3US6A

Crystal structure of histidine-containing phosphotransfer protein mthpt1 from medicago truncatula
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
148
structure length
148
Chain Sequence
b'EVGQMRRQWVDYIKSMFMEGFLDGQFLQLQQLQDENNPEFVFEVVSLFFDDSERILKDLSFAVDQQSIDFKKVDAHVHQFKGSSASIGAQRVKNSCVAFRNFCEEQNIDACRRCLQQVKQEYLLVKNKLETLLRLEQQIVAAGGSIPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine-containing Phosphotransfer Protein type 1, MtHPt1
publication title Medicago truncatula histidine-containing phosphotransfer protein: Structural and biochemical insights into the cytokinin transduction pathway in plants.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Transferase
total genus 67
structure length 148
sequence length 148
ec nomenclature ec 2.7.3.-:
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 3us6A00
2OOCA 1YVIA 4PACA 1I5NA 1A0BA 1C02A 3MYFA 2LD6A 2LP4A 1OXBA 2R25A 3US6A 1SR2A 1WN0A 3IQTA 1BDJB 2Q4FA 3U3BA 1QSPA 1C03A 3KYIA 2A0BA 3KYJA 4G78A 4EUKB 1Y6DA 2LCHA 1TQGA 1OXKA 1FR0A
chains in the Genus database with same CATH superfamily
2OOCA 1TWAA 3ASNC 4U5GA 2L6FA 1OR3A 1YLMA 3TJ5A 2V26A 3DJUB 5L0GA 1ZHWA 3J06A 1LS4A 4D4NA 4EKWA 4U5HA 5JRAA 4NC3A 4C3EA 2J7PA 4PJNA 4YT2A 2R7WA 4CX9A 1VYKA 5L3QA 2PX3A 3HNLA 1T5OA 2KQ9A 2QTVA 4NY3A 1L3PA 1T9KA 5DLJA 2EIMC 2L9JA 4DJ9A 3ABMC 3EG9A 3RQEA 3DD7A 1ZHZA 1O87A 1W2WA 3I5QA 3C8GD 3H2VA 3QVYA 3KH2A 4DBQA 2YL0A 2Q00A 4CDVA 4I1MA 2O9XA 3ASOC 4G78A 3TOMA 1MNEA 3W2VA 3T4RA 1YZAA 2HMQA 3ZG1A 2XS1A 4LERA 4A2NB 4CIHA 2GWWA 3AG3C 3B0PA 3EG9B 2R7XA 1Z6AA 4PACA 4U5CE 3SYNA 1I4ZA 1BR4A 2JD3A 1LIHA 2B0HA 1HW1A 2MHRA 4XQ1A 3W8IA 5KYWA 1E84A 4MVSA 2PX0A 1HMDA 3I5PA 4BJ1A 2HV6A 3AG2C 2NPUA 1ST6A 2G62A 2GA0A 4IWBA 4O6NA 1CPRA 1SR2A 4XEVA 3TOLA 3B0UX 2QE9A 2ZPAA 1WN0A 3FMSA 1BR2A 4BEJA 1KTMA 2A1DD 5KYWB 2Y3BA 3C18A 3U3BA 1M2OA 2YVKA 3KKBA 2IXPA 3GEEA 3EH1A 1EQ1A 3HTKC 3EH2A 5CI8A 5HSWA 4G7HF 2WZLA 3RQFA 4I3MA 4OD4A 2GFHA 2XLDA 1V74B 3WHNA 1DOWA 4EBJA 5D91A 4IAOA 4E0HA 2M4EA 5DQTA 3EHNA 3K66A 2XL8A 4H4KC 3TD7A 4MTGA 4XTKA 5DS4A 3BRJA 1MMGA 5B3IA 2R7TA 2RSEB 1NFNA 3B71A 1G4WR 1LKXA 3OWTA 2P1AA 4MVZA 1JMWA 1WOLA 1RMVA 3L8IA 1UG7A 3S90A 4LDQA 4YT5A 4CSAC 3GORA 2HSBA 2HJ3A 5A6BD 3U3FA 3IPMO 1T6QA 1IW7F 2B0JA 3W2WA 4XLPF 5JT4A 1Q0MA 4QI0A 1OW8A 1K40A 4RBNA 1OQCA 1QVXA 3KYJA 5L0CA 4N4WA 5E2QA 4D4XA 3U9MA 1VMAA 3M4BA 4C7OA 1QPUA 1FFHA 1RCPA 2D5RB 2JX0A 2YKZA 2YQYA 4MTFA 4Z9HA 1Z7Qc 5A69A 1M56C 1RJ9B 2I8BA 1YZCA 2YRFA 2YWAA 3AG4C 1YARO 3MYIA 3NMIA 3LEVA 3ZC4A 3OEOA 3ZIBA 5BQIA 1E86A 3X2QC 2LFFA 3EJNA 3CEXA 1O5HA 1T6IA 2BC5A 3GM1A 1V55C 3G50A 1FFTC 1TFOB 3JT1A 4JIOA 2P61A 3VRCA 5FCLA 1J8MF 3CAXA 1TR2A 4FX5A 2OJED 3DI5A 2V3CC 2L81A 1QQ3A 3H65A 3RFYA 3EQLF 3G4ZA 4ULWA 4YN0B 4JTDB 256BA 3LJBA 3WG7C 3NMJA 2VCBA 2KW3C 3W4YA 4EWCA 2ZXOA 3DAGA 4JJFA 1AVOB 3FOPA 3FHDA 3K33A 3LNRA 4YT4A 5L0FA 3RYLA 4JCHA 1D1CA 2H7OA 3K6BA 2X51A 3JZ0A 3NYLA 4NTAA 4GEHA 3NKEA 2F22A 4O7GA 3SXZA 1MMDA 2R7QA 3N24A 2LQGA 5CIVA 2YL7A 2IOQA 2DYRC 4Q4ZF 2R7SA 3S27A 2EILC 3QW0A 2AU5A 4E0IA 3FAPB 4OINF 2XLWA 4Z9JA 2ICWG 1JAFA 1G5ZA 4XEFA 4CS7A 2WL8A 2E87A 3GANA 3QVZA 2KNHA 1BDJB 3R2PA 3ZTZA 2PF4E 4ONSA 1TKNA 3FOOA 2UUIA 4WGYA 5B1BC 3U9JA 4E17A 3N2ZB 4IJJA 2X0CA 4EUKB 3O39A 2KSFA 5A6BA 3EGDA 2ASRA 1H9TA 2KYHA 2AWYA 1APCA 1LM3B 4U5EE 3TK0A 4CS8A 3PCVA 3EFOB 5JSLA 3HKKA 3IQ5A 2EPOA 1G8XA 3V5XA 4BJTA 1J8YF 3NDBB 4K1OA 3V7OA 4JEAA 1FNTc 2EPKX 4E7SA 3C7JA 1PV3A 4P6IC 1U89A 3EGDB 4KNVA 4YL0A 3SXYA 4AL0A 5E3CA 2RD9A 3VYWA 4E7ZA 3JYHA 5F28E 1B68A 4EBBA 3ZDLA 4JURI 3DM5A 3UGOA 2HS5A 1YA7O 4U5FE 4AE4A 1Q0DA 3T6GB 2XXAB 5A6JA 4FESA 1QZXA 3O10A 1FR0A 1A7EA 1WASA 4MVQA 3LEOA 2G3KA 3O55A 4Q5SF 4KI2A 1YAUO 1U0BB 3EHMA 2P6VA 4MVUA 4W8KA 2A68F 3U5SA 4AK9A 4PK4A 3OA1A 1HW2A 3B29A 3S0XA 3DMDA 1Z3IX 3M4CA 4N6CA 3L0IA 1LE4A 1RKEA 4I1OB 4G0HA 2R03A 1IZMA 5DQZA 1ZZPA 2XM0A 2LFDA 1VLSA 4DRJB 4WGZA 2J46A 4FWVA 3ZVRA 3L34A 3KPHA 4ER9A 4DRIB 3B0VC 2A69F 5KYUA 3EZIA 4JCZA 3TJ6A 3SEOA 1YYXA 1OCRC 1XWJA 1QSPA 4XEKA 4JE9A 4NCQA 1D1AA 1ZW3A 2TMVP 1C17M 4A4AA 4PR9A 2FAPB 1RKEB 3JSZA 2R9RB 4R32A 2D4UA 1Q0FA 2KK1A 1PCXA 4YK5A 1T01A 4C3DA 2PBEA 2R02A 3Q7LA 4NTBA 5DVWA 3POVA 2P0NA 4MVOA 5KYUB 3CQZA 2Q9CA 4XPXA 1BR1A 2WVQA 3BEHA 4LACB 4X0RA 3LLKA 3MYFA 5KYYA 4LDKA 2OJQA 2ZD9A 1SZIA 4B6IA 2XL6A 1M6TA 2Q9AA 2EPLX 4JW1A 3S29A 2YHSA 3ITFA 1HE1A 3HNIA 4H54A 3U2LA 4OIQF 2OU6A 1FAPB 2J9VA 4RD9A 1RJ9A 3ZQYA 1A41A 3T6JA 3LS1A 1GQAA 1CGNA 1LE2A 5KYYB 3O6XA 1OW7A 1VYIA 1Y4CA 1BBHA 1TWGA 1TWCA 2W9YA 2WZFA 4MVRA 3U2MA 5FZTA 2DYSC 4YJWA 5D92A 3A11A 2J8WA 3ZQVA 2QLAA 1MMNA 4CBEA 4DOZA 1OCOC 3C63A 3U8PA 4F4BA 1NG1A 1Z23A 3EPVA 4G7ZF 4N06A 2Q3TA 2Z15A 5CI9A 2C03A 1A0BA 1C02A 2VASA 1WGWA 4HEAJ 4G7OF 1QLEC 3M1CB 4AL1A 2XL4A 4JVSA 3AGTA 4MNDA 4CS8C 3AJMA 2R25A 4KNWA 2DI3A 2VCAA 2CYDA 4YL1A 4ZLDA 1EA8A 5KYNA 2QNLA 2I15A 2AVKA 1CGME 2L6HA 2NG1A 1E2XA 2PP4A 1V4AA 2ZXPA 4P9TA 3Q7GA 3R7CA 4EHPA 2MWQA 3UMKA 2OKUA 3SXMA 4YL3A 4M63A 3RVYA 1NLXA 4BJ5A 1CGOA 3F46A 1ORYA 2A6HF 3GM2A 1FTSA 5AGFA 4IARA 1H9GA 4JTCB 4O79A 1GM5A 2EPNA 4HFKB 2XSEA 5E3AA 3HNKA 3LNMB 3Q6NA 5T3WA 3RVZA 5L0DA 5B3SC 5T1DB 3ATPA 1JR8A 1A7DA 3M15A 2KJGA 1L7CA 3RH3A 2XS8A 2KGOA 2OEXA 1GGQA 3U0CA 3EFOA 1LVKA 2P7VA 4CS9A 4O6YA 3JRMO 3AQBA 1JPNA 2C04A 3L1MA 2YEVA 5F5FA 1E85A 2XRHA 1Q0GA 4MW8A 1NZEA 1WATA 2KC3A 1DOVA 2LCHA 3IQ6A 1NSGB 3S9OA 1I4YA 5COGA 2Q9BA 3DKAA 3T6BA 3TULA 2HMZA 2HZ8A 4JJGA 1ZU5A 3AOUA 4RDAA 4AE4B 4K0DA 4CJOA 4LLCA 5DS6A 3U8VA 3X1OA 4MVMA 2EINC 2CGEA 2FGYA 3ECSA 4NTFA 1VTMP 4PFOA 4C3BA 2GAQA 1ZHXA 1K05A 2J9UA 1ZW2A 3US6A 2Y69C 1FMVA 4IAQA 2XXAA 4DXWA 1R4TA 5KYXA 4I44A 2R05A 5AC5A 3K7DA 2AP3A 2FFHA 2EIKC 3K1IA 4MS2A 2NUPA 3IQTA 2R7VA 2J0WA 4GYTA 4JKVA 4U5BE 2EIJC 2HJMA 2HSQA 1NFOA 2HFIA 2Q4FA 2R7RA 3G4XA 3RQGA 2Y39A 1HE9A 5BQGA 2A0BA 5BQHA 4IB4A 4KBLA 4IRUA 4EIYA 1MQVA 2YLIA 2ZXWC 3LS0A 4CIPA 5HV9A 1V54C 3T9OA 1JOGA 5KYXB 4OIOF 3GODA 3RKOF 4Z9IA 2NUPB 2GDCA 4DBRA 1Z5ZA 4WJ0A 3F47A 5GPGB 3MX3A 1H6GA 2ETSA 2IBFA 4OD5A 2OG2A 3HJCA 3FXHA 1LPEA 3MBGA 3NKDA 4LLEA 5A6AA 4JTAB 2Y3GA 1OXBA 2XLOA 3ZSUA 4OIPF 4MTOA 2QUPA 1VK5A 3C8ZA 3FDQA 4U5DE 2CDQA 3LUTB 2H7BA 3DE8A 3WODF 1Z63A 1NU7D 2HV7A 1QKRA 3AG1C 1OW6A 3SP1A 4E18A 5EHHA 3NG1A 3NRHA 4O6MA 4IGGA 3L8JA 1S7ZA 1TQGA 2PNOA 4J32B 5T3TA 1SMYF 1OXKA 2W4MA 3N0TA 3GEHA 3PHF2 4JRZA 1SYQA 4MQ9F 3A9CA 5B1AC 2NUTA 4U9EA 3SXKA 4PJLA 1I5NA 2H7VC 3GEIA 3QTHA 4BJ5C 4BPMA 4DVYP 2YLDA 3IQCA 4P9FA 3ZTMA 4Q7CA 5E33A 3ABLC 5TJ5E 5COFA 4J30B 3UMIA 1YDIA 5JVEA 5JLIA 5L0HA 4HFFB 4FAPB 3DZAA 2J9BA 5AC4A 1S05A 5EGYA 5L0IA 3GM3A 3SNHA 2YL3A 2XLVA 1HMOA 1VOMA 1OCCC 1ORSC 3LESA 3QMKA 2NSFA 2NUTB 4K7BA 4HE8D 3DE9A 5K0IA 2OCCC 1H7IA 5DS5A 1C03A 3Q6MA 4N6HA 1XZQA 2CW0F 1VB5A 2J45A 3KYIA 3W8HA 4CJGA 4BG0A 3TQOA 1N1CA 1D0ZA 2IXMA 3JYYA 1YJGA 2L7AA 1OKKD 3DM9B 3LAYA 3NYMA 4AX2A 4CS9C 4ZLCA 4QI2A 3B9QA 1A7VA 4DRHB 3UMHA 2IXOA 3S28A 2M64A 3DJNB 2CNWA 3HNJA 4JEBA 3JTLO 4LDRA 2R7UA 3KL4A 1MMAA 1K04A 3DXJF 1M57C 1ZU4A 1PD0A 2VCCA 1Q0KA 3LLIA 4BEMJ 1YA9A 2HUJA 1RXQA 1ZVZA 2LP4A 3UGPA 3NYJA 1OCZC 4PJMA 3H2UA 2YL1A 1D0YA 1PD1A 2CCYA 1GS9A 2WB7A 2W45A 2PFDA 3GWLA 3SZRA 1UFBA 2G3VA 4YT8A 2L6GA 4W8PA 1BZ4A 2BE5F 3VM6A 3JSEO 5BUOA 2DGJA 2XM4A 3JRTA 2IYLD 5EK0A 1ZHYA 4ANJA 2XLEA 4BJ6C 3ABKC 2VB6A 3K1IC 1Y6DA 3AQCA 3M79A 2JPUA 2AWCA 2UUHA 3VF0A 2J7PD 3AGUA 1WTYA 2LK4A 2XLHA 3C8GA 4DVZA 2W4BA 1AUEA 4KC9A 3KMIA 1YVIA 2IXNA 2J9WA 3E9VA 3IHUA 3QW1A 2BL2A 3QZCA 4J7TA 3UR3C 4CDAA 2LIGA 3V5ZA 1M2VA 3EGXA 2MYSA 1JPJA 3RIPA 3NMKA 3DAFA 2VC9A 3E70C 4C7OB 2EPMX 4L6RA 2H8AA 3C8GB 1ZYRF 3FAJA 5L3VA 2J0XA 1XZPA 2YZSA 3UNGC 3DWWA 2WZGA 3EZHA 3RF3A 1VLTA 1EI7A 2A6EF 3IEEA 5JP7A 4OIRF 2Q7RA 4XPYA 3WAQA 4J7YA 1HY5A 1M2VB 1ORJA 1SF8A 3EGXB 4JZAA 1NU9C 4MW3A 4ULVA 4XPWA 4CDYA 1OR2A 2HKVA 1U6HA 3PDMP 4U9DA 4NQFA 5IY5C 3PMRA 1MNDA 3ZWIA 3I4UA 3JCUQ 1KNYA 1WWPA 3K1HA 5F5HA 1RKCA 2Y3DA 2YLGA 4PJJA 1D1BA 1ZHTA 2WVNA 4XLNF 4EBKA 2IM8A 1AEPA 1OKKA 2OQMA 2ZXRA 2LD6A 2LSEA 2VH3A 5JS5A 4CSAA 5COMA 1TWHA 5A6KA 3C62A 3FVYA 1F1MA 2R7OA 3GWNA 4JC7A 3S84A 2WVOA 3RW0A 4QDLA 2XLMA 2A0UA 3V5YA 1TFKB 4XWJA 1T6UA 1EKYA 3VAYA 1E83A 1LI7A 4WABA 3CZ6A 1LS1A 1JRAA 1NBBA 1R5ID 2Y3HA 4BJ6A 4YWQA 1G4US 3MLGA 5JUAA 1YYJA 1CPQA 4PFPA 4GQHA 3CSKA 2OEVA 3HLZA 1FMWA 1LI5A 2CNWD 3MFNA 1KU2A 2DB4A 5L0JA 1O3UA 4UDVA 1D0XA 2QY9A 2NSGA
chains in the Genus database with same CATH topology
2OOCA 1YVIA 4PACA 1I5NA 1A0BA 1C02A 3MYFA 2LD6A 2LP4A 1OXBA 2R25A 3US6A 1SR2A 1WN0A 3IQTA 1BDJB 2Q4FA 3U3BA 1QSPA 1C03A 3KYIA 2A0BA 3KYJA 4G78A 4EUKB 1Y6DA 2LCHA 1TQGA 1OXKA 1FR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOC A;  1YVI A;  4PAC A;  1I5N A;  1A0B A;  1C02 A;  3MYF A;  2LD6 A;  2LP4 A;  1OXB A;  2R25 A;  3US6 A;  1SR2 A;  1WN0 A;  3IQT A;  1BDJ B;  2Q4F A;  3U3B A;  1QSP A;  1C03 A;  3KYI A;  2A0B A;  3KYJ A;  4G78 A;  4EUK B;  1Y6D A;  2LCH A;  1TQG A;  1OXK A;  1FR0 A; 
#chains in the Genus database with same CATH topology
 2OOC A;  1TWA A;  3ASN C;  4U5G A;  2L6F A;  1OR3 A;  1YLM A;  3TJ5 A;  2V26 A;  3DJU B;  5L0G A;  1ZHW A;  3J06 A;  1LS4 A;  4D4N A;  4EKW A;  4U5H A;  5JRA A;  4NC3 A;  4C3E A;  2J7P A;  4PJN A;  4YT2 A;  2R7W A;  4CX9 A;  1VYK A;  5L3Q A;  2PX3 A;  3HNL A;  1T5O A;  2KQ9 A;  2QTV A;  4NY3 A;  1L3P A;  1T9K A;  5DLJ A;  2EIM C;  2L9J A;  4DJ9 A;  3ABM C;  3EG9 A;  3RQE A;  3DD7 A;  1ZHZ A;  1O87 A;  1W2W A;  3I5Q A;  3C8G D;  3H2V A;  3QVY A;  3KH2 A;  4DBQ A;  2YL0 A;  2Q00 A;  4CDV A;  4I1M A;  2O9X A;  3ASO C;  4G78 A;  3TOM A;  1MNE A;  3W2V A;  3T4R A;  1YZA A;  2HMQ A;  3ZG1 A;  2XS1 A;  4LER A;  4A2N B;  4CIH A;  2GWW A;  3AG3 C;  3B0P A;  3EG9 B;  2R7X A;  1Z6A A;  4PAC A;  4U5C E;  3SYN A;  1I4Z A;  1BR4 A;  2JD3 A;  1LIH A;  2B0H A;  1HW1 A;  2MHR A;  4XQ1 A;  3W8I A;  5KYW A;  1E84 A;  4MVS A;  2PX0 A;  1HMD A;  3I5P A;  4BJ1 A;  2HV6 A;  3AG2 C;  2NPU A;  1ST6 A;  2G62 A;  2GA0 A;  4IWB A;  4O6N A;  1CPR A;  1SR2 A;  4XEV A;  3TOL A;  3B0U X;  2QE9 A;  2ZPA A;  1WN0 A;  3FMS A;  1BR2 A;  4BEJ A;  1KTM A;  2A1D D;  5KYW B;  2Y3B A;  3C18 A;  3U3B A;  1M2O A;  2YVK A;  3KKB A;  2IXP A;  3GEE A;  3EH1 A;  1EQ1 A;  3HTK C;  3EH2 A;  5CI8 A;  5HSW A;  4G7H F;  2WZL A;  3RQF A;  4I3M A;  4OD4 A;  2GFH A;  2XLD A;  1V74 B;  3WHN A;  1DOW A;  4EBJ A;  5D91 A;  4IAO A;  4E0H A;  2M4E A;  5DQT A;  3EHN A;  3K66 A;  2XL8 A;  4H4K C;  3TD7 A;  4MTG A;  4XTK A;  5DS4 A;  3BRJ A;  1MMG A;  5B3I A;  2R7T A;  2RSE B;  1NFN A;  3B71 A;  1G4W R;  1LKX A;  3OWT A;  2P1A A;  4MVZ A;  1JMW A;  1WOL A;  1RMV A;  3L8I A;  1UG7 A;  3S90 A;  4LDQ A;  4YT5 A;  4CSA C;  3GOR A;  2HSB A;  2HJ3 A;  5A6B D;  3U3F A;  3IPM O;  1T6Q A;  1IW7 F;  2B0J A;  3W2W A;  4XLP F;  5JT4 A;  1Q0M A;  4QI0 A;  1OW8 A;  1K40 A;  4RBN A;  1OQC A;  1QVX A;  3KYJ A;  5L0C A;  4N4W A;  5E2Q A;  4D4X A;  3U9M A;  1VMA A;  3M4B A;  4C7O A;  1QPU A;  1FFH A;  1RCP A;  2D5R B;  2JX0 A;  2YKZ A;  2YQY A;  4MTF A;  4Z9H A;  1Z7Q c;  5A69 A;  1M56 C;  1RJ9 B;  2I8B A;  1YZC A;  2YRF A;  2YWA A;  3AG4 C;  1YAR O;  3MYI A;  3NMI A;  3LEV A;  3ZC4 A;  3OEO A;  3ZIB A;  5BQI A;  1E86 A;  3X2Q C;  2LFF A;  3EJN A;  3CEX A;  1O5H A;  1T6I A;  2BC5 A;  3GM1 A;  1V55 C;  3G50 A;  1FFT C;  1TFO B;  3JT1 A;  4JIO A;  2P61 A;  3VRC A;  5FCL A;  1J8M F;  3CAX A;  1TR2 A;  4FX5 A;  2OJE D;  3DI5 A;  2V3C C;  2L81 A;  1QQ3 A;  3H65 A;  3RFY A;  3EQL F;  3G4Z A;  4ULW A;  4YN0 B;  4JTD B;  256B A;  3LJB A;  3WG7 C;  3NMJ A;  2VCB A;  2KW3 C;  3W4Y A;  4EWC A;  2ZXO A;  3DAG A;  4JJF A;  1AVO B;  3FOP A;  3FHD A;  3K33 A;  3LNR A;  4YT4 A;  5L0F A;  3RYL A;  4JCH A;  1D1C A;  2H7O A;  3K6B A;  2X51 A;  3JZ0 A;  3NYL A;  4NTA A;  4GEH A;  3NKE A;  2F22 A;  4O7G A;  3SXZ A;  1MMD A;  2R7Q A;  3N24 A;  2LQG A;  5CIV A;  2YL7 A;  2IOQ A;  2DYR C;  4Q4Z F;  2R7S A;  3S27 A;  2EIL C;  3QW0 A;  2AU5 A;  4E0I A;  3FAP B;  4OIN F;  2XLW A;  4Z9J A;  2ICW G;  1JAF A;  1G5Z A;  4XEF A;  4CS7 A;  2WL8 A;  2E87 A;  3GAN A;  3QVZ A;  2KNH A;  1BDJ B;  3R2P A;  3ZTZ A;  2PF4 E;  4ONS A;  1TKN A;  3FOO A;  2UUI A;  4WGY A;  5B1B C;  3U9J A;  4E17 A;  3N2Z B;  4IJJ A;  2X0C A;  4EUK B;  3O39 A;  2KSF A;  5A6B A;  3EGD A;  2ASR A;  1H9T A;  2KYH A;  2AWY A;  1APC A;  1LM3 B;  4U5E E;  3TK0 A;  4CS8 A;  3PCV A;  3EFO B;  5JSL A;  3HKK A;  3IQ5 A;  2EPO A;  1G8X A;  3V5X A;  4BJT A;  1J8Y F;  3NDB B;  4K1O A;  3V7O A;  4JEA A;  1FNT c;  2EPK X;  4E7S A;  3C7J A;  1PV3 A;  4P6I C;  1U89 A;  3EGD B;  4KNV A;  4YL0 A;  3SXY A;  4AL0 A;  5E3C A;  2RD9 A;  3VYW A;  4E7Z A;  3JYH A;  5F28 E;  1B68 A;  4EBB A;  3ZDL A;  4JUR I;  3DM5 A;  3UGO A;  2HS5 A;  1YA7 O;  4U5F E;  4AE4 A;  1Q0D A;  3T6G B;  2XXA B;  5A6J A;  4FES A;  1QZX A;  3O10 A;  1FR0 A;  1A7E A;  1WAS A;  4MVQ A;  3LEO A;  2G3K A;  3O55 A;  4Q5S F;  4KI2 A;  1YAU O;  1U0B B;  3EHM A;  2P6V A;  4MVU A;  4W8K A;  2A68 F;  3U5S A;  4AK9 A;  4PK4 A;  3OA1 A;  1HW2 A;  3B29 A;  3S0X A;  3DMD A;  1Z3I X;  3M4C A;  4N6C A;  3L0I A;  1LE4 A;  1RKE A;  4I1O B;  4G0H A;  2R03 A;  1IZM A;  5DQZ A;  1ZZP A;  2XM0 A;  2LFD A;  1VLS A;  4DRJ B;  4WGZ A;  2J46 A;  4FWV A;  3ZVR A;  3L34 A;  3KPH A;  4ER9 A;  4DRI B;  3B0V C;  2A69 F;  5KYU A;  3EZI A;  4JCZ A;  3TJ6 A;  3SEO A;  1YYX A;  1OCR C;  1XWJ A;  1QSP A;  4XEK A;  4JE9 A;  4NCQ A;  1D1A A;  1ZW3 A;  2TMV P;  1C17 M;  4A4A A;  4PR9 A;  2FAP B;  1RKE B;  3JSZ A;  2R9R B;  4R32 A;  2D4U A;  1Q0F A;  2KK1 A;  1PCX A;  4YK5 A;  1T01 A;  4C3D A;  2PBE A;  2R02 A;  3Q7L A;  4NTB A;  5DVW A;  3POV A;  2P0N A;  4MVO A;  5KYU B;  3CQZ A;  2Q9C A;  4XPX A;  1BR1 A;  2WVQ A;  3BEH A;  4LAC B;  4X0R A;  3LLK A;  3MYF A;  5KYY A;  4LDK A;  2OJQ A;  2ZD9 A;  1SZI A;  4B6I A;  2XL6 A;  1M6T A;  2Q9A A;  2EPL X;  4JW1 A;  3S29 A;  2YHS A;  3ITF A;  1HE1 A;  3HNI A;  4H54 A;  3U2L A;  4OIQ F;  2OU6 A;  1FAP B;  2J9V A;  4RD9 A;  1RJ9 A;  3ZQY A;  1A41 A;  3T6J A;  3LS1 A;  1GQA A;  1CGN A;  1LE2 A;  5KYY B;  3O6X A;  1OW7 A;  1VYI A;  1Y4C A;  1BBH A;  1TWG A;  1TWC A;  2W9Y A;  2WZF A;  4MVR A;  3U2M A;  5FZT A;  2DYS C;  4YJW A;  5D92 A;  3A11 A;  2J8W A;  3ZQV A;  2QLA A;  1MMN A;  4CBE A;  4DOZ A;  1OCO C;  3C63 A;  3U8P A;  4F4B A;  1NG1 A;  1Z23 A;  3EPV A;  4G7Z F;  4N06 A;  2Q3T A;  2Z15 A;  5CI9 A;  2C03 A;  1A0B A;  1C02 A;  2VAS A;  1WGW A;  4HEA J;  4G7O F;  1QLE C;  3M1C B;  4AL1 A;  2XL4 A;  4JVS A;  3AGT A;  4MND A;  4CS8 C;  3AJM A;  2R25 A;  4KNW A;  2DI3 A;  2VCA A;  2CYD A;  4YL1 A;  4ZLD A;  1EA8 A;  5KYN A;  2QNL A;  2I15 A;  2AVK A;  1CGM E;  2L6H A;  2NG1 A;  1E2X A;  2PP4 A;  1V4A A;  2ZXP A;  4P9T A;  3Q7G A;  3R7C A;  4EHP A;  2MWQ A;  3UMK A;  2OKU A;  3SXM A;  4YL3 A;  4M63 A;  3RVY A;  1NLX A;  4BJ5 A;  1CGO A;  3F46 A;  1ORY A;  2A6H F;  3GM2 A;  1FTS A;  5AGF A;  4IAR A;  1H9G A;  4JTC B;  4O79 A;  1GM5 A;  2EPN A;  4HFK B;  2XSE A;  5E3A A;  3HNK A;  3LNM B;  3Q6N A;  5T3W A;  3RVZ A;  5L0D A;  5B3S C;  5T1D B;  3ATP A;  1JR8 A;  1A7D A;  3M15 A;  2KJG A;  1L7C A;  3RH3 A;  2XS8 A;  2KGO A;  2OEX A;  1GGQ A;  3U0C A;  3EFO A;  1LVK A;  2P7V A;  4CS9 A;  4O6Y A;  3JRM O;  3AQB A;  1JPN A;  2C04 A;  3L1M A;  2YEV A;  5F5F A;  1E85 A;  2XRH A;  1Q0G A;  4MW8 A;  1NZE A;  1WAT A;  2KC3 A;  1DOV A;  2LCH A;  3IQ6 A;  1NSG B;  3S9O A;  1I4Y A;  5COG A;  2Q9B A;  3DKA A;  3T6B A;  3TUL A;  2HMZ A;  2HZ8 A;  4JJG A;  1ZU5 A;  3AOU A;  4RDA A;  4AE4 B;  4K0D A;  4CJO A;  4LLC A;  5DS6 A;  3U8V A;  3X1O A;  4MVM A;  2EIN C;  2CGE A;  2FGY A;  3ECS A;  4NTF A;  1VTM P;  4PFO A;  4C3B A;  2GAQ A;  1ZHX A;  1K05 A;  2J9U A;  1ZW2 A;  3US6 A;  2Y69 C;  1FMV A;  4IAQ A;  2XXA A;  4DXW A;  1R4T A;  5KYX A;  4I44 A;  2R05 A;  5AC5 A;  3K7D A;  2AP3 A;  2FFH A;  2EIK C;  3K1I A;  4MS2 A;  2NUP A;  3IQT A;  2R7V A;  2J0W A;  4GYT A;  4JKV A;  4U5B E;  2EIJ C;  2HJM A;  2HSQ A;  1NFO A;  2HFI A;  2Q4F A;  2R7R A;  3G4X A;  3RQG A;  2Y39 A;  1HE9 A;  5BQG A;  2A0B A;  5BQH A;  4IB4 A;  4KBL A;  4IRU A;  4EIY A;  1MQV A;  2YLI A;  2ZXW C;  3LS0 A;  4CIP A;  5HV9 A;  1V54 C;  3T9O A;  1JOG A;  5KYX B;  4OIO F;  3GOD A;  3RKO F;  4Z9I A;  2NUP B;  2GDC A;  4DBR A;  1Z5Z A;  4WJ0 A;  3F47 A;  5GPG B;  3MX3 A;  1H6G A;  2ETS A;  2IBF A;  4OD5 A;  2OG2 A;  3HJC A;  3FXH A;  1LPE A;  3MBG A;  3NKD A;  4LLE A;  5A6A A;  4JTA B;  2Y3G A;  1OXB A;  2XLO A;  3ZSU A;  4OIP F;  4MTO A;  2QUP A;  1VK5 A;  3C8Z A;  3FDQ A;  4U5D E;  2CDQ A;  3LUT B;  2H7B A;  3DE8 A;  3WOD F;  1Z63 A;  1NU7 D;  2HV7 A;  1QKR A;  3AG1 C;  1OW6 A;  3SP1 A;  4E18 A;  5EHH A;  3NG1 A;  3NRH A;  4O6M A;  4IGG A;  3L8J A;  1S7Z A;  1TQG A;  2PNO A;  4J32 B;  5T3T A;  1SMY F;  1OXK A;  2W4M A;  3N0T A;  3GEH A;  3PHF 2;  4JRZ A;  1SYQ A;  4MQ9 F;  3A9C A;  5B1A C;  2NUT A;  4U9E A;  3SXK A;  4PJL A;  1I5N A;  2H7V C;  3GEI A;  3QTH A;  4BJ5 C;  4BPM A;  4DVY P;  2YLD A;  3IQC A;  4P9F A;  3ZTM A;  4Q7C A;  5E33 A;  3ABL C;  5TJ5 E;  5COF A;  4J30 B;  3UMI A;  1YDI A;  5JVE A;  5JLI A;  5L0H A;  4HFF B;  4FAP B;  3DZA A;  2J9B A;  5AC4 A;  1S05 A;  5EGY A;  5L0I A;  3GM3 A;  3SNH A;  2YL3 A;  2XLV A;  1HMO A;  1VOM A;  1OCC C;  1ORS C;  3LES A;  3QMK A;  2NSF A;  2NUT B;  4K7B A;  4HE8 D;  3DE9 A;  5K0I A;  2OCC C;  1H7I A;  5DS5 A;  1C03 A;  3Q6M A;  4N6H A;  1XZQ A;  2CW0 F;  1VB5 A;  2J45 A;  3KYI A;  3W8H A;  4CJG A;  4BG0 A;  3TQO A;  1N1C A;  1D0Z A;  2IXM A;  3JYY A;  1YJG A;  2L7A A;  1OKK D;  3DM9 B;  3LAY A;  3NYM A;  4AX2 A;  4CS9 C;  4ZLC A;  4QI2 A;  3B9Q A;  1A7V A;  4DRH B;  3UMH A;  2IXO A;  3S28 A;  2M64 A;  3DJN B;  2CNW A;  3HNJ A;  4JEB A;  3JTL O;  4LDR A;  2R7U A;  3KL4 A;  1MMA A;  1K04 A;  3DXJ F;  1M57 C;  1ZU4 A;  1PD0 A;  2VCC A;  1Q0K A;  3LLI A;  4BEM J;  1YA9 A;  2HUJ A;  1RXQ A;  1ZVZ A;  2LP4 A;  3UGP A;  3NYJ A;  1OCZ C;  4PJM A;  3H2U A;  2YL1 A;  1D0Y A;  1PD1 A;  2CCY A;  1GS9 A;  2WB7 A;  2W45 A;  2PFD A;  3GWL A;  3SZR A;  1UFB A;  2G3V A;  4YT8 A;  2L6G A;  4W8P A;  1BZ4 A;  2BE5 F;  3VM6 A;  3JSE O;  5BUO A;  2DGJ A;  2XM4 A;  3JRT A;  2IYL D;  5EK0 A;  1ZHY A;  4ANJ A;  2XLE A;  4BJ6 C;  3ABK C;  2VB6 A;  3K1I C;  1Y6D A;  3AQC A;  3M79 A;  2JPU A;  2AWC A;  2UUH A;  3VF0 A;  2J7P D;  3AGU A;  1WTY A;  2LK4 A;  2XLH A;  3C8G A;  4DVZ A;  2W4B A;  1AUE A;  4KC9 A;  3KMI A;  1YVI A;  2IXN A;  2J9W A;  3E9V A;  3IHU A;  3QW1 A;  2BL2 A;  3QZC A;  4J7T A;  3UR3 C;  4CDA A;  2LIG A;  3V5Z A;  1M2V A;  3EGX A;  2MYS A;  1JPJ A;  3RIP A;  3NMK A;  3DAF A;  2VC9 A;  3E70 C;  4C7O B;  2EPM X;  4L6R A;  2H8A A;  3C8G B;  1ZYR F;  3FAJ A;  5L3V A;  2J0X A;  1XZP A;  2YZS A;  3UNG C;  3DWW A;  2WZG A;  3EZH A;  3RF3 A;  1VLT A;  1EI7 A;  2A6E F;  3IEE A;  5JP7 A;  4OIR F;  2Q7R A;  4XPY A;  3WAQ A;  4J7Y A;  1HY5 A;  1M2V B;  1ORJ A;  1SF8 A;  3EGX B;  4JZA A;  1NU9 C;  4MW3 A;  4ULV A;  4XPW A;  4CDY A;  1OR2 A;  2HKV A;  1U6H A;  3PDM P;  4U9D A;  4NQF A;  5IY5 C;  3PMR A;  1MND A;  3ZWI A;  3I4U A;  3JCU Q;  1KNY A;  1WWP A;  3K1H A;  5F5H A;  1RKC A;  2Y3D A;  2YLG A;  4PJJ A;  1D1B A;  1ZHT A;  2WVN A;  4XLN F;  4EBK A;  2IM8 A;  1AEP A;  1OKK A;  2OQM A;  2ZXR A;  2LD6 A;  2LSE A;  2VH3 A;  5JS5 A;  4CSA A;  5COM A;  1TWH A;  5A6K A;  3C62 A;  3FVY A;  1F1M A;  2R7O A;  3GWN A;  4JC7 A;  3S84 A;  2WVO A;  3RW0 A;  4QDL A;  2XLM A;  2A0U A;  3V5Y A;  1TFK B;  4XWJ A;  1T6U A;  1EKY A;  3VAY A;  1E83 A;  1LI7 A;  4WAB A;  3CZ6 A;  1LS1 A;  1JRA A;  1NBB A;  1R5I D;  2Y3H A;  4BJ6 A;  4YWQ A;  1G4U S;  3MLG A;  5JUA A;  1YYJ A;  1CPQ A;  4PFP A;  4GQH A;  3CSK A;  2OEV A;  3HLZ A;  1FMW A;  1LI5 A;  2CNW D;  3MFN A;  1KU2 A;  2DB4 A;  5L0J A;  1O3U A;  4UDV A;  1D0X A;  2QY9 A;  2NSG A; 
#chains in the Genus database with same CATH homology
 2OOC A;  1YVI A;  4PAC A;  1I5N A;  1A0B A;  1C02 A;  3MYF A;  2LD6 A;  2LP4 A;  1OXB A;  2R25 A;  3US6 A;  1SR2 A;  1WN0 A;  3IQT A;  1BDJ B;  2Q4F A;  3U3B A;  1QSP A;  1C03 A;  3KYI A;  2A0B A;  3KYJ A;  4G78 A;  4EUK B;  1Y6D A;  2LCH A;  1TQG A;  1OXK A;  1FR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...