 2LFFA 3U5SA 2ICWG 5A6AA 1NFNA 3W2VA 3C8GA 1K40A 2W4MA
chains in the Genus database with same CATH topology
2XLEA 4WGZA 3HNJA 4CDAA 1CPRA 2YL1A 2YLDA 1YYXA 3DE8A 1CPQA 1E84A 2J8WA 3QVZA 2XLHA 3NMKA 3NMJA 3NMIA 1S05A 5JUAA 2CCYA 4L6RA 2XLMA 5B3IA 256BA 4U9EA 1A7VA 3IQ5A 1LM3B 2YLIA 4CIPA 1YYJA 2XLDA 1CGOA 2QLAA 1M6TA 1YZAA 2YKZA 3L1MA 3ZWIA 5JLIA 2BC5A 4ULVA 3M4BA 3DE9A 3M4CA 5JVEA 1NBBA 1JAFA 5JT4A 4CDVA 4JEBA 3ZTMA 2XL8A 4CX9A 3C63A 1BBHA 4IAQA 4CJGA 4IARA 1GQAA 3TOLA 5JSLA 4D4XA 3C62A 4JE9A 5AGFA 1YZCA 2YL0A 4D4NA 2J9BA 4WGYA 4CDYA 1CGNA 3QVYA 1APCA 5JS5A 1E83A 4N4WA 3QW1A 2XLVA 4ER9A 4JKVA 3HNIA 3M15A 3FOPA 2XLWA 1RCPA 3ZQVA 1E85A 3FOOA 3HNKA 3HNLA 5JRAA 2XM0A 2XL6A 2XM4A 4JEAA 4N6HA 3ZQYA 1QQ3A 4EIYA 1MQVA 3ZTZA 4IB4A 4CJOA 2YLGA 1E86A 5JP7A 3QW0A 3TOMA 4NC3A 1QPUA 4U9DA 2YL7A 3U8PA 2YL3A 3IQ6A 3VRCA 3M79A 2XLOA 1EKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLE A;  4WGZ A;  3HNJ A;  4CDA A;  1CPR A;  2YL1 A;  2YLD A;  1YYX A;  3DE8 A;  1CPQ A;  1E84 A;  2J8W A;  3QVZ A;  2XLH A;  3NMK A;  3NMJ A;  3NMI A;  1S05 A;  5JUA A;  2CCY A;  4L6R A;  2XLM A;  5B3I A;  256B A;  4U9E A;  1A7V A;  3IQ5 A;  1LM3 B;  2YLI A;  4CIP A;  1YYJ A;  2XLD A;  1CGO A;  2QLA A;  1M6T A;  1YZA A;  2YKZ A;  3L1M A;  3ZWI A;  5JLI A;  2BC5 A;  4ULV A;  3M4B A;  3DE9 A;  3M4C A;  5JVE A;  1NBB A;  1JAF A;  5JT4 A;  4CDV A;  4JEB A;  3ZTM A;  2XL8 A;  4CX9 A;  3C63 A;  1BBH A;  4IAQ A;  4CJG A;  4IAR A;  1GQA A;  3TOL A;  5JSL A;  4D4X A;  3C62 A;  4JE9 A;  5AGF A;  1YZC A;  2YL0 A;  4D4N A;  2J9B A;  4WGY A;  4CDY A;  1CGN A;  3QVY A;  1APC A;  5JS5 A;  1E83 A;  4N4W A;  3QW1 A;  2XLV A;  4ER9 A;  4JKV A;  3HNI A;  3M15 A;  3FOP A;  2XLW A;  1RCP A;  3ZQV A;  1E85 A;  3FOO A;  3HNK A;  3HNL A;  5JRA A;  2XM0 A;  2XL6 A;  2XM4 A;  4JEA A;  4N6H A;  3ZQY A;  1QQ3 A;  4EIY A;  1MQV A;  3ZTZ A;  4IB4 A;  4CJO A;  2YLG A;  1E86 A;  5JP7 A;  3QW0 A;  3TOM A;  4NC3 A;  1QPU A;  4U9D A;  2YL7 A;  3U8P A;  2YL3 A;  3IQ6 A;  3VRC A;  3M79 A;  2XLO A;  1EKY A; 
#chains in the Genus database with same CATH topology
 3NKE A;  3EZH A;  1K04 A;  3PHF 2;  4JUR I;  5BQI A;  1S7Z A;  1R4T A;  2AVK A;  2LP4 A;  4O7G A;  3N24 A;  2FAP B;  2BE5 F;  1ZZP A;  2YL1 A;  3I5Q A;  4MW8 A;  4DRJ B;  4MVM A;  1G4U S;  3I5P A;  2MYS A;  3FXH A;  5DS4 A;  3GM1 A;  1BR2 A;  2J9U A;  1NLX A;  2JX0 A;  2WVN A;  3K6B A;  4MVR A;  4KNW A;  2NUP A;  2NUT A;  1MNE A;  2W45 A;  1LE2 A;  1Q0F A;  2ETS A;  2XLH A;  2Z15 A;  3ABM C;  2YVK A;  2O9X A;  1FTS A;  1B68 A;  3FAJ A;  3H2U A;  4FES A;  5F28 E;  1F1M A;  3C7J A;  2KQ9 A;  4XPX A;  1LI7 A;  1Q0M A;  4NCQ A;  4GYT A;  5KYU A;  1BZ4 A;  4NQF A;  4PFO A;  4JCZ A;  1FAP B;  2Q3T A;  4K7B A;  1Q0K A;  2XLM A;  4CS7 A;  2Q9B A;  256B A;  1WWP A;  2F22 A;  5KYY A;  4G7O F;  3C8G B;  2ZD9 A;  1A7V A;  3UMK A;  4YT2 A;  3G4Z A;  3EZI A;  1FFT C;  2LFD A;  3JYH A;  4CS8 C;  3UR3 C;  4NTA A;  5B1B C;  4EUK B;  2LK4 A;  4QDL A;  1V4A A;  4YL3 A;  4LAC B;  2R03 A;  4N06 A;  1M57 C;  1YZA A;  2YKZ A;  3L1M A;  3RQF A;  3ZWI A;  2J0W A;  4KC9 A;  4BEM J;  4I1M A;  2NUP B;  2NUT B;  4O6N A;  3DMD A;  2DI3 A;  4MVU A;  3M4C A;  3O10 A;  4CS8 A;  1JAF A;  3U9M A;  2GA0 A;  5D91 A;  3C8Z A;  4E0H A;  3S9O A;  3T6B A;  4JEB A;  4IAO A;  1N1C A;  4PJM A;  4EHP A;  4DBQ A;  2VCA A;  3O6X A;  1SR2 A;  4OIO F;  1M2O A;  3AG1 C;  1MMD A;  3C63 A;  4LDR A;  5A6B D;  2LCH A;  1TFO B;  2QUP A;  1LIH A;  1QLE C;  2LIG A;  1GQA A;  3GWL A;  4LER A;  1LVK A;  2GDC A;  2UUH A;  1D0Y A;  3LLI A;  5E2Q A;  3AG4 C;  2LQG A;  3W8I A;  4YJW A;  5KYY B;  3UNG C;  1YZC A;  4ZLD A;  2A0U A;  2VCB A;  2NG1 A;  1H7I A;  2AWC A;  1ZHT A;  2ZXR A;  4JVS A;  4OD4 A;  1V54 C;  4HFF B;  3ZG1 A;  2G3K A;  4JJF A;  4U5D E;  1C03 A;  1BDJ B;  4D4N A;  2FGY A;  2J9B A;  2GFH A;  4LLC A;  4B6I A;  4PK4 A;  1NU9 C;  4YT8 A;  4U5F E;  4XWJ A;  5L0D A;  1Q0G A;  4XPY A;  4IGG A;  3KMI A;  3DI5 A;  3DD7 A;  2W4B A;  3GM3 A;  3QW1 A;  1T5O A;  1LS4 A;  4IJJ A;  4EBK A;  1DOW A;  3IPM O;  4DRH B;  2R7T A;  2A0B A;  4XTK A;  1EA8 A;  2OOC A;  3LEO A;  3LUT B;  4PAC A;  2PX0 A;  4P9T A;  3TJ6 A;  2R7V A;  3PDM P;  2HSQ A;  2VH3 A;  1OXK A;  1XWJ A;  1JMW A;  3FOO A;  2A69 F;  1HY5 A;  2J9W A;  3HNK A;  4YT5 A;  1WTY A;  4O6Y A;  3ZQY A;  2HV7 A;  3EJN A;  2OU6 A;  3BRJ A;  3RFY A;  3MLG A;  3X2Q C;  4E18 A;  2CGE A;  4EIY A;  4HFK B;  5F5F A;  1IW7 F;  3U9J A;  3S27 A;  5KYX A;  2KYH A;  4JIO A;  1E2X A;  2OCC C;  4P6I C;  4BJ5 A;  3ASN C;  3B0P A;  2JPU A;  4C3D A;  1VK5 A;  3IEE A;  4U9D A;  1OKK D;  4YWQ A;  3JCU Q;  2GWW A;  4NY3 A;  3M79 A;  2WVQ A;  3GOD A;  3W2W A;  2B0J A;  3A11 A;  3K66 A;  4MTF A;  1ORS C;  3H65 A;  2L7A A;  4C3B A;  4AX2 A;  2V3C C;  3L34 A;  4WGZ A;  1EKY A;  4EKW A;  3EQL F;  2IXP A;  2EPO A;  3K33 A;  1CGM E;  2CDQ A;  1VTM P;  4A2N B;  3AOU A;  2OEX A;  2OKU A;  2UUI A;  4JTD B;  1XZP A;  3SP1 A;  1JRA A;  1Q0D A;  4AL0 A;  2L6F A;  4Z9H A;  1OCR C;  1J8M F;  1FNT c;  2G3V A;  1YYX A;  1Z7Q c;  1MND A;  3R2P A;  1CPQ A;  4FAP B;  2HMZ A;  1D1C A;  3ZC4 A;  2L6G A;  3NDB B;  4I3M A;  1ORY A;  1C02 A;  4O6M A;  1O3U A;  1ZU4 A;  2IXO A;  3GEI A;  3UMH A;  1NSG B;  2H7O A;  3DJU B;  5DQT A;  4CS9 C;  4U5C E;  1EI7 A;  2H7V C;  3GOR A;  2EPL X;  3GAN A;  2R25 A;  4JRZ A;  5KYX B;  1H9G A;  1VMA A;  1YA7 O;  3SXK A;  2RD9 A;  3EFO A;  2Q9A A;  1RXQ A;  5FCL A;  2P6V A;  1T01 A;  4EBJ A;  3BEH A;  4CS9 A;  4C3E A;  1NG1 A;  1TR2 A;  5GPG B;  4U9E A;  5AC5 A;  3HKK A;  3LS0 A;  4E0I A;  1G8X A;  4EWC A;  1JOG A;  3NKD A;  2A6H F;  4JTC B;  3SEO A;  3VAY A;  4DVY P;  1VLS A;  2QY9 A;  3ABK C;  3E9V A;  1YYJ A;  4PR9 A;  5CIV A;  4XPW A;  2XLD A;  3VF0 A;  3S29 A;  1JR8 A;  1T6Q A;  1M6T A;  5BUO A;  3LAY A;  2G62 A;  5KYW A;  4RBN A;  2YEV A;  1V55 C;  3M4B A;  3WG7 C;  4DOZ A;  5JVE A;  1NBB A;  3DZA A;  2OJQ A;  3DAF A;  2XSE A;  1WAT A;  1OR3 A;  2R9R B;  2A1D D;  4AL1 A;  3HLZ A;  2I8B A;  4MTO A;  3MYF A;  4OIN F;  3RF3 A;  2J0X A;  1ZHX A;  4CX9 A;  3MYI A;  1QSP A;  1DOV A;  2M64 A;  2YHS A;  2HUJ A;  4XEV A;  4YN0 B;  1Z3I X;  2QE9 A;  3R7C A;  3EFO B;  3TOL A;  4BPM A;  5JSL A;  4PJN A;  3MBG A;  1AUE A;  2WZF A;  3C62 A;  2EIM C;  1ZU5 A;  5AGF A;  1ZHW A;  3FAP B;  1JPN A;  3KYI A;  3ASO C;  3GM2 A;  3JSE O;  4JZA A;  3WHN A;  4W8P A;  3DKA A;  5A6K A;  2M4E A;  2J46 A;  1SZI A;  2L9J A;  3JT1 A;  2HZ8 A;  2P0N A;  2ZPA A;  4G7H F;  1A7D A;  3QMK A;  1ZHY A;  4MVO A;  5KYW B;  3SXZ A;  5L0F A;  3HJC A;  1A0B A;  3O55 A;  4NTF A;  5EGY A;  4PFP A;  2EPM X;  3H2V A;  5A6B A;  1E83 A;  2PX3 A;  1TWC A;  3I4U A;  2KSF A;  2XLV A;  1PV3 A;  2P61 A;  1T9K A;  1MMG A;  3LLK A;  4FWV A;  4JKV A;  2HJM A;  3M15 A;  3TQO A;  1ZYR F;  2WVO A;  5KYU B;  3DAG A;  2XLW A;  4Z9I A;  1AEP A;  2CNW D;  4DRI B;  5HSW A;  4K0D A;  4JCH A;  5L0G A;  2CYD A;  2C03 A;  1UG7 A;  2RSE B;  4MW3 A;  3POV A;  3N2Z B;  2XL6 A;  2IOQ A;  3ABL C;  2OQM A;  1QQ3 A;  2VAS A;  4I44 A;  1MQV A;  3SXM A;  4MVQ A;  1TWA A;  2BL2 A;  3CAX A;  4IB4 A;  3ZTZ A;  2EIN C;  4CJO A;  1D1A A;  4ANJ A;  3RQE A;  2R05 A;  1OW8 A;  3TOM A;  1QPU A;  2KGO A;  3VYW A;  3S84 A;  3A9C A;  4MTG A;  2YL7 A;  3U8P A;  1R5I D;  3IQ6 A;  3VRC A;  3TJ5 A;  4CIH A;  1OR2 A;  2LSE A;  1G5Z A;  3K1H A;  3RKO F;  2X0C A;  4HE8 D;  3G50 A;  2YRF A;  3RQG A;  2KC3 A;  1ZW2 A;  2NSG A;  4DJ9 A;  4Q5S F;  2Q00 A;  3HNJ A;  3F47 A;  4CDA A;  3RVY A;  3WOD F;  2HKV A;  1CPR A;  3ZIB A;  4MND A;  3AJM A;  3AG2 C;  2X51 A;  3LNR A;  2YLD A;  3US6 A;  1HE1 A;  3DE8 A;  2R7X A;  3MX3 A;  4J32 B;  2EPK X;  3NG1 A;  3QVZ A;  2KK1 A;  3RH3 A;  3NYJ A;  3Q6M A;  2LD6 A;  5HV9 A;  2Y3H A;  1OKK A;  2YQY A;  3O39 A;  1MMA A;  3LNM B;  1NZE A;  3RW0 A;  3TUL A;  3EPV A;  4I1O B;  3U0C A;  3Q6N A;  1H9T A;  3V7O A;  1S05 A;  1LS1 A;  1YAR O;  4JTA B;  3DWW A;  2KNH A;  3EGX A;  3IHU A;  1LPE A;  4PJJ A;  2CCY A;  2E87 A;  3MFN A;  4MVZ A;  4L6R A;  3U2M A;  5B3I A;  2WL8 A;  3LJB A;  4ULW A;  2H8A A;  1J8Y F;  1TQG A;  1YJG A;  4JW1 A;  5EHH A;  3NRH A;  3IQ5 A;  3LS1 A;  2EPN A;  3W4Y A;  2YZS A;  2YWA A;  2IM8 A;  5A6J A;  2Y39 A;  3LEV A;  2B0H A;  3JSZ A;  1SF8 A;  4OD5 A;  1QKR A;  1TWH A;  4CBE A;  3S90 A;  2J7P D;  3T6G B;  2Q7R A;  1OW6 A;  2DGJ A;  2QLA A;  2XL4 A;  1Z23 A;  1OCC C;  1AVO B;  1NFO A;  3U3F A;  3OA1 A;  4JC7 A;  3EH1 A;  3S28 A;  3U8V A;  5JLI A;  4ULV A;  5CI9 A;  1IZM A;  2C04 A;  2J9V A;  3DXJ F;  2Y3G A;  1I4Z A;  3B0V C;  1PD1 A;  4YL1 A;  4BEJ A;  2AP3 A;  1FFH A;  3JTL O;  3FDQ A;  5DVW A;  5JT4 A;  2HS5 A;  3L8J A;  4JJG A;  2R7U A;  2PFD A;  4K1O A;  2DYS C;  1I5N A;  5E33 A;  5KYN A;  3W8H A;  2XL8 A;  4AE4 A;  3NYL A;  1BBH A;  2W9Y A;  3F46 A;  4XLN F;  4BJ6 C;  4WAB A;  4KI2 A;  3B71 A;  3U2L A;  4CJG A;  2VC9 A;  3ITF A;  4E7Z A;  3DM5 A;  3EGX B;  1OCO C;  4D4X A;  1L3P A;  4E17 A;  2QTV A;  4F4B A;  3T9O A;  1M56 C;  2QNL A;  2CW0 F;  4JE9 A;  3T6J A;  5A69 A;  5DQZ A;  4XLP F;  3JRM O;  5L0H A;  1OQC A;  2A68 F;  4H54 A;  1D0Z A;  3AQC A;  2ASR A;  3AG3 C;  3SZR A;  1BR1 A;  5F5H A;  2XXA A;  3FHD A;  1HE9 A;  1A7E A;  1ZVZ A;  4QI0 A;  4XQ1 A;  4BG0 A;  4UDV A;  1MMN A;  4MQ9 F;  4U5E E;  1PCX A;  1ZW3 A;  1TFK B;  3KKB A;  2ZXP A;  4G0H A;  4GEH A;  4XEF A;  1XZQ A;  2Y3D A;  2AWY A;  3UMI A;  3WAQ A;  4CDY A;  4LDK A;  3QVY A;  1APC A;  3E70 C;  3EG9 A;  1Y4C A;  5D92 A;  1T6U A;  3EH2 A;  4RDA A;  1D1B A;  3N0T A;  2HSB A;  2WZG A;  4ER9 A;  3B0U X;  2R7W A;  2OG2 A;  4M63 A;  4FX5 A;  3Q7G A;  4G7Z F;  1Z5Z A;  1GGQ A;  3C8G D;  1QZX A;  1M2V A;  4U5G A;  1RCP A;  2FFH A;  3ZQV A;  4AE4 B;  1E85 A;  2TMV P;  3JRT A;  1YDI A;  1G4W R;  1OCZ C;  3TK0 A;  1UFB A;  4YK5 A;  3QTH A;  3HNL A;  2DB4 A;  3KH2 A;  1Z6A A;  2AU5 A;  2XM4 A;  4W8K A;  4JEA A;  2OJE D;  4N6H A;  5DS6 A;  1WN0 A;  3X1O A;  1LE4 A;  1HW2 A;  2YLG A;  3FMS A;  1Z63 A;  3AQB A;  5JP7 A;  4N6C A;  1E86 A;  5DS5 A;  2HFI A;  4IWB A;  2VB6 A;  1D0X A;  1K05 A;  3L8I A;  3DM9 B;  2XXA B;  1YAU O;  2WZL A;  2PF4 E;  4YL0 A;  2EIK C;  2XLO A;  3J06 A;  1H6G A;  2P1A A;  3RVZ A;  2CNW A;  3Q7L A;  3LES A;  1HMD A;  2XLE A;  3EG9 B;  3SXY A;  3EGD A;  1YLM A;  3T4R A;  3K1I C;  4J30 B;  3DJN B;  1GM5 A;  1L7C A;  1VYK A;  2MWQ A;  1M2V B;  3JZ0 A;  1E84 A;  2J8W A;  1KNY A;  1U0B B;  3CZ6 A;  4OIQ F;  5K0I A;  3V5X A;  3QZC A;  4IRU A;  2J45 A;  3K1I A;  4U5B E;  5COF A;  4E7S A;  2P7V A;  3KL4 A;  5BQH A;  3NMK A;  1RMV A;  2ZXO A;  2HJ3 A;  2XRH A;  3NMJ A;  4GQH A;  4MVS A;  3NMI A;  3ATP A;  2R7S A;  1TKN A;  5L0I A;  2XS8 A;  4J7Y A;  4LLE A;  3ZSU A;  3HTK C;  1TWG A;  2I15 A;  4A4A A;  4BJT A;  4BJ1 A;  3L0I A;  4H4K C;  4KNV A;  1C17 M;  3JYY A;  5JUA A;  2R7Q A;  4MS2 A;  3RIP A;  5L3Q A;  4OIP F;  2GAQ A;  1Y6D A;  4PJL A;  5COM A;  1SYQ A;  4O79 A;  5L3V A;  1LM3 B;  2YLI A;  1RJ9 A;  3EGD B;  5CI8 A;  4AK9 A;  1O5H A;  2D5R B;  3AGU A;  4ZLC A;  3EHN A;  3NYM A;  4CIP A;  2NPU A;  3G4X A;  2IXM A;  1CGO A;  1T6I A;  2R02 A;  2MHR A;  2Y3B A;  3OWT A;  5TJ5 E;  2BC5 A;  4Z9J A;  2L81 A;  3B9Q A;  1VB5 A;  3KPH A;  2Y69 C;  2PP4 A;  3AGT A;  4P9F A;  3RYL A;  3GEH A;  3DE9 A;  4RD9 A;  4YT4 A;  2KW3 C;  1OXB A;  2H7B A;  1NU7 D;  2JD3 A;  5BQG A;  1O87 A;  2EIJ C;  4LDQ A;  5T1D B;  3TD7 A;  4CDV A;  5IY5 C;  4QI2 A;  2IYL D;  2IXN A;  3S0X A;  3ZTM A;  3PCV A;  3UGO A;  1RKE A;  4NTB A;  2XS1 A;  4IAQ A;  4X0R A;  4Q7C A;  4ONS A;  4IAR A;  5DLJ A;  1HMO A;  1JPJ A;  2IBF A;  1VOM A;  4BJ5 C;  2VCC A;  1KTM A;  2J7P A;  3ECS A;  1FMV A;  1PD0 A;  3OEO A;  5E3A A;  4OIR F;  1U6H A;  3C18 A;  3M1C B;  3V5Y A;  3KYJ A;  2R7O A;  5L0C A;  4C7O A;  2V26 A;  1LI5 A;  4Q4Z F;  4WJ0 A;  2A6E F;  1RJ9 B;  5L0J A;  1RKC A;  3CSK A;  1ZHZ A;  2YL0 A;  2Q9C A;  5T3W A;  3V5Z A;  5B3S C;  4DXW A;  2R7R A;  4DBR A;  3VM6 A;  4WGY A;  2DYR C;  2KJG A;  1CGN A;  3K7D A;  3ZDL A;  1OW7 A;  3UGP A;  1A41 A;  1V74 B;  4J7T A;  3ZVR A;  4XEK A;  3PMR A;  3CQZ A;  5JS5 A;  4DVZ A;  1QVX A;  5T3T A;  3GWN A;  2OEV A;  4N4W A;  5AC4 A;  3FVY A;  3IQT A;  4U5H A;  2EIL C;  3EHM A;  3SYN A;  1GS9 A;  1ORJ A;  3HNI A;  5FZT A;  3FOP A;  2D4U A;  3CEX A;  5E3C A;  2NSF A;  2ZXW C;  1WGW A;  1EQ1 A;  3IQC A;  1RKE B;  4KBL A;  5B1A C;  4CSA C;  3B29 A;  1LKX A;  1HW1 A;  2L6H A;  2Q4F A;  2HMQ A;  1U89 A;  1YA9 A;  3U3B A;  1W2W A;  1WOL A;  1BR4 A;  1I4Y A;  1FR0 A;  1VLT A;  4HEA J;  5JRA A;  2XM0 A;  5COG A;  4BJ6 A;  2PBE A;  4R32 A;  2WB7 A;  2HV6 A;  4G78 A;  4CSA A;  4C7O B;  3QW0 A;  1FMW A;  1WAS A;  4NC3 A;  1KU2 A;  1ST6 A;  4EBB A;  5EK0 A;  3GEE A;  3SNH A;  1YVI A;  2YL3 A;  1SMY F;  1VYI A;  2PNO A;  2LFF A;  3U5S A;  2ICW G;  5A6A A;  1NFN A;  3W2V A;  3C8G A;  1K40 A;  2W4M A; 
#chains in the Genus database with same CATH homology
 2XLE A;  4WGZ A;  3HNJ A;  4CDA A;  1CPR A;  2YL1 A;  2YLD A;  1YYX A;  3DE8 A;  1CPQ A;  1E84 A;  2J8W A;  3QVZ A;  2XLH A;  3NMK A;  3NMJ A;  3NMI A;  1S05 A;  5JUA A;  2CCY A;  4L6R A;  2XLM A;  5B3I A;  256B A;  4U9E A;  1A7V A;  3IQ5 A;  1LM3 B;  2YLI A;  4CIP A;  1YYJ A;  2XLD A;  1CGO A;  2QLA A;  1M6T A;  1YZA A;  2YKZ A;  3L1M A;  3ZWI A;  5JLI A;  2BC5 A;  4ULV A;  3M4B A;  3DE9 A;  3M4C A;  5JVE A;  1NBB A;  1JAF A;  5JT4 A;  4CDV A;  4JEB A;  3ZTM A;  2XL8 A;  4CX9 A;  3C63 A;  1BBH A;  4IAQ A;  4CJG A;  4IAR A;  1GQA A;  3TOL A;  5JSL A;  4D4X A;  3C62 A;  4JE9 A;  5AGF A;  1YZC A;  2YL0 A;  4D4N A;  2J9B A;  4WGY A;  4CDY A;  1CGN A;  3QVY A;  1APC A;  5JS5 A;  1E83 A;  4N4W A;  3QW1 A;  2XLV A;  4ER9 A;  4JKV A;  3HNI A;  3M15 A;  3FOP A;  2XLW A;  1RCP A;  3ZQV A;  1E85 A;  3FOO A;  3HNK A;  3HNL A;  5JRA A;  2XM0 A;  2XL6 A;  2XM4 A;  4JEA A;  4N6H A;  3ZQY A;  1QQ3 A;  4EIY A;  1MQV A;  3ZTZ A;  4IB4 A;  4CJO A;  2YLG A;  1E86 A;  5JP7 A;  3QW0 A;  3TOM A;  4NC3 A;  1QPU A;  4U9D A;  2YL7 A;  3U8P A;  2YL3 A;  3IQ6 A;  3VRC A;  3M79 A;  2XLO A;  1EKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...