3NMIA

Crystal structure of the phenanthroline-modified cytochrome cb562 variant, mbp-phen2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFAILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Porous protein frameworks with unsaturated metal centers in sterically encumbered coordination sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 45
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3nmiA00
4L6RA 2XLHA 1A7VA 5AGFA 1YYJA 2YL7A 5JT4A 3C62A 1CGOA 3TOLA 4CDYA 2CCYA 1NBBA 1S05A 4N4WA 1YZCA 2XLWA 3NMJA 4U9DA 2YL1A 5JS5A 3IQ6A 3DE9A 4IARA 4JEAA 1CGNA 3M4CA 4CIPA 1LM3B 3QVZA 4IAQA 1QQ3A 5JUAA 2YLGA 3L1MA 4JEBA 1JAFA 4WGYA 4D4NA 2YL3A 2XM0A 3NMKA 1MQVA 4WGZA 4ER9A 1E84A 3M15A 3ZWIA 4D4XA 256BA 2XLMA 3IQ5A 1YZAA 1M6TA 4JKVA 3ZQYA 3M4BA 2J8WA 3QW0A 1RCPA 2YKZA 4CDVA 5JVEA 1APCA 2QLAA 2XLOA 1YYXA 4CJOA 2XLEA 2YLDA 3TOMA 2YLIA 5JLIA 3ZQVA 4U9EA 3QVYA 4N6HA 4NC3A 1CPQA 1CPRA 3ZTMA 1GQAA 2XLDA 2XL6A 5JSLA 1E86A 3FOOA 3VRCA 4JE9A 3M79A 4CX9A 3HNJA 2XL8A 3HNLA 1QPUA 5JRAA 4CJGA 1EKYA 3QW1A 2XM4A 3NMIA 3HNIA 1E85A 3ZTZA 2J9BA 3FOPA 3DE8A 4EIYA 5JP7A 2XLVA 1BBHA 4ULVA 4IB4A 2YL0A 3HNKA 4CDAA 5B3IA 1E83A 3C63A 2BC5A 3U8PA
chains in the Genus database with same CATH superfamily
2HFIA 2C03A 4DVYP 1OQCA 1YA9A 2A6EF 1AVOB 3UMKA 4KBLA 2R7XA 3NKDA 2IOQA 3JTLO 2PBEA 1ZHZA 3ZIBA 1ORJA 4DOZA 1B68A 1MMAA 4PJNA 4ULWA 3K1HA 5E33A 3LNMB 5KYUB 3E70C 4CBEA 3RVYA 2R7SA 1SZIA 4C3DA 2AWYA 1DOVA 1V54C 3ZG1A 1D0ZA 3GWNA 4N4WA 1YZCA 2I15A 3NMJA 2VASA 4MVUA 3WODF 4FESA 1V55C 1LVKA 3EFOA 4E0IA 2R7VA 2EIJC 3C18A 1M2OA 2KGOA 5JS5A 2IBFA 4LDQA 1LPEA 4JTCB 2FAPB 5FZTA 3NKEA 2R7OA 3LNRA 2O9XA 3U3FA 3PHF2 4YK5A 1ST6A 3W8HA 4C3BA 4LDRA 3GEIA 2YHSA 4HE8D 1YDIA 3KMIA 4HFFB 5JUAA 2KK1A 2YLGA 4BJ5A 3AG2C 2J9VA 1SF8A 3LS0A 1Z23A 4YT2A 1OCCC 1JAFA 4JEBA 4WGYA 4BG0A 4D4NA 3G4ZA 3I5QA 2XM0A 3NMKA 1OCOC 4YL0A 5K0IA 1MQVA 2EPOA 4JIOA 1E2XA 1YARO 1RKEA 1U89A 3QZCA 3AG1C 3W2WA 2R7UA 3ZWIA 2W45A 3IEEA 1MNDA 4FWVA 4D4XA 2YRFA 4ONSA 3S27A 1VYKA 1YLMA 2R9RB 3K7DA 4QI0A 4ANJA 4MVZA 5TJ5E 1FMVA 1H6GA 1HMOA 3S84A 1T01A 3SZRA 3UNGC 2V3CC 4C7OA 1RCPA 2WZFA 5E3AA 1APCA 2VCCA 2OG2A 2KYHA 1Q0DA 1VOMA 2EPMX 3TOMA 4OIQF 4YT5A 2VCAA 3EGDA 1S7ZA 1ZZPA 4FX5A 3RF3A 3L8IA 3ZQVA 3EH2A 2DYSC 3MX3A 1VTMP 4I3MA 4RBNA 5D91A 1M2VA 3C8GA 1C17M 2KQ9A 4CS8A 2D4UA 2F22A 1AEPA 2EPKX 4N6HA 2AWCA 4RD9A 2G3KA 3FXHA 1BR4A 1CPRA 2P1AA 4P6IC 3LUTB 1Z5ZA 2E87A 2UUIA 4JRZA 2XLDA 4U5EE 1LE4A 1MMGA 2XL6A 4CS9A 2G3VA 2Y3BA 4N06A 4JJGA 4PFOA 3KL4A 4J7TA 2IXNA 3PCVA 3US6A 4XTKA 4KNWA 4MTGA 1SYQA 3JYHA 2IXPA 1KU2A 5T3TA 2WVNA 2BL2A 1TWAA 1K40A 1Q0GA 1ZHXA 3BRJA 3EG9A 4Q4ZF 2H7OA 3UGPA 5L0DA 1LI7A 2VB6A 5B1AC 1GS9A 3L8JA 4U5BE 2Q7RA 2L6GA 3FAPB 1ZU4A 5T3WA 3O6XA 4EHPA 4G78A 3M1CB 4JCHA 3CZ6A 2B0HA 3NDBB 5KYWB 1O87A 3HNIA 4DBRA 4LDKA 4MQ9F 3U5SA 5DQTA 4KI2A 2L7AA 1HMDA 1MMDA 2J9BA 5KYXB 3FAJA 1ZVZA 1I4ZA 3CQZA 2A69F 2ASRA 1QKRA 3GORA 2I8BA 1A41A 5GPGB 4BJ5C 4MVSA 3Q6NA 4U5CE 1OW7A 3I5PA 1J8MF 4N6CA 3LESA 3H65A 4C3EA 2MWQA 3MYIA 3AQBA 2LQGA 2YVKA 4XQ1A 3SXZA 3VF0A 5DS6A 1XZPA 2QNLA 3LLIA 4E7ZA 2NSGA 2R7WA 1HE1A 3LS1A 1TWHA 3TK0A 2WVOA 3RKOF 3SXKA 2OQMA 1MNEA 4L6RA 2PFDA 1A7VA 1YJGA 3AGUA 4O6MA 4CS7A 4MVMA 2EIKC 3MYFA 3RFYA 2RD9A 5A6KA 2ICWG 3GANA 4JZAA 5KYYB 5T1DB 1KNYA 3O55A 1VK5A 2M4EA 3C62A 4IJJA 4OIPF 4G0HA 4IAOA 4JURI 1UFBA 2HS5A 3O10A 4H54A 4O79A 2L6FA 5COGA 3TOLA 4CDYA 2CDQA 1J8YF 4CS8C 5L0GA 2GFHA 2IYLD 1FNTc 2YWAA 3N24A 3X2QC 2YZSA 4O6NA 2HKVA 2J7PA 2YL1A 1W2WA 3EGXA 3W4YA 4DRJB 3AJMA 5F5FA 2HMQA 3GM2A 1G4WR 3IQ6A 3DE9A 4EBKA 1ZW2A 2J46A 3RVZA 3LJBA 2QE9A 3DAFA 4CS9C 1ZYRF 4EWCA 3QMKA 2OOCA 3RYLA 1Q0KA 5A6BA 3B0PA 1PD0A 2ZXRA 2XS1A 1ORYA 4E7SA 3B9QA 2QY9A 5A69A 5AC5A 3DJNB 1WASA 2XL4A 4GYTA 1VLTA 3S28A 3L1MA 3OA1A 4XPXA 1H9GA 1JR8A 3GM3A 2WB7A 3EHMA 3G50A 3OWTA 4FAPB 3MLGA 4WGZA 1Q0MA 1E84A 4E17A 3U3BA 3V7OA 3T4RA 2DB4A 4P9FA 4UDVA 1HE9A 3A11A 4X0RA 4P9TA 4Z9IA 4A4AA 1RJ9B 1D1CA 1YZAA 3C7JA 4JKVA 4BJ6A 3SXMA 2H7VC 2W4BA 5B1BC 2YKZA 3AQCA 2PP4A 4K7BA 4CDVA 2OCCC 1M56C 2EIMC 1PD1A 1T6UA 2XLEA 3V5XA 3N0TA 4GQHA 2R7TA 4U5GA 4MTOA 4QDLA 2GA0A 1OR3A 5COFA 2L9JA 4MVOA 2J7PD 1Y6DA 2X0CA 3U9MA 5DVWA 3ASOC 1BDJB 3UMIA 1RKEB 4KC9A 5CIVA 1MMNA 3ZTMA 4OIRF 2A0BA 3HTKC 2Y3GA 1GQAA 2CYDA 2KNHA 5A6BD 2LD6A 1LE2A 2Q9AA 1NU9C 3FMSA 1YAUO 1OCZC 1Z3IX 2OJQA 3IPMO 3VRCA 1D0XA 3TJ5A 3S0XA 4C7OB 2OEVA 3ZSUA 3U0CA 4ZLDA 4RDAA 1Z63A 3PMRA 2Q9CA 1HW1A 1LS4A 1F1MA 3KPHA 1OKKA 4HEAJ 5E3CA 4EBBA 2PX3A 5HV9A 2KW3C 1XWJA 4K0DA 4PR9A 3U9JA 4EUKB 3JT1A 1M2VB 3AG3C 3C8GB 1QPUA 2DGJA 3U2MA 2HMZA 3DXJF 5EGYA 4OINF 4R32A 5BQGA 2H8AA 3QW1A 1Z6AA 5A6AA 3RW0A 1V4AA 2P61A 1ORSC 2W4MA 3HJCA 4I44A 2Z15A 3FDQA 3Q6MA 3S29A 3FOPA 2Q3TA 4EIYA 3WG7C 2YEVA 5HSWA 1U0BB 5JP7A 3ABMC 2Q4FA 2MHRA 3T6BA 4PFPA 2HZ8A 2XLVA 3IQTA 1YA7O 1QLEC 2J0WA 3EG9B 1EI7A 4IWBA 1BBHA 2LIGA 4I1MA 3RQGA 3BEHA 1OXBA 4EBJA 4IB4A 1OCRC 2YL0A 3W8IA 4CDAA 4E0HA 3CAXA 3KYIA 2Y3HA 3LEOA 2L6HA 1BR2A 2GWWA 3G4XA 3JSZA 4WABA 1VLSA 3ABLC 3EJNA 3FVYA 3DM5A 4BJ6C 2NUPB 2EILC 4DRHB 3TJ6A 1JRAA 4JW1A 1RXQA 2FFHA 2JX0A 4XLNF 3U8VA 4PJMA 1FAPB 2IXMA 3JRMO 4OD5A 5IY5C 2UUHA 2PX0A 2AP3A 1CGOA 1T5OA 3MBGA 1XZQA 1OKKD 5DS5A 2HSQA 1RMVA 1FTSA 2CCYA 2OJED 2LFDA 1NG1A 3VM6A 1R4TA 1S05A 3DAGA 2XLWA 2OEXA 3ZDLA 2C04A 4NQFA 2ZPAA 1NZEA 4U9DA 5L0CA 3UMHA 3NYMA 2A0UA 4XEKA 2JD3A 3SYNA 1CGNA 1TR2A 3M4CA 4J30B 5EK0A 2Y39A 1AUEA 4CIPA 4DJ9A 2XSEA 1WWPA 3TQOA 1QZXA 1GM5A 4Q7CA 1LM3B 1K05A 1Y4CA 4I1OB 2HV7A 1WOLA 2ZXOA 3QVZA 4IAQA 3IQCA 4JC7A 4MNDA 3B0UX 4DRIB 2GAQA 5BQIA 5DLJA 3VAYA 4AL1A 3DWWA 4MTFA 3T6GB 1IZMA 2XS8A 2YL3A 4G7ZF 2NSFA 5DQZA 5COMA 3B0VC 3EZHA 5KYXA 2XXAA 2NUTB 2HJ3A 2MYSA 3EGXB 1WTYA 3M15A 3O39A 4W8PA 3TD7A 4BPMA 256BA 2TMVP 1ZU5A 3POVA 2A6HF 5DS4A 3H2UA 3CSKA 2AU5A 1TKNA 1A7EA 1O5HA 2J8WA 3QW0A 5L3QA 1FR0A 1C02A 1SMYF 2LFFA 3DMDA 4JCZA 4K1OA 4CJOA 5L0IA 2EPLX 1RKCA 3K1IA 2VH3A 2J0XA 4JVSA 3JZ0A 4YL3A 1TFKB 3DI5A 3PDMP 4OIOF 3S9OA 3CEXA 3GWLA 2EPNA 3A9CA 3ATPA 2Y69C 4YL1A 4U5HA 4MVQA 4AE4A 4DXWA 3R7CA 2EINC 3UR3C 1CPQA 3W2VA 1I5NA 2PF4E 4PJLA 5CI9A 4XEVA 4XWJA 3T9OA 4DBQA 2IM8A 2V26A 4OD4A 1TQGA 1C03A 3EFOB 5JSLA 1E86A 1L7CA 4YT8A 5CI8A 4LLEA 4MW8A 2BE5F 3LEVA 3ITFA 2CNWA 3ZC4A 1EQ1A 1G4US 3M79A 3QTHA 3R2PA 4G7OF 1OW6A 2P7VA 3F46A 4JTDB 4DVZA 1LIHA 3ECSA 2J45A 1BR1A 2LP4A 2Y3DA 3SNHA 4Q5SF 1T6QA 1WATA 2X51A 2XL8A 3DKAA 4NTBA 2ZXPA 3RIPA 5JRAA 2AVKA 1G8XA 1OR2A 3DJUB 3KYJA 2HJMA 2NG1A 3K6BA 4O7GA 4BEMJ 2XM4A 3NG1A 2R02A 1ZHYA 3NMIA 3Q7LA 3NYLA 3DE8A 5KYUA 1WN0A 3AOUA 1FFTC 4JJFA 1PCXA 2WZLA 3EZIA 1RJ9A 3L0IA 3B29A 4ULVA 5D92A 2J9UA 2YQYA 3HNKA 2CW0F 4W8KA 4ZLCA 1QVXA 4AX2A 1E83A 1I4YA 3C63A 3EGDB 4E18A 2IXOA 3ZTZA 1TFOB 3DZAA 3L34A 1JMWA 4YT4A 2XLHA 2W9YA 5AGFA 1IW7F 2WZGA 1NU7D 3SEOA 3TULA 1YYJA 5A6JA 2A1DD 3RQFA 2R7RA 2YL7A 3OEOA 2HUJA 3GM1A 3GEHA 4LERA 2CNWD 4PJJA 3K1IC 5JT4A 1H9TA 3V5ZA 3EHNA 4NY3A 2R7QA 3IHUA 1G5ZA 4XLPF 3MFNA 1NBBA 4AL0A 3WHNA 2CGEA 2LSEA 4LACB 3SXYA 3E9VA 3ZVRA 5L0FA 1QSPA 1ZW3A 2RSEB 1N1CA 4IARA 4CSAA 4JEAA 4YWQA 1WGWA 1D1BA 3GEEA 1SR2A 4PK4A 3J06A 2KC3A 2A68F 4KNVA 4MW3A 1LS1A 1QQ3A 2LCHA 4Z9JA 2VC9A 2DYRC 3K66A 1BZ4A 2D5RB 4U5FE 3KH2A 3U2LA 1FMWA 3N2ZB 4WJ0A 3V5YA 1M57C 2H7BA 1JOGA 3JRTA 4ER9A 1H7IA 3JSEO 1TWCA 2J9WA 2P0NA 1NLXA 4A2NB 5B3SC 4BJTA 3C8ZA 4G7HF 2XLMA 1CGME 3FHDA 3IQ5A 2XXAB 4PACA 1A7DA 1M6TA 4HFKB 2Q9BA 3ZQYA 1GGQA 3M4BA 2JPUA 4B6IA 5AC4A 3EPVA 2HV6A 2Q00A 5JVEA 4O6YA 2QLAA 4QI2A 1YYXA 2XLOA 1T9KA 4NTFA 2YLDA 1K04A 2YLIA 4XEFA 4YN0B 5L0JA 5KYNA 3WAQA 5JLIA 3Q7GA 1L3PA 1U6HA 5L3VA 4CIHA 3HLZA 2NPUA 3VYWA 2G62A 2NUPA 4JTAB 4U9EA 2WVQA 3QVYA 3DM9B 2L81A 2LK4A 3GODA 4XPYA 5L0HA 1NFNA 4NC3A 3LAYA 4BJ1A 1T6IA 4NCQA 5BUOA 5FCLA 1VYIA 2OKUA 5KYWA 1FFHA 1KTMA 1DOWA 3I4UA 5BQHA 3LLKA 3EH1A 1LI5A 1A0BA 3UGOA 5E2QA 3FOOA 2GDCA 3C8GD 3KKBA 1VMAA 2KSFA 2WL8A 1EA8A 2M64A 2ZD9A 3DD7A 3EQLF 3S90A 4JE9A 4M63A 3K33A 1D1AA 1UG7A 1LKXA 1OW8A 4CX9A 4MVRA 2QUPA 1HW2A 4GEHA 1NSGB 1R5ID 1VB5A 2P6VA 2ETSA 3HNJA 4J32B 3HNLA 5F28E 4EKWA 3NYJA 1TWGA 4J7YA 1ZHTA 1NFOA 2ZXWC 3RH3A 3X1OA 4CJGA 1Z7Qc 5EHHA 4XPWA 4AE4B 4CSAC 4BEJA 1EKYA 2VCBA 2R25A 1Q0FA 2FGYA 4F4BA 1E85A 3NRHA 2XRHA 5KYYA 2PNOA 3F47A 1D0YA 3JYYA 2KJGA 4NTAA 4U5DE 3ABKC 1YVIA 2DI3A 3ASNC 4MS2A 3AG4C 1JPJA 3AGTA 4Z9HA 4AK9A 2OU6A 1ZHWA 4LLCA 1O3UA 2NUTA 1OXKA 2B0JA 4IGGA 1V74B 1JPNA 1PV3A 2R03A 3RQEA 4IRUA 3B71A 3T6JA 3JCUQ 2HSBA 3H2VA 5B3IA 4H4KC 1HY5A 2QTVA 3SP1A 5F5HA 3HKKA 2R05A 2BC5A 3U8PA 4YJWA
chains in the Genus database with same CATH topology
4L6RA 2XLHA 1A7VA 5AGFA 1YYJA 2YL7A 5JT4A 3C62A 1CGOA 3TOLA 4CDYA 2CCYA 1NBBA 1S05A 4N4WA 1YZCA 2XLWA 3NMJA 4U9DA 2YL1A 5JS5A 3IQ6A 3DE9A 4IARA 4JEAA 1CGNA 3M4CA 4CIPA 1LM3B 3QVZA 4IAQA 1QQ3A 5JUAA 2YLGA 3L1MA 4JEBA 1JAFA 4WGYA 4D4NA 2YL3A 2XM0A 3NMKA 1MQVA 4WGZA 4ER9A 1E84A 3M15A 3ZWIA 4D4XA 256BA 2XLMA 3IQ5A 1YZAA 1M6TA 4JKVA 3ZQYA 3M4BA 2J8WA 3QW0A 1RCPA 2YKZA 4CDVA 5JVEA 1APCA 2QLAA 2XLOA 1YYXA 4CJOA 2XLEA 2YLDA 3TOMA 2YLIA 5JLIA 3ZQVA 4U9EA 3QVYA 4N6HA 4NC3A 1CPQA 1CPRA 3ZTMA 1GQAA 2XLDA 2XL6A 5JSLA 1E86A 3FOOA 3VRCA 4JE9A 3M79A 4CX9A 3HNJA 2XL8A 3HNLA 1QPUA 5JRAA 4CJGA 1EKYA 3QW1A 2XM4A 3NMIA 3HNIA 1E85A 3ZTZA 2J9BA 3FOPA 3DE8A 4EIYA 5JP7A 2XLVA 1BBHA 4ULVA 4IB4A 2YL0A 3HNKA 4CDAA 5B3IA 1E83A 3C63A 2BC5A 3U8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L6R A;  2XLH A;  1A7V A;  5AGF A;  1YYJ A;  2YL7 A;  5JT4 A;  3C62 A;  1CGO A;  3TOL A;  4CDY A;  2CCY A;  1NBB A;  1S05 A;  4N4W A;  1YZC A;  2XLW A;  3NMJ A;  4U9D A;  2YL1 A;  5JS5 A;  3IQ6 A;  3DE9 A;  4IAR A;  4JEA A;  1CGN A;  3M4C A;  4CIP A;  1LM3 B;  3QVZ A;  4IAQ A;  1QQ3 A;  5JUA A;  2YLG A;  3L1M A;  4JEB A;  1JAF A;  4WGY A;  4D4N A;  2YL3 A;  2XM0 A;  3NMK A;  1MQV A;  4WGZ A;  4ER9 A;  1E84 A;  3M15 A;  3ZWI A;  4D4X A;  256B A;  2XLM A;  3IQ5 A;  1YZA A;  1M6T A;  4JKV A;  3ZQY A;  3M4B A;  2J8W A;  3QW0 A;  1RCP A;  2YKZ A;  4CDV A;  5JVE A;  1APC A;  2QLA A;  2XLO A;  1YYX A;  4CJO A;  2XLE A;  2YLD A;  3TOM A;  2YLI A;  5JLI A;  3ZQV A;  4U9E A;  3QVY A;  4N6H A;  4NC3 A;  1CPQ A;  1CPR A;  3ZTM A;  1GQA A;  2XLD A;  2XL6 A;  5JSL A;  1E86 A;  3FOO A;  3VRC A;  4JE9 A;  3M79 A;  4CX9 A;  3HNJ A;  2XL8 A;  3HNL A;  1QPU A;  5JRA A;  4CJG A;  1EKY A;  3QW1 A;  2XM4 A;  3NMI A;  3HNI A;  1E85 A;  3ZTZ A;  2J9B A;  3FOP A;  3DE8 A;  4EIY A;  5JP7 A;  2XLV A;  1BBH A;  4ULV A;  4IB4 A;  2YL0 A;  3HNK A;  4CDA A;  5B3I A;  1E83 A;  3C63 A;  2BC5 A;  3U8P A; 
#chains in the Genus database with same CATH topology
 2HFI A;  2C03 A;  4DVY P;  1OQC A;  1YA9 A;  2A6E F;  1AVO B;  3UMK A;  4KBL A;  2R7X A;  3NKD A;  2IOQ A;  3JTL O;  2PBE A;  1ZHZ A;  3ZIB A;  1ORJ A;  4DOZ A;  1B68 A;  1MMA A;  4PJN A;  4ULW A;  3K1H A;  5E33 A;  3LNM B;  5KYU B;  3E70 C;  4CBE A;  3RVY A;  2R7S A;  1SZI A;  4C3D A;  2AWY A;  1DOV A;  1V54 C;  3ZG1 A;  1D0Z A;  3GWN A;  4N4W A;  1YZC A;  2I15 A;  3NMJ A;  2VAS A;  4MVU A;  3WOD F;  4FES A;  1V55 C;  1LVK A;  3EFO A;  4E0I A;  2R7V A;  2EIJ C;  3C18 A;  1M2O A;  2KGO A;  5JS5 A;  2IBF A;  4LDQ A;  1LPE A;  4JTC B;  2FAP B;  5FZT A;  3NKE A;  2R7O A;  3LNR A;  2O9X A;  3U3F A;  3PHF 2;  4YK5 A;  1ST6 A;  3W8H A;  4C3B A;  4LDR A;  3GEI A;  2YHS A;  4HE8 D;  1YDI A;  3KMI A;  4HFF B;  5JUA A;  2KK1 A;  2YLG A;  4BJ5 A;  3AG2 C;  2J9V A;  1SF8 A;  3LS0 A;  1Z23 A;  4YT2 A;  1OCC C;  1JAF A;  4JEB A;  4WGY A;  4BG0 A;  4D4N A;  3G4Z A;  3I5Q A;  2XM0 A;  3NMK A;  1OCO C;  4YL0 A;  5K0I A;  1MQV A;  2EPO A;  4JIO A;  1E2X A;  1YAR O;  1RKE A;  1U89 A;  3QZC A;  3AG1 C;  3W2W A;  2R7U A;  3ZWI A;  2W45 A;  3IEE A;  1MND A;  4FWV A;  4D4X A;  2YRF A;  4ONS A;  3S27 A;  1VYK A;  1YLM A;  2R9R B;  3K7D A;  4QI0 A;  4ANJ A;  4MVZ A;  5TJ5 E;  1FMV A;  1H6G A;  1HMO A;  3S84 A;  1T01 A;  3SZR A;  3UNG C;  2V3C C;  4C7O A;  1RCP A;  2WZF A;  5E3A A;  1APC A;  2VCC A;  2OG2 A;  2KYH A;  1Q0D A;  1VOM A;  2EPM X;  3TOM A;  4OIQ F;  4YT5 A;  2VCA A;  3EGD A;  1S7Z A;  1ZZP A;  4FX5 A;  3RF3 A;  3L8I A;  3ZQV A;  3EH2 A;  2DYS C;  3MX3 A;  1VTM P;  4I3M A;  4RBN A;  5D91 A;  1M2V A;  3C8G A;  1C17 M;  2KQ9 A;  4CS8 A;  2D4U A;  2F22 A;  1AEP A;  2EPK X;  4N6H A;  2AWC A;  4RD9 A;  2G3K A;  3FXH A;  1BR4 A;  1CPR A;  2P1A A;  4P6I C;  3LUT B;  1Z5Z A;  2E87 A;  2UUI A;  4JRZ A;  2XLD A;  4U5E E;  1LE4 A;  1MMG A;  2XL6 A;  4CS9 A;  2G3V A;  2Y3B A;  4N06 A;  4JJG A;  4PFO A;  3KL4 A;  4J7T A;  2IXN A;  3PCV A;  3US6 A;  4XTK A;  4KNW A;  4MTG A;  1SYQ A;  3JYH A;  2IXP A;  1KU2 A;  5T3T A;  2WVN A;  2BL2 A;  1TWA A;  1K40 A;  1Q0G A;  1ZHX A;  3BRJ A;  3EG9 A;  4Q4Z F;  2H7O A;  3UGP A;  5L0D A;  1LI7 A;  2VB6 A;  5B1A C;  1GS9 A;  3L8J A;  4U5B E;  2Q7R A;  2L6G A;  3FAP B;  1ZU4 A;  5T3W A;  3O6X A;  4EHP A;  4G78 A;  3M1C B;  4JCH A;  3CZ6 A;  2B0H A;  3NDB B;  5KYW B;  1O87 A;  3HNI A;  4DBR A;  4LDK A;  4MQ9 F;  3U5S A;  5DQT A;  4KI2 A;  2L7A A;  1HMD A;  1MMD A;  2J9B A;  5KYX B;  3FAJ A;  1ZVZ A;  1I4Z A;  3CQZ A;  2A69 F;  2ASR A;  1QKR A;  3GOR A;  2I8B A;  1A41 A;  5GPG B;  4BJ5 C;  4MVS A;  3Q6N A;  4U5C E;  1OW7 A;  3I5P A;  1J8M F;  4N6C A;  3LES A;  3H65 A;  4C3E A;  2MWQ A;  3MYI A;  3AQB A;  2LQG A;  2YVK A;  4XQ1 A;  3SXZ A;  3VF0 A;  5DS6 A;  1XZP A;  2QNL A;  3LLI A;  4E7Z A;  2NSG A;  2R7W A;  1HE1 A;  3LS1 A;  1TWH A;  3TK0 A;  2WVO A;  3RKO F;  3SXK A;  2OQM A;  1MNE A;  4L6R A;  2PFD A;  1A7V A;  1YJG A;  3AGU A;  4O6M A;  4CS7 A;  4MVM A;  2EIK C;  3MYF A;  3RFY A;  2RD9 A;  5A6K A;  2ICW G;  3GAN A;  4JZA A;  5KYY B;  5T1D B;  1KNY A;  3O55 A;  1VK5 A;  2M4E A;  3C62 A;  4IJJ A;  4OIP F;  4G0H A;  4IAO A;  4JUR I;  1UFB A;  2HS5 A;  3O10 A;  4H54 A;  4O79 A;  2L6F A;  5COG A;  3TOL A;  4CDY A;  2CDQ A;  1J8Y F;  4CS8 C;  5L0G A;  2GFH A;  2IYL D;  1FNT c;  2YWA A;  3N24 A;  3X2Q C;  2YZS A;  4O6N A;  2HKV A;  2J7P A;  2YL1 A;  1W2W A;  3EGX A;  3W4Y A;  4DRJ B;  3AJM A;  5F5F A;  2HMQ A;  3GM2 A;  1G4W R;  3IQ6 A;  3DE9 A;  4EBK A;  1ZW2 A;  2J46 A;  3RVZ A;  3LJB A;  2QE9 A;  3DAF A;  4CS9 C;  1ZYR F;  4EWC A;  3QMK A;  2OOC A;  3RYL A;  1Q0K A;  5A6B A;  3B0P A;  1PD0 A;  2ZXR A;  2XS1 A;  1ORY A;  4E7S A;  3B9Q A;  2QY9 A;  5A69 A;  5AC5 A;  3DJN B;  1WAS A;  2XL4 A;  4GYT A;  1VLT A;  3S28 A;  3L1M A;  3OA1 A;  4XPX A;  1H9G A;  1JR8 A;  3GM3 A;  2WB7 A;  3EHM A;  3G50 A;  3OWT A;  4FAP B;  3MLG A;  4WGZ A;  1Q0M A;  1E84 A;  4E17 A;  3U3B A;  3V7O A;  3T4R A;  2DB4 A;  4P9F A;  4UDV A;  1HE9 A;  3A11 A;  4X0R A;  4P9T A;  4Z9I A;  4A4A A;  1RJ9 B;  1D1C A;  1YZA A;  3C7J A;  4JKV A;  4BJ6 A;  3SXM A;  2H7V C;  2W4B A;  5B1B C;  2YKZ A;  3AQC A;  2PP4 A;  4K7B A;  4CDV A;  2OCC C;  1M56 C;  2EIM C;  1PD1 A;  1T6U A;  2XLE A;  3V5X A;  3N0T A;  4GQH A;  2R7T A;  4U5G A;  4MTO A;  4QDL A;  2GA0 A;  1OR3 A;  5COF A;  2L9J A;  4MVO A;  2J7P D;  1Y6D A;  2X0C A;  3U9M A;  5DVW A;  3ASO C;  1BDJ B;  3UMI A;  1RKE B;  4KC9 A;  5CIV A;  1MMN A;  3ZTM A;  4OIR F;  2A0B A;  3HTK C;  2Y3G A;  1GQA A;  2CYD A;  2KNH A;  5A6B D;  2LD6 A;  1LE2 A;  2Q9A A;  1NU9 C;  3FMS A;  1YAU O;  1OCZ C;  1Z3I X;  2OJQ A;  3IPM O;  3VRC A;  1D0X A;  3TJ5 A;  3S0X A;  4C7O B;  2OEV A;  3ZSU A;  3U0C A;  4ZLD A;  4RDA A;  1Z63 A;  3PMR A;  2Q9C A;  1HW1 A;  1LS4 A;  1F1M A;  3KPH A;  1OKK A;  4HEA J;  5E3C A;  4EBB A;  2PX3 A;  5HV9 A;  2KW3 C;  1XWJ A;  4K0D A;  4PR9 A;  3U9J A;  4EUK B;  3JT1 A;  1M2V B;  3AG3 C;  3C8G B;  1QPU A;  2DGJ A;  3U2M A;  2HMZ A;  3DXJ F;  5EGY A;  4OIN F;  4R32 A;  5BQG A;  2H8A A;  3QW1 A;  1Z6A A;  5A6A A;  3RW0 A;  1V4A A;  2P61 A;  1ORS C;  2W4M A;  3HJC A;  4I44 A;  2Z15 A;  3FDQ A;  3Q6M A;  3S29 A;  3FOP A;  2Q3T A;  4EIY A;  3WG7 C;  2YEV A;  5HSW A;  1U0B B;  5JP7 A;  3ABM C;  2Q4F A;  2MHR A;  3T6B A;  4PFP A;  2HZ8 A;  2XLV A;  3IQT A;  1YA7 O;  1QLE C;  2J0W A;  3EG9 B;  1EI7 A;  4IWB A;  1BBH A;  2LIG A;  4I1M A;  3RQG A;  3BEH A;  1OXB A;  4EBJ A;  4IB4 A;  1OCR C;  2YL0 A;  3W8I A;  4CDA A;  4E0H A;  3CAX A;  3KYI A;  2Y3H A;  3LEO A;  2L6H A;  1BR2 A;  2GWW A;  3G4X A;  3JSZ A;  4WAB A;  1VLS A;  3ABL C;  3EJN A;  3FVY A;  3DM5 A;  4BJ6 C;  2NUP B;  2EIL C;  4DRH B;  3TJ6 A;  1JRA A;  4JW1 A;  1RXQ A;  2FFH A;  2JX0 A;  4XLN F;  3U8V A;  4PJM A;  1FAP B;  2IXM A;  3JRM O;  4OD5 A;  5IY5 C;  2UUH A;  2PX0 A;  2AP3 A;  1CGO A;  1T5O A;  3MBG A;  1XZQ A;  1OKK D;  5DS5 A;  2HSQ A;  1RMV A;  1FTS A;  2CCY A;  2OJE D;  2LFD A;  1NG1 A;  3VM6 A;  1R4T A;  1S05 A;  3DAG A;  2XLW A;  2OEX A;  3ZDL A;  2C04 A;  4NQF A;  2ZPA A;  1NZE A;  4U9D A;  5L0C A;  3UMH A;  3NYM A;  2A0U A;  4XEK A;  2JD3 A;  3SYN A;  1CGN A;  1TR2 A;  3M4C A;  4J30 B;  5EK0 A;  2Y39 A;  1AUE A;  4CIP A;  4DJ9 A;  2XSE A;  1WWP A;  3TQO A;  1QZX A;  1GM5 A;  4Q7C A;  1LM3 B;  1K05 A;  1Y4C A;  4I1O B;  2HV7 A;  1WOL A;  2ZXO A;  3QVZ A;  4IAQ A;  3IQC A;  4JC7 A;  4MND A;  3B0U X;  4DRI B;  2GAQ A;  5BQI A;  5DLJ A;  3VAY A;  4AL1 A;  3DWW A;  4MTF A;  3T6G B;  1IZM A;  2XS8 A;  2YL3 A;  4G7Z F;  2NSF A;  5DQZ A;  5COM A;  3B0V C;  3EZH A;  5KYX A;  2XXA A;  2NUT B;  2HJ3 A;  2MYS A;  3EGX B;  1WTY A;  3M15 A;  3O39 A;  4W8P A;  3TD7 A;  4BPM A;  256B A;  2TMV P;  1ZU5 A;  3POV A;  2A6H F;  5DS4 A;  3H2U A;  3CSK A;  2AU5 A;  1TKN A;  1A7E A;  1O5H A;  2J8W A;  3QW0 A;  5L3Q A;  1FR0 A;  1C02 A;  1SMY F;  2LFF A;  3DMD A;  4JCZ A;  4K1O A;  4CJO A;  5L0I A;  2EPL X;  1RKC A;  3K1I A;  2VH3 A;  2J0X A;  4JVS A;  3JZ0 A;  4YL3 A;  1TFK B;  3DI5 A;  3PDM P;  4OIO F;  3S9O A;  3CEX A;  3GWL A;  2EPN A;  3A9C A;  3ATP A;  2Y69 C;  4YL1 A;  4U5H A;  4MVQ A;  4AE4 A;  4DXW A;  3R7C A;  2EIN C;  3UR3 C;  1CPQ A;  3W2V A;  1I5N A;  2PF4 E;  4PJL A;  5CI9 A;  4XEV A;  4XWJ A;  3T9O A;  4DBQ A;  2IM8 A;  2V26 A;  4OD4 A;  1TQG A;  1C03 A;  3EFO B;  5JSL A;  1E86 A;  1L7C A;  4YT8 A;  5CI8 A;  4LLE A;  4MW8 A;  2BE5 F;  3LEV A;  3ITF A;  2CNW A;  3ZC4 A;  1EQ1 A;  1G4U S;  3M79 A;  3QTH A;  3R2P A;  4G7O F;  1OW6 A;  2P7V A;  3F46 A;  4JTD B;  4DVZ A;  1LIH A;  3ECS A;  2J45 A;  1BR1 A;  2LP4 A;  2Y3D A;  3SNH A;  4Q5S F;  1T6Q A;  1WAT A;  2X51 A;  2XL8 A;  3DKA A;  4NTB A;  2ZXP A;  3RIP A;  5JRA A;  2AVK A;  1G8X A;  1OR2 A;  3DJU B;  3KYJ A;  2HJM A;  2NG1 A;  3K6B A;  4O7G A;  4BEM J;  2XM4 A;  3NG1 A;  2R02 A;  1ZHY A;  3NMI A;  3Q7L A;  3NYL A;  3DE8 A;  5KYU A;  1WN0 A;  3AOU A;  1FFT C;  4JJF A;  1PCX A;  2WZL A;  3EZI A;  1RJ9 A;  3L0I A;  3B29 A;  4ULV A;  5D92 A;  2J9U A;  2YQY A;  3HNK A;  2CW0 F;  4W8K A;  4ZLC A;  1QVX A;  4AX2 A;  1E83 A;  1I4Y A;  3C63 A;  3EGD B;  4E18 A;  2IXO A;  3ZTZ A;  1TFO B;  3DZA A;  3L34 A;  1JMW A;  4YT4 A;  2XLH A;  2W9Y A;  5AGF A;  1IW7 F;  2WZG A;  1NU7 D;  3SEO A;  3TUL A;  1YYJ A;  5A6J A;  2A1D D;  3RQF A;  2R7R A;  2YL7 A;  3OEO A;  2HUJ A;  3GM1 A;  3GEH A;  4LER A;  2CNW D;  4PJJ A;  3K1I C;  5JT4 A;  1H9T A;  3V5Z A;  3EHN A;  4NY3 A;  2R7Q A;  3IHU A;  1G5Z A;  4XLP F;  3MFN A;  1NBB A;  4AL0 A;  3WHN A;  2CGE A;  2LSE A;  4LAC B;  3SXY A;  3E9V A;  3ZVR A;  5L0F A;  1QSP A;  1ZW3 A;  2RSE B;  1N1C A;  4IAR A;  4CSA A;  4JEA A;  4YWQ A;  1WGW A;  1D1B A;  3GEE A;  1SR2 A;  4PK4 A;  3J06 A;  2KC3 A;  2A68 F;  4KNV A;  4MW3 A;  1LS1 A;  1QQ3 A;  2LCH A;  4Z9J A;  2VC9 A;  2DYR C;  3K66 A;  1BZ4 A;  2D5R B;  4U5F E;  3KH2 A;  3U2L A;  1FMW A;  3N2Z B;  4WJ0 A;  3V5Y A;  1M57 C;  2H7B A;  1JOG A;  3JRT A;  4ER9 A;  1H7I A;  3JSE O;  1TWC A;  2J9W A;  2P0N A;  1NLX A;  4A2N B;  5B3S C;  4BJT A;  3C8Z A;  4G7H F;  2XLM A;  1CGM E;  3FHD A;  3IQ5 A;  2XXA B;  4PAC A;  1A7D A;  1M6T A;  4HFK B;  2Q9B A;  3ZQY A;  1GGQ A;  3M4B A;  2JPU A;  4B6I A;  5AC4 A;  3EPV A;  2HV6 A;  2Q00 A;  5JVE A;  4O6Y A;  2QLA A;  4QI2 A;  1YYX A;  2XLO A;  1T9K A;  4NTF A;  2YLD A;  1K04 A;  2YLI A;  4XEF A;  4YN0 B;  5L0J A;  5KYN A;  3WAQ A;  5JLI A;  3Q7G A;  1L3P A;  1U6H A;  5L3V A;  4CIH A;  3HLZ A;  2NPU A;  3VYW A;  2G62 A;  2NUP A;  4JTA B;  4U9E A;  2WVQ A;  3QVY A;  3DM9 B;  2L81 A;  2LK4 A;  3GOD A;  4XPY A;  5L0H A;  1NFN A;  4NC3 A;  3LAY A;  4BJ1 A;  1T6I A;  4NCQ A;  5BUO A;  5FCL A;  1VYI A;  2OKU A;  5KYW A;  1FFH A;  1KTM A;  1DOW A;  3I4U A;  5BQH A;  3LLK A;  3EH1 A;  1LI5 A;  1A0B A;  3UGO A;  5E2Q A;  3FOO A;  2GDC A;  3C8G D;  3KKB A;  1VMA A;  2KSF A;  2WL8 A;  1EA8 A;  2M64 A;  2ZD9 A;  3DD7 A;  3EQL F;  3S90 A;  4JE9 A;  4M63 A;  3K33 A;  1D1A A;  1UG7 A;  1LKX A;  1OW8 A;  4CX9 A;  4MVR A;  2QUP A;  1HW2 A;  4GEH A;  1NSG B;  1R5I D;  1VB5 A;  2P6V A;  2ETS A;  3HNJ A;  4J32 B;  3HNL A;  5F28 E;  4EKW A;  3NYJ A;  1TWG A;  4J7Y A;  1ZHT A;  1NFO A;  2ZXW C;  3RH3 A;  3X1O A;  4CJG A;  1Z7Q c;  5EHH A;  4XPW A;  4AE4 B;  4CSA C;  4BEJ A;  1EKY A;  2VCB A;  2R25 A;  1Q0F A;  2FGY A;  4F4B A;  1E85 A;  3NRH A;  2XRH A;  5KYY A;  2PNO A;  3F47 A;  1D0Y A;  3JYY A;  2KJG A;  4NTA A;  4U5D E;  3ABK C;  1YVI A;  2DI3 A;  3ASN C;  4MS2 A;  3AG4 C;  1JPJ A;  3AGT A;  4Z9H A;  4AK9 A;  2OU6 A;  1ZHW A;  4LLC A;  1O3U A;  2NUT A;  1OXK A;  2B0J A;  4IGG A;  1V74 B;  1JPN A;  1PV3 A;  2R03 A;  3RQE A;  4IRU A;  3B71 A;  3T6J A;  3JCU Q;  2HSB A;  3H2V A;  5B3I A;  4H4K C;  1HY5 A;  2QTV A;  3SP1 A;  5F5H A;  3HKK A;  2R05 A;  2BC5 A;  3U8P A;  4YJW A; 
#chains in the Genus database with same CATH homology
 4L6R A;  2XLH A;  1A7V A;  5AGF A;  1YYJ A;  2YL7 A;  5JT4 A;  3C62 A;  1CGO A;  3TOL A;  4CDY A;  2CCY A;  1NBB A;  1S05 A;  4N4W A;  1YZC A;  2XLW A;  3NMJ A;  4U9D A;  2YL1 A;  5JS5 A;  3IQ6 A;  3DE9 A;  4IAR A;  4JEA A;  1CGN A;  3M4C A;  4CIP A;  1LM3 B;  3QVZ A;  4IAQ A;  1QQ3 A;  5JUA A;  2YLG A;  3L1M A;  4JEB A;  1JAF A;  4WGY A;  4D4N A;  2YL3 A;  2XM0 A;  3NMK A;  1MQV A;  4WGZ A;  4ER9 A;  1E84 A;  3M15 A;  3ZWI A;  4D4X A;  256B A;  2XLM A;  3IQ5 A;  1YZA A;  1M6T A;  4JKV A;  3ZQY A;  3M4B A;  2J8W A;  3QW0 A;  1RCP A;  2YKZ A;  4CDV A;  5JVE A;  1APC A;  2QLA A;  2XLO A;  1YYX A;  4CJO A;  2XLE A;  2YLD A;  3TOM A;  2YLI A;  5JLI A;  3ZQV A;  4U9E A;  3QVY A;  4N6H A;  4NC3 A;  1CPQ A;  1CPR A;  3ZTM A;  1GQA A;  2XLD A;  2XL6 A;  5JSL A;  1E86 A;  3FOO A;  3VRC A;  4JE9 A;  3M79 A;  4CX9 A;  3HNJ A;  2XL8 A;  3HNL A;  1QPU A;  5JRA A;  4CJG A;  1EKY A;  3QW1 A;  2XM4 A;  3NMI A;  3HNI A;  1E85 A;  3ZTZ A;  2J9B A;  3FOP A;  3DE8 A;  4EIY A;  5JP7 A;  2XLV A;  1BBH A;  4ULV A;  4IB4 A;  2YL0 A;  3HNK A;  4CDA A;  5B3I A;  1E83 A;  3C63 A;  2BC5 A;  3U8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...