4BEMJ

Crystal structure of the f-type atp synthase c-ring from acetobacterium woodii.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
181
structure length
181
Chain Sequence
IGDMNIVDFVIQFLSQFDPVDVIKGFSALGIGLAMVAGVGPGIGQGFAAGKGAEAVGKNPTKSNDIVMIMLLGAAVAETSGIFSLVIALILLFANPFISSTASVWILSASAMASGIAMIAGIGPGTGQGYAAGKGAEAVGIRPEMKSAILRVMLLGQAVAQTTGIYALIVALILMYANPFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords F1FO ATPASE C2 SUBUNIT
publication title High-Resolution Structure and Mechanism of an F/V-Hybrid Rotor Ring in a Na+-Coupled ATP Synthase
pubmed doi rcsb
total genus 77
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2013-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00137 ATP-synt_C ATP synthase subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) lithium bound rotor ring of v- atpase 4bemJ00
4BEMJ 2DB4A 2CYDA 5TJ5E 2BL2A 3AOUA
chains in the Genus database with same CATH superfamily
4Q4ZF 4MVQA 1FMVA 1ZW2A 3GEEA 3HNLA 1G5ZA 3DMDA 1ORYA 3SEOA 1WN0A 3SNHA 1YYXA 1NBBA 2A68F 2DI3A 4ONSA 1FAPB 1LS1A 3A9CA 4JTDB 2KNHA 4JTCB 2J9WA 4A4AA 2W4BA 3ABKC 1T6IA 3NYLA 3J06A 3AJMA 1RXQA 2ICWG 5L3VA 2R7WA 4QI2A 3W2VA 2L6HA 1E83A 3M79A 2B0JA 5L0FA 2NSGA 3ATPA 4NCQA 3LEVA 4JCHA 3OEOA 3EZHA 1BR4A 2GDCA 4IJJA 3EFOA 1W2WA 3MFNA 2XM0A 3NG1A 2R7SA 2IXOA 2J0XA 4OIRF 1FNTc 1OCOC 4XEVA 4LERA 5JS5A 3AG4C 3Q6NA 5E2QA 1YDIA 3UMKA 5KYUB 3FDQA 2L9JA 3F47A 3SXKA 4HFKB 3B29A 3KPHA 5DLJA 1JOGA 3HLZA 4BJ6A 1O5HA 4KNVA 1BBHA 1M2VB 1L7CA 1JAFA 4MVMA 1LKXA 1OQCA 4C3DA 4P9TA 5JVEA 2YL7A 2R7OA 3O10A 2Y3BA 4O7GA 3DE8A 2HZ8A 5DS4A 4JKVA 1OR2A 1M6TA 3IQCA 1OXBA 1VLTA 3L1MA 2AU5A 5BQGA 4R32A 4EUKB 1E86A 4AX2A 3O55A 4U5BE 2HS5A 1YARO 2MYSA 5KYYA 4EBJA 4C7OB 1V55C 1MMGA 3TJ5A 1CGNA 1PCXA 2AWYA 2XLEA 3CQZA 4CBEA 5L0HA 4GYTA 3TQOA 3EGXB 1H9TA 2V3CC 5BQIA 1AVOB 3W4YA 4EBBA 5B1BC 2CYDA 1QLEC 2VCBA 1OR3A 3DM5A 1V74B 4NTBA 2XL8A 3DD7A 4WGZA 2XXAB 4NC3A 2C04A 3HJCA 4CIHA 3AG3C 4H4KC 1MNEA 5BUOA 3QW1A 3TK0A 1J8MF 1QPUA 1V4AA 4Z9JA 2L7AA 5E33A 1H7IA 1LS4A 1O87A 3T6BA 1E85A 3KL4A 5A6BA 3EGDB 2R7UA 2IXPA 3ZWIA 3AGTA 2A0UA 4KC9A 1D0YA 3RVZA 3QVZA 5A6BD 4OINF 4I1MA 4J30B 3E9VA 4JTAB 3U2LA 2GFHA 3JSEO 2Q9CA 4XPXA 5KYWB 1CPQA 3ZG1A 5F28E 1GM5A 3B0VC 4J32B 2CCYA 2IXMA 2YRFA 2XL4A 1D0XA 4YL1A 4XPWA 3TJ6A 4JEAA 1C02A 4U5GA 4CS9A 4JZAA 3CAXA 5D92A 4U9DA 4AE4B 3GEIA 1I4ZA 5E3AA 2LIGA 3ZTZA 1JPNA 2A0BA 2O9XA 2J7PA 1S7ZA 2Y3HA 3K1IC 1N1CA 3NMIA 4JC7A 4E17A 4CIPA 2UUHA 1ZHWA 3DKAA 4J7YA 5JP7A 2LCHA 1BR2A 3LS0A 1Z23A 4GEHA 4CS7A 5COGA 3R7CA 2IXNA 2IYLD 1HMDA 1MMNA 4PFPA 4WGYA 3X2QC 3POVA 3FAPB 4YT5A 1FR0A 2R02A 3NMJA 4C3EA 4FESA 4U9EA 2YZSA 1ZU4A 3CEXA 2V26A 2WL8A 3I5QA 4IGGA 3T6GB 2CW0F 5EGYA 2VC9A 2NG1A 3K1HA 1RKEA 2HJMA 2ETSA 2HMZA 2NUPA 2Z15A 3T4RA 3VYWA 1KU2A 2KK1A 4RBNA 1ORJA 4CS8A 4XLPF 2R7RA 3FVYA 3GODA 3LEOA 3VRCA 2KC3A 2OJED 3I4UA 3UMHA 4N6HA 4U5EE 3FMSA 1ZHTA 3RQGA 5AC4A 3NDBB 1TWCA 3EH1A 3LLIA 1HMOA 1OXKA 3DWWA 3GANA 3N24A 3EH2A 3MLGA 4PJMA 5F5HA 3ASOC 2FFHA 4MVRA 5DQZA 1D0ZA 1M56C 2Q9BA 3V5XA 4ANJA 4F4BA 3IEEA 5B3SC 2Q7RA 2L6FA 3L34A 2EILC 4JEBA 1ZW3A 3Q6MA 4NTAA 3ZIBA 4YL3A 1S05A 4CJGA 1GQAA 1K40A 1G4US 1T9KA 1APCA 3U9JA 1A7DA 2WVQA 3BRJA 3WODF 4BEJA 3GEHA 1A41A 2XS1A 4MW8A 1SZIA 5T1DB 3G50A 1TQGA 3RQEA 3JZ0A 2LP4A 4B6IA 1Z7Qc 1RKCA 3SXZA 4DBQA 2W4MA 4E0HA 2OU6A 3HTKC 3K33A 2XLHA 5JT4A 2WZFA 5GPGB 1SYQA 3IQ5A 4E18A 3PDMP 1TR2A 2HSQA 2YL0A 2Y39A 3DAFA 1TFKB 4Z9IA 3C62A 5L0JA 3N0TA 5D91A 3EQLF 4J7TA 1NSGB 5COMA 1TKNA 3OWTA 4JIOA 2Q4FA 1VYKA 1HE1A 256BA 4EKWA 1TWAA 2JD3A 3FOOA 5KYXA 1EA8A 3M1CB 1SF8A 3EFOB 3HNKA 4N6CA 1T01A 3AQCA 3VM6A 1HE9A 2KGOA 3H65A 3WG7C 3M4BA 1OCRC 4DRJB 5K0IA 3DAGA 2JX0A 3L0IA 2X0CA 4PJNA 5BQHA 2C03A 2YEVA 4I1OB 2BL2A 3ZC4A 2R7TA 3ITFA 3EPVA 3FHDA 2EPLX 4OIOF 3U3FA 4BEMJ 4D4XA 2AWCA 1H6GA 3RIPA 2NUTA 2KW3C 3Q7LA 3RVYA 3CZ6A 1YZCA 2IM8A 3I5PA 4BPMA 4CSAC 1UG7A 2EINC 5DVWA 1ZHXA 2XSEA 5CI8A 3TOLA 2XL6A 1Q0GA 3ZQVA 2J9BA 2PF4E 1ZZPA 3ZSUA 5B3IA 1NFNA 2HFIA 2R7QA 2GWWA 5B1AC 3B71A 4K1OA 3RQFA 4CS9C 3KYJA 1WOLA 2DYSC 2HV6A 4XEFA 1L3PA 1VOMA 4ER9A 1DOWA 5A69A 1BR1A 4Q5SF 4FX5A 4E7SA 4MS2A 2P6VA 4XLNF 1Z5ZA 1GGQA 3S29A 3G4ZA 1Q0FA 2A69F 3ZTMA 2P0NA 1M2VA 4EBKA 4LDKA 3RFYA 1IW7F 3GWNA 2EIMC 1SMYF 4Q7CA 3JYYA 4GQHA 4X0RA 1ST6A 1YLMA 1XZPA 3BEHA 4DVYP 4MVZA 4XTKA 3IPMO 4QDLA 2VCCA 3OA1A 4JCZA 5COFA 3C8GA 1XWJA 3JTLO 1F1MA 1QVXA 2KQ9A 2YLDA 1LPEA 1PD1A 2P1AA 1Q0DA 4W8PA 3C8GD 1NG1A 4CS8C 3A11A 4DVZA 1T6QA 3QMKA 4BJ1A 1YJGA 4IARA 3W8IA 1TWGA 2R9RB 4G7ZF 3H2VA 3SYNA 4MTGA 4C7OA 3QTHA 3EGXA 1OCCC 3US6A 5DQTA 1K05A 5FCLA 3IHUA 4G7OF 1NLXA 5DS6A 2J9UA 1RJ9B 1ZVZA 5L0CA 1HY5A 1YA7O 4ZLDA 1H9GA 3RYLA 3AG1C 2WZGA 3UGOA 4BJ5A 3PHF2 4NY3A 4PR9A 1QKRA 2R7VA 1A7VA 3JRTA 3L8JA 3M15A 1NZEA 3EGDA 2W9YA 4NTFA 4K7BA 5L0IA 2J7PD 2L6GA 2VB6A 1WWPA 2BE5F 2J8WA 1G8XA 2X51A 3UGPA 2YL3A 3AG2C 4XPYA 1M2OA 1HW1A 3B0UX 4MTOA 1WATA 4QI0A 1FTSA 4U5FE 3TOMA 3NKDA 3V5ZA 5KYWA 4O6MA 1LI5A 1VLSA 5A6AA 1E2XA 1RMVA 2YLIA 5T3WA 1CGME 2NUPB 4IAOA 4DJ9A 1M57C 3U2MA 4ULWA 2HUJA 5CI9A 3NMKA 3DM9B 2RD9A 3JSZA 2YKZA 3LESA 3EG9B 3ZVRA 3W8HA 3GM1A 5E3CA 4CX9A 1I4YA 3CSKA 2Y3GA 3GORA 3WHNA 4BG0A 3S84A 2YHSA 1A7EA 2MHRA 1T5OA 2PBEA 2F22A 3KKBA 2ZXWC 2KSFA 4WJ0A 1BZ4A 1EI7A 3FAJA 4OD4A 5A6KA 1NU7D 4JJGA 3V5YA 4XEKA 3VAYA 3KMIA 4IAQA 3UR3C 2I15A 2KJGA 2NPUA 1CPRA 2P61A 4YJWA 1YAUO 4IB4A 3RKOF 1U0BB 2IBFA 2VASA 2FAPB 4WABA 5JSLA 4JVSA 3W2WA 3B0PA 4JW1A 1O3UA 2YLGA 3SXYA 2XLOA 1U6HA 1BDJB 1JPJA 4XWJA 4YK5A 1A0BA 1PV3A 5JLIA 4D4NA 2TMVP 3HNJA 3T9OA 1D1AA 2Y3DA 3E70C 2VCAA 4G0HA 2FGYA 4JURI 2CGEA 4HEAJ 2Q00A 5HSWA 2EPOA 2XLWA 2YL1A 4N4WA 3ECSA 2QNLA 3VF0A 3U9MA 2J9VA 4IRUA 4DOZA 3C8ZA 4AL0A 2XLMA 3DI5A 1C17M 1TFOB 4CDAA 1FFHA 2L81A 4H54A 4CJOA 4U5HA 5L0DA 5KYXB 1MMDA 1OW7A 3K1IA 3SZRA 3S90A 4N06A 4NQFA 3K6BA 4UDVA 1QSPA 1KTMA 2ZXRA 4LDRA 1OW8A 2JPUA 1YA9A 4L6RA 4IWBA 4MVUA 2A1DD 3EJNA 1SR2A 2I8BA 1DOVA 2QUPA 2WZLA 1YYJA 2UUIA 3GM3A 4U5DE 3TULA 4JRZA 2A6HF 4JJFA 1KNYA 1LI7A 1QQ3A 4A2NB 1D1BA 3H2UA 2J0WA 1CGOA 2XRHA 2OCCC 3SXMA 3SP1A 4K0DA 3O39A 3V7OA 4EWCA 5L3QA 2H7OA 1IZMA 1VMAA 2M64A 5T3TA 3LJBA 4Z9HA 4YWQA 2G62A 2NUTB 3ABMC 5JUAA 5KYNA 3JRMO 3QVYA 1HW2A 1K04A 3JT1A 2XLVA 2M4EA 1Z63A 2H7VC 3AQBA 2ZXPA 1QZXA 5AC5A 1YVIA 2LSEA 2NSFA 2HMQA 4MVOA 4MTFA 4RDAA 3RH3A 2R7XA 3EHNA 3HKKA 3DJUB 2P7VA 4KI2A 2LFDA 2WVOA 3NRHA 1Y6DA 2VH3A 1VTMP 1XZQA 3PCVA 1UFBA 1MNDA 2ZPAA 3DXJF 4MNDA 2PX0A 3O6XA 4DXWA 5KYYB 1EKYA 4YL0A 5KYUA 4BJ5C 3AOUA 2QLAA 5CIVA 3DZAA 4YT2A 5DS5A 1LIHA 4I44A 1NU9C 4W8KA 3ZQYA 5EK0A 1Q0KA 1LE4A 3NYJA 1MQVA 3U8VA 2LFFA 2Q9AA 3X1OA 2LK4A 1FMWA 3JCUQ 1Z3IX 4YN0B 4PK4A 4YT4A 1R4TA 5HV9A 3C8GB 4M63A 1VB5A 3WAQA 2PFDA 3NYMA 3FOPA 1JRAA 2EPKX 2R25A 3F46A 4KBLA 3S9OA 3NKEA 3U0CA 4DRHB 3EHMA 2HV7A 3C7JA 4FAPB 4OIQF 4O6NA 5EHHA 2ZXOA 2PX3A 3S27A 1I5NA 4O79A 4YT8A 2Y69C 4ZLCA 1MMAA 2QY9A 4KNWA 2OEVA 3IQ6A 2QE9A 1Z6AA 3PMRA 5IY5C 5FZTA 2EIKC 3LUTB 1AEPA 2XXAA 3S28A 2GA0A 1B68A 1LVKA 1VK5A 2CDQA 4PACA 2H7BA 2W45A 2XLDA 4DBRA 3U8PA 3HNIA 1WASA 2J46A 1R5ID 2R05A 5AGFA 2DB4A 4LLEA 5JRAA 1G4WR 1OCZC 2GAQA 2HKVA 4C3BA 4BJTA 2HJ3A 1AUEA 4DRIB 1RCPA 2EIJC 3N2ZB 4CDVA 1OW6A 2D5RB 1GS9A 4CSAA 2OG2A 3LNRA 3MBGA 2AVKA 4LLCA 4G7HF 2EPNA 3T6JA 1EQ1A 2PP4A 3TD7A 3S0XA 1RKEB 4ULVA 2OJQA 3B9QA 4O6YA 1ZU5A 2XS8A 2YWAA 1RJ9A 4E0IA 3M4CA 1D1CA 5F5FA 4AK9A 3MX3A 4LDQA 3U5SA 3C63A 2MWQA 4AE4A 1E84A 3ABLC 1YZAA 3DJNB 3ZDLA 2EPMX 2IOQA 2QTVA 2G3VA 4EIYA 1U89A 2Q3TA 1ZYRF 2RSEB 3QW0A 2J45A 4CDYA 1T6UA 1V54C 1OKKA 3EZIA 3ASNC 3G4XA 4RD9A 3UNGC 4AL1A 3LNMB 2WB7A 4MVSA 4PJLA 3C18A 4HE8D 1OKKD 1ORSC 2D4UA 4OD5A 1VYIA 2A6EF 3UMIA 2OQMA 2KYHA 3GWLA 1ZHYA 1LM3B 2ASRA 4OIPF 2BC5A 4P6IC 2LQGA 5A6JA 2HSBA 3KYIA 2G3KA 3R2PA 4EHPA 3GM2A 1JMWA 1TWHA 3K7DA 4BJ6C 2DYRC 4FWVA 1C03A 3RW0A 4E7ZA 1FFTC 3MYFA 4I3MA 4P9FA 1ZHZA 4MQ9F 2OEXA 4PJJA 3Q7GA 2ZD9A 3EG9A 4JE9A 2R03A 3RF3A 1J8YF 2PNOA 2H8AA 3LAYA 3LS1A 4LACB 4XQ1A 4G78A 1LE2A 4PFOA 2XM4A 2CNWA 5TJ5E 5L0GA 1Q0MA 2DGJA 3K66A 2E87A 2YQYA 3LLKA 4HFFB 4U5CE 1WGWA 3AGUA 2CNWD 2LD6A 2OKUA 2AP3A 3DE9A 1WTYA 2B0HA 3JYHA 4MW3A 3U3BA 2OOCA 1NFOA 3FXHA 3KH2A 2WVNA 3IQTA 3L8IA 1Y4CA 1PD0A 3MYIA 3QZCA 1JR8A 2YVKA
chains in the Genus database with same CATH topology
4BEMJ 2DB4A 2CYDA 5TJ5E 2BL2A 3AOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BEM J;  2DB4 A;  2CYD A;  5TJ5 E;  2BL2 A;  3AOU A; 
#chains in the Genus database with same CATH topology
 4Q4Z F;  4MVQ A;  1FMV A;  1ZW2 A;  3GEE A;  3HNL A;  1G5Z A;  3DMD A;  1ORY A;  3SEO A;  1WN0 A;  3SNH A;  1YYX A;  1NBB A;  2A68 F;  2DI3 A;  4ONS A;  1FAP B;  1LS1 A;  3A9C A;  4JTD B;  2KNH A;  4JTC B;  2J9W A;  4A4A A;  2W4B A;  3ABK C;  1T6I A;  3NYL A;  3J06 A;  3AJM A;  1RXQ A;  2ICW G;  5L3V A;  2R7W A;  4QI2 A;  3W2V A;  2L6H A;  1E83 A;  3M79 A;  2B0J A;  5L0F A;  2NSG A;  3ATP A;  4NCQ A;  3LEV A;  4JCH A;  3OEO A;  3EZH A;  1BR4 A;  2GDC A;  4IJJ A;  3EFO A;  1W2W A;  3MFN A;  2XM0 A;  3NG1 A;  2R7S A;  2IXO A;  2J0X A;  4OIR F;  1FNT c;  1OCO C;  4XEV A;  4LER A;  5JS5 A;  3AG4 C;  3Q6N A;  5E2Q A;  1YDI A;  3UMK A;  5KYU B;  3FDQ A;  2L9J A;  3F47 A;  3SXK A;  4HFK B;  3B29 A;  3KPH A;  5DLJ A;  1JOG A;  3HLZ A;  4BJ6 A;  1O5H A;  4KNV A;  1BBH A;  1M2V B;  1L7C A;  1JAF A;  4MVM A;  1LKX A;  1OQC A;  4C3D A;  4P9T A;  5JVE A;  2YL7 A;  2R7O A;  3O10 A;  2Y3B A;  4O7G A;  3DE8 A;  2HZ8 A;  5DS4 A;  4JKV A;  1OR2 A;  1M6T A;  3IQC A;  1OXB A;  1VLT A;  3L1M A;  2AU5 A;  5BQG A;  4R32 A;  4EUK B;  1E86 A;  4AX2 A;  3O55 A;  4U5B E;  2HS5 A;  1YAR O;  2MYS A;  5KYY A;  4EBJ A;  4C7O B;  1V55 C;  1MMG A;  3TJ5 A;  1CGN A;  1PCX A;  2AWY A;  2XLE A;  3CQZ A;  4CBE A;  5L0H A;  4GYT A;  3TQO A;  3EGX B;  1H9T A;  2V3C C;  5BQI A;  1AVO B;  3W4Y A;  4EBB A;  5B1B C;  2CYD A;  1QLE C;  2VCB A;  1OR3 A;  3DM5 A;  1V74 B;  4NTB A;  2XL8 A;  3DD7 A;  4WGZ A;  2XXA B;  4NC3 A;  2C04 A;  3HJC A;  4CIH A;  3AG3 C;  4H4K C;  1MNE A;  5BUO A;  3QW1 A;  3TK0 A;  1J8M F;  1QPU A;  1V4A A;  4Z9J A;  2L7A A;  5E33 A;  1H7I A;  1LS4 A;  1O87 A;  3T6B A;  1E85 A;  3KL4 A;  5A6B A;  3EGD B;  2R7U A;  2IXP A;  3ZWI A;  3AGT A;  2A0U A;  4KC9 A;  1D0Y A;  3RVZ A;  3QVZ A;  5A6B D;  4OIN F;  4I1M A;  4J30 B;  3E9V A;  4JTA B;  3U2L A;  2GFH A;  3JSE O;  2Q9C A;  4XPX A;  5KYW B;  1CPQ A;  3ZG1 A;  5F28 E;  1GM5 A;  3B0V C;  4J32 B;  2CCY A;  2IXM A;  2YRF A;  2XL4 A;  1D0X A;  4YL1 A;  4XPW A;  3TJ6 A;  4JEA A;  1C02 A;  4U5G A;  4CS9 A;  4JZA A;  3CAX A;  5D92 A;  4U9D A;  4AE4 B;  3GEI A;  1I4Z A;  5E3A A;  2LIG A;  3ZTZ A;  1JPN A;  2A0B A;  2O9X A;  2J7P A;  1S7Z A;  2Y3H A;  3K1I C;  1N1C A;  3NMI A;  4JC7 A;  4E17 A;  4CIP A;  2UUH A;  1ZHW A;  3DKA A;  4J7Y A;  5JP7 A;  2LCH A;  1BR2 A;  3LS0 A;  1Z23 A;  4GEH A;  4CS7 A;  5COG A;  3R7C A;  2IXN A;  2IYL D;  1HMD A;  1MMN A;  4PFP A;  4WGY A;  3X2Q C;  3POV A;  3FAP B;  4YT5 A;  1FR0 A;  2R02 A;  3NMJ A;  4C3E A;  4FES A;  4U9E A;  2YZS A;  1ZU4 A;  3CEX A;  2V26 A;  2WL8 A;  3I5Q A;  4IGG A;  3T6G B;  2CW0 F;  5EGY A;  2VC9 A;  2NG1 A;  3K1H A;  1RKE A;  2HJM A;  2ETS A;  2HMZ A;  2NUP A;  2Z15 A;  3T4R A;  3VYW A;  1KU2 A;  2KK1 A;  4RBN A;  1ORJ A;  4CS8 A;  4XLP F;  2R7R A;  3FVY A;  3GOD A;  3LEO A;  3VRC A;  2KC3 A;  2OJE D;  3I4U A;  3UMH A;  4N6H A;  4U5E E;  3FMS A;  1ZHT A;  3RQG A;  5AC4 A;  3NDB B;  1TWC A;  3EH1 A;  3LLI A;  1HMO A;  1OXK A;  3DWW A;  3GAN A;  3N24 A;  3EH2 A;  3MLG A;  4PJM A;  5F5H A;  3ASO C;  2FFH A;  4MVR A;  5DQZ A;  1D0Z A;  1M56 C;  2Q9B A;  3V5X A;  4ANJ A;  4F4B A;  3IEE A;  5B3S C;  2Q7R A;  2L6F A;  3L34 A;  2EIL C;  4JEB A;  1ZW3 A;  3Q6M A;  4NTA A;  3ZIB A;  4YL3 A;  1S05 A;  4CJG A;  1GQA A;  1K40 A;  1G4U S;  1T9K A;  1APC A;  3U9J A;  1A7D A;  2WVQ A;  3BRJ A;  3WOD F;  4BEJ A;  3GEH A;  1A41 A;  2XS1 A;  4MW8 A;  1SZI A;  5T1D B;  3G50 A;  1TQG A;  3RQE A;  3JZ0 A;  2LP4 A;  4B6I A;  1Z7Q c;  1RKC A;  3SXZ A;  4DBQ A;  2W4M A;  4E0H A;  2OU6 A;  3HTK C;  3K33 A;  2XLH A;  5JT4 A;  2WZF A;  5GPG B;  1SYQ A;  3IQ5 A;  4E18 A;  3PDM P;  1TR2 A;  2HSQ A;  2YL0 A;  2Y39 A;  3DAF A;  1TFK B;  4Z9I A;  3C62 A;  5L0J A;  3N0T A;  5D91 A;  3EQL F;  4J7T A;  1NSG B;  5COM A;  1TKN A;  3OWT A;  4JIO A;  2Q4F A;  1VYK A;  1HE1 A;  256B A;  4EKW A;  1TWA A;  2JD3 A;  3FOO A;  5KYX A;  1EA8 A;  3M1C B;  1SF8 A;  3EFO B;  3HNK A;  4N6C A;  1T01 A;  3AQC A;  3VM6 A;  1HE9 A;  2KGO A;  3H65 A;  3WG7 C;  3M4B A;  1OCR C;  4DRJ B;  5K0I A;  3DAG A;  2JX0 A;  3L0I A;  2X0C A;  4PJN A;  5BQH A;  2C03 A;  2YEV A;  4I1O B;  2BL2 A;  3ZC4 A;  2R7T A;  3ITF A;  3EPV A;  3FHD A;  2EPL X;  4OIO F;  3U3F A;  4BEM J;  4D4X A;  2AWC A;  1H6G A;  3RIP A;  2NUT A;  2KW3 C;  3Q7L A;  3RVY A;  3CZ6 A;  1YZC A;  2IM8 A;  3I5P A;  4BPM A;  4CSA C;  1UG7 A;  2EIN C;  5DVW A;  1ZHX A;  2XSE A;  5CI8 A;  3TOL A;  2XL6 A;  1Q0G A;  3ZQV A;  2J9B A;  2PF4 E;  1ZZP A;  3ZSU A;  5B3I A;  1NFN A;  2HFI A;  2R7Q A;  2GWW A;  5B1A C;  3B71 A;  4K1O A;  3RQF A;  4CS9 C;  3KYJ A;  1WOL A;  2DYS C;  2HV6 A;  4XEF A;  1L3P A;  1VOM A;  4ER9 A;  1DOW A;  5A69 A;  1BR1 A;  4Q5S F;  4FX5 A;  4E7S A;  4MS2 A;  2P6V A;  4XLN F;  1Z5Z A;  1GGQ A;  3S29 A;  3G4Z A;  1Q0F A;  2A69 F;  3ZTM A;  2P0N A;  1M2V A;  4EBK A;  4LDK A;  3RFY A;  1IW7 F;  3GWN A;  2EIM C;  1SMY F;  4Q7C A;  3JYY A;  4GQH A;  4X0R A;  1ST6 A;  1YLM A;  1XZP A;  3BEH A;  4DVY P;  4MVZ A;  4XTK A;  3IPM O;  4QDL A;  2VCC A;  3OA1 A;  4JCZ A;  5COF A;  3C8G A;  1XWJ A;  3JTL O;  1F1M A;  1QVX A;  2KQ9 A;  2YLD A;  1LPE A;  1PD1 A;  2P1A A;  1Q0D A;  4W8P A;  3C8G D;  1NG1 A;  4CS8 C;  3A11 A;  4DVZ A;  1T6Q A;  3QMK A;  4BJ1 A;  1YJG A;  4IAR A;  3W8I A;  1TWG A;  2R9R B;  4G7Z F;  3H2V A;  3SYN A;  4MTG A;  4C7O A;  3QTH A;  3EGX A;  1OCC C;  3US6 A;  5DQT A;  1K05 A;  5FCL A;  3IHU A;  4G7O F;  1NLX A;  5DS6 A;  2J9U A;  1RJ9 B;  1ZVZ A;  5L0C A;  1HY5 A;  1YA7 O;  4ZLD A;  1H9G A;  3RYL A;  3AG1 C;  2WZG A;  3UGO A;  4BJ5 A;  3PHF 2;  4NY3 A;  4PR9 A;  1QKR A;  2R7V A;  1A7V A;  3JRT A;  3L8J A;  3M15 A;  1NZE A;  3EGD A;  2W9Y A;  4NTF A;  4K7B A;  5L0I A;  2J7P D;  2L6G A;  2VB6 A;  1WWP A;  2BE5 F;  2J8W A;  1G8X A;  2X51 A;  3UGP A;  2YL3 A;  3AG2 C;  4XPY A;  1M2O A;  1HW1 A;  3B0U X;  4MTO A;  1WAT A;  4QI0 A;  1FTS A;  4U5F E;  3TOM A;  3NKD A;  3V5Z A;  5KYW A;  4O6M A;  1LI5 A;  1VLS A;  5A6A A;  1E2X A;  1RMV A;  2YLI A;  5T3W A;  1CGM E;  2NUP B;  4IAO A;  4DJ9 A;  1M57 C;  3U2M A;  4ULW A;  2HUJ A;  5CI9 A;  3NMK A;  3DM9 B;  2RD9 A;  3JSZ A;  2YKZ A;  3LES A;  3EG9 B;  3ZVR A;  3W8H A;  3GM1 A;  5E3C A;  4CX9 A;  1I4Y A;  3CSK A;  2Y3G A;  3GOR A;  3WHN A;  4BG0 A;  3S84 A;  2YHS A;  1A7E A;  2MHR A;  1T5O A;  2PBE A;  2F22 A;  3KKB A;  2ZXW C;  2KSF A;  4WJ0 A;  1BZ4 A;  1EI7 A;  3FAJ A;  4OD4 A;  5A6K A;  1NU7 D;  4JJG A;  3V5Y A;  4XEK A;  3VAY A;  3KMI A;  4IAQ A;  3UR3 C;  2I15 A;  2KJG A;  2NPU A;  1CPR A;  2P61 A;  4YJW A;  1YAU O;  4IB4 A;  3RKO F;  1U0B B;  2IBF A;  2VAS A;  2FAP B;  4WAB A;  5JSL A;  4JVS A;  3W2W A;  3B0P A;  4JW1 A;  1O3U A;  2YLG A;  3SXY A;  2XLO A;  1U6H A;  1BDJ B;  1JPJ A;  4XWJ A;  4YK5 A;  1A0B A;  1PV3 A;  5JLI A;  4D4N A;  2TMV P;  3HNJ A;  3T9O A;  1D1A A;  2Y3D A;  3E70 C;  2VCA A;  4G0H A;  2FGY A;  4JUR I;  2CGE A;  4HEA J;  2Q00 A;  5HSW A;  2EPO A;  2XLW A;  2YL1 A;  4N4W A;  3ECS A;  2QNL A;  3VF0 A;  3U9M A;  2J9V A;  4IRU A;  4DOZ A;  3C8Z A;  4AL0 A;  2XLM A;  3DI5 A;  1C17 M;  1TFO B;  4CDA A;  1FFH A;  2L81 A;  4H54 A;  4CJO A;  4U5H A;  5L0D A;  5KYX B;  1MMD A;  1OW7 A;  3K1I A;  3SZR A;  3S90 A;  4N06 A;  4NQF A;  3K6B A;  4UDV A;  1QSP A;  1KTM A;  2ZXR A;  4LDR A;  1OW8 A;  2JPU A;  1YA9 A;  4L6R A;  4IWB A;  4MVU A;  2A1D D;  3EJN A;  1SR2 A;  2I8B A;  1DOV A;  2QUP A;  2WZL A;  1YYJ A;  2UUI A;  3GM3 A;  4U5D E;  3TUL A;  4JRZ A;  2A6H F;  4JJF A;  1KNY A;  1LI7 A;  1QQ3 A;  4A2N B;  1D1B A;  3H2U A;  2J0W A;  1CGO A;  2XRH A;  2OCC C;  3SXM A;  3SP1 A;  4K0D A;  3O39 A;  3V7O A;  4EWC A;  5L3Q A;  2H7O A;  1IZM A;  1VMA A;  2M64 A;  5T3T A;  3LJB A;  4Z9H A;  4YWQ A;  2G62 A;  2NUT B;  3ABM C;  5JUA A;  5KYN A;  3JRM O;  3QVY A;  1HW2 A;  1K04 A;  3JT1 A;  2XLV A;  2M4E A;  1Z63 A;  2H7V C;  3AQB A;  2ZXP A;  1QZX A;  5AC5 A;  1YVI A;  2LSE A;  2NSF A;  2HMQ A;  4MVO A;  4MTF A;  4RDA A;  3RH3 A;  2R7X A;  3EHN A;  3HKK A;  3DJU B;  2P7V A;  4KI2 A;  2LFD A;  2WVO A;  3NRH A;  1Y6D A;  2VH3 A;  1VTM P;  1XZQ A;  3PCV A;  1UFB A;  1MND A;  2ZPA A;  3DXJ F;  4MND A;  2PX0 A;  3O6X A;  4DXW A;  5KYY B;  1EKY A;  4YL0 A;  5KYU A;  4BJ5 C;  3AOU A;  2QLA A;  5CIV A;  3DZA A;  4YT2 A;  5DS5 A;  1LIH A;  4I44 A;  1NU9 C;  4W8K A;  3ZQY A;  5EK0 A;  1Q0K A;  1LE4 A;  3NYJ A;  1MQV A;  3U8V A;  2LFF A;  2Q9A A;  3X1O A;  2LK4 A;  1FMW A;  3JCU Q;  1Z3I X;  4YN0 B;  4PK4 A;  4YT4 A;  1R4T A;  5HV9 A;  3C8G B;  4M63 A;  1VB5 A;  3WAQ A;  2PFD A;  3NYM A;  3FOP A;  1JRA A;  2EPK X;  2R25 A;  3F46 A;  4KBL A;  3S9O A;  3NKE A;  3U0C A;  4DRH B;  3EHM A;  2HV7 A;  3C7J A;  4FAP B;  4OIQ F;  4O6N A;  5EHH A;  2ZXO A;  2PX3 A;  3S27 A;  1I5N A;  4O79 A;  4YT8 A;  2Y69 C;  4ZLC A;  1MMA A;  2QY9 A;  4KNW A;  2OEV A;  3IQ6 A;  2QE9 A;  1Z6A A;  3PMR A;  5IY5 C;  5FZT A;  2EIK C;  3LUT B;  1AEP A;  2XXA A;  3S28 A;  2GA0 A;  1B68 A;  1LVK A;  1VK5 A;  2CDQ A;  4PAC A;  2H7B A;  2W45 A;  2XLD A;  4DBR A;  3U8P A;  3HNI A;  1WAS A;  2J46 A;  1R5I D;  2R05 A;  5AGF A;  2DB4 A;  4LLE A;  5JRA A;  1G4W R;  1OCZ C;  2GAQ A;  2HKV A;  4C3B A;  4BJT A;  2HJ3 A;  1AUE A;  4DRI B;  1RCP A;  2EIJ C;  3N2Z B;  4CDV A;  1OW6 A;  2D5R B;  1GS9 A;  4CSA A;  2OG2 A;  3LNR A;  3MBG A;  2AVK A;  4LLC A;  4G7H F;  2EPN A;  3T6J A;  1EQ1 A;  2PP4 A;  3TD7 A;  3S0X A;  1RKE B;  4ULV A;  2OJQ A;  3B9Q A;  4O6Y A;  1ZU5 A;  2XS8 A;  2YWA A;  1RJ9 A;  4E0I A;  3M4C A;  1D1C A;  5F5F A;  4AK9 A;  3MX3 A;  4LDQ A;  3U5S A;  3C63 A;  2MWQ A;  4AE4 A;  1E84 A;  3ABL C;  1YZA A;  3DJN B;  3ZDL A;  2EPM X;  2IOQ A;  2QTV A;  2G3V A;  4EIY A;  1U89 A;  2Q3T A;  1ZYR F;  2RSE B;  3QW0 A;  2J45 A;  4CDY A;  1T6U A;  1V54 C;  1OKK A;  3EZI A;  3ASN C;  3G4X A;  4RD9 A;  3UNG C;  4AL1 A;  3LNM B;  2WB7 A;  4MVS A;  4PJL A;  3C18 A;  4HE8 D;  1OKK D;  1ORS C;  2D4U A;  4OD5 A;  1VYI A;  2A6E F;  3UMI A;  2OQM A;  2KYH A;  3GWL A;  1ZHY A;  1LM3 B;  2ASR A;  4OIP F;  2BC5 A;  4P6I C;  2LQG A;  5A6J A;  2HSB A;  3KYI A;  2G3K A;  3R2P A;  4EHP A;  3GM2 A;  1JMW A;  1TWH A;  3K7D A;  4BJ6 C;  2DYR C;  4FWV A;  1C03 A;  3RW0 A;  4E7Z A;  1FFT C;  3MYF A;  4I3M A;  4P9F A;  1ZHZ A;  4MQ9 F;  2OEX A;  4PJJ A;  3Q7G A;  2ZD9 A;  3EG9 A;  4JE9 A;  2R03 A;  3RF3 A;  1J8Y F;  2PNO A;  2H8A A;  3LAY A;  3LS1 A;  4LAC B;  4XQ1 A;  4G78 A;  1LE2 A;  4PFO A;  2XM4 A;  2CNW A;  5TJ5 E;  5L0G A;  1Q0M A;  2DGJ A;  3K66 A;  2E87 A;  2YQY A;  3LLK A;  4HFF B;  4U5C E;  1WGW A;  3AGU A;  2CNW D;  2LD6 A;  2OKU A;  2AP3 A;  3DE9 A;  1WTY A;  2B0H A;  3JYH A;  4MW3 A;  3U3B A;  2OOC A;  1NFO A;  3FXH A;  3KH2 A;  2WVN A;  3IQT A;  3L8I A;  1Y4C A;  1PD0 A;  3MYI A;  3QZC A;  1JR8 A;  2YVK A; 
#chains in the Genus database with same CATH homology
 4BEM J;  2DB4 A;  2CYD A;  5TJ5 E;  2BL2 A;  3AOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...