3US6A

Crystal structure of histidine-containing phosphotransfer protein mthpt1 from medicago truncatula
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
148
structure length
148
Chain Sequence
EVGQMRRQWVDYIKSMFMEGFLDGQFLQLQQLQDENNPEFVFEVVSLFFDDSERILKDLSFAVDQQSIDFKKVDAHVHQFKGSSASIGAQRVKNSCVAFRNFCEEQNIDACRRCLQQVKQEYLLVKNKLETLLRLEQQIVAAGGSIPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Medicago truncatula histidine-containing phosphotransfer protein: Structural and biochemical insights into the cytokinin transduction pathway in plants.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Transferase
molecule keywords Histidine-containing Phosphotransfer Protein type 1, MtHPt1
total genus 67
structure length 148
sequence length 148
ec nomenclature ec 2.7.3.-:
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 3us6A00
3KYJA 1YVIA 1WN0A 1BDJB 2OOCA 3IQTA 2LP4A 2LCHA 4PACA 2R25A 1Y6DA 1C03A 1OXBA 1QSPA 1TQGA 3U3BA 1C02A 3US6A 2A0BA 2LD6A 4EUKB 3MYFA 1SR2A 1FR0A 1OXKA 3KYIA 1I5NA 4G78A 1A0BA 2Q4FA
chains in the Genus database with same CATH superfamily
4Z9JA 2W9YA 5JLIA 3AGUA 1EI7A 1VOMA 3NKDA 2LP4A 1D1AA 5DLJA 1O87A 256BA 3U5SA 4JZAA 2VCAA 3O55A 1JMWA 1BBHA 2EILC 3DKAA 3AJMA 5L0CA 1ST6A 5IY5C 1RMVA 4PR9A 3C7JA 2ZXOA 4R32A 3RW0A 1OW6A 1O3UA 4PK4A 2OU6A 5CI9A 2XXAB 4O7GA 3ZTMA 4BJ6A 3HNLA 2V26A 2R7WA 2NPUA 3AGTA 2XL4A 4AX2A 4G78A 3IQCA 1Q0DA 2QLAA 2YKZA 2NSFA 3FVYA 1RJ9A 1S7ZA 1Z6AA 2Q7RA 1H9GA 3K7DA 5JT4A 2W4MA 3JCUQ 1YJGA 2C03A 4OIQF 4EKWA 4E18A 1HE1A 4C3BA 4JE9A 1H9TA 3W8HA 1CGOA 3HLZA 2EIMC 1LE2A 2HJMA 4P6IC 3RVZA 1GM5A 2XS8A 3X1OA 1E85A 1LI5A 4CS8C 3DZAA 5TJ5E 3M15A 4PFOA 3G50A 4YK5A 4YWQA 4ZLCA 1DOWA 1OKKA 3RQEA 3S27A 3VYWA 1T6QA 3AG3C 2L6FA 2OG2A 3JYHA 4BJ1A 4DRHB 1ZVZA 1XZPA 1G5ZA 1ZHWA 4WJ0A 1OKKD 1TWGA 2AVKA 3MYFA 3RFYA 2OJED 3FOPA 3KMIA 4XEFA 1SR2A 3EH2A 4XPYA 4OIRF 4CBEA 4ANJA 4JIOA 1O5HA 4JW1A 3EG9B 3C8GB 1JR8A 2HMZA 5KYUA 3DMDA 3RVYA 2J7PA 3W8IA 5KYNA 2LQGA 2M4EA 3LEOA 4J7TA 1U89A 3M4CA 2DI3A 3DJUB 1VK5A 2J0WA 4KI2A 3Q7LA 2G62A 1NFNA 1NG1A 4YT4A 3TJ5A 2IXPA 2ETSA 3F46A 4OIPF 5L0IA 3L0IA 1VLTA 4E7ZA 2XLVA 2L7AA 3C8ZA 1QKRA 4XPWA 2O9XA 1H6GA 4JVSA 2YL0A 4LERA 5E33A 1MMDA 3RH3A 3V5XA 4N6HA 5DS4A 2XM0A 4NCQA 1FFHA 1NSGB 1OCCC 1RKEB 3KH2A 1YAUO 3FDQA 3MX3A 2WVNA 4N4WA 1KNYA 1DOVA 2YL1A 1OW7A 1YZCA 3CAXA 3VF0A 1B68A 1ZHTA 2AP3A 4CX9A 4XLPF 2VB6A 1K05A 4FX5A 2HS5A 2CDQA 3IQ6A 3KPHA 5L0GA 1OR2A 1WTYA 1MNEA 1LE4A 4MQ9F 2XLMA 5F28E 2OJQA 4Q7CA 3ZQYA 3KKBA 3GM3A 3ASOC 1ZYRF 4MTFA 3UNGC 3EH1A 4YT8A 3EQLF 2VASA 3AOUA 1U6HA 1D1CA 1LIHA 3JSZA 4XWJA 1E2XA 2P0NA 3EGDA 4GEHA 2IYLD 3V5YA 4AL0A 4EHPA 3S90A 1GQAA 5FZTA 2JD3A 2R25A 3RYLA 5KYUB 4K7BA 3N24A 2M64A 1D0ZA 4WABA 3EFOA 1L7CA 3JTLO 2DB4A 1RJ9B 3HNJA 2XLOA 3EGXA 2WB7A 2D4UA 4HFKB 3ZDLA 3NG1A 1JAFA 2A0BA 1BR4A 1QQ3A 2WVOA 3ECSA 4H54A 4A4AA 2C04A 2L9JA 3IPMO 2EPKX 2DYRC 3AG1C 2XLEA 2AWYA 2R9RB 3NRHA 1AVOB 3O39A 3R7CA 5L3QA 1TR2A 2NUTB 4ER9A 4W8KA 1YA9A 4JCHA 1SZIA 4BJ5C 5BQIA 3NDBB 4JCZA 2WVQA 4XLNF 2XRHA 5FCLA 3SP1A 2EIJC 2ZD9A 4I1MA 2AU5A 2VH3A 1J8MF 5D91A 5JS5A 2OCCC 4WGYA 1Q0GA 3LS0A 2J8WA 1T5OA 1WWPA 3TQOA 1FTSA 3VM6A 2W4BA 2PFDA 4XEKA 1ZU5A 1LKXA 1TQGA 4FAPB 1PCXA 4MTOA 5AC5A 2LIGA 4PJLA 1K40A 4NQFA 1VMAA 3V7OA 2EIKC 3G4XA 2ASRA 4DOZA 1JOGA 2J46A 2PBEA 3LLIA 3WODF 2UUHA 3I5QA 3Q7GA 1XWJA 4G0HA 4JC7A 4CIPA 1WATA 2PNOA 1NBBA 3C8GD 3EGXB 1C17M 4J32B 1FMWA 5JP7A 3T6GB 5F5HA 3DAFA 4N6CA 3CZ6A 4HFFB 4E17A 2HV7A 4G7HF 1MQVA 3C18A 5GPGB 2NUPA 5B3IA 2LCHA 3OA1A 1YYXA 1NU9C 2KC3A 4BJTA 4LLCA 4C3DA 5DQTA 5A6JA 3K66A 1LM3B 3JZ0A 1A7VA 5L0JA 4OINF 3K1HA 1C02A 4NTFA 3TD7A 4C3EA 1EKYA 2J9UA 2GA0A 4P9FA 3HJCA 1NFOA 1ZW3A 4DBRA 1SF8A 1GGQA 4NC3A 1FR0A 1TFOB 4KNVA 2KNHA 4H4KC 1LPEA 1V74B 4OIOF 3K1IC 4E7SA 4IAQA 3E9VA 3CSKA 3JRMO 3NMKA 4C7OA 5CI8A 2CNWA 3S84A 1HMOA 1PD0A 4L6RA 1N1CA 1HMDA 3AQBA 1Y4CA 4ONSA 4U5EE 3SXKA 2YVKA 3T6BA 2A0UA 5B3SC 1I4ZA 2R7VA 2J9VA 1FMVA 2P61A 1YARO 3M79A 4JKVA 3T9OA 2HSBA 1Y6DA 2G3VA 1Q0KA 1Z3IX 3GEIA 4JJGA 1ORSC 1HW1A 3U2MA 2ZXPA 2GWWA 3EHMA 4Z9IA 2PF4E 1ZHZA 3ASNC 1E83A 4CS7A 4AL1A 2R05A 1YYJA 3C8GA 2WL8A 3LAYA 3E70C 4MVQA 4P9TA 2NUTA 1LI7A 2LSEA 3SNHA 2LFDA 2YLIA 4IWBA 4YT5A 3WHNA 1HE9A 1S05A 4CDVA 3A11A 4DRIB 1F1MA 3FHDA 1Z63A 4EBKA 4ULWA 1M56C 3U8PA 1E86A 4N06A 2VC9A 2EINC 1G4WR 2YLDA 1Q0FA 3EZIA 3HTKC 3W2VA 4AE4A 2J45A 4BPMA 4CS9A 4EBBA 2B0JA 5KYWB 4MVRA 4I1OB 3VAYA 2XLHA 3TOMA 2J7PD 5KYXB 2J9BA 2I15A 4LDKA 1HW2A 3U2LA 1G8XA 1M57C 1EA8A 2H7VC 3AQCA 1IW7F 4B6IA 3FAJA 2ZXWC 5E2QA 2CW0F 5A6AA 2J9WA 1T01A 4YT2A 3SEOA 4RD9A 3M4BA 2Y69C 3QZCA 5B1BC 5BQGA 3GEEA 5K0IA 3ITFA 3B0UX 2CYDA 5EK0A 5DQZA 2Q9BA 4OD5A 2HFIA 2Q9CA 3K6BA 1OCRC 4JEBA 4DXWA 3A9CA 3EHNA 2OKUA 4E0HA 3UR3C 2IXNA 3R2PA 2NG1A 3B0PA 4LDRA 2ZXRA 3EZHA 3EGDB 3LJBA 1RKCA 1OW8A 2I8BA 2L6HA 3WAQA 2XLWA 4BJ5A 5KYWA 2YL3A 1YLMA 2A6HF 2A6EF 2QTVA 3DWWA 1TKNA 5EGYA 1ORJA 1SMYF 4GYTA 5COMA 3DAGA 5E3CA 3S9OA 3X2QC 1TWAA 4F4BA 3Q6NA 3ZTZA 3ABLC 4Q5SF 2R7QA 5A6BD 3DE8A 3M1CB 4M63A 5L0HA 4U9EA 1SYQA 4O6YA 3U3FA 3W4YA 1TWCA 3MLGA 4DVYP 4AE4B 4EWCA 1ZZPA 2A68F 3TK0A 4G7OF 3ZWIA 1VYIA 3DI5A 4GQHA 2ICWG 2MYSA 2X51A 4MVMA 5JRAA 4DVZA 5COFA 4JTDB 3DJNB 2Y3DA 3RIPA 3SXYA 3MYIA 2L6GA 2P1AA 3ATPA 3T6JA 2GFHA 3SYNA 2YQYA 1HY5A 1V55C 5EHHA 3ZIBA 3QVYA 2Y39A 4HE8D 1YDIA 3DM5A 1BDJB 2Y3BA 3FOOA 2TMVP 3LLKA 2NUPB 4Z9HA 3LUTB 3J06A 2BC5A 2RD9A 3TOLA 5JVEA 4I3MA 1A7EA 3UMKA 2XXAA 2KW3C 3HKKA 3HNKA 2Q9AA 3ABKC 4MVZA 2IOQA 4CJOA 4YJWA 4EIYA 1Z23A 1J8YF 4JTCB 4MTGA 2YHSA 3US6A 2HMQA 4BJ6C 2CCYA 4YL1A 4CSAC 1K04A 1JRAA 3H2VA 3U9MA 4QI2A 4J7YA 2HZ8A 3SXZA 4U5GA 3ZVRA 3PMRA 1I5NA 3GEHA 4KNWA 3ZC4A 3IQ5A 2XSEA 1OQCA 4XPXA 4CS9C 2R7TA 3O10A 2OEXA 2KK1A 3CQZA 2OEVA 3L8JA 3QVZA 3L34A 1LS1A 3DM9B 3Q6MA 1R4TA 3F47A 4E0IA 1FAPB 2VCCA 3QW0A 3V5ZA 5L0DA 4BG0A 1OR3A 1FFTC 1WASA 3G4ZA 3DXJF 1VYKA 4NTBA 3U8VA 4CSAA 4PJMA 2B0HA 3QW1A 4W8PA 3TULA 3GODA 3GM1A 2LD6A 4PJJA 1M6TA 3S29A 3EFOB 3RQGA 4LDQA 2EPNA 4CDYA 2OQMA 1T6UA 3C62A 5DS6A 4JTAB 2H7BA 1RXQA 4NTAA 5E3AA 3UMIA 2P7VA 3O6XA 4MVSA 3JRTA 3PHF2 3C63A 1ORYA 1A0BA 3BRJA 1GS9A 3OWTA 3RF3A 2AWCA 4XQ1A 3UMHA 1D0YA 4D4XA 5L0FA 1AUEA 4PACA 2XL6A 4MW3A 1M2VA 1WGWA 3LNMB 4ULVA 1OXBA 2MWQA 3NYLA 1NU7D 5B1AC 1RCPA 2BL2A 3I5PA 5CIVA 2KQ9A 1QZXA 3GWLA 4AK9A 4ZLDA 3K1IA 3GORA 3MFNA 4LLEA 2XM4A 3LEVA 5KYYB 2J0XA 4MVOA 3KYIA 1W2WA 2Y3GA 5JSLA 3AG2C 4U5DE 1A41A 1BR1A 3NKEA 3B9QA 5A6KA 1U0BB 1OCZC 2Q00A 5T3WA 1QLEC 1EQ1A 1H7IA 1L3PA 1V54C 4CJGA 2R7RA 3KYJA 3B29A 3W2WA 2WZGA 3PCVA 3T4RA 2R7UA 5DVWA 2JX0A 4O6NA 2DGJA 2YWAA 1XZQA 4FESA 3AG4C 3GWNA 4IB4A 2H7OA 4JEAA 4UDVA 1NLXA 1T6IA 2YLGA 4JURI 4DRJB 3UGPA 4FWVA 1QSPA 1YA7O 5AGFA 4RBNA 2DYSC 2EPMX 2F22A 1TFKB 2QUPA 4EUKB 4U5CE 5L3VA 1E84A 4O6MA 1UG7A 3B0VC 1RKEA 2H8AA 2G3KA 2XS1A 1PV3A 3CEXA 3QTHA 1OXKA 2YZSA 4RDAA 1CGME 4U9DA 5T3TA 1LVKA 2QY9A 2R7OA 4BEJA 4Q4ZF 4IAOA 2Z15A 2Q3TA 2YEVA 4IARA 2EPOA 2RSEB 4IRUA 4MNDA 5KYXA 4WGZA 1IZMA 1Z7Qc 1VTMP 3S0XA 2KYHA 2IM8A 3H65A 3NYJA 2A69F 3U0CA 4XEVA 2R03A 3ZSUA 1ZHXA 2HKVA 2KJGA 2OOCA 3LS1A 4C7OB 3DE9A 4CS8A 2L81A 4DBQA 1FNTc 4NY3A 4YN0B 1LS4A 2FAPB 3VRCA 1VB5A 2R02A 3GANA 3L1MA 2D5RB 3POVA 3MBGA 3SXMA 1KTMA 1MMNA 1MNDA 1KU2A 4KC9A 3WG7C 1JPJA 4QDLA 1D1BA 4MW8A 5BQHA 1AEPA 4JJFA 2ZPAA 2YL7A 5COGA 3ZG1A 1M2OA 1M2VB 2HV6A 3NYMA 4U5HA 4OD4A 4IGGA 2FFHA 4CDAA 1YZAA 2GDCA 1QPUA 1Z5ZA 2Q4FA 3HNIA 3KL4A 1BR2A 2Y3HA 4IJJA 3S28A 1R5ID 1OCOC 4KBLA 3ABMC 4XTKA 1WN0A 5T1DB 3ZQVA 2V3CC 3IQTA 5D92A 3N0TA 3RKOF 4EBJA 4CIHA 2A1DD 3SZRA 4A2NB 2WZFA 2W45A 3PDMP 1CPQA 2HSQA 1TWHA 1C03A 4J30B 5F5FA 2HUJA 1WOLA 2XLDA 1T9KA 4YL0A 4MS2A 3JT1A 4JRZA 3JSEO 2IXMA 5DS5A 4I44A 3RQFA 1A7DA 1CGNA 3FXHA 3EG9A 4QI0A 2LFFA 3H2UA 1Q0MA 5KYYA 5A6BA 2EPLX 3EPVA 2E87A 4LACB 4DJ9A 1MMAA 1NZEA 2XL8A 3NMJA 5BUOA 2UUIA 3FAPB 4O79A 4U5FE 4HEAJ 3TJ6A 5HV9A 2X0CA 2NSGA 2PX0A 4G7ZF 2CNWD 3L8IA 4MVUA 2QE9A 3B71A 5AC4A 5A69A 2IBFA 1MMGA 1YVIA 1ZU4A 2PP4A 3JYYA 3I4UA 5JUAA 4BEMJ 4PFPA 2WZLA 4PJNA 1UFBA 1D0XA 3QMKA 2PX3A 4U5BE 2JPUA 2HJ3A 2BE5F 3FMSA 3DD7A 3BEHA 1PD1A 2CGEA 2QNLA 3U3BA 1I4YA 3NMIA 4D4NA 5HSWA 1V4AA 1ZHYA 1JPNA 1G4US 3IEEA 3N2ZB 1CPRA 2R7SA 1ZW2A 3LNRA 4K0DA 1APCA 3EJNA 2VCBA 3LESA 2KSFA 3K33A 3UGOA 3IHUA 2FGYA 2LK4A 1VLSA 3GM2A 3OEOA 2R7XA 1QVXA 2IXOA 2MHRA 4X0RA 2P6VA 4K1OA 1BZ4A 4YL3A 3U9JA 2GAQA 2KGOA 2YRFA
chains in the Genus database with same CATH topology
3KYJA 1YVIA 1WN0A 1BDJB 2OOCA 3IQTA 2LP4A 2LCHA 4PACA 2R25A 1Y6DA 1C03A 1OXBA 1QSPA 1TQGA 3U3BA 1C02A 3US6A 2A0BA 2LD6A 4EUKB 3MYFA 1SR2A 1FR0A 1OXKA 3KYIA 1I5NA 4G78A 1A0BA 2Q4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KYJ A;  1YVI A;  1WN0 A;  1BDJ B;  2OOC A;  3IQT A;  2LP4 A;  2LCH A;  4PAC A;  2R25 A;  1Y6D A;  1C03 A;  1OXB A;  1QSP A;  1TQG A;  3U3B A;  1C02 A;  3US6 A;  2A0B A;  2LD6 A;  4EUK B;  3MYF A;  1SR2 A;  1FR0 A;  1OXK A;  3KYI A;  1I5N A;  4G78 A;  1A0B A;  2Q4F A; 
#chains in the Genus database with same CATH topology
 4Z9J A;  2W9Y A;  5JLI A;  3AGU A;  1EI7 A;  1VOM A;  3NKD A;  2LP4 A;  1D1A A;  5DLJ A;  1O87 A;  256B A;  3U5S A;  4JZA A;  2VCA A;  3O55 A;  1JMW A;  1BBH A;  2EIL C;  3DKA A;  3AJM A;  5L0C A;  1ST6 A;  5IY5 C;  1RMV A;  4PR9 A;  3C7J A;  2ZXO A;  4R32 A;  3RW0 A;  1OW6 A;  1O3U A;  4PK4 A;  2OU6 A;  5CI9 A;  2XXA B;  4O7G A;  3ZTM A;  4BJ6 A;  3HNL A;  2V26 A;  2R7W A;  2NPU A;  3AGT A;  2XL4 A;  4AX2 A;  4G78 A;  3IQC A;  1Q0D A;  2QLA A;  2YKZ A;  2NSF A;  3FVY A;  1RJ9 A;  1S7Z A;  1Z6A A;  2Q7R A;  1H9G A;  3K7D A;  5JT4 A;  2W4M A;  3JCU Q;  1YJG A;  2C03 A;  4OIQ F;  4EKW A;  4E18 A;  1HE1 A;  4C3B A;  4JE9 A;  1H9T A;  3W8H A;  1CGO A;  3HLZ A;  2EIM C;  1LE2 A;  2HJM A;  4P6I C;  3RVZ A;  1GM5 A;  2XS8 A;  3X1O A;  1E85 A;  1LI5 A;  4CS8 C;  3DZA A;  5TJ5 E;  3M15 A;  4PFO A;  3G50 A;  4YK5 A;  4YWQ A;  4ZLC A;  1DOW A;  1OKK A;  3RQE A;  3S27 A;  3VYW A;  1T6Q A;  3AG3 C;  2L6F A;  2OG2 A;  3JYH A;  4BJ1 A;  4DRH B;  1ZVZ A;  1XZP A;  1G5Z A;  1ZHW A;  4WJ0 A;  1OKK D;  1TWG A;  2AVK A;  3MYF A;  3RFY A;  2OJE D;  3FOP A;  3KMI A;  4XEF A;  1SR2 A;  3EH2 A;  4XPY A;  4OIR F;  4CBE A;  4ANJ A;  4JIO A;  1O5H A;  4JW1 A;  3EG9 B;  3C8G B;  1JR8 A;  2HMZ A;  5KYU A;  3DMD A;  3RVY A;  2J7P A;  3W8I A;  5KYN A;  2LQG A;  2M4E A;  3LEO A;  4J7T A;  1U89 A;  3M4C A;  2DI3 A;  3DJU B;  1VK5 A;  2J0W A;  4KI2 A;  3Q7L A;  2G62 A;  1NFN A;  1NG1 A;  4YT4 A;  3TJ5 A;  2IXP A;  2ETS A;  3F46 A;  4OIP F;  5L0I A;  3L0I A;  1VLT A;  4E7Z A;  2XLV A;  2L7A A;  3C8Z A;  1QKR A;  4XPW A;  2O9X A;  1H6G A;  4JVS A;  2YL0 A;  4LER A;  5E33 A;  1MMD A;  3RH3 A;  3V5X A;  4N6H A;  5DS4 A;  2XM0 A;  4NCQ A;  1FFH A;  1NSG B;  1OCC C;  1RKE B;  3KH2 A;  1YAU O;  3FDQ A;  3MX3 A;  2WVN A;  4N4W A;  1KNY A;  1DOV A;  2YL1 A;  1OW7 A;  1YZC A;  3CAX A;  3VF0 A;  1B68 A;  1ZHT A;  2AP3 A;  4CX9 A;  4XLP F;  2VB6 A;  1K05 A;  4FX5 A;  2HS5 A;  2CDQ A;  3IQ6 A;  3KPH A;  5L0G A;  1OR2 A;  1WTY A;  1MNE A;  1LE4 A;  4MQ9 F;  2XLM A;  5F28 E;  2OJQ A;  4Q7C A;  3ZQY A;  3KKB A;  3GM3 A;  3ASO C;  1ZYR F;  4MTF A;  3UNG C;  3EH1 A;  4YT8 A;  3EQL F;  2VAS A;  3AOU A;  1U6H A;  1D1C A;  1LIH A;  3JSZ A;  4XWJ A;  1E2X A;  2P0N A;  3EGD A;  4GEH A;  2IYL D;  3V5Y A;  4AL0 A;  4EHP A;  3S90 A;  1GQA A;  5FZT A;  2JD3 A;  2R25 A;  3RYL A;  5KYU B;  4K7B A;  3N24 A;  2M64 A;  1D0Z A;  4WAB A;  3EFO A;  1L7C A;  3JTL O;  2DB4 A;  1RJ9 B;  3HNJ A;  2XLO A;  3EGX A;  2WB7 A;  2D4U A;  4HFK B;  3ZDL A;  3NG1 A;  1JAF A;  2A0B A;  1BR4 A;  1QQ3 A;  2WVO A;  3ECS A;  4H54 A;  4A4A A;  2C04 A;  2L9J A;  3IPM O;  2EPK X;  2DYR C;  3AG1 C;  2XLE A;  2AWY A;  2R9R B;  3NRH A;  1AVO B;  3O39 A;  3R7C A;  5L3Q A;  1TR2 A;  2NUT B;  4ER9 A;  4W8K A;  1YA9 A;  4JCH A;  1SZI A;  4BJ5 C;  5BQI A;  3NDB B;  4JCZ A;  2WVQ A;  4XLN F;  2XRH A;  5FCL A;  3SP1 A;  2EIJ C;  2ZD9 A;  4I1M A;  2AU5 A;  2VH3 A;  1J8M F;  5D91 A;  5JS5 A;  2OCC C;  4WGY A;  1Q0G A;  3LS0 A;  2J8W A;  1T5O A;  1WWP A;  3TQO A;  1FTS A;  3VM6 A;  2W4B A;  2PFD A;  4XEK A;  1ZU5 A;  1LKX A;  1TQG A;  4FAP B;  1PCX A;  4MTO A;  5AC5 A;  2LIG A;  4PJL A;  1K40 A;  4NQF A;  1VMA A;  3V7O A;  2EIK C;  3G4X A;  2ASR A;  4DOZ A;  1JOG A;  2J46 A;  2PBE A;  3LLI A;  3WOD F;  2UUH A;  3I5Q A;  3Q7G A;  1XWJ A;  4G0H A;  4JC7 A;  4CIP A;  1WAT A;  2PNO A;  1NBB A;  3C8G D;  3EGX B;  1C17 M;  4J32 B;  1FMW A;  5JP7 A;  3T6G B;  5F5H A;  3DAF A;  4N6C A;  3CZ6 A;  4HFF B;  4E17 A;  2HV7 A;  4G7H F;  1MQV A;  3C18 A;  5GPG B;  2NUP A;  5B3I A;  2LCH A;  3OA1 A;  1YYX A;  1NU9 C;  2KC3 A;  4BJT A;  4LLC A;  4C3D A;  5DQT A;  5A6J A;  3K66 A;  1LM3 B;  3JZ0 A;  1A7V A;  5L0J A;  4OIN F;  3K1H A;  1C02 A;  4NTF A;  3TD7 A;  4C3E A;  1EKY A;  2J9U A;  2GA0 A;  4P9F A;  3HJC A;  1NFO A;  1ZW3 A;  4DBR A;  1SF8 A;  1GGQ A;  4NC3 A;  1FR0 A;  1TFO B;  4KNV A;  2KNH A;  4H4K C;  1LPE A;  1V74 B;  4OIO F;  3K1I C;  4E7S A;  4IAQ A;  3E9V A;  3CSK A;  3JRM O;  3NMK A;  4C7O A;  5CI8 A;  2CNW A;  3S84 A;  1HMO A;  1PD0 A;  4L6R A;  1N1C A;  1HMD A;  3AQB A;  1Y4C A;  4ONS A;  4U5E E;  3SXK A;  2YVK A;  3T6B A;  2A0U A;  5B3S C;  1I4Z A;  2R7V A;  2J9V A;  1FMV A;  2P61 A;  1YAR O;  3M79 A;  4JKV A;  3T9O A;  2HSB A;  1Y6D A;  2G3V A;  1Q0K A;  1Z3I X;  3GEI A;  4JJG A;  1ORS C;  1HW1 A;  3U2M A;  2ZXP A;  2GWW A;  3EHM A;  4Z9I A;  2PF4 E;  1ZHZ A;  3ASN C;  1E83 A;  4CS7 A;  4AL1 A;  2R05 A;  1YYJ A;  3C8G A;  2WL8 A;  3LAY A;  3E70 C;  4MVQ A;  4P9T A;  2NUT A;  1LI7 A;  2LSE A;  3SNH A;  2LFD A;  2YLI A;  4IWB A;  4YT5 A;  3WHN A;  1HE9 A;  1S05 A;  4CDV A;  3A11 A;  4DRI B;  1F1M A;  3FHD A;  1Z63 A;  4EBK A;  4ULW A;  1M56 C;  3U8P A;  1E86 A;  4N06 A;  2VC9 A;  2EIN C;  1G4W R;  2YLD A;  1Q0F A;  3EZI A;  3HTK C;  3W2V A;  4AE4 A;  2J45 A;  4BPM A;  4CS9 A;  4EBB A;  2B0J A;  5KYW B;  4MVR A;  4I1O B;  3VAY A;  2XLH A;  3TOM A;  2J7P D;  5KYX B;  2J9B A;  2I15 A;  4LDK A;  1HW2 A;  3U2L A;  1G8X A;  1M57 C;  1EA8 A;  2H7V C;  3AQC A;  1IW7 F;  4B6I A;  3FAJ A;  2ZXW C;  5E2Q A;  2CW0 F;  5A6A A;  2J9W A;  1T01 A;  4YT2 A;  3SEO A;  4RD9 A;  3M4B A;  2Y69 C;  3QZC A;  5B1B C;  5BQG A;  3GEE A;  5K0I A;  3ITF A;  3B0U X;  2CYD A;  5EK0 A;  5DQZ A;  2Q9B A;  4OD5 A;  2HFI A;  2Q9C A;  3K6B A;  1OCR C;  4JEB A;  4DXW A;  3A9C A;  3EHN A;  2OKU A;  4E0H A;  3UR3 C;  2IXN A;  3R2P A;  2NG1 A;  3B0P A;  4LDR A;  2ZXR A;  3EZH A;  3EGD B;  3LJB A;  1RKC A;  1OW8 A;  2I8B A;  2L6H A;  3WAQ A;  2XLW A;  4BJ5 A;  5KYW A;  2YL3 A;  1YLM A;  2A6H F;  2A6E F;  2QTV A;  3DWW A;  1TKN A;  5EGY A;  1ORJ A;  1SMY F;  4GYT A;  5COM A;  3DAG A;  5E3C A;  3S9O A;  3X2Q C;  1TWA A;  4F4B A;  3Q6N A;  3ZTZ A;  3ABL C;  4Q5S F;  2R7Q A;  5A6B D;  3DE8 A;  3M1C B;  4M63 A;  5L0H A;  4U9E A;  1SYQ A;  4O6Y A;  3U3F A;  3W4Y A;  1TWC A;  3MLG A;  4DVY P;  4AE4 B;  4EWC A;  1ZZP A;  2A68 F;  3TK0 A;  4G7O F;  3ZWI A;  1VYI A;  3DI5 A;  4GQH A;  2ICW G;  2MYS A;  2X51 A;  4MVM A;  5JRA A;  4DVZ A;  5COF A;  4JTD B;  3DJN B;  2Y3D A;  3RIP A;  3SXY A;  3MYI A;  2L6G A;  2P1A A;  3ATP A;  3T6J A;  2GFH A;  3SYN A;  2YQY A;  1HY5 A;  1V55 C;  5EHH A;  3ZIB A;  3QVY A;  2Y39 A;  4HE8 D;  1YDI A;  3DM5 A;  1BDJ B;  2Y3B A;  3FOO A;  2TMV P;  3LLK A;  2NUP B;  4Z9H A;  3LUT B;  3J06 A;  2BC5 A;  2RD9 A;  3TOL A;  5JVE A;  4I3M A;  1A7E A;  3UMK A;  2XXA A;  2KW3 C;  3HKK A;  3HNK A;  2Q9A A;  3ABK C;  4MVZ A;  2IOQ A;  4CJO A;  4YJW A;  4EIY A;  1Z23 A;  1J8Y F;  4JTC B;  4MTG A;  2YHS A;  3US6 A;  2HMQ A;  4BJ6 C;  2CCY A;  4YL1 A;  4CSA C;  1K04 A;  1JRA A;  3H2V A;  3U9M A;  4QI2 A;  4J7Y A;  2HZ8 A;  3SXZ A;  4U5G A;  3ZVR A;  3PMR A;  1I5N A;  3GEH A;  4KNW A;  3ZC4 A;  3IQ5 A;  2XSE A;  1OQC A;  4XPX A;  4CS9 C;  2R7T A;  3O10 A;  2OEX A;  2KK1 A;  3CQZ A;  2OEV A;  3L8J A;  3QVZ A;  3L34 A;  1LS1 A;  3DM9 B;  3Q6M A;  1R4T A;  3F47 A;  4E0I A;  1FAP B;  2VCC A;  3QW0 A;  3V5Z A;  5L0D A;  4BG0 A;  1OR3 A;  1FFT C;  1WAS A;  3G4Z A;  3DXJ F;  1VYK A;  4NTB A;  3U8V A;  4CSA A;  4PJM A;  2B0H A;  3QW1 A;  4W8P A;  3TUL A;  3GOD A;  3GM1 A;  2LD6 A;  4PJJ A;  1M6T A;  3S29 A;  3EFO B;  3RQG A;  4LDQ A;  2EPN A;  4CDY A;  2OQM A;  1T6U A;  3C62 A;  5DS6 A;  4JTA B;  2H7B A;  1RXQ A;  4NTA A;  5E3A A;  3UMI A;  2P7V A;  3O6X A;  4MVS A;  3JRT A;  3PHF 2;  3C63 A;  1ORY A;  1A0B A;  3BRJ A;  1GS9 A;  3OWT A;  3RF3 A;  2AWC A;  4XQ1 A;  3UMH A;  1D0Y A;  4D4X A;  5L0F A;  1AUE A;  4PAC A;  2XL6 A;  4MW3 A;  1M2V A;  1WGW A;  3LNM B;  4ULV A;  1OXB A;  2MWQ A;  3NYL A;  1NU7 D;  5B1A C;  1RCP A;  2BL2 A;  3I5P A;  5CIV A;  2KQ9 A;  1QZX A;  3GWL A;  4AK9 A;  4ZLD A;  3K1I A;  3GOR A;  3MFN A;  4LLE A;  2XM4 A;  3LEV A;  5KYY B;  2J0X A;  4MVO A;  3KYI A;  1W2W A;  2Y3G A;  5JSL A;  3AG2 C;  4U5D E;  1A41 A;  1BR1 A;  3NKE A;  3B9Q A;  5A6K A;  1U0B B;  1OCZ C;  2Q00 A;  5T3W A;  1QLE C;  1EQ1 A;  1H7I A;  1L3P A;  1V54 C;  4CJG A;  2R7R A;  3KYJ A;  3B29 A;  3W2W A;  2WZG A;  3PCV A;  3T4R A;  2R7U A;  5DVW A;  2JX0 A;  4O6N A;  2DGJ A;  2YWA A;  1XZQ A;  4FES A;  3AG4 C;  3GWN A;  4IB4 A;  2H7O A;  4JEA A;  4UDV A;  1NLX A;  1T6I A;  2YLG A;  4JUR I;  4DRJ B;  3UGP A;  4FWV A;  1QSP A;  1YA7 O;  5AGF A;  4RBN A;  2DYS C;  2EPM X;  2F22 A;  1TFK B;  2QUP A;  4EUK B;  4U5C E;  5L3V A;  1E84 A;  4O6M A;  1UG7 A;  3B0V C;  1RKE A;  2H8A A;  2G3K A;  2XS1 A;  1PV3 A;  3CEX A;  3QTH A;  1OXK A;  2YZS A;  4RDA A;  1CGM E;  4U9D A;  5T3T A;  1LVK A;  2QY9 A;  2R7O A;  4BEJ A;  4Q4Z F;  4IAO A;  2Z15 A;  2Q3T A;  2YEV A;  4IAR A;  2EPO A;  2RSE B;  4IRU A;  4MND A;  5KYX A;  4WGZ A;  1IZM A;  1Z7Q c;  1VTM P;  3S0X A;  2KYH A;  2IM8 A;  3H65 A;  3NYJ A;  2A69 F;  3U0C A;  4XEV A;  2R03 A;  3ZSU A;  1ZHX A;  2HKV A;  2KJG A;  2OOC A;  3LS1 A;  4C7O B;  3DE9 A;  4CS8 A;  2L81 A;  4DBQ A;  1FNT c;  4NY3 A;  4YN0 B;  1LS4 A;  2FAP B;  3VRC A;  1VB5 A;  2R02 A;  3GAN A;  3L1M A;  2D5R B;  3POV A;  3MBG A;  3SXM A;  1KTM A;  1MMN A;  1MND A;  1KU2 A;  4KC9 A;  3WG7 C;  1JPJ A;  4QDL A;  1D1B A;  4MW8 A;  5BQH A;  1AEP A;  4JJF A;  2ZPA A;  2YL7 A;  5COG A;  3ZG1 A;  1M2O A;  1M2V B;  2HV6 A;  3NYM A;  4U5H A;  4OD4 A;  4IGG A;  2FFH A;  4CDA A;  1YZA A;  2GDC A;  1QPU A;  1Z5Z A;  2Q4F A;  3HNI A;  3KL4 A;  1BR2 A;  2Y3H A;  4IJJ A;  3S28 A;  1R5I D;  1OCO C;  4KBL A;  3ABM C;  4XTK A;  1WN0 A;  5T1D B;  3ZQV A;  2V3C C;  3IQT A;  5D92 A;  3N0T A;  3RKO F;  4EBJ A;  4CIH A;  2A1D D;  3SZR A;  4A2N B;  2WZF A;  2W45 A;  3PDM P;  1CPQ A;  2HSQ A;  1TWH A;  1C03 A;  4J30 B;  5F5F A;  2HUJ A;  1WOL A;  2XLD A;  1T9K A;  4YL0 A;  4MS2 A;  3JT1 A;  4JRZ A;  3JSE O;  2IXM A;  5DS5 A;  4I44 A;  3RQF A;  1A7D A;  1CGN A;  3FXH A;  3EG9 A;  4QI0 A;  2LFF A;  3H2U A;  1Q0M A;  5KYY A;  5A6B A;  2EPL X;  3EPV A;  2E87 A;  4LAC B;  4DJ9 A;  1MMA A;  1NZE A;  2XL8 A;  3NMJ A;  5BUO A;  2UUI A;  3FAP B;  4O79 A;  4U5F E;  4HEA J;  3TJ6 A;  5HV9 A;  2X0C A;  2NSG A;  2PX0 A;  4G7Z F;  2CNW D;  3L8I A;  4MVU A;  2QE9 A;  3B71 A;  5AC4 A;  5A69 A;  2IBF A;  1MMG A;  1YVI A;  1ZU4 A;  2PP4 A;  3JYY A;  3I4U A;  5JUA A;  4BEM J;  4PFP A;  2WZL A;  4PJN A;  1UFB A;  1D0X A;  3QMK A;  2PX3 A;  4U5B E;  2JPU A;  2HJ3 A;  2BE5 F;  3FMS A;  3DD7 A;  3BEH A;  1PD1 A;  2CGE A;  2QNL A;  3U3B A;  1I4Y A;  3NMI A;  4D4N A;  5HSW A;  1V4A A;  1ZHY A;  1JPN A;  1G4U S;  3IEE A;  3N2Z B;  1CPR A;  2R7S A;  1ZW2 A;  3LNR A;  4K0D A;  1APC A;  3EJN A;  2VCB A;  3LES A;  2KSF A;  3K33 A;  3UGO A;  3IHU A;  2FGY A;  2LK4 A;  1VLS A;  3GM2 A;  3OEO A;  2R7X A;  1QVX A;  2IXO A;  2MHR A;  4X0R A;  2P6V A;  4K1O A;  1BZ4 A;  4YL3 A;  3U9J A;  2GAQ A;  2KGO A;  2YRF A; 
#chains in the Genus database with same CATH homology
 3KYJ A;  1YVI A;  1WN0 A;  1BDJ B;  2OOC A;  3IQT A;  2LP4 A;  2LCH A;  4PAC A;  2R25 A;  1Y6D A;  1C03 A;  1OXB A;  1QSP A;  1TQG A;  3U3B A;  1C02 A;  3US6 A;  2A0B A;  2LD6 A;  4EUK B;  3MYF A;  1SR2 A;  1FR0 A;  1OXK A;  3KYI A;  1I5N A;  4G78 A;  1A0B A;  2Q4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...