3US6A

Crystal structure of histidine-containing phosphotransfer protein mthpt1 from medicago truncatula
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
148
structure length
148
Chain Sequence
EVGQMRRQWVDYIKSMFMEGFLDGQFLQLQQLQDENNPEFVFEVVSLFFDDSERILKDLSFAVDQQSIDFKKVDAHVHQFKGSSASIGAQRVKNSCVAFRNFCEEQNIDACRRCLQQVKQEYLLVKNKLETLLRLEQQIVAAGGSIPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine-containing Phosphotransfer Protein type 1, MtHPt1
publication title Medicago truncatula histidine-containing phosphotransfer protein: Structural and biochemical insights into the cytokinin transduction pathway in plants.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Transferase
total genus 67
structure length 148
sequence length 148
ec nomenclature ec 2.7.3.-:
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 3us6A00
1FR0A 1Y6DA 4G78A 3KYJA 1A0BA 1WN0A 3IQTA 3US6A 1QSPA 1BDJB 2OOCA 1OXBA 3KYIA 2LD6A 1YVIA 1I5NA 2R25A 4EUKB 1C02A 1SR2A 3MYFA 2Q4FA 1TQGA 2A0BA 2LCHA 2LP4A 4PACA 3U3BA 1C03A 1OXKA
chains in the Genus database with same CATH superfamily
2CNWA 3QVYA 1MMGA 3C8ZA 1Y6DA 2XLOA 3KYJA 1HE1A 2XSEA 2YZSA 4XPYA 5D91A 5L0HA 5KYNA 5KYYB 1U0BB 2R7XA 5F28E 2EPLX 3K1IA 2OOCA 1LPEA 5FZTA 3EFOA 3LJBA 4E17A 3K7DA 1Q0FA 4AE4A 4PFOA 2OKUA 3RIPA 4MQ9F 5HSWA 3OA1A 2A68F 4MVRA 2NUPB 4IAQA 2NSFA 4PJMA 3LLIA 3E70C 5KYUA 1C02A 2NSGA 1OCZC 3GEHA 3MYFA 1H9TA 2IXMA 3DKAA 3LLKA 2ZXOA 2B0JA 4J7YA 4NCQA 4WGZA 3AGUA 1GGQA 1HMDA 1MMAA 1NZEA 2WZLA 3LESA 1J8YF 2YHSA 2A69F 3DAFA 3N0TA 4HFKB 4BJ5A 4F4BA 4CX9A 1ZYRF 4YL3A 1ZVZA 1FMWA 1WWPA 2L6GA 1Z23A 3QMKA 5HV9A 3PDMP 4OIQF 1PCXA 3SXZA 1EI7A 2KK1A 1YARO 2YL7A 3SZRA 4C3EA 3L8JA 2UUIA 4JVSA 4U5CE 3MX3A 4PK4A 2HZ8A 1LE4A 3AQCA 2LD6A 5A69A 2Y39A 5DQTA 1RCPA 2CNWD 2R25A 4LDQA 4OD5A 1FFHA 1OQCA 2MYSA 1NLXA 1TQGA 3RQGA 3U8VA 2OEVA 4JZAA 1NBBA 3POVA 5GPGB 1FNTc 3EG9A 1L7CA 5A6KA 3IHUA 4MVQA 2KSFA 3M1CB 1E84A 5A6BA 3OEOA 2AP3A 2IYLD 1C03A 1AUEA 3LEVA 1E83A 1CGOA 4BPMA 1G8XA 3B71A 3RQEA 5JS5A 3FAPB 4K1OA 2R7RA 3JT1A 2AWCA 3SXKA 4QI2A 2P1AA 4EIYA 2EPOA 1ZHZA 1GS9A 3B29A 4YJWA 3H2VA 3L8IA 3NDBB 2M64A 2HJ3A 3I5PA 2VASA 3FHDA 3GWNA 1HW2A 4PJLA 1YDIA 4Q7CA 1NSGB 4U5BE 3AJMA 4P9FA 4CS9C 4PR9A 3MLGA 1R4TA 2HV6A 3AOUA 3UMIA 5AC4A 1O3UA 4KI2A 2A0UA 4ONSA 5DS6A 4BG0A 3ZTZA 1MNEA 3AGTA 4JIOA 2VCBA 5KYYA 4YT5A 1PD1A 1WOLA 1JMWA 3JYYA 3LUTB 4AE4B 1G5ZA 2IXPA 3C62A 2WB7A 2G62A 1OXKA 1T5OA 2FFHA 3JSZA 3W2WA 2NUPA 5KYUB 2EIJC 4XPXA 2AWYA 1E2XA 4G0HA 4CS8A 1WN0A 3T4RA 2CYDA 2DYSC 3K33A 4JTAB 3U0CA 2HSQA 2J45A 3HNLA 1TFKB 3L34A 3RYLA 2GAQA 5T3WA 4MTFA 4RBNA 3ZTMA 1JR8A 1H9GA 2W4BA 3DWWA 1OKKA 4ER9A 2YQYA 4NY3A 4DBQA 1BR2A 4CIPA 5EGYA 1I4ZA 1IZMA 1NG1A 3DE9A 1T6IA 3T6BA 4NQFA 4CSAA 4OIOF 1BBHA 1A7EA 2XS8A 3Q6MA 4I1OB 4O6NA 1ZHXA 2XS1A 2HV7A 2W4MA 3K6BA 4XLPF 3EGXA 4G7OF 5A6AA 2QNLA 1OCCC 1LM3B 5L0JA 3K1IC 3S0XA 4DJ9A 1M56C 3N24A 2PBEA 2XL4A 2XM4A 3LEOA 4W8PA 4MVOA 4PFPA 5IY5C 1TKNA 3GM3A 2Q7RA 1AEPA 4WJ0A 4Q4ZF 3UGPA 4CBEA 2A6EF 4U5HA 3WHNA 1S05A 3B0VC 5B3IA 5JT4A 4IWBA 3EG9B 3PCVA 4XTKA 5T1DB 1LE2A 4EHPA 3DMDA 3EJNA 1L3PA 3F46A 4RD9A 3ATPA 1EKYA 3CZ6A 3K1HA 2H8AA 3RQFA 4AK9A 1WATA 4Z9HA 4UDVA 4DRJB 2GFHA 3SYNA 4CS7A 3OWTA 1T6QA 3G4ZA 3JTLO 5L0FA 3ECSA 2JX0A 2XLDA 1UG7A 3ABKC 3EZHA 4D4NA 2IBFA 3AG2C 2ICWG 1OKKD 4QI0A 1JRAA 3A11A 1VLSA 1Q0MA 2BL2A 4N6CA 3G4XA 3SXMA 3F47A 3EH1A 4LLCA 5E2QA 1D0YA 1LVKA 3WG7C 3W8IA 2XL8A 1YYXA 2D5RB 3FMSA 2WZGA 2R7OA 1OCOC 3M79A 4LLEA 2H7OA 3NG1A 2J9WA 4E0HA 2D4UA 2Y3DA 4JW1A 1BZ4A 3DD7A 3U9JA 1AVOB 1LKXA 2HS5A 3BRJA 3B0UX 1M2VA 4A2NB 1YVIA 1K05A 1Q0DA 4J32B 3CQZA 2YLIA 3DI5A 3Q7GA 1FTSA 4AL0A 2YVKA 3VM6A 4C7OA 1QKRA 5F5HA 3T9OA 1HY5A 2R9RB 1JPNA 4GEHA 3ZC4A 2KC3A 1GM5A 3V5YA 4LDKA 1FFTC 3LNMB 1RMVA 4CDAA 5K0IA 4MVMA 3NMJA 2J8WA 3M15A 3UMHA 4XEKA 1FMVA 4U5GA 5BQHA 3V5ZA 1JPJA 3CSKA 4G78A 4JTDB 2JPUA 3ZSUA 2R7UA 4U5DE 2Y69C 3NMIA 2W45A 4E7SA 3EZIA 3EGXB 256BA 4D4XA 3ASNC 3DJUB 4MVSA 4H4KC 2AVKA 4JEBA 5CIVA 4JCZA 3S29A 3W2VA 1BR4A 2P6VA 4K7BA 3JSEO 3AG1C 5E33A 4OD4A 4BJ1A 5AC5A 4I44A 3ZWIA 3FVYA 2VC9A 4I3MA 4XWJA 4EWCA 2R7WA 4NC3A 2J9VA 5L0DA 3O6XA 2KW3C 2R02A 2GA0A 3JRMO 3ZQYA 3KMIA 4BEMJ 1U6HA 1CPRA 1M2OA 2R7TA 2R7VA 2J9BA 1V74B 2QLAA 4YK5A 3U3FA 4JURI 1UFBA 2PFDA 4ZLCA 3DJNB 1VYIA 3EH2A 2DGJA 5L0GA 1GQAA 1M6TA 2IM8A 4HFFB 1Z7Qc 3L1MA 3C18A 3US6A 4YL1A 3R7CA 3VF0A 4DRIB 4CSAC 2QUPA 2H7BA 3T6JA 4AL1A 3WODF 3U2LA 1FAPB 1V55C 1QPUA 3NYMA 4IRUA 5TJ5E 2KGOA 4FESA 1H7IA 4O6YA 4CJOA 1Z63A 1MNDA 3LNRA 3G50A 1SF8A 2EPKX 1V4AA 4LACB 1HW1A 3ABLC 2OCCC 4MW8A 3GEIA 1ORSC 2HMQA 2A0BA 2VH3A 4BJTA 1XWJA 3S84A 1EQ1A 2YL0A 1A7DA 3A9CA 4FWVA 4N06A 1F1MA 1QQ3A 1M2VB 2IOQA 4N4WA 2LP4A 1YYJA 2ZXPA 2OU6A 3C8GA 3NYJA 1WTYA 1E85A 1CGNA 2NUTB 3K66A 3GM2A 3KPHA 3KH2A 4JE9A 3TK0A 1D0XA 4JJGA 2KQ9A 3DE8A 5DLJA 2Q9AA 4MTOA 1A0BA 1K04A 2WL8A 4IGGA 4MVUA 2R03A 3TQOA 3Q6NA 4YT4A 1H6GA 1VLTA 2XLVA 2ZXRA 4J30B 1WASA 3KYIA 2NG1A 3I4UA 3M4CA 3MBGA 2YLGA 2ZXWC 3HJCA 3RVZA 5BQIA 1WGWA 1Q0KA 3T6GB 1I5NA 1Z6AA 2X51A 3ZQVA 2HMZA 2IXNA 3QTHA 4PJNA 2J7PA 5EK0A 4G7ZF 1PD0A 2R05A 4B6IA 4YT2A 4P6IC 3HTKC 4P9TA 5L0CA 3S28A 3RKOF 2HFIA 3W4YA 2XLHA 2LCHA 1XZPA 2G3KA 3E9VA 1D1BA 1OW7A 1APCA 1W2WA 5A6JA 2Q00A 5KYWB 1YJGA 3HNIA 2YRFA 1VK5A 2HKVA 4CIHA 2ZPAA 3JRTA 1E86A 4RDAA 1Z5ZA 1D1AA 1N1CA 3TULA 4G7HF 5E3AA 3DZAA 5DQZA 2HUJA 3QZCA 4Q5SF 1BDJB 1OCRC 1QSPA 2J0XA 3C8GD 3HNKA 3QW0A 4E18A 1PV3A 2L9JA 4DVZA 1RJ9A 2HSBA 3FOPA 3RFYA 5JUAA 2CCYA 1DOWA 4BJ5C 3FDQA 2UUHA 2VCAA 3R2PA 1YLMA 3B9QA 1SR2A 4FX5A 4GQHA 1ZZPA 4KBLA 4MW3A 2JD3A 4R32A 1OR2A 3AG3C 3L0IA 5DS5A 2YKZA 3H65A 3SXYA 1TWAA 5D92A 3GWLA 4CS9A 1ZHTA 2I15A 2A1DD 2I8BA 2WZFA 2A6HF 4JJFA 4EBKA 1KNYA 4XPWA 1TWCA 3TOMA 2EIMC 2LFDA 2J7PD 5CI8A 3X1OA 4XLNF 3IQTA 1ZU5A 3S27A 2FAPB 4MNDA 4K0DA 2OG2A 4KNWA 5DVWA 4ULWA 1QZXA 3C8GB 3QW1A 4A4AA 4WGYA 1G4WR 1ZHYA 3C7JA 3ZIBA 4U9DA 3ABMC 1K40A 1A7VA 2XL6A 3X2QC 4MTGA 4WABA 2NUTA 2ZD9A 1RXQA 1G4US 2GWWA 5JVEA 4ZLDA 1LS4A 1NU9C 3IEEA 4YT8A 4J7TA 2VCCA 4HEAJ 4QDLA 2J0WA 2H7VC 2WVQA 4I1MA 3UMKA 5COFA 3GM1A 3I5QA 3HLZA 3V5XA 1LI5A 2RD9A 3JCUQ 1YA7O 3VRCA 3PMRA 2Y3GA 1LS1A 2VB6A 4O7GA 2Q3TA 5B3SC 5KYXB 2LK4A 3Q7LA 1FR0A 5JP7A 4OINF 4C3BA 2YWAA 1CPQA 1I4YA 3EGDA 4BJ6A 1D0ZA 3U2MA 4C3DA 1VYKA 3B0PA 4U5EE 4JC7A 2PX0A 4MVZA 4U9EA 1XZQA 3LS1A 1U89A 1OXBA 1M57C 2O9XA 4L6RA 2P61A 4N6HA 4W8KA 5JRAA 1R5ID 3U9MA 1IW7F 2CDQA 2MWQA 2LSEA 3IQ6A 5KYWA 2PP4A 1VOMA 1QLEC 3QVZA 4NTFA 3GODA 2OEXA 5EHHA 3SEOA 3TD7A 2BC5A 4CDVA 1O87A 2XLMA 1Q0GA 2MHRA 2XM0A 1RJ9B 4JCHA 4MS2A 1EA8A 1HMOA 2R7QA 4BEJA 4CS8C 1O5HA 1RKEB 4CJGA 1VMAA 1OR3A 2KYHA 2P7VA 5T3TA 4CDYA 4XEFA 3VAYA 1OW6A 4DOZA 1VTMP 3FOOA 3IQCA 2XXAB 3O39A 1D1CA 2OJQA 1MMNA 4DBRA 4EKWA 2QTVA 2P0NA 2Z15A 4ULVA 4OIPF 2QY9A 1Y4CA 1TWHA 3FXHA 4Z9IA 2J9UA 3EPVA 2XRHA 4JTCB 4NTBA 5AGFA 5COGA 3WAQA 2OQMA 3HNJA 3AG4C 2EPNA 5L3QA 3NKEA 4O6MA 2XLEA 5JSLA 3RW0A 1LI7A 1KU2A 2L7AA 4AX2A 2C03A 1S7ZA 2PX3A 3GORA 3BEHA 1KTMA 4XEVA 4LDRA 2RSEB 4JRZA 2EINC 4LERA 1ZHWA 2F22A 3NKDA 3TJ5A 4JEAA 3M4BA 1SMYF 3TJ6A 4Z9JA 1J8MF 3LAYA 1Z3IX 3U8PA 1ORJA 2FGYA 4HE8D 2B0HA 1LIHA 3V7OA 2YEVA 4XQ1A 5F5FA 3GEEA 1HE9A 2DYRC 1C17M 4H54A 5BUOA 3SP1A 3ASOC 3J06A 1CGME 3CAXA 4DXWA 1TFOB 3EQLF 3ITFA 4EUKB 2L6HA 2YL3A 2HJMA 2PNOA 2QE9A 4KC9A 3JZ0A 3UR3C 4EBBA 1ZW2A 3HKKA 5B1AC 4YWQA 3EGDB 1B68A 2C04A 2CW0F 5DS4A 5KYXA 1ZU4A 3S9OA 2AU5A 1T01A 2CGEA 2J46A 3EFOB 2IXOA 4M63A 3ZDLA 1TWGA 4JKVA 2L6FA 3U3BA 3LS0A 3NYLA 1NFNA 2NPUA 4DVYP 1TR2A 4IARA 5L3VA 3FAJA 3SNHA 2YL1A 1ZW3A 3GANA 2LIGA 1NU7D 3C63A 2Q9BA 3RVYA 1VB5A 1ST6A 5L0IA 3DAGA 5A6BD 2ETSA 3AQBA 2WVNA 3KKBA 5E3CA 4ANJA 2X0CA 2L81A 4PJJA 2YLDA 2OJED 1YA9A 5COMA 5BQGA 4OIRF 3DM9B 3W8HA 3MYIA 4C7OB 2EILC 4YN0B 3RH3A 4YL0A 3ZG1A 5FCLA 1RKEA 3NMKA 1YZAA 3RF3A 2EPMX 3UGOA 4IAOA 3VYWA 4IB4A 4NTAA 4EBJA 2G3VA 3MFNA 2XXAA 4E0IA 4BJ6C 4U5FE 2TMVP 3CEXA 4PACA 1NFOA 3UNGC 2BE5F 1A41A 2W9YA 2EIKC 2GDCA 2V26A 3EHNA 4O79A 5B1BC 1MMDA 1V54C 2XLWA 4GYTA 3EHMA 1YAUO 3S90A 1BR1A 2KJGA 2PF4E 1T9KA 2LFFA 1OW8A 3KL4A 3O55A 5JLIA 1RKCA 3N2ZB 3O10A 4KNVA 4X0RA 3ZVRA 1MQVA 2Q9CA 3IQ5A 3U5SA 3JYHA 5CI9A 1SYQA 3IPMO 2R7SA 1JAFA 2KNHA 3DM5A 4FAPB 2Y3BA 1JOGA 1QVXA 3DXJF 2V3CC 2Q4FA 2ASRA 3PHF2 1DOVA 1ORYA 1SZIA 4IJJA 2M4EA 2DB4A 3H2UA 2Y3HA 4E7ZA 4DRHB 2E87A 2WVOA 2LQGA 2DI3A 3TOLA 1YZCA 1T6UA 3NRHA
chains in the Genus database with same CATH topology
1FR0A 1Y6DA 4G78A 3KYJA 1A0BA 1WN0A 3IQTA 3US6A 1QSPA 1BDJB 2OOCA 1OXBA 3KYIA 2LD6A 1YVIA 1I5NA 2R25A 4EUKB 1C02A 1SR2A 3MYFA 2Q4FA 1TQGA 2A0BA 2LCHA 2LP4A 4PACA 3U3BA 1C03A 1OXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FR0 A;  1Y6D A;  4G78 A;  3KYJ A;  1A0B A;  1WN0 A;  3IQT A;  3US6 A;  1QSP A;  1BDJ B;  2OOC A;  1OXB A;  3KYI A;  2LD6 A;  1YVI A;  1I5N A;  2R25 A;  4EUK B;  1C02 A;  1SR2 A;  3MYF A;  2Q4F A;  1TQG A;  2A0B A;  2LCH A;  2LP4 A;  4PAC A;  3U3B A;  1C03 A;  1OXK A; 
#chains in the Genus database with same CATH topology
 2CNW A;  3QVY A;  1MMG A;  3C8Z A;  1Y6D A;  2XLO A;  3KYJ A;  1HE1 A;  2XSE A;  2YZS A;  4XPY A;  5D91 A;  5L0H A;  5KYN A;  5KYY B;  1U0B B;  2R7X A;  5F28 E;  2EPL X;  3K1I A;  2OOC A;  1LPE A;  5FZT A;  3EFO A;  3LJB A;  4E17 A;  3K7D A;  1Q0F A;  4AE4 A;  4PFO A;  2OKU A;  3RIP A;  4MQ9 F;  5HSW A;  3OA1 A;  2A68 F;  4MVR A;  2NUP B;  4IAQ A;  2NSF A;  4PJM A;  3LLI A;  3E70 C;  5KYU A;  1C02 A;  2NSG A;  1OCZ C;  3GEH A;  3MYF A;  1H9T A;  2IXM A;  3DKA A;  3LLK A;  2ZXO A;  2B0J A;  4J7Y A;  4NCQ A;  4WGZ A;  3AGU A;  1GGQ A;  1HMD A;  1MMA A;  1NZE A;  2WZL A;  3LES A;  1J8Y F;  2YHS A;  2A69 F;  3DAF A;  3N0T A;  4HFK B;  4BJ5 A;  4F4B A;  4CX9 A;  1ZYR F;  4YL3 A;  1ZVZ A;  1FMW A;  1WWP A;  2L6G A;  1Z23 A;  3QMK A;  5HV9 A;  3PDM P;  4OIQ F;  1PCX A;  3SXZ A;  1EI7 A;  2KK1 A;  1YAR O;  2YL7 A;  3SZR A;  4C3E A;  3L8J A;  2UUI A;  4JVS A;  4U5C E;  3MX3 A;  4PK4 A;  2HZ8 A;  1LE4 A;  3AQC A;  2LD6 A;  5A69 A;  2Y39 A;  5DQT A;  1RCP A;  2CNW D;  2R25 A;  4LDQ A;  4OD5 A;  1FFH A;  1OQC A;  2MYS A;  1NLX A;  1TQG A;  3RQG A;  3U8V A;  2OEV A;  4JZA A;  1NBB A;  3POV A;  5GPG B;  1FNT c;  3EG9 A;  1L7C A;  5A6K A;  3IHU A;  4MVQ A;  2KSF A;  3M1C B;  1E84 A;  5A6B A;  3OEO A;  2AP3 A;  2IYL D;  1C03 A;  1AUE A;  3LEV A;  1E83 A;  1CGO A;  4BPM A;  1G8X A;  3B71 A;  3RQE A;  5JS5 A;  3FAP B;  4K1O A;  2R7R A;  3JT1 A;  2AWC A;  3SXK A;  4QI2 A;  2P1A A;  4EIY A;  2EPO A;  1ZHZ A;  1GS9 A;  3B29 A;  4YJW A;  3H2V A;  3L8I A;  3NDB B;  2M64 A;  2HJ3 A;  3I5P A;  2VAS A;  3FHD A;  3GWN A;  1HW2 A;  4PJL A;  1YDI A;  4Q7C A;  1NSG B;  4U5B E;  3AJM A;  4P9F A;  4CS9 C;  4PR9 A;  3MLG A;  1R4T A;  2HV6 A;  3AOU A;  3UMI A;  5AC4 A;  1O3U A;  4KI2 A;  2A0U A;  4ONS A;  5DS6 A;  4BG0 A;  3ZTZ A;  1MNE A;  3AGT A;  4JIO A;  2VCB A;  5KYY A;  4YT5 A;  1PD1 A;  1WOL A;  1JMW A;  3JYY A;  3LUT B;  4AE4 B;  1G5Z A;  2IXP A;  3C62 A;  2WB7 A;  2G62 A;  1OXK A;  1T5O A;  2FFH A;  3JSZ A;  3W2W A;  2NUP A;  5KYU B;  2EIJ C;  4XPX A;  2AWY A;  1E2X A;  4G0H A;  4CS8 A;  1WN0 A;  3T4R A;  2CYD A;  2DYS C;  3K33 A;  4JTA B;  3U0C A;  2HSQ A;  2J45 A;  3HNL A;  1TFK B;  3L34 A;  3RYL A;  2GAQ A;  5T3W A;  4MTF A;  4RBN A;  3ZTM A;  1JR8 A;  1H9G A;  2W4B A;  3DWW A;  1OKK A;  4ER9 A;  2YQY A;  4NY3 A;  4DBQ A;  1BR2 A;  4CIP A;  5EGY A;  1I4Z A;  1IZM A;  1NG1 A;  3DE9 A;  1T6I A;  3T6B A;  4NQF A;  4CSA A;  4OIO F;  1BBH A;  1A7E A;  2XS8 A;  3Q6M A;  4I1O B;  4O6N A;  1ZHX A;  2XS1 A;  2HV7 A;  2W4M A;  3K6B A;  4XLP F;  3EGX A;  4G7O F;  5A6A A;  2QNL A;  1OCC C;  1LM3 B;  5L0J A;  3K1I C;  3S0X A;  4DJ9 A;  1M56 C;  3N24 A;  2PBE A;  2XL4 A;  2XM4 A;  3LEO A;  4W8P A;  4MVO A;  4PFP A;  5IY5 C;  1TKN A;  3GM3 A;  2Q7R A;  1AEP A;  4WJ0 A;  4Q4Z F;  3UGP A;  4CBE A;  2A6E F;  4U5H A;  3WHN A;  1S05 A;  3B0V C;  5B3I A;  5JT4 A;  4IWB A;  3EG9 B;  3PCV A;  4XTK A;  5T1D B;  1LE2 A;  4EHP A;  3DMD A;  3EJN A;  1L3P A;  3F46 A;  4RD9 A;  3ATP A;  1EKY A;  3CZ6 A;  3K1H A;  2H8A A;  3RQF A;  4AK9 A;  1WAT A;  4Z9H A;  4UDV A;  4DRJ B;  2GFH A;  3SYN A;  4CS7 A;  3OWT A;  1T6Q A;  3G4Z A;  3JTL O;  5L0F A;  3ECS A;  2JX0 A;  2XLD A;  1UG7 A;  3ABK C;  3EZH A;  4D4N A;  2IBF A;  3AG2 C;  2ICW G;  1OKK D;  4QI0 A;  1JRA A;  3A11 A;  1VLS A;  1Q0M A;  2BL2 A;  4N6C A;  3G4X A;  3SXM A;  3F47 A;  3EH1 A;  4LLC A;  5E2Q A;  1D0Y A;  1LVK A;  3WG7 C;  3W8I A;  2XL8 A;  1YYX A;  2D5R B;  3FMS A;  2WZG A;  2R7O A;  1OCO C;  3M79 A;  4LLE A;  2H7O A;  3NG1 A;  2J9W A;  4E0H A;  2D4U A;  2Y3D A;  4JW1 A;  1BZ4 A;  3DD7 A;  3U9J A;  1AVO B;  1LKX A;  2HS5 A;  3BRJ A;  3B0U X;  1M2V A;  4A2N B;  1YVI A;  1K05 A;  1Q0D A;  4J32 B;  3CQZ A;  2YLI A;  3DI5 A;  3Q7G A;  1FTS A;  4AL0 A;  2YVK A;  3VM6 A;  4C7O A;  1QKR A;  5F5H A;  3T9O A;  1HY5 A;  2R9R B;  1JPN A;  4GEH A;  3ZC4 A;  2KC3 A;  1GM5 A;  3V5Y A;  4LDK A;  1FFT C;  3LNM B;  1RMV A;  4CDA A;  5K0I A;  4MVM A;  3NMJ A;  2J8W A;  3M15 A;  3UMH A;  4XEK A;  1FMV A;  4U5G A;  5BQH A;  3V5Z A;  1JPJ A;  3CSK A;  4G78 A;  4JTD B;  2JPU A;  3ZSU A;  2R7U A;  4U5D E;  2Y69 C;  3NMI A;  2W45 A;  4E7S A;  3EZI A;  3EGX B;  256B A;  4D4X A;  3ASN C;  3DJU B;  4MVS A;  4H4K C;  2AVK A;  4JEB A;  5CIV A;  4JCZ A;  3S29 A;  3W2V A;  1BR4 A;  2P6V A;  4K7B A;  3JSE O;  3AG1 C;  5E33 A;  4OD4 A;  4BJ1 A;  5AC5 A;  4I44 A;  3ZWI A;  3FVY A;  2VC9 A;  4I3M A;  4XWJ A;  4EWC A;  2R7W A;  4NC3 A;  2J9V A;  5L0D A;  3O6X A;  2KW3 C;  2R02 A;  2GA0 A;  3JRM O;  3ZQY A;  3KMI A;  4BEM J;  1U6H A;  1CPR A;  1M2O A;  2R7T A;  2R7V A;  2J9B A;  1V74 B;  2QLA A;  4YK5 A;  3U3F A;  4JUR I;  1UFB A;  2PFD A;  4ZLC A;  3DJN B;  1VYI A;  3EH2 A;  2DGJ A;  5L0G A;  1GQA A;  1M6T A;  2IM8 A;  4HFF B;  1Z7Q c;  3L1M A;  3C18 A;  3US6 A;  4YL1 A;  3R7C A;  3VF0 A;  4DRI B;  4CSA C;  2QUP A;  2H7B A;  3T6J A;  4AL1 A;  3WOD F;  3U2L A;  1FAP B;  1V55 C;  1QPU A;  3NYM A;  4IRU A;  5TJ5 E;  2KGO A;  4FES A;  1H7I A;  4O6Y A;  4CJO A;  1Z63 A;  1MND A;  3LNR A;  3G50 A;  1SF8 A;  2EPK X;  1V4A A;  4LAC B;  1HW1 A;  3ABL C;  2OCC C;  4MW8 A;  3GEI A;  1ORS C;  2HMQ A;  2A0B A;  2VH3 A;  4BJT A;  1XWJ A;  3S84 A;  1EQ1 A;  2YL0 A;  1A7D A;  3A9C A;  4FWV A;  4N06 A;  1F1M A;  1QQ3 A;  1M2V B;  2IOQ A;  4N4W A;  2LP4 A;  1YYJ A;  2ZXP A;  2OU6 A;  3C8G A;  3NYJ A;  1WTY A;  1E85 A;  1CGN A;  2NUT B;  3K66 A;  3GM2 A;  3KPH A;  3KH2 A;  4JE9 A;  3TK0 A;  1D0X A;  4JJG A;  2KQ9 A;  3DE8 A;  5DLJ A;  2Q9A A;  4MTO A;  1A0B A;  1K04 A;  2WL8 A;  4IGG A;  4MVU A;  2R03 A;  3TQO A;  3Q6N A;  4YT4 A;  1H6G A;  1VLT A;  2XLV A;  2ZXR A;  4J30 B;  1WAS A;  3KYI A;  2NG1 A;  3I4U A;  3M4C A;  3MBG A;  2YLG A;  2ZXW C;  3HJC A;  3RVZ A;  5BQI A;  1WGW A;  1Q0K A;  3T6G B;  1I5N A;  1Z6A A;  2X51 A;  3ZQV A;  2HMZ A;  2IXN A;  3QTH A;  4PJN A;  2J7P A;  5EK0 A;  4G7Z F;  1PD0 A;  2R05 A;  4B6I A;  4YT2 A;  4P6I C;  3HTK C;  4P9T A;  5L0C A;  3S28 A;  3RKO F;  2HFI A;  3W4Y A;  2XLH A;  2LCH A;  1XZP A;  2G3K A;  3E9V A;  1D1B A;  1OW7 A;  1APC A;  1W2W A;  5A6J A;  2Q00 A;  5KYW B;  1YJG A;  3HNI A;  2YRF A;  1VK5 A;  2HKV A;  4CIH A;  2ZPA A;  3JRT A;  1E86 A;  4RDA A;  1Z5Z A;  1D1A A;  1N1C A;  3TUL A;  4G7H F;  5E3A A;  3DZA A;  5DQZ A;  2HUJ A;  3QZC A;  4Q5S F;  1BDJ B;  1OCR C;  1QSP A;  2J0X A;  3C8G D;  3HNK A;  3QW0 A;  4E18 A;  1PV3 A;  2L9J A;  4DVZ A;  1RJ9 A;  2HSB A;  3FOP A;  3RFY A;  5JUA A;  2CCY A;  1DOW A;  4BJ5 C;  3FDQ A;  2UUH A;  2VCA A;  3R2P A;  1YLM A;  3B9Q A;  1SR2 A;  4FX5 A;  4GQH A;  1ZZP A;  4KBL A;  4MW3 A;  2JD3 A;  4R32 A;  1OR2 A;  3AG3 C;  3L0I A;  5DS5 A;  2YKZ A;  3H65 A;  3SXY A;  1TWA A;  5D92 A;  3GWL A;  4CS9 A;  1ZHT A;  2I15 A;  2A1D D;  2I8B A;  2WZF A;  2A6H F;  4JJF A;  4EBK A;  1KNY A;  4XPW A;  1TWC A;  3TOM A;  2EIM C;  2LFD A;  2J7P D;  5CI8 A;  3X1O A;  4XLN F;  3IQT A;  1ZU5 A;  3S27 A;  2FAP B;  4MND A;  4K0D A;  2OG2 A;  4KNW A;  5DVW A;  4ULW A;  1QZX A;  3C8G B;  3QW1 A;  4A4A A;  4WGY A;  1G4W R;  1ZHY A;  3C7J A;  3ZIB A;  4U9D A;  3ABM C;  1K40 A;  1A7V A;  2XL6 A;  3X2Q C;  4MTG A;  4WAB A;  2NUT A;  2ZD9 A;  1RXQ A;  1G4U S;  2GWW A;  5JVE A;  4ZLD A;  1LS4 A;  1NU9 C;  3IEE A;  4YT8 A;  4J7T A;  2VCC A;  4HEA J;  4QDL A;  2J0W A;  2H7V C;  2WVQ A;  4I1M A;  3UMK A;  5COF A;  3GM1 A;  3I5Q A;  3HLZ A;  3V5X A;  1LI5 A;  2RD9 A;  3JCU Q;  1YA7 O;  3VRC A;  3PMR A;  2Y3G A;  1LS1 A;  2VB6 A;  4O7G A;  2Q3T A;  5B3S C;  5KYX B;  2LK4 A;  3Q7L A;  1FR0 A;  5JP7 A;  4OIN F;  4C3B A;  2YWA A;  1CPQ A;  1I4Y A;  3EGD A;  4BJ6 A;  1D0Z A;  3U2M A;  4C3D A;  1VYK A;  3B0P A;  4U5E E;  4JC7 A;  2PX0 A;  4MVZ A;  4U9E A;  1XZQ A;  3LS1 A;  1U89 A;  1OXB A;  1M57 C;  2O9X A;  4L6R A;  2P61 A;  4N6H A;  4W8K A;  5JRA A;  1R5I D;  3U9M A;  1IW7 F;  2CDQ A;  2MWQ A;  2LSE A;  3IQ6 A;  5KYW A;  2PP4 A;  1VOM A;  1QLE C;  3QVZ A;  4NTF A;  3GOD A;  2OEX A;  5EHH A;  3SEO A;  3TD7 A;  2BC5 A;  4CDV A;  1O87 A;  2XLM A;  1Q0G A;  2MHR A;  2XM0 A;  1RJ9 B;  4JCH A;  4MS2 A;  1EA8 A;  1HMO A;  2R7Q A;  4BEJ A;  4CS8 C;  1O5H A;  1RKE B;  4CJG A;  1VMA A;  1OR3 A;  2KYH A;  2P7V A;  5T3T A;  4CDY A;  4XEF A;  3VAY A;  1OW6 A;  4DOZ A;  1VTM P;  3FOO A;  3IQC A;  2XXA B;  3O39 A;  1D1C A;  2OJQ A;  1MMN A;  4DBR A;  4EKW A;  2QTV A;  2P0N A;  2Z15 A;  4ULV A;  4OIP F;  2QY9 A;  1Y4C A;  1TWH A;  3FXH A;  4Z9I A;  2J9U A;  3EPV A;  2XRH A;  4JTC B;  4NTB A;  5AGF A;  5COG A;  3WAQ A;  2OQM A;  3HNJ A;  3AG4 C;  2EPN A;  5L3Q A;  3NKE A;  4O6M A;  2XLE A;  5JSL A;  3RW0 A;  1LI7 A;  1KU2 A;  2L7A A;  4AX2 A;  2C03 A;  1S7Z A;  2PX3 A;  3GOR A;  3BEH A;  1KTM A;  4XEV A;  4LDR A;  2RSE B;  4JRZ A;  2EIN C;  4LER A;  1ZHW A;  2F22 A;  3NKD A;  3TJ5 A;  4JEA A;  3M4B A;  1SMY F;  3TJ6 A;  4Z9J A;  1J8M F;  3LAY A;  1Z3I X;  3U8P A;  1ORJ A;  2FGY A;  4HE8 D;  2B0H A;  1LIH A;  3V7O A;  2YEV A;  4XQ1 A;  5F5F A;  3GEE A;  1HE9 A;  2DYR C;  1C17 M;  4H54 A;  5BUO A;  3SP1 A;  3ASO C;  3J06 A;  1CGM E;  3CAX A;  4DXW A;  1TFO B;  3EQL F;  3ITF A;  4EUK B;  2L6H A;  2YL3 A;  2HJM A;  2PNO A;  2QE9 A;  4KC9 A;  3JZ0 A;  3UR3 C;  4EBB A;  1ZW2 A;  3HKK A;  5B1A C;  4YWQ A;  3EGD B;  1B68 A;  2C04 A;  2CW0 F;  5DS4 A;  5KYX A;  1ZU4 A;  3S9O A;  2AU5 A;  1T01 A;  2CGE A;  2J46 A;  3EFO B;  2IXO A;  4M63 A;  3ZDL A;  1TWG A;  4JKV A;  2L6F A;  3U3B A;  3LS0 A;  3NYL A;  1NFN A;  2NPU A;  4DVY P;  1TR2 A;  4IAR A;  5L3V A;  3FAJ A;  3SNH A;  2YL1 A;  1ZW3 A;  3GAN A;  2LIG A;  1NU7 D;  3C63 A;  2Q9B A;  3RVY A;  1VB5 A;  1ST6 A;  5L0I A;  3DAG A;  5A6B D;  2ETS A;  3AQB A;  2WVN A;  3KKB A;  5E3C A;  4ANJ A;  2X0C A;  2L81 A;  4PJJ A;  2YLD A;  2OJE D;  1YA9 A;  5COM A;  5BQG A;  4OIR F;  3DM9 B;  3W8H A;  3MYI A;  4C7O B;  2EIL C;  4YN0 B;  3RH3 A;  4YL0 A;  3ZG1 A;  5FCL A;  1RKE A;  3NMK A;  1YZA A;  3RF3 A;  2EPM X;  3UGO A;  4IAO A;  3VYW A;  4IB4 A;  4NTA A;  4EBJ A;  2G3V A;  3MFN A;  2XXA A;  4E0I A;  4BJ6 C;  4U5F E;  2TMV P;  3CEX A;  4PAC A;  1NFO A;  3UNG C;  2BE5 F;  1A41 A;  2W9Y A;  2EIK C;  2GDC A;  2V26 A;  3EHN A;  4O79 A;  5B1B C;  1MMD A;  1V54 C;  2XLW A;  4GYT A;  3EHM A;  1YAU O;  3S90 A;  1BR1 A;  2KJG A;  2PF4 E;  1T9K A;  2LFF A;  1OW8 A;  3KL4 A;  3O55 A;  5JLI A;  1RKC A;  3N2Z B;  3O10 A;  4KNV A;  4X0R A;  3ZVR A;  1MQV A;  2Q9C A;  3IQ5 A;  3U5S A;  3JYH A;  5CI9 A;  1SYQ A;  3IPM O;  2R7S A;  1JAF A;  2KNH A;  3DM5 A;  4FAP B;  2Y3B A;  1JOG A;  1QVX A;  3DXJ F;  2V3C C;  2Q4F A;  2ASR A;  3PHF 2;  1DOV A;  1ORY A;  1SZI A;  4IJJ A;  2M4E A;  2DB4 A;  3H2U A;  2Y3H A;  4E7Z A;  4DRH B;  2E87 A;  2WVO A;  2LQG A;  2DI3 A;  3TOL A;  1YZC A;  1T6U A;  3NRH A; 
#chains in the Genus database with same CATH homology
 1FR0 A;  1Y6D A;  4G78 A;  3KYJ A;  1A0B A;  1WN0 A;  3IQT A;  3US6 A;  1QSP A;  1BDJ B;  2OOC A;  1OXB A;  3KYI A;  2LD6 A;  1YVI A;  1I5N A;  2R25 A;  4EUK B;  1C02 A;  1SR2 A;  3MYF A;  2Q4F A;  1TQG A;  2A0B A;  2LCH A;  2LP4 A;  4PAC A;  3U3B A;  1C03 A;  1OXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...