3NMIA

Crystal structure of the phenanthroline-modified cytochrome cb562 variant, mbp-phen2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFAILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
publication title Porous protein frameworks with unsaturated metal centers in sterically encumbered coordination sites.
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3nmiA00
4CJGA 1A7VA 1BBHA 3C62A 1YYXA 2YLDA 3M79A 3U8PA 256BA 4EIYA 3IQ5A 4N6HA 3NMKA 3FOOA 4CX9A 1S05A 3NMIA 3L1MA 2BC5A 3TOMA 3QVZA 3DE8A 5JUAA 3HNLA 2XL8A 1CPRA 3DE9A 4IARA 2J8WA 3HNIA 4WGYA 2XLEA 5JSLA 1CGNA 4JKVA 2CCYA 3C63A 1YZCA 3NMJA 4IAQA 4ER9A 4ULVA 3QW0A 4D4NA 2YLIA 5JS5A 1RCPA 4N4WA 1YYJA 2YKZA 4CDAA 5AGFA 2YL1A 1M6TA 2XLOA 1E86A 1GQAA 1MQVA 3FOPA 3HNKA 4U9EA 3ZTMA 2YL7A 4IB4A 5JVEA 1CGOA 5JRAA 1E85A 3IQ6A 3M4BA 2J9BA 5B3IA 3QW1A 1E84A 2XLMA 1E83A 2QLAA 2XM4A 4L6RA 5JP7A 4U9DA 1LM3B 4WGZA 3ZQYA 1JAFA 4NC3A 3ZTZA 4CDVA 3ZQVA 1NBBA 2YL0A 4CIPA 2XLVA 5JLIA 4D4XA 1APCA 1YZAA 1QPUA 1QQ3A 3TOLA 1EKYA 3M4CA 1CPQA 4JE9A 4CJOA 2XM0A 2XL6A 3ZWIA 2YL3A 2YLGA 4JEAA 2XLDA 3QVYA 2XLHA 4CDYA 2XLWA 3M15A 5JT4A 3HNJA 3VRCA 4JEBA
chains in the Genus database with same CATH superfamily
3OEOA 2VH3A 1E2XA 4CBEA 2M4EA 4CJGA 1IZMA 3L8JA 3SEOA 4NTBA 5GPGB 1ZYRF 5B3SC 1OCOC 3CZ6A 3C62A 2FGYA 3H2VA 1YYXA 2R7UA 256BA 3CEXA 4FESA 2UUIA 4EIYA 1M57C 3FDQA 2UUHA 2AWYA 1C02A 2WL8A 3FOOA 1LI5A 1NLXA 4XPXA 2LP4A 4RDAA 4YJWA 5CIVA 4I1MA 1OW8A 4AE4B 3LEOA 2WVOA 3W8HA 5DVWA 1A0BA 2BL2A 3JSEO 3ITFA 4MVRA 3TJ5A 2KNHA 2XL8A 3TULA 2Q00A 3DE9A 2P7VA 3ZSUA 1MMDA 3T6JA 3HNIA 2QUPA 3LUTB 2CCYA 4EBBA 1YZCA 4BJTA 4MVSA 2YVKA 1DOWA 1K40A 1M56C 2IOQA 2PF4E 4D4NA 2MHRA 2YLIA 5KYXA 5JS5A 1J8MF 3H65A 2A6EF 2D4UA 2LK4A 2J7PD 2H7OA 2F22A 4O6MA 5AGFA 1Z5ZA 1I5NA 1ZVZA 1BR2A 2OOCA 1LI7A 3F47A 3IQCA 2XLOA 5EHHA 1AUEA 2YWAA 3IQTA 4RBNA 1TFOB 1GQAA 4Z9HA 3FOPA 2YQYA 3KPHA 1Q0DA 3EFOB 4XLNF 3Q6MA 3OWTA 3K1HA 4OD4A 3M1CB 3Q6NA 2R25A 4IAOA 5DS6A 2R7SA 4JVSA 1U6HA 2WZLA 3GM2A 5F5HA 3NG1A 3ZIBA 3JRMO 2G62A 1OW6A 3AOUA 1O87A 1Y4CA 4WABA 4Z9IA 5A69A 4CSAC 5KYWA 2H7VC 2Q9AA 1XZPA 1W2WA 3QW1A 2KJGA 3FMSA 1GS9A 2QLAA 1BR1A 3DZAA 1TWGA 2XM4A 3KL4A 4G78A 3WHNA 5BUOA 2J9VA 3GM1A 2KQ9A 4KI2A 4CS9C 1WN0A 3B9QA 3ZQYA 2VCCA 3JSZA 2HSQA 2IM8A 4YT8A 4NC3A 1CGME 1A41A 5K0IA 4MW8A 4LLEA 1MNDA 1MMNA 3A11A 2FAPB 2M64A 4YT5A 4U5EE 4G7ZF 4ULWA 3SXMA 4BJ5C 2KC3A 4E0HA 1GM5A 3EHMA 3RKOF 2VASA 1Y6DA 1EI7A 1T9KA 2R05A 4J32B 4DBRA 5KYUB 2XXAB 1V54C 3RQFA 3IEEA 1FNTc 3UR3C 4A2NB 1E83A 3EGDB 2EINC 1YJGA 4JE9A 5KYNA 3TK0A 1K04A 2X51A 3KMIA 4IRUA 4JTAB 1RKEA 4QI0A 1TWHA 4YN0B 4AL1A 4CJOA 5L0CA 2XL6A 3JT1A 3LS0A 1KNYA 1Q0GA 3WODF 5A6BA 2JPUA 5EK0A 4BJ6C 4BEJA 3ABLC 2WZGA 5BQGA 2YLGA 3WAQA 4LLCA 5L0GA 2HV6A 4PFPA 2XLDA 3NYLA 4C7OB 2RSEB 3F46A 2C04A 2G3VA 1V74B 2XLWA 4MVMA 3ZDLA 2R7VA 3M15A 1EQ1A 3N0TA 4G0HA 4CS9A 2YRFA 4JCHA 1U0BB 4YL1A 3ZC4A 5DQTA 4DVYP 1JPJA 2P6VA 2NUPA 4JEBA 1G8XA 4XTKA 1G5ZA 5KYYA 5D92A 3U0CA 2R9RB 4LERA 2LQGA 4MVOA 5CI8A 1OQCA 1LS4A 2IXMA 2L6HA 2NSFA 2YLDA 3M79A 3U8PA 3RF3A 1SR2A 4NTFA 3TD7A 3IQ5A 5TJ5E 3NMKA 3RH3A 2J0WA 3FAPB 1Z3IX 3KYJA 2EPNA 2EPOA 3LLIA 3DI5A 4K1OA 4J7YA 5B1AC 4DRIB 3NMIA 2IBFA 3TOMA 1FFTC 3GEEA 4LDKA 3MX3A 4MW3A 3PDMP 1C17M 2QNLA 4N06A 3DE8A 4O7GA 5JUAA 3HNLA 2R7TA 1OR3A 3S0XA 3ASNC 3PCVA 3C8GA 3LS1A 1ZHTA 5FCLA 1JR8A 4QDLA 4YT4A 1G4US 3AQCA 3C63A 3SXKA 1QZXA 2D5RB 1G4WR 4DRJB 4ER9A 1TFKB 4W8KA 4DOZA 2ICWG 4ULVA 5A6JA 1K05A 4JJGA 5AC4A 1RCPA 1YYJA 2W45A 4PACA 4NQFA 2NG1A 3O39A 3TJ6A 4CDAA 1PCXA 3ABMC 2YHSA 2YL1A 3AG1C 2A69F 3EG9B 3EQLF 1RJ9A 1FFHA 1ZHZA 2JX0A 4IJJA 3S90A 1LE4A 1LIHA 1LPEA 1MQVA 2ZXWC 4PK4A 3RVZA 3FHDA 3KYIA 5L3VA 2YL7A 2DGJA 4DRHB 4NTAA 1MMGA 1V4AA 4E0IA 1FR0A 5L0JA 3UMHA 1CGOA 1R4TA 2P1AA 3EH1A 4KNWA 3MLGA 3SXYA 5BQIA 3M4BA 1HE9A 2VCBA 3V5YA 2MWQA 3T9OA 4ZLCA 5KYXB 3U3BA 1EA8A 3WG7C 3X1OA 5IY5C 1LKXA 4DBQA 1NZEA 1OKKA 3LNRA 4U9DA 2Y3GA 4PJJA 4WGZA 5COGA 2A68F 3JRTA 1YA7O 3PHF2 3B29A 3RVYA 3B0UX 4CDVA 3FVYA 3G4ZA 4BJ5A 2IXNA 3X2QC 2KYHA 4MTGA 2BE5F 5EGYA 2YL0A 3UGPA 1YVIA 2XLVA 1Q0KA 4F4BA 2LCHA 1I4YA 3B71A 2LFDA 3DJUB 3GODA 1OXBA 2J0XA 4EBJA 5HSWA 3KKBA 1TWAA 1VK5A 4JCZA 1L3PA 2J45A 3AG4C 4BJ1A 3LEVA 1EKYA 1AEPA 3M4CA 2AWCA 5A6KA 2XRHA 4U5GA 4U5HA 1CPQA 1JMWA 1YDIA 2Q9CA 1RKCA 4BEMJ 2Q4FA 4MTOA 5L0HA 5DLJA 1NU7D 1SF8A 3FAJA 4BJ6A 2NPUA 3Q7GA 3ECSA 5BQHA 3HTKC 3MYFA 3ATPA 3POVA 3EJNA 3L0IA 2JD3A 4JEAA 4CS7A 5E3CA 4JIOA 2XLHA 3EFOA 1ST6A 4XEKA 1A7DA 2Q7RA 3LESA 4JW1A 4MNDA 4CDYA 3G50A 5JT4A 3E70C 3SYNA 1OW7A 4JURI 2GAQA 3RW0A 4I1OB 1RMVA 3JZ0A 4P6IC 4XPYA 3VRCA 2Y69C 2EPMX 3AG2C 1D1BA 3VF0A 4G7HF 4OIPF 1LS1A 1WWPA 3EGXB 1A7VA 1KTMA 2XS8A 1Z63A 2ZPAA 4WJ0A 3L8IA 2J9WA 3RFYA 2CGEA 4U5CE 4N6HA 1Z7Qc 3DM9B 3PMRA 1UFBA 2QTVA 3R7CA 5L0FA 3B0PA 3EZHA 3S29A 2LSEA 2CNWD 2VC9A 1S05A 2WVQA 2LIGA 2W9YA 3AGTA 1LVKA 3DXJF 2ZXOA 1I4ZA 2BC5A 5COFA 2H8AA 3DD7A 4A4AA 4DJ9A 2HMZA 3ASOC 2R03A 3R2PA 4B6IA 4CS8A 1M2VA 5T3TA 3J06A 2LD6A 2X0CA 3I4UA 2ZD9A 5COMA 3SNHA 4E18A 2QY9A 1WTYA 4EWCA 2OKUA 2HMQA 5KYYB 3AQBA 3E9VA 2C03A 2XLEA 2YZSA 1CGNA 2DYRC 5JSLA 4JKVA 4OIQF 3S9OA 1WATA 3JYYA 2NUTA 2KK1A 4IAQA 2FFHA 4ZLDA 3LJBA 1N1CA 1VYIA 1V55C 2KGOA 2B0HA 4JZAA 2B0JA 2Y3BA 4C3EA 3U2LA 2E87A 4MQ9F 1MMAA 1VMAA 3DMDA 1M6TA 2Y3HA 3K33A 1QLEC 2PX3A 1ORSC 2VB6A 1E86A 5L3QA 3QZCA 1WGWA 1F1MA 3IHUA 3HNKA 2TMVP 4GEHA 4J30B 3ZTMA 4PJMA 3ABKC 2KSFA 2Q3TA 3I5QA 1WASA 1ZW2A 3GANA 4IB4A 4AL0A 2CYDA 4C7OA 2OJQA 1LE2A 1OR2A 2OJED 3C8GB 5F5FA 1D0ZA 3US6A 2XS1A 4BPMA 1J8YF 3S27A 3JYHA 4C3BA 1R5ID 3K6BA 1TQGA 3N2ZB 4U5DE 5JRAA 2EIKC 2OU6A 4H4KC 1SZIA 1HMOA 1Z23A 3IQ6A 5F28E 2EILC 3K1IC 4DXWA 3SXZA 2HZ8A 4CIHA 4J7TA 3U5SA 4RD9A 1ORJA 1E84A 4NY3A 4P9TA 1YA9A 1Z6AA 4OD5A 1RJ9B 2L81A 1LM3B 3C7JA 1BZ4A 3S84A 4HE8D 4EHPA 3U8VA 3SZRA 1ZW3A 2PFDA 2OCCC 3V5ZA 3VAYA 4OIRF 3ZQVA 2V3CC 3MYIA 2Q9BA 3C8GD 4EKWA 3JTLO 5E33A 5JLIA 1QSPA 4D4XA 2EPLX 1APCA 3UMIA 4Q7CA 4EUKB 5L0DA 4YL3A 3MBGA 1ZZPA 3H2UA 4CSAA 1C03A 1ZU4A 2R7QA 2IXPA 1HY5A 3DAGA 4IGGA 3EH2A 3U9MA 1QQ3A 2GDCA 3TOLA 3NRHA 1HMDA 1T5OA 1PD0A 2WB7A 2OQMA 3T6GB 2YEVA 3UNGC 2Y39A 3N24A 4PJLA 1ORYA 1O3UA 2OEVA 4JC7A 3RYLA 3GWLA 2QE9A 1Q0FA 4XEFA 2NSGA 1T6UA 1OCCC 4PJNA 3TQOA 3ZWIA 1NU9C 1FMWA 1HW2A 2ZXPA 4YK5A 3EG9A 2GWWA 1SMYF 4MVUA 2DYSC 2HFIA 3U3FA 2J7PA 3CSKA 3AJMA 4NCQA 2WVNA 2R02A 3AG3C 3QVYA 3O10A 3LLKA 2EPKX 5FZTA 3VM6A 1D0XA 5DQZA 1HW1A 4AE4A 2Z15A 5DS4A 3O6XA 4E7ZA 1H9TA 2AU5A 3L34A 4UDVA 3DAFA 1JRAA 2GFHA 2ETSA 1VOMA 3HNJA 3V5XA 2L9JA 3JCUQ 5KYWB 4K0DA 1YLMA 3CAXA 1HE1A 1OKKD 1UG7A 4MVZA 4OIOF 1BBHA 3OA1A 2I15A 1ZHWA 2CDQA 1VB5A 4JRZA 1WOLA 4G7OF 1H9GA 1Q0MA 2PBEA 1VYKA 1NG1A 1T6IA 4XQ1A 2I8BA 4CX9A 2PX0A 3BEHA 3G4XA 2ZXRA 2KW3C 3L1MA 3LAYA 1IW7F 4KC9A 4DVZA 5CI9A 4XWJA 5E2QA 2HV7A 1NFOA 5AC5A 1D1CA 3QVZA 5DS5A 3K7DA 3EPVA 2XSEA 3HJCA 3S28A 2H7BA 3NYMA 1CPRA 1OCRC 2V26A 1S7ZA 3LNMB 4MVQA 4IARA 4I3MA 2A1DD 2LFFA 2J8WA 2J9UA 3NKEA 4FX5A 4WGYA 1VLSA 2L7AA 3RQGA 1DOVA 4LDRA 4JJFA 2VCAA 4O6YA 4YT2A 1H7IA 3NMJA 4QI2A 4Z9JA 2OEXA 2R7WA 3QTHA 1PD1A 3I5PA 4KBLA 4U5FE 3B0VC 2R7XA 3QW0A 1RKEB 4IWBA 3T6BA 4XEVA 1MNEA 1VLTA 4N4WA 4O6NA 4ONSA 2YKZA 2ASRA 1BR4A 3U9JA 2DB4A 1PV3A 3FXHA 3EHNA 5T1DB 2XL4A 1OXKA 3A9CA 5E3AA 3RQEA 4XPWA 3T4RA 1VTMP 3KH2A 4AX2A 4U9EA 4PR9A 3GWNA 2PP4A 1M2VB 3V7OA 1FAPB 2CNWA 3W8IA 3DKAA 2DI3A 1XZQA 5JVEA 3HLZA 3AGUA 1XWJA 1SYQA 4YWQA 3QMKA 1BDJB 1T01A 2EIJC 2NUPB 2W4BA 3K1IA 4JTCB 1TR2A 2L6FA 2NUTB 3W2VA 3ZG1A 4U5BE 2Y3DA 3U2MA 1E85A 5KYUA 3GEIA 5D91A 2XXAA 2J9BA 4K7BA 3VYWA 4I44A 1YARO 4MS2A 5B3IA 1QKRA 3UGOA 4HFKB 3EGXA 2XLMA 3EGDA 1L7CA 4N6CA 1D0YA 1NFNA 3DM5A 3DWWA 4PFOA 4R32A 4AK9A 5A6BD 4L6RA 5JP7A 3NKDA 2W4MA 2OG2A 4BG0A 4O79A 1GGQA 3GEHA 4YL0A 3C18A 1D1AA 4X0RA 2AP3A 1FMVA 1JAFA 2PNOA 2RD9A 3NYJA 4H54A 4OINF 3ZTZA 2P61A 2O9XA 3HKKA 2HUJA 1NBBA 3C8ZA 3DJNB 1JOGA 2HJ3A 2WZFA 4CIPA 1YAUO 4GYTA 4HEAJ 2A0BA 3EZIA 1H6GA 2L6GA 4E17A 1ZHXA 1YZAA 5HV9A 3GORA 1NSGB 4C3DA 1AVOB 4LDQA 4Q5SF 2MYSA 3O55A 4M63A 2IYLD 3GM3A 4JTDB 1QPUA 2A6HF 2HS5A 4Q4ZF 2G3KA 1ZHYA 3Q7LA 4LACB 5A6AA 4FWVA 1RXQA 1OCZC 3K66A 5B1BC 2J46A 3CQZA 4GQHA 3RIPA 2HKVA 3MFNA 1FTSA 4KNVA 1M2OA 4XLPF 2AVKA 1ZU5A 1KU2A 4P9FA 1O5HA 1T6QA 3UMKA 3ZVRA 4EBKA 4E7SA 2XM0A 4W8PA 3NDBB 2P0NA 2YL3A 4FAPB 3W2WA 2HSBA 1B68A 2HJMA 1A7EA 4HFFB 1TWCA 3SP1A 2GA0A 2R7OA 4ANJA 1U89A 1QVXA 2R7RA 5L0IA 3W4YA 3IPMO 3BRJA 5T3WA 2IXOA 1TKNA 4MTFA 4CS8C 2EIMC 2CW0F 2A0UA 1JPNA
chains in the Genus database with same CATH topology
4CJGA 1A7VA 1BBHA 3C62A 1YYXA 2YLDA 3M79A 3U8PA 256BA 4EIYA 3IQ5A 4N6HA 3NMKA 3FOOA 4CX9A 1S05A 3NMIA 3L1MA 2BC5A 3TOMA 3QVZA 3DE8A 5JUAA 3HNLA 2XL8A 1CPRA 3DE9A 4IARA 2J8WA 3HNIA 4WGYA 2XLEA 5JSLA 1CGNA 4JKVA 2CCYA 3C63A 1YZCA 3NMJA 4IAQA 4ER9A 4ULVA 3QW0A 4D4NA 2YLIA 5JS5A 1RCPA 4N4WA 1YYJA 2YKZA 4CDAA 5AGFA 2YL1A 1M6TA 2XLOA 1E86A 1GQAA 1MQVA 3FOPA 3HNKA 4U9EA 3ZTMA 2YL7A 4IB4A 5JVEA 1CGOA 5JRAA 1E85A 3IQ6A 3M4BA 2J9BA 5B3IA 3QW1A 1E84A 2XLMA 1E83A 2QLAA 2XM4A 4L6RA 5JP7A 4U9DA 1LM3B 4WGZA 3ZQYA 1JAFA 4NC3A 3ZTZA 4CDVA 3ZQVA 1NBBA 2YL0A 4CIPA 2XLVA 5JLIA 4D4XA 1APCA 1YZAA 1QPUA 1QQ3A 3TOLA 1EKYA 3M4CA 1CPQA 4JE9A 4CJOA 2XM0A 2XL6A 3ZWIA 2YL3A 2YLGA 4JEAA 2XLDA 3QVYA 2XLHA 4CDYA 2XLWA 3M15A 5JT4A 3HNJA 3VRCA 4JEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJG A;  1A7V A;  1BBH A;  3C62 A;  1YYX A;  2YLD A;  3M79 A;  3U8P A;  256B A;  4EIY A;  3IQ5 A;  4N6H A;  3NMK A;  3FOO A;  4CX9 A;  1S05 A;  3NMI A;  3L1M A;  2BC5 A;  3TOM A;  3QVZ A;  3DE8 A;  5JUA A;  3HNL A;  2XL8 A;  1CPR A;  3DE9 A;  4IAR A;  2J8W A;  3HNI A;  4WGY A;  2XLE A;  5JSL A;  1CGN A;  4JKV A;  2CCY A;  3C63 A;  1YZC A;  3NMJ A;  4IAQ A;  4ER9 A;  4ULV A;  3QW0 A;  4D4N A;  2YLI A;  5JS5 A;  1RCP A;  4N4W A;  1YYJ A;  2YKZ A;  4CDA A;  5AGF A;  2YL1 A;  1M6T A;  2XLO A;  1E86 A;  1GQA A;  1MQV A;  3FOP A;  3HNK A;  4U9E A;  3ZTM A;  2YL7 A;  4IB4 A;  5JVE A;  1CGO A;  5JRA A;  1E85 A;  3IQ6 A;  3M4B A;  2J9B A;  5B3I A;  3QW1 A;  1E84 A;  2XLM A;  1E83 A;  2QLA A;  2XM4 A;  4L6R A;  5JP7 A;  4U9D A;  1LM3 B;  4WGZ A;  3ZQY A;  1JAF A;  4NC3 A;  3ZTZ A;  4CDV A;  3ZQV A;  1NBB A;  2YL0 A;  4CIP A;  2XLV A;  5JLI A;  4D4X A;  1APC A;  1YZA A;  1QPU A;  1QQ3 A;  3TOL A;  1EKY A;  3M4C A;  1CPQ A;  4JE9 A;  4CJO A;  2XM0 A;  2XL6 A;  3ZWI A;  2YL3 A;  2YLG A;  4JEA A;  2XLD A;  3QVY A;  2XLH A;  4CDY A;  2XLW A;  3M15 A;  5JT4 A;  3HNJ A;  3VRC A;  4JEB A; 
#chains in the Genus database with same CATH topology
 3OEO A;  2VH3 A;  1E2X A;  4CBE A;  2M4E A;  4CJG A;  1IZM A;  3L8J A;  3SEO A;  4NTB A;  5GPG B;  1ZYR F;  5B3S C;  1OCO C;  3CZ6 A;  3C62 A;  2FGY A;  3H2V A;  1YYX A;  2R7U A;  256B A;  3CEX A;  4FES A;  2UUI A;  4EIY A;  1M57 C;  3FDQ A;  2UUH A;  2AWY A;  1C02 A;  2WL8 A;  3FOO A;  1LI5 A;  1NLX A;  4XPX A;  2LP4 A;  4RDA A;  4YJW A;  5CIV A;  4I1M A;  1OW8 A;  4AE4 B;  3LEO A;  2WVO A;  3W8H A;  5DVW A;  1A0B A;  2BL2 A;  3JSE O;  3ITF A;  4MVR A;  3TJ5 A;  2KNH A;  2XL8 A;  3TUL A;  2Q00 A;  3DE9 A;  2P7V A;  3ZSU A;  1MMD A;  3T6J A;  3HNI A;  2QUP A;  3LUT B;  2CCY A;  4EBB A;  1YZC A;  4BJT A;  4MVS A;  2YVK A;  1DOW A;  1K40 A;  1M56 C;  2IOQ A;  2PF4 E;  4D4N A;  2MHR A;  2YLI A;  5KYX A;  5JS5 A;  1J8M F;  3H65 A;  2A6E F;  2D4U A;  2LK4 A;  2J7P D;  2H7O A;  2F22 A;  4O6M A;  5AGF A;  1Z5Z A;  1I5N A;  1ZVZ A;  1BR2 A;  2OOC A;  1LI7 A;  3F47 A;  3IQC A;  2XLO A;  5EHH A;  1AUE A;  2YWA A;  3IQT A;  4RBN A;  1TFO B;  1GQA A;  4Z9H A;  3FOP A;  2YQY A;  3KPH A;  1Q0D A;  3EFO B;  4XLN F;  3Q6M A;  3OWT A;  3K1H A;  4OD4 A;  3M1C B;  3Q6N A;  2R25 A;  4IAO A;  5DS6 A;  2R7S A;  4JVS A;  1U6H A;  2WZL A;  3GM2 A;  5F5H A;  3NG1 A;  3ZIB A;  3JRM O;  2G62 A;  1OW6 A;  3AOU A;  1O87 A;  1Y4C A;  4WAB A;  4Z9I A;  5A69 A;  4CSA C;  5KYW A;  2H7V C;  2Q9A A;  1XZP A;  1W2W A;  3QW1 A;  2KJG A;  3FMS A;  1GS9 A;  2QLA A;  1BR1 A;  3DZA A;  1TWG A;  2XM4 A;  3KL4 A;  4G78 A;  3WHN A;  5BUO A;  2J9V A;  3GM1 A;  2KQ9 A;  4KI2 A;  4CS9 C;  1WN0 A;  3B9Q A;  3ZQY A;  2VCC A;  3JSZ A;  2HSQ A;  2IM8 A;  4YT8 A;  4NC3 A;  1CGM E;  1A41 A;  5K0I A;  4MW8 A;  4LLE A;  1MND A;  1MMN A;  3A11 A;  2FAP B;  2M64 A;  4YT5 A;  4U5E E;  4G7Z F;  4ULW A;  3SXM A;  4BJ5 C;  2KC3 A;  4E0H A;  1GM5 A;  3EHM A;  3RKO F;  2VAS A;  1Y6D A;  1EI7 A;  1T9K A;  2R05 A;  4J32 B;  4DBR A;  5KYU B;  2XXA B;  1V54 C;  3RQF A;  3IEE A;  1FNT c;  3UR3 C;  4A2N B;  1E83 A;  3EGD B;  2EIN C;  1YJG A;  4JE9 A;  5KYN A;  3TK0 A;  1K04 A;  2X51 A;  3KMI A;  4IRU A;  4JTA B;  1RKE A;  4QI0 A;  1TWH A;  4YN0 B;  4AL1 A;  4CJO A;  5L0C A;  2XL6 A;  3JT1 A;  3LS0 A;  1KNY A;  1Q0G A;  3WOD F;  5A6B A;  2JPU A;  5EK0 A;  4BJ6 C;  4BEJ A;  3ABL C;  2WZG A;  5BQG A;  2YLG A;  3WAQ A;  4LLC A;  5L0G A;  2HV6 A;  4PFP A;  2XLD A;  3NYL A;  4C7O B;  2RSE B;  3F46 A;  2C04 A;  2G3V A;  1V74 B;  2XLW A;  4MVM A;  3ZDL A;  2R7V A;  3M15 A;  1EQ1 A;  3N0T A;  4G0H A;  4CS9 A;  2YRF A;  4JCH A;  1U0B B;  4YL1 A;  3ZC4 A;  5DQT A;  4DVY P;  1JPJ A;  2P6V A;  2NUP A;  4JEB A;  1G8X A;  4XTK A;  1G5Z A;  5KYY A;  5D92 A;  3U0C A;  2R9R B;  4LER A;  2LQG A;  4MVO A;  5CI8 A;  1OQC A;  1LS4 A;  2IXM A;  2L6H A;  2NSF A;  2YLD A;  3M79 A;  3U8P A;  3RF3 A;  1SR2 A;  4NTF A;  3TD7 A;  3IQ5 A;  5TJ5 E;  3NMK A;  3RH3 A;  2J0W A;  3FAP B;  1Z3I X;  3KYJ A;  2EPN A;  2EPO A;  3LLI A;  3DI5 A;  4K1O A;  4J7Y A;  5B1A C;  4DRI B;  3NMI A;  2IBF A;  3TOM A;  1FFT C;  3GEE A;  4LDK A;  3MX3 A;  4MW3 A;  3PDM P;  1C17 M;  2QNL A;  4N06 A;  3DE8 A;  4O7G A;  5JUA A;  3HNL A;  2R7T A;  1OR3 A;  3S0X A;  3ASN C;  3PCV A;  3C8G A;  3LS1 A;  1ZHT A;  5FCL A;  1JR8 A;  4QDL A;  4YT4 A;  1G4U S;  3AQC A;  3C63 A;  3SXK A;  1QZX A;  2D5R B;  1G4W R;  4DRJ B;  4ER9 A;  1TFK B;  4W8K A;  4DOZ A;  2ICW G;  4ULV A;  5A6J A;  1K05 A;  4JJG A;  5AC4 A;  1RCP A;  1YYJ A;  2W45 A;  4PAC A;  4NQF A;  2NG1 A;  3O39 A;  3TJ6 A;  4CDA A;  1PCX A;  3ABM C;  2YHS A;  2YL1 A;  3AG1 C;  2A69 F;  3EG9 B;  3EQL F;  1RJ9 A;  1FFH A;  1ZHZ A;  2JX0 A;  4IJJ A;  3S90 A;  1LE4 A;  1LIH A;  1LPE A;  1MQV A;  2ZXW C;  4PK4 A;  3RVZ A;  3FHD A;  3KYI A;  5L3V A;  2YL7 A;  2DGJ A;  4DRH B;  4NTA A;  1MMG A;  1V4A A;  4E0I A;  1FR0 A;  5L0J A;  3UMH A;  1CGO A;  1R4T A;  2P1A A;  3EH1 A;  4KNW A;  3MLG A;  3SXY A;  5BQI A;  3M4B A;  1HE9 A;  2VCB A;  3V5Y A;  2MWQ A;  3T9O A;  4ZLC A;  5KYX B;  3U3B A;  1EA8 A;  3WG7 C;  3X1O A;  5IY5 C;  1LKX A;  4DBQ A;  1NZE A;  1OKK A;  3LNR A;  4U9D A;  2Y3G A;  4PJJ A;  4WGZ A;  5COG A;  2A68 F;  3JRT A;  1YA7 O;  3PHF 2;  3B29 A;  3RVY A;  3B0U X;  4CDV A;  3FVY A;  3G4Z A;  4BJ5 A;  2IXN A;  3X2Q C;  2KYH A;  4MTG A;  2BE5 F;  5EGY A;  2YL0 A;  3UGP A;  1YVI A;  2XLV A;  1Q0K A;  4F4B A;  2LCH A;  1I4Y A;  3B71 A;  2LFD A;  3DJU B;  3GOD A;  1OXB A;  2J0X A;  4EBJ A;  5HSW A;  3KKB A;  1TWA A;  1VK5 A;  4JCZ A;  1L3P A;  2J45 A;  3AG4 C;  4BJ1 A;  3LEV A;  1EKY A;  1AEP A;  3M4C A;  2AWC A;  5A6K A;  2XRH A;  4U5G A;  4U5H A;  1CPQ A;  1JMW A;  1YDI A;  2Q9C A;  1RKC A;  4BEM J;  2Q4F A;  4MTO A;  5L0H A;  5DLJ A;  1NU7 D;  1SF8 A;  3FAJ A;  4BJ6 A;  2NPU A;  3Q7G A;  3ECS A;  5BQH A;  3HTK C;  3MYF A;  3ATP A;  3POV A;  3EJN A;  3L0I A;  2JD3 A;  4JEA A;  4CS7 A;  5E3C A;  4JIO A;  2XLH A;  3EFO A;  1ST6 A;  4XEK A;  1A7D A;  2Q7R A;  3LES A;  4JW1 A;  4MND A;  4CDY A;  3G50 A;  5JT4 A;  3E70 C;  3SYN A;  1OW7 A;  4JUR I;  2GAQ A;  3RW0 A;  4I1O B;  1RMV A;  3JZ0 A;  4P6I C;  4XPY A;  3VRC A;  2Y69 C;  2EPM X;  3AG2 C;  1D1B A;  3VF0 A;  4G7H F;  4OIP F;  1LS1 A;  1WWP A;  3EGX B;  1A7V A;  1KTM A;  2XS8 A;  1Z63 A;  2ZPA A;  4WJ0 A;  3L8I A;  2J9W A;  3RFY A;  2CGE A;  4U5C E;  4N6H A;  1Z7Q c;  3DM9 B;  3PMR A;  1UFB A;  2QTV A;  3R7C A;  5L0F A;  3B0P A;  3EZH A;  3S29 A;  2LSE A;  2CNW D;  2VC9 A;  1S05 A;  2WVQ A;  2LIG A;  2W9Y A;  3AGT A;  1LVK A;  3DXJ F;  2ZXO A;  1I4Z A;  2BC5 A;  5COF A;  2H8A A;  3DD7 A;  4A4A A;  4DJ9 A;  2HMZ A;  3ASO C;  2R03 A;  3R2P A;  4B6I A;  4CS8 A;  1M2V A;  5T3T A;  3J06 A;  2LD6 A;  2X0C A;  3I4U A;  2ZD9 A;  5COM A;  3SNH A;  4E18 A;  2QY9 A;  1WTY A;  4EWC A;  2OKU A;  2HMQ A;  5KYY B;  3AQB A;  3E9V A;  2C03 A;  2XLE A;  2YZS A;  1CGN A;  2DYR C;  5JSL A;  4JKV A;  4OIQ F;  3S9O A;  1WAT A;  3JYY A;  2NUT A;  2KK1 A;  4IAQ A;  2FFH A;  4ZLD A;  3LJB A;  1N1C A;  1VYI A;  1V55 C;  2KGO A;  2B0H A;  4JZA A;  2B0J A;  2Y3B A;  4C3E A;  3U2L A;  2E87 A;  4MQ9 F;  1MMA A;  1VMA A;  3DMD A;  1M6T A;  2Y3H A;  3K33 A;  1QLE C;  2PX3 A;  1ORS C;  2VB6 A;  1E86 A;  5L3Q A;  3QZC A;  1WGW A;  1F1M A;  3IHU A;  3HNK A;  2TMV P;  4GEH A;  4J30 B;  3ZTM A;  4PJM A;  3ABK C;  2KSF A;  2Q3T A;  3I5Q A;  1WAS A;  1ZW2 A;  3GAN A;  4IB4 A;  4AL0 A;  2CYD A;  4C7O A;  2OJQ A;  1LE2 A;  1OR2 A;  2OJE D;  3C8G B;  5F5F A;  1D0Z A;  3US6 A;  2XS1 A;  4BPM A;  1J8Y F;  3S27 A;  3JYH A;  4C3B A;  1R5I D;  3K6B A;  1TQG A;  3N2Z B;  4U5D E;  5JRA A;  2EIK C;  2OU6 A;  4H4K C;  1SZI A;  1HMO A;  1Z23 A;  3IQ6 A;  5F28 E;  2EIL C;  3K1I C;  4DXW A;  3SXZ A;  2HZ8 A;  4CIH A;  4J7T A;  3U5S A;  4RD9 A;  1ORJ A;  1E84 A;  4NY3 A;  4P9T A;  1YA9 A;  1Z6A A;  4OD5 A;  1RJ9 B;  2L81 A;  1LM3 B;  3C7J A;  1BZ4 A;  3S84 A;  4HE8 D;  4EHP A;  3U8V A;  3SZR A;  1ZW3 A;  2PFD A;  2OCC C;  3V5Z A;  3VAY A;  4OIR F;  3ZQV A;  2V3C C;  3MYI A;  2Q9B A;  3C8G D;  4EKW A;  3JTL O;  5E33 A;  5JLI A;  1QSP A;  4D4X A;  2EPL X;  1APC A;  3UMI A;  4Q7C A;  4EUK B;  5L0D A;  4YL3 A;  3MBG A;  1ZZP A;  3H2U A;  4CSA A;  1C03 A;  1ZU4 A;  2R7Q A;  2IXP A;  1HY5 A;  3DAG A;  4IGG A;  3EH2 A;  3U9M A;  1QQ3 A;  2GDC A;  3TOL A;  3NRH A;  1HMD A;  1T5O A;  1PD0 A;  2WB7 A;  2OQM A;  3T6G B;  2YEV A;  3UNG C;  2Y39 A;  3N24 A;  4PJL A;  1ORY A;  1O3U A;  2OEV A;  4JC7 A;  3RYL A;  3GWL A;  2QE9 A;  1Q0F A;  4XEF A;  2NSG A;  1T6U A;  1OCC C;  4PJN A;  3TQO A;  3ZWI A;  1NU9 C;  1FMW A;  1HW2 A;  2ZXP A;  4YK5 A;  3EG9 A;  2GWW A;  1SMY F;  4MVU A;  2DYS C;  2HFI A;  3U3F A;  2J7P A;  3CSK A;  3AJM A;  4NCQ A;  2WVN A;  2R02 A;  3AG3 C;  3QVY A;  3O10 A;  3LLK A;  2EPK X;  5FZT A;  3VM6 A;  1D0X A;  5DQZ A;  1HW1 A;  4AE4 A;  2Z15 A;  5DS4 A;  3O6X A;  4E7Z A;  1H9T A;  2AU5 A;  3L34 A;  4UDV A;  3DAF A;  1JRA A;  2GFH A;  2ETS A;  1VOM A;  3HNJ A;  3V5X A;  2L9J A;  3JCU Q;  5KYW B;  4K0D A;  1YLM A;  3CAX A;  1HE1 A;  1OKK D;  1UG7 A;  4MVZ A;  4OIO F;  1BBH A;  3OA1 A;  2I15 A;  1ZHW A;  2CDQ A;  1VB5 A;  4JRZ A;  1WOL A;  4G7O F;  1H9G A;  1Q0M A;  2PBE A;  1VYK A;  1NG1 A;  1T6I A;  4XQ1 A;  2I8B A;  4CX9 A;  2PX0 A;  3BEH A;  3G4X A;  2ZXR A;  2KW3 C;  3L1M A;  3LAY A;  1IW7 F;  4KC9 A;  4DVZ A;  5CI9 A;  4XWJ A;  5E2Q A;  2HV7 A;  1NFO A;  5AC5 A;  1D1C A;  3QVZ A;  5DS5 A;  3K7D A;  3EPV A;  2XSE A;  3HJC A;  3S28 A;  2H7B A;  3NYM A;  1CPR A;  1OCR C;  2V26 A;  1S7Z A;  3LNM B;  4MVQ A;  4IAR A;  4I3M A;  2A1D D;  2LFF A;  2J8W A;  2J9U A;  3NKE A;  4FX5 A;  4WGY A;  1VLS A;  2L7A A;  3RQG A;  1DOV A;  4LDR A;  4JJF A;  2VCA A;  4O6Y A;  4YT2 A;  1H7I A;  3NMJ A;  4QI2 A;  4Z9J A;  2OEX A;  2R7W A;  3QTH A;  1PD1 A;  3I5P A;  4KBL A;  4U5F E;  3B0V C;  2R7X A;  3QW0 A;  1RKE B;  4IWB A;  3T6B A;  4XEV A;  1MNE A;  1VLT A;  4N4W A;  4O6N A;  4ONS A;  2YKZ A;  2ASR A;  1BR4 A;  3U9J A;  2DB4 A;  1PV3 A;  3FXH A;  3EHN A;  5T1D B;  2XL4 A;  1OXK A;  3A9C A;  5E3A A;  3RQE A;  4XPW A;  3T4R A;  1VTM P;  3KH2 A;  4AX2 A;  4U9E A;  4PR9 A;  3GWN A;  2PP4 A;  1M2V B;  3V7O A;  1FAP B;  2CNW A;  3W8I A;  3DKA A;  2DI3 A;  1XZQ A;  5JVE A;  3HLZ A;  3AGU A;  1XWJ A;  1SYQ A;  4YWQ A;  3QMK A;  1BDJ B;  1T01 A;  2EIJ C;  2NUP B;  2W4B A;  3K1I A;  4JTC B;  1TR2 A;  2L6F A;  2NUT B;  3W2V A;  3ZG1 A;  4U5B E;  2Y3D A;  3U2M A;  1E85 A;  5KYU A;  3GEI A;  5D91 A;  2XXA A;  2J9B A;  4K7B A;  3VYW A;  4I44 A;  1YAR O;  4MS2 A;  5B3I A;  1QKR A;  3UGO A;  4HFK B;  3EGX A;  2XLM A;  3EGD A;  1L7C A;  4N6C A;  1D0Y A;  1NFN A;  3DM5 A;  3DWW A;  4PFO A;  4R32 A;  4AK9 A;  5A6B D;  4L6R A;  5JP7 A;  3NKD A;  2W4M A;  2OG2 A;  4BG0 A;  4O79 A;  1GGQ A;  3GEH A;  4YL0 A;  3C18 A;  1D1A A;  4X0R A;  2AP3 A;  1FMV A;  1JAF A;  2PNO A;  2RD9 A;  3NYJ A;  4H54 A;  4OIN F;  3ZTZ A;  2P61 A;  2O9X A;  3HKK A;  2HUJ A;  1NBB A;  3C8Z A;  3DJN B;  1JOG A;  2HJ3 A;  2WZF A;  4CIP A;  1YAU O;  4GYT A;  4HEA J;  2A0B A;  3EZI A;  1H6G A;  2L6G A;  4E17 A;  1ZHX A;  1YZA A;  5HV9 A;  3GOR A;  1NSG B;  4C3D A;  1AVO B;  4LDQ A;  4Q5S F;  2MYS A;  3O55 A;  4M63 A;  2IYL D;  3GM3 A;  4JTD B;  1QPU A;  2A6H F;  2HS5 A;  4Q4Z F;  2G3K A;  1ZHY A;  3Q7L A;  4LAC B;  5A6A A;  4FWV A;  1RXQ A;  1OCZ C;  3K66 A;  5B1B C;  2J46 A;  3CQZ A;  4GQH A;  3RIP A;  2HKV A;  3MFN A;  1FTS A;  4KNV A;  1M2O A;  4XLP F;  2AVK A;  1ZU5 A;  1KU2 A;  4P9F A;  1O5H A;  1T6Q A;  3UMK A;  3ZVR A;  4EBK A;  4E7S A;  2XM0 A;  4W8P A;  3NDB B;  2P0N A;  2YL3 A;  4FAP B;  3W2W A;  2HSB A;  1B68 A;  2HJM A;  1A7E A;  4HFF B;  1TWC A;  3SP1 A;  2GA0 A;  2R7O A;  4ANJ A;  1U89 A;  1QVX A;  2R7R A;  5L0I A;  3W4Y A;  3IPM O;  3BRJ A;  5T3W A;  2IXO A;  1TKN A;  4MTF A;  4CS8 C;  2EIM C;  2CW0 F;  2A0U A;  1JPN A; 
#chains in the Genus database with same CATH homology
 4CJG A;  1A7V A;  1BBH A;  3C62 A;  1YYX A;  2YLD A;  3M79 A;  3U8P A;  256B A;  4EIY A;  3IQ5 A;  4N6H A;  3NMK A;  3FOO A;  4CX9 A;  1S05 A;  3NMI A;  3L1M A;  2BC5 A;  3TOM A;  3QVZ A;  3DE8 A;  5JUA A;  3HNL A;  2XL8 A;  1CPR A;  3DE9 A;  4IAR A;  2J8W A;  3HNI A;  4WGY A;  2XLE A;  5JSL A;  1CGN A;  4JKV A;  2CCY A;  3C63 A;  1YZC A;  3NMJ A;  4IAQ A;  4ER9 A;  4ULV A;  3QW0 A;  4D4N A;  2YLI A;  5JS5 A;  1RCP A;  4N4W A;  1YYJ A;  2YKZ A;  4CDA A;  5AGF A;  2YL1 A;  1M6T A;  2XLO A;  1E86 A;  1GQA A;  1MQV A;  3FOP A;  3HNK A;  4U9E A;  3ZTM A;  2YL7 A;  4IB4 A;  5JVE A;  1CGO A;  5JRA A;  1E85 A;  3IQ6 A;  3M4B A;  2J9B A;  5B3I A;  3QW1 A;  1E84 A;  2XLM A;  1E83 A;  2QLA A;  2XM4 A;  4L6R A;  5JP7 A;  4U9D A;  1LM3 B;  4WGZ A;  3ZQY A;  1JAF A;  4NC3 A;  3ZTZ A;  4CDV A;  3ZQV A;  1NBB A;  2YL0 A;  4CIP A;  2XLV A;  5JLI A;  4D4X A;  1APC A;  1YZA A;  1QPU A;  1QQ3 A;  3TOL A;  1EKY A;  3M4C A;  1CPQ A;  4JE9 A;  4CJO A;  2XM0 A;  2XL6 A;  3ZWI A;  2YL3 A;  2YLG A;  4JEA A;  2XLD A;  3QVY A;  2XLH A;  4CDY A;  2XLW A;  3M15 A;  5JT4 A;  3HNJ A;  3VRC A;  4JEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...