3US6A

Crystal structure of histidine-containing phosphotransfer protein mthpt1 from medicago truncatula
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
148
structure length
148
Chain Sequence
EVGQMRRQWVDYIKSMFMEGFLDGQFLQLQQLQDENNPEFVFEVVSLFFDDSERILKDLSFAVDQQSIDFKKVDAHVHQFKGSSASIGAQRVKNSCVAFRNFCEEQNIDACRRCLQQVKQEYLLVKNKLETLLRLEQQIVAAGGSIPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histidine-containing Phosphotransfer Protein type 1, MtHPt1
publication title Medicago truncatula histidine-containing phosphotransfer protein: Structural and biochemical insights into the cytokinin transduction pathway in plants.
pubmed doi rcsb
source organism Medicago truncatula
total genus 67
structure length 148
sequence length 148
ec nomenclature ec 2.7.3.-:
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 3us6A00
1TQGA 1YVIA 4EUKB 1I5NA 3IQTA 2Q4FA 1Y6DA 1SR2A 3U3BA 1A0BA 1C03A 2R25A 1FR0A 1OXBA 4PACA 3KYIA 3KYJA 2LCHA 2OOCA 1OXKA 3MYFA 2LD6A 1C02A 1QSPA 2A0BA 1WN0A 4G78A 1BDJB 3US6A 2LP4A
chains in the Genus database with same CATH superfamily
4QI2A 1VOMA 5CI8A 4OD4A 5DS6A 2W4MA 3CEXA 3KMIA 3RVZA 1Z5ZA 4ZLCA 2Y69C 5JLIA 3RW0A 2G3VA 1MQVA 3F46A 3Q6MA 2Z15A 3O55A 3U2MA 1U0BB 1J8MF 1YZAA 1BR2A 1RJ9A 3M79A 5DVWA 4CBEA 4J7YA 4WGYA 4HFFB 2YRFA 4O79A 2J0XA 1JAFA 3EJNA 1A41A 2LSEA 5E2QA 2M64A 3SYNA 3QW0A 4LLEA 2WB7A 3U9JA 2QE9A 4NTFA 4U5HA 2XL4A 3GM1A 2XLDA 2GFHA 1H7IA 3DE8A 4H54A 3G50A 3PDMP 2R7SA 3RKOF 3X2QC 4CIPA 5HSWA 4MQ9F 4JJFA 1ZU5A 3JRMO 4L6RA 4XTKA 1RJ9B 2A0BA 4DBQA 3WG7C 3PCVA 4PFOA 4K0DA 4FWVA 3IQ5A 3UMIA 2WZFA 2RD9A 4OIRF 2GAQA 4BJ5A 4BJ6C 3A9CA 5F28E 2NSGA 5TJ5E 2MWQA 3POVA 3KPHA 4MNDA 1CPRA 3AG1C 4FAPB 2R02A 4PJMA 4CX9A 5KYUA 2HUJA 3U3FA 5IY5C 4CJOA 1Y4CA 4O7GA 2X51A 3BEHA 1C17M 4EHPA 3DKAA 3ASNC 3AJMA 1LM3B 1OXKA 3HTKC 4W8KA 1F1MA 3RH3A 2XXAA 1D0YA 1ZVZA 1ZYRF 3RVYA 3NMKA 3VM6A 1OKKD 3ABLC 3AQBA 3C63A 2I8BA 3NKDA 4XLPF 1VTMP 3EGDA 2D5RB 3O6XA 3GWNA 4RBNA 3DWWA 4Z9HA 4MW3A 3ZDLA 1H6GA 3DJUB 4LDRA 4E18A 3LEOA 2EIMC 1NU7D 4GQHA 5DLJA 3NYMA 4P9FA 2J9WA 2NSFA 3FVYA 4AX2A 2R03A 2VC9A 5KYXA 2XXAB 1GS9A 2FAPB 3QTHA 2XS1A 3AQCA 2PBEA 3NDBB 4I3MA 3B0VC 3FHDA 3WHNA 2GDCA 1BZ4A 1RKEB 5A69A 1HE9A 4E0HA 4FESA 4U5EE 1G5ZA 1OCOC 1XZPA 3W4YA 4FX5A 3SXYA 2YL3A 3M4CA 1CGME 2A1DD 2D4UA 4IGGA 1D0XA 1O5HA 2G3KA 2W45A 4HE8D 4XPXA 2P0NA 1QVXA 3R7CA 3B9QA 4P6IC 1E85A 1YLMA 1APCA 1HW2A 1LIHA 3RQGA 2YWAA 5DS4A 3QVYA 4A2NB 5L0GA 1HE1A 2YLGA 2A0UA 1ZHWA 1R4TA 3K33A 4HEAJ 2EPKX 4Q7CA 3S29A 1E83A 4G7OF 2AU5A 1YDIA 3U5SA 4Q4ZF 2OG2A 5A6JA 4IB4A 3NMJA 1VLTA 1FAPB 4E0IA 2ZD9A 2L7AA 3LNMB 4IRUA 2Y3DA 4AE4A 1K40A 3V7OA 3S0XA 1Z7Qc 1PD0A 3RF3A 4LDKA 3U8VA 2PP4A 3N0TA 4ZLDA 4QI0A 3DJNB 1NG1A 4DVYP 3NYLA 1DOVA 1Z63A 2GA0A 1LI7A 4JIOA 2IXMA 4XEVA 3UGOA 1G4US 3DI5A 3FOPA 3T6GB 5E3AA 5A6BA 3TK0A 3CQZA 1L3PA 5KYYB 2JX0A 2XLMA 2DB4A 2P7VA 1D1AA 2A6EF 1LVKA 1U89A 4N6CA 4NCQA 1SMYF 3UR3C 4KC9A 4ER9A 2P1AA 2J9BA 4YWQA 2YL7A 4U5BE 3ZTZA 3FDQA 5BQHA 1ZZPA 3TOMA 4GYTA 2KC3A 3KL4A 1OW7A 4BJ6A 5AC5A 4OIOF 2KGOA 2XLWA 1NFNA 3GODA 3GORA 4J32B 4JCZA 1ZW2A 2LQGA 3MLGA 4MTGA 1FR0A 5B1AC 2EIKC 2DGJA 5JRAA 4XWJA 5L3VA 2Q00A 3N2ZB 1WASA 1E84A 1OW8A 4P9TA 3BRJA 1AEPA 4X0RA 2OKUA 4EIYA 2EINC 1MMNA 2A68F 2Q3TA 1N1CA 3Q7GA 4DJ9A 5A6KA 1WN0A 3DE9A 5KYWB 5B3IA 4B6IA 1YA9A 2FGYA 3LS1A 3B29A 3RIPA 3MFNA 1YVIA 1T6IA 5JSLA 4DOZA 5KYNA 1HMDA 2KW3C 3E70C 1BBHA 2Q4FA 2OQMA 2HSBA 3HLZA 3PHF2 1VLSA 1ZHTA 1Q0DA 4IJJA 4PJNA 4CDYA 3UGPA 1TWAA 2XLVA 1J8YF 4O6MA 1E86A 2KQ9A 2R7UA 3LLIA 5BUOA 3LJBA 3S9OA 4CIHA 3A11A 3K7DA 4MVUA 3FOOA 4JW1A 3EFOB 3JT1A 2WZGA 5CIVA 1M6TA 3JCUQ 5COFA 2WL8A 4JC7A 5K0IA 4CS7A 3M1CB 5T1DB 2VCBA 5B3SC 4XEKA 4U9EA 2XLHA 4G78A 3ZTMA 2YLIA 4DRHB 2YHSA 3T4RA 3H2UA 1NU9C 2EPLX 2YL0A 4E7ZA 3HNLA 3G4ZA 3C8ZA 5GPGB 2F22A 2L6HA 3CAXA 5E33A 3TJ6A 3IHUA 5JS5A 4R32A 4C7OB 3OEOA 5EGYA 2XS8A 1A0BA 1C03A 1JPJA 1WATA 1NLXA 5T3WA 5BQIA 5EHHA 4BJ1A 1OW6A 1W2WA 3LAYA 2WZLA 4PJJA 2Y3HA 3AGUA 4KBLA 1VK5A 2VCAA 1D1BA 2M4EA 3H2VA 2R05A 1EQ1A 2LK4A 2XLOA 1JPNA 3DAFA 1MMAA 2OCCC 3V5YA 2TMVP 3G4XA 4YT2A 1A7VA 1LKXA 2Y3GA 2XM4A 2Y3BA 3IEEA 4YN0B 1RKEA 4K7BA 1KU2A 3ZIBA 4KNVA 4CSAC 3K1IC 1E2XA 2LP4A 4NTBA 2NUTA 1OCCC 1A7EA 2J8WA 3L0IA 4IWBA 4RD9A 1LPEA 4OINF 1I5NA 1RXQA 1TR2A 3UNGC 1SR2A 3U3BA 5L3QA 3QMKA 2L6FA 1V4AA 1YARO 1IW7F 4EWCA 4MTFA 1HMOA 1ORYA 3JZ0A 1M2VB 3EZHA 3LUTB 3Q6NA 5D92A 1CPQA 3VRCA 2BL2A 3LEVA 3JSEO 1M2OA 1OKKA 1PD1A 2QUPA 2NUTB 3AG2C 3KYIA 3M15A 2YZSA 3H65A 4YT5A 3ZSUA 4C3BA 1NSGB 1YJGA 1KTMA 2GWWA 1K04A 1YZCA 2MHRA 1ZHXA 4JJGA 4LERA 4Z9IA 2KYHA 2LD6A 2ZXOA 5COMA 4JCHA 2CW0F 3M4BA 1B68A 3O39A 3WAQA 4EKWA 1WTYA 3N24A 3SP1A 3KKBA 1EA8A 1FMWA 3K1HA 4YL0A 3SXMA 2UUHA 4ANJA 4CS8A 5L0DA 4PFPA 4NTAA 2OEXA 4EUKB 2HFIA 2LFFA 2R7VA 4DBRA 4N6HA 4XQ1A 3AG4C 4F4BA 2HKVA 4H4KC 4K1OA 4M63A 1U6HA 1K05A 4I1OB 4C3DA 4E17A 3FAJA 3HKKA 1T6QA 1V55C 4EBJA 1AUEA 2I15A 3TJ5A 1OCZC 4MVRA 5KYYA 3SXKA 3GWLA 4MS2A 3B71A 1ZHYA 3MX3A 3U8PA 1D1CA 4AL1A 3C7JA 4OIQF 3MYFA 3AGTA 3J06A 5L0JA 3V5XA 2AWYA 3I5QA 2HMQA 1CGOA 4I44A 3W8IA 1C02A 2V26A 3S27A 5COGA 1YYXA 2KJGA 2OU6A 1IZMA 3EGXB 1DOWA 4JKVA 2VCCA 3SXZA 2NUPB 4PR9A 2X0CA 2LIGA 2HJ3A 4PK4A 1RMVA 2R7QA 3IQTA 5D91A 2BC5A 1LE2A 3GEEA 3GEIA 1XZQA 1O3UA 1TFKB 4LACB 2HV6A 3KH2A 2L9JA 1CGNA 2PX3A 2B0JA 1L7CA 3V5ZA 3W2VA 4YT8A 5KYWA 3FXHA 2BE5F 3GM2A 2XL8A 4U5DE 1FFTC 4XPYA 3ZG1A 3ZVRA 5L0HA 3TULA 3KYJA 3DZAA 4DXWA 4LLCA 2J7PD 3HNJA 1JMWA 2JPUA 5E3CA 2EPMX 3L8IA 3OWTA 3DD7A 3QW1A 4U5CE 4BJTA 1TFOB 3SEOA 3LESA 2Q9BA 1SZIA 5B1BC 2E87A 2H7VC 2EPOA 2WVOA 1QKRA 3DMDA 3QVZA 2JD3A 3UMKA 4RDAA 4ULWA 2J0WA 1QPUA 1MNEA 1SYQA 4Q5SF 3EFOA 2CNWD 3I4UA 3MBGA 1HY5A 3RQFA 2WVQA 1Q0KA 1Y6DA 3NMIA 3HJCA 1M57C 3GANA 4U5FE 3LS0A 4JVSA 1T5OA 1JR8A 4NC3A 4JTDB 4BEMJ 4C3EA 4NQFA 2CCYA 4JEAA 3L1MA 1VYIA 2IYLD 5JVEA 1MNDA 4JTCB 4CS9C 3ATPA 2LCHA 4JE9A 2XM0A 2XLEA 2XSEA 3HNIA 2G62A 3JSZA 4KNWA 5CI9A 4D4XA 2H7BA 2W4BA 3EH2A 3DXJF 5AGFA 4C7OA 1QSPA 3PMRA 3Q7LA 4JTAB 2A69F 4DRIB 3JYYA 1JRAA 1NZEA 2CDQA 1LE4A 4DVZA 1AVOB 1ZU4A 3NKEA 3MYIA 4IAOA 4YL3A 1WWPA 3T6JA 3T6BA 3RQEA 3SNHA 3E9VA 2H8AA 1V74B 2C03A 2OEVA 4ULVA 3IQCA 3ZWIA 4UDVA 4G7ZF 1GGQA 2QNLA 3JTLO 4YT4A 2PF4E 2Q7RA 2IXPA 1OCRC 2QLAA 3S28A 5AC4A 1OQCA 2J9UA 1ZHZA 2KNHA 1LI5A 2AWCA 2WVNA 3EG9B 2YKZA 2R7OA 4IAQA 3EZIA 2PFDA 1GQAA 4XPWA 2HZ8A 3VF0A 2HS5A 4N06A 3OA1A 3S84A 3I5PA 1OXBA 2EIJC 2VH3A 4DRJB 1ORJA 4MVZA 2HV7A 3LLKA 3RFYA 4BG0A 5A6AA 2YQYA 3DAGA 4MVSA 2ZPAA 3B0UX 2NG1A 1OR2A 1GM5A 2NPUA 3DM5A 2P6VA 4CDVA 3W8HA 1RCPA 1M2VA 1OR3A 2RSEB 4JURI 2KSFA 5L0FA 2Q9AA 2CYDA 1FFHA 1R5ID 2YVKA 3EHNA 1NBBA 4G0HA 4E7SA 5T3TA 3UMHA 3X1OA 2V3CC 4EBKA 1WOLA 1TWHA 1QLEC 3ZC4A 1T6UA 1JOGA 4GEHA 4XLNF 1UFBA 2YL1A 1QZXA 3CZ6A 3F47A 4AK9A 3W2WA 5DQZA 3TOLA 2IXNA 1YYJA 4ONSA 3K66A 1Z3IX 1Q0GA 256BA 1G8XA 5KYUB 2OJED 4JRZA 1FNTc 3RYLA 2O9XA 3ZQVA 3US6A 2DI3A 4BPMA 1T9KA 4MVOA 1S05A 1WGWA 2L81A 3FMSA 2IM8A 2UUIA 1M56C 2PNOA 5DS5A 2HJMA 1Z6AA 2J46A 3EGDB 2ZXPA 3NYJA 3LNRA 2YLDA 4MTOA 2R7RA 1YA7O 1VMAA 3EQLF 4YK5A 2R25A 3IQ6A 1H9TA 3ECSA 2HMZA 4Z9JA 4MVMA 5KYXB 2R7XA 4PACA 3EGXA 2NUPA 2L6GA 3S90A 2KK1A 1A7DA 2J45A 3GEHA 3JYHA 3T9OA 3U2LA 4CS9A 1RKCA 2J9VA 4MW8A 2Y39A 1BR1A 1UG7A 2CGEA 5JT4A 2OJQA 4OD5A 1Q0MA 2ZXWC 2HSQA 2AP3A 4BJ5C 2IXOA 1BDJB 2MYSA 1TWGA 5F5HA 2QY9A 2QTVA 1T01A 3C62A 1FTSA 3IPMO 3TD7A 3ZQYA 4MVQA 5JUAA 3U0CA 1I4YA 4D4NA 2YEVA 4IARA 1TQGA 4WGZA 5A6BD 3EH1A 2ASRA 2FFHA 2R9RB 1TWCA 1D0ZA 1V54C 3L34A 3SZRA 3R2PA 2DYRC 3L8JA 5DQTA 3C8GD 2IBFA 1ST6A 4AL0A 3ASOC 3K6BA 4EBBA 4CJGA 4QDLA 3AG3C 1G4WR 2LFDA 4PJLA 4YJWA 2P61A 1MMDA 1S7ZA 2OOCA 3EPVA 4OIPF 1KNYA 4JZAA 2ZXRA 2XL6A 3HNKA 1YAUO 2ICWG 1NFOA 1ZW3A 1O87A 4BEJA 4I1MA 4J7TA 5L0CA 1VB5A 3NG1A 3VAYA 3ABKC 4O6NA 4KI2A 2AVKA 2VASA 1PCXA 2XRHA 3CSKA 3VYWA 3C8GA 4CDAA 1MMGA 5EK0A 1LS1A 2PX0A 1I4ZA 1SF8A 2A6HF 1H9GA 4CSAA 3AOUA 3QZCA 2ETSA 4JEBA 1ORSC 1XWJA 2EILC 2DYSC 3EHMA 3FAPB 3K1IA 3ABMC 2W9YA 4LDQA 2EPNA 2Q9CA 1EI7A 1LS4A 5FZTA 1PV3A 2R7WA 3ITFA 5HV9A 5FCLA 1QQ3A 2J7PA 5BQGA 4O6YA 1Q0FA 1HW1A 3C8GB 1EKYA 1BR4A 3JRTA 2R7TA 4J30B 4YL1A 2C04A 4G7HF 4XEFA 3DM9B 5F5FA 3WODF 1FMVA 2B0HA 3C18A 3NRHA 4HFKB 4W8PA 2IOQA 5JP7A 4AE4B 4N4WA 4WJ0A 3TQOA 4CS8C 4WABA 3U9MA 4U5GA 4A4AA 3O10A 5L0IA 2VB6A 2CNWA 4U9DA 3EG9A 1TKNA 2H7OA 3B0PA 1Z23A 4NY3A 1VYKA 3GM3A
chains in the Genus database with same CATH topology
1TQGA 1YVIA 4EUKB 1I5NA 3IQTA 2Q4FA 1Y6DA 1SR2A 3U3BA 1A0BA 1C03A 2R25A 1FR0A 1OXBA 4PACA 3KYIA 3KYJA 2LCHA 2OOCA 1OXKA 3MYFA 2LD6A 1C02A 1QSPA 2A0BA 1WN0A 4G78A 1BDJB 3US6A 2LP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TQG A;  1YVI A;  4EUK B;  1I5N A;  3IQT A;  2Q4F A;  1Y6D A;  1SR2 A;  3U3B A;  1A0B A;  1C03 A;  2R25 A;  1FR0 A;  1OXB A;  4PAC A;  3KYI A;  3KYJ A;  2LCH A;  2OOC A;  1OXK A;  3MYF A;  2LD6 A;  1C02 A;  1QSP A;  2A0B A;  1WN0 A;  4G78 A;  1BDJ B;  3US6 A;  2LP4 A; 
#chains in the Genus database with same CATH topology
 4QI2 A;  1VOM A;  5CI8 A;  4OD4 A;  5DS6 A;  2W4M A;  3CEX A;  3KMI A;  3RVZ A;  1Z5Z A;  4ZLC A;  2Y69 C;  5JLI A;  3RW0 A;  2G3V A;  1MQV A;  3F46 A;  3Q6M A;  2Z15 A;  3O55 A;  3U2M A;  1U0B B;  1J8M F;  1YZA A;  1BR2 A;  1RJ9 A;  3M79 A;  5DVW A;  4CBE A;  4J7Y A;  4WGY A;  4HFF B;  2YRF A;  4O79 A;  2J0X A;  1JAF A;  3EJN A;  1A41 A;  2LSE A;  5E2Q A;  2M64 A;  3SYN A;  3QW0 A;  4LLE A;  2WB7 A;  3U9J A;  2QE9 A;  4NTF A;  4U5H A;  2XL4 A;  3GM1 A;  2XLD A;  2GFH A;  1H7I A;  3DE8 A;  4H54 A;  3G50 A;  3PDM P;  2R7S A;  3RKO F;  3X2Q C;  4CIP A;  5HSW A;  4MQ9 F;  4JJF A;  1ZU5 A;  3JRM O;  4L6R A;  4XTK A;  1RJ9 B;  2A0B A;  4DBQ A;  3WG7 C;  3PCV A;  4PFO A;  4K0D A;  4FWV A;  3IQ5 A;  3UMI A;  2WZF A;  2RD9 A;  4OIR F;  2GAQ A;  4BJ5 A;  4BJ6 C;  3A9C A;  5F28 E;  2NSG A;  5TJ5 E;  2MWQ A;  3POV A;  3KPH A;  4MND A;  1CPR A;  3AG1 C;  4FAP B;  2R02 A;  4PJM A;  4CX9 A;  5KYU A;  2HUJ A;  3U3F A;  5IY5 C;  4CJO A;  1Y4C A;  4O7G A;  2X51 A;  3BEH A;  1C17 M;  4EHP A;  3DKA A;  3ASN C;  3AJM A;  1LM3 B;  1OXK A;  3HTK C;  4W8K A;  1F1M A;  3RH3 A;  2XXA A;  1D0Y A;  1ZVZ A;  1ZYR F;  3RVY A;  3NMK A;  3VM6 A;  1OKK D;  3ABL C;  3AQB A;  3C63 A;  2I8B A;  3NKD A;  4XLP F;  1VTM P;  3EGD A;  2D5R B;  3O6X A;  3GWN A;  4RBN A;  3DWW A;  4Z9H A;  4MW3 A;  3ZDL A;  1H6G A;  3DJU B;  4LDR A;  4E18 A;  3LEO A;  2EIM C;  1NU7 D;  4GQH A;  5DLJ A;  3NYM A;  4P9F A;  2J9W A;  2NSF A;  3FVY A;  4AX2 A;  2R03 A;  2VC9 A;  5KYX A;  2XXA B;  1GS9 A;  2FAP B;  3QTH A;  2XS1 A;  3AQC A;  2PBE A;  3NDB B;  4I3M A;  3B0V C;  3FHD A;  3WHN A;  2GDC A;  1BZ4 A;  1RKE B;  5A69 A;  1HE9 A;  4E0H A;  4FES A;  4U5E E;  1G5Z A;  1OCO C;  1XZP A;  3W4Y A;  4FX5 A;  3SXY A;  2YL3 A;  3M4C A;  1CGM E;  2A1D D;  2D4U A;  4IGG A;  1D0X A;  1O5H A;  2G3K A;  2W45 A;  4HE8 D;  4XPX A;  2P0N A;  1QVX A;  3R7C A;  3B9Q A;  4P6I C;  1E85 A;  1YLM A;  1APC A;  1HW2 A;  1LIH A;  3RQG A;  2YWA A;  5DS4 A;  3QVY A;  4A2N B;  5L0G A;  1HE1 A;  2YLG A;  2A0U A;  1ZHW A;  1R4T A;  3K33 A;  4HEA J;  2EPK X;  4Q7C A;  3S29 A;  1E83 A;  4G7O F;  2AU5 A;  1YDI A;  3U5S A;  4Q4Z F;  2OG2 A;  5A6J A;  4IB4 A;  3NMJ A;  1VLT A;  1FAP B;  4E0I A;  2ZD9 A;  2L7A A;  3LNM B;  4IRU A;  2Y3D A;  4AE4 A;  1K40 A;  3V7O A;  3S0X A;  1Z7Q c;  1PD0 A;  3RF3 A;  4LDK A;  3U8V A;  2PP4 A;  3N0T A;  4ZLD A;  4QI0 A;  3DJN B;  1NG1 A;  4DVY P;  3NYL A;  1DOV A;  1Z63 A;  2GA0 A;  1LI7 A;  4JIO A;  2IXM A;  4XEV A;  3UGO A;  1G4U S;  3DI5 A;  3FOP A;  3T6G B;  5E3A A;  5A6B A;  3TK0 A;  3CQZ A;  1L3P A;  5KYY B;  2JX0 A;  2XLM A;  2DB4 A;  2P7V A;  1D1A A;  2A6E F;  1LVK A;  1U89 A;  4N6C A;  4NCQ A;  1SMY F;  3UR3 C;  4KC9 A;  4ER9 A;  2P1A A;  2J9B A;  4YWQ A;  2YL7 A;  4U5B E;  3ZTZ A;  3FDQ A;  5BQH A;  1ZZP A;  3TOM A;  4GYT A;  2KC3 A;  3KL4 A;  1OW7 A;  4BJ6 A;  5AC5 A;  4OIO F;  2KGO A;  2XLW A;  1NFN A;  3GOD A;  3GOR A;  4J32 B;  4JCZ A;  1ZW2 A;  2LQG A;  3MLG A;  4MTG A;  1FR0 A;  5B1A C;  2EIK C;  2DGJ A;  5JRA A;  4XWJ A;  5L3V A;  2Q00 A;  3N2Z B;  1WAS A;  1E84 A;  1OW8 A;  4P9T A;  3BRJ A;  1AEP A;  4X0R A;  2OKU A;  4EIY A;  2EIN C;  1MMN A;  2A68 F;  2Q3T A;  1N1C A;  3Q7G A;  4DJ9 A;  5A6K A;  1WN0 A;  3DE9 A;  5KYW B;  5B3I A;  4B6I A;  1YA9 A;  2FGY A;  3LS1 A;  3B29 A;  3RIP A;  3MFN A;  1YVI A;  1T6I A;  5JSL A;  4DOZ A;  5KYN A;  1HMD A;  2KW3 C;  3E70 C;  1BBH A;  2Q4F A;  2OQM A;  2HSB A;  3HLZ A;  3PHF 2;  1VLS A;  1ZHT A;  1Q0D A;  4IJJ A;  4PJN A;  4CDY A;  3UGP A;  1TWA A;  2XLV A;  1J8Y F;  4O6M A;  1E86 A;  2KQ9 A;  2R7U A;  3LLI A;  5BUO A;  3LJB A;  3S9O A;  4CIH A;  3A11 A;  3K7D A;  4MVU A;  3FOO A;  4JW1 A;  3EFO B;  3JT1 A;  2WZG A;  5CIV A;  1M6T A;  3JCU Q;  5COF A;  2WL8 A;  4JC7 A;  5K0I A;  4CS7 A;  3M1C B;  5T1D B;  2VCB A;  5B3S C;  4XEK A;  4U9E A;  2XLH A;  4G78 A;  3ZTM A;  2YLI A;  4DRH B;  2YHS A;  3T4R A;  3H2U A;  1NU9 C;  2EPL X;  2YL0 A;  4E7Z A;  3HNL A;  3G4Z A;  3C8Z A;  5GPG B;  2F22 A;  2L6H A;  3CAX A;  5E33 A;  3TJ6 A;  3IHU A;  5JS5 A;  4R32 A;  4C7O B;  3OEO A;  5EGY A;  2XS8 A;  1A0B A;  1C03 A;  1JPJ A;  1WAT A;  1NLX A;  5T3W A;  5BQI A;  5EHH A;  4BJ1 A;  1OW6 A;  1W2W A;  3LAY A;  2WZL A;  4PJJ A;  2Y3H A;  3AGU A;  4KBL A;  1VK5 A;  2VCA A;  1D1B A;  2M4E A;  3H2V A;  2R05 A;  1EQ1 A;  2LK4 A;  2XLO A;  1JPN A;  3DAF A;  1MMA A;  2OCC C;  3V5Y A;  2TMV P;  3G4X A;  4YT2 A;  1A7V A;  1LKX A;  2Y3G A;  2XM4 A;  2Y3B A;  3IEE A;  4YN0 B;  1RKE A;  4K7B A;  1KU2 A;  3ZIB A;  4KNV A;  4CSA C;  3K1I C;  1E2X A;  2LP4 A;  4NTB A;  2NUT A;  1OCC C;  1A7E A;  2J8W A;  3L0I A;  4IWB A;  4RD9 A;  1LPE A;  4OIN F;  1I5N A;  1RXQ A;  1TR2 A;  3UNG C;  1SR2 A;  3U3B A;  5L3Q A;  3QMK A;  2L6F A;  1V4A A;  1YAR O;  1IW7 F;  4EWC A;  4MTF A;  1HMO A;  1ORY A;  3JZ0 A;  1M2V B;  3EZH A;  3LUT B;  3Q6N A;  5D92 A;  1CPQ A;  3VRC A;  2BL2 A;  3LEV A;  3JSE O;  1M2O A;  1OKK A;  1PD1 A;  2QUP A;  2NUT B;  3AG2 C;  3KYI A;  3M15 A;  2YZS A;  3H65 A;  4YT5 A;  3ZSU A;  4C3B A;  1NSG B;  1YJG A;  1KTM A;  2GWW A;  1K04 A;  1YZC A;  2MHR A;  1ZHX A;  4JJG A;  4LER A;  4Z9I A;  2KYH A;  2LD6 A;  2ZXO A;  5COM A;  4JCH A;  2CW0 F;  3M4B A;  1B68 A;  3O39 A;  3WAQ A;  4EKW A;  1WTY A;  3N24 A;  3SP1 A;  3KKB A;  1EA8 A;  1FMW A;  3K1H A;  4YL0 A;  3SXM A;  2UUH A;  4ANJ A;  4CS8 A;  5L0D A;  4PFP A;  4NTA A;  2OEX A;  4EUK B;  2HFI A;  2LFF A;  2R7V A;  4DBR A;  4N6H A;  4XQ1 A;  3AG4 C;  4F4B A;  2HKV A;  4H4K C;  4K1O A;  4M63 A;  1U6H A;  1K05 A;  4I1O B;  4C3D A;  4E17 A;  3FAJ A;  3HKK A;  1T6Q A;  1V55 C;  4EBJ A;  1AUE A;  2I15 A;  3TJ5 A;  1OCZ C;  4MVR A;  5KYY A;  3SXK A;  3GWL A;  4MS2 A;  3B71 A;  1ZHY A;  3MX3 A;  3U8P A;  1D1C A;  4AL1 A;  3C7J A;  4OIQ F;  3MYF A;  3AGT A;  3J06 A;  5L0J A;  3V5X A;  2AWY A;  3I5Q A;  2HMQ A;  1CGO A;  4I44 A;  3W8I A;  1C02 A;  2V26 A;  3S27 A;  5COG A;  1YYX A;  2KJG A;  2OU6 A;  1IZM A;  3EGX B;  1DOW A;  4JKV A;  2VCC A;  3SXZ A;  2NUP B;  4PR9 A;  2X0C A;  2LIG A;  2HJ3 A;  4PK4 A;  1RMV A;  2R7Q A;  3IQT A;  5D91 A;  2BC5 A;  1LE2 A;  3GEE A;  3GEI A;  1XZQ A;  1O3U A;  1TFK B;  4LAC B;  2HV6 A;  3KH2 A;  2L9J A;  1CGN A;  2PX3 A;  2B0J A;  1L7C A;  3V5Z A;  3W2V A;  4YT8 A;  5KYW A;  3FXH A;  2BE5 F;  3GM2 A;  2XL8 A;  4U5D E;  1FFT C;  4XPY A;  3ZG1 A;  3ZVR A;  5L0H A;  3TUL A;  3KYJ A;  3DZA A;  4DXW A;  4LLC A;  2J7P D;  3HNJ A;  1JMW A;  2JPU A;  5E3C A;  2EPM X;  3L8I A;  3OWT A;  3DD7 A;  3QW1 A;  4U5C E;  4BJT A;  1TFO B;  3SEO A;  3LES A;  2Q9B A;  1SZI A;  5B1B C;  2E87 A;  2H7V C;  2EPO A;  2WVO A;  1QKR A;  3DMD A;  3QVZ A;  2JD3 A;  3UMK A;  4RDA A;  4ULW A;  2J0W A;  1QPU A;  1MNE A;  1SYQ A;  4Q5S F;  3EFO A;  2CNW D;  3I4U A;  3MBG A;  1HY5 A;  3RQF A;  2WVQ A;  1Q0K A;  1Y6D A;  3NMI A;  3HJC A;  1M57 C;  3GAN A;  4U5F E;  3LS0 A;  4JVS A;  1T5O A;  1JR8 A;  4NC3 A;  4JTD B;  4BEM J;  4C3E A;  4NQF A;  2CCY A;  4JEA A;  3L1M A;  1VYI A;  2IYL D;  5JVE A;  1MND A;  4JTC B;  4CS9 C;  3ATP A;  2LCH A;  4JE9 A;  2XM0 A;  2XLE A;  2XSE A;  3HNI A;  2G62 A;  3JSZ A;  4KNW A;  5CI9 A;  4D4X A;  2H7B A;  2W4B A;  3EH2 A;  3DXJ F;  5AGF A;  4C7O A;  1QSP A;  3PMR A;  3Q7L A;  4JTA B;  2A69 F;  4DRI B;  3JYY A;  1JRA A;  1NZE A;  2CDQ A;  1LE4 A;  4DVZ A;  1AVO B;  1ZU4 A;  3NKE A;  3MYI A;  4IAO A;  4YL3 A;  1WWP A;  3T6J A;  3T6B A;  3RQE A;  3SNH A;  3E9V A;  2H8A A;  1V74 B;  2C03 A;  2OEV A;  4ULV A;  3IQC A;  3ZWI A;  4UDV A;  4G7Z F;  1GGQ A;  2QNL A;  3JTL O;  4YT4 A;  2PF4 E;  2Q7R A;  2IXP A;  1OCR C;  2QLA A;  3S28 A;  5AC4 A;  1OQC A;  2J9U A;  1ZHZ A;  2KNH A;  1LI5 A;  2AWC A;  2WVN A;  3EG9 B;  2YKZ A;  2R7O A;  4IAQ A;  3EZI A;  2PFD A;  1GQA A;  4XPW A;  2HZ8 A;  3VF0 A;  2HS5 A;  4N06 A;  3OA1 A;  3S84 A;  3I5P A;  1OXB A;  2EIJ C;  2VH3 A;  4DRJ B;  1ORJ A;  4MVZ A;  2HV7 A;  3LLK A;  3RFY A;  4BG0 A;  5A6A A;  2YQY A;  3DAG A;  4MVS A;  2ZPA A;  3B0U X;  2NG1 A;  1OR2 A;  1GM5 A;  2NPU A;  3DM5 A;  2P6V A;  4CDV A;  3W8H A;  1RCP A;  1M2V A;  1OR3 A;  2RSE B;  4JUR I;  2KSF A;  5L0F A;  2Q9A A;  2CYD A;  1FFH A;  1R5I D;  2YVK A;  3EHN A;  1NBB A;  4G0H A;  4E7S A;  5T3T A;  3UMH A;  3X1O A;  2V3C C;  4EBK A;  1WOL A;  1TWH A;  1QLE C;  3ZC4 A;  1T6U A;  1JOG A;  4GEH A;  4XLN F;  1UFB A;  2YL1 A;  1QZX A;  3CZ6 A;  3F47 A;  4AK9 A;  3W2W A;  5DQZ A;  3TOL A;  2IXN A;  1YYJ A;  4ONS A;  3K66 A;  1Z3I X;  1Q0G A;  256B A;  1G8X A;  5KYU B;  2OJE D;  4JRZ A;  1FNT c;  3RYL A;  2O9X A;  3ZQV A;  3US6 A;  2DI3 A;  4BPM A;  1T9K A;  4MVO A;  1S05 A;  1WGW A;  2L81 A;  3FMS A;  2IM8 A;  2UUI A;  1M56 C;  2PNO A;  5DS5 A;  2HJM A;  1Z6A A;  2J46 A;  3EGD B;  2ZXP A;  3NYJ A;  3LNR A;  2YLD A;  4MTO A;  2R7R A;  1YA7 O;  1VMA A;  3EQL F;  4YK5 A;  2R25 A;  3IQ6 A;  1H9T A;  3ECS A;  2HMZ A;  4Z9J A;  4MVM A;  5KYX B;  2R7X A;  4PAC A;  3EGX A;  2NUP A;  2L6G A;  3S90 A;  2KK1 A;  1A7D A;  2J45 A;  3GEH A;  3JYH A;  3T9O A;  3U2L A;  4CS9 A;  1RKC A;  2J9V A;  4MW8 A;  2Y39 A;  1BR1 A;  1UG7 A;  2CGE A;  5JT4 A;  2OJQ A;  4OD5 A;  1Q0M A;  2ZXW C;  2HSQ A;  2AP3 A;  4BJ5 C;  2IXO A;  1BDJ B;  2MYS A;  1TWG A;  5F5H A;  2QY9 A;  2QTV A;  1T01 A;  3C62 A;  1FTS A;  3IPM O;  3TD7 A;  3ZQY A;  4MVQ A;  5JUA A;  3U0C A;  1I4Y A;  4D4N A;  2YEV A;  4IAR A;  1TQG A;  4WGZ A;  5A6B D;  3EH1 A;  2ASR A;  2FFH A;  2R9R B;  1TWC A;  1D0Z A;  1V54 C;  3L34 A;  3SZR A;  3R2P A;  2DYR C;  3L8J A;  5DQT A;  3C8G D;  2IBF A;  1ST6 A;  4AL0 A;  3ASO C;  3K6B A;  4EBB A;  4CJG A;  4QDL A;  3AG3 C;  1G4W R;  2LFD A;  4PJL A;  4YJW A;  2P61 A;  1MMD A;  1S7Z A;  2OOC A;  3EPV A;  4OIP F;  1KNY A;  4JZA A;  2ZXR A;  2XL6 A;  3HNK A;  1YAU O;  2ICW G;  1NFO A;  1ZW3 A;  1O87 A;  4BEJ A;  4I1M A;  4J7T A;  5L0C A;  1VB5 A;  3NG1 A;  3VAY A;  3ABK C;  4O6N A;  4KI2 A;  2AVK A;  2VAS A;  1PCX A;  2XRH A;  3CSK A;  3VYW A;  3C8G A;  4CDA A;  1MMG A;  5EK0 A;  1LS1 A;  2PX0 A;  1I4Z A;  1SF8 A;  2A6H F;  1H9G A;  4CSA A;  3AOU A;  3QZC A;  2ETS A;  4JEB A;  1ORS C;  1XWJ A;  2EIL C;  2DYS C;  3EHM A;  3FAP B;  3K1I A;  3ABM C;  2W9Y A;  4LDQ A;  2EPN A;  2Q9C A;  1EI7 A;  1LS4 A;  5FZT A;  1PV3 A;  2R7W A;  3ITF A;  5HV9 A;  5FCL A;  1QQ3 A;  2J7P A;  5BQG A;  4O6Y A;  1Q0F A;  1HW1 A;  3C8G B;  1EKY A;  1BR4 A;  3JRT A;  2R7T A;  4J30 B;  4YL1 A;  2C04 A;  4G7H F;  4XEF A;  3DM9 B;  5F5F A;  3WOD F;  1FMV A;  2B0H A;  3C18 A;  3NRH A;  4HFK B;  4W8P A;  2IOQ A;  5JP7 A;  4AE4 B;  4N4W A;  4WJ0 A;  3TQO A;  4CS8 C;  4WAB A;  3U9M A;  4U5G A;  4A4A A;  3O10 A;  5L0I A;  2VB6 A;  2CNW A;  4U9D A;  3EG9 A;  1TKN A;  2H7O A;  3B0P A;  1Z23 A;  4NY3 A;  1VYK A;  3GM3 A; 
#chains in the Genus database with same CATH homology
 1TQG A;  1YVI A;  4EUK B;  1I5N A;  3IQT A;  2Q4F A;  1Y6D A;  1SR2 A;  3U3B A;  1A0B A;  1C03 A;  2R25 A;  1FR0 A;  1OXB A;  4PAC A;  3KYI A;  3KYJ A;  2LCH A;  2OOC A;  1OXK A;  3MYF A;  2LD6 A;  1C02 A;  1QSP A;  2A0B A;  1WN0 A;  4G78 A;  1BDJ B;  3US6 A;  2LP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...