4BEMJ

Crystal structure of the f-type atp synthase c-ring from acetobacterium woodii.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
181
structure length
181
Chain Sequence
b'IGDMNIVDFVIQFLSQFDPVDVIKGFSALGIGLAMVAGVGPGIGQGFAAGKGAEAVGKNPTKSNDIVMIMLLGAAVAETSGIFSLVIALILLFANPFISSTASVWILSASAMASGIAMIAGIGPGTGQGYAAGKGAEAVGIRPEMKSAILRVMLLGQAVAQTTGIYALIVALILMYANPFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F1FO ATPASE C2 SUBUNIT
publication title High-Resolution Structure and Mechanism of an F/V-Hybrid Rotor Ring in a Na+-Coupled ATP Synthase
pubmed doi rcsb
molecule tags Hydrolase
total genus 77
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2013-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00137 ATP-synt_C ATP synthase subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) lithium bound rotor ring of v- atpase 4bemJ00
2BL2A 2DB4A 5TJ5E 2CYDA 4BEMJ 3AOUA
chains in the Genus database with same CATH superfamily
4G7ZF 5JP7A 2R7WA 2GDCA 4ONSA 2R03A 1EKYA 4MTGA 4JURI 1E84A 1Q0FA 1ORSC 2WL8A 4EBBA 2WVQA 3TOMA 4BPMA 3AOUA 3E70C 1Z63A 1ZYRF 4L6RA 3RF3A 5FZTA 3UGPA 2AP3A 5B1BC 3JRTA 3O55A 4MVOA 1RKCA 3K33A 3SXZA 1RXQA 3MBGA 3EHNA 4MTFA 4PJJA 4DRHB 5B3SC 3LS1A 2YRFA 4AL1A 3B0UX 3MX3A 5KYYB 3C8GA 3WG7C 1TWHA 3C7JA 1AVOB 2H7OA 4JIOA 4XWJA 1U0BB 1FFHA 1T01A 2Q7RA 1XZPA 4IJJA 1A7EA 3KH2A 4AX2A 4CJGA 1LPEA 4LDRA 3RFYA 4C3DA 3DJNB 4FAPB 4U9EA 3QTHA 3KPHA 1H9GA 2XLOA 4R32A 3U9JA 4MNDA 3X1OA 2J9BA 1HY5A 1OKKA 1OR3A 4O6MA 3AGUA 2RD9A 3U3FA 4NCQA 2EINC 4E0HA 2YL7A 4I1OB 4IAOA 1QKRA 1ORYA 1OW8A 3MLGA 2HFIA 1G5ZA 1SYQA 4J7YA 1JOGA 3GM1A 2HV6A 4MVQA 3TJ5A 1LS4A 4BG0A 2A0BA 3VF0A 2PNOA 4ER9A 5A6KA 1ZHZA 5KYXA 1UFBA 2ICWG 3KMIA 1BZ4A 3RKOF 1AUEA 2VASA 2EILC 4RD9A 3B9QA 1GM5A 1QLEC 4U5HA 1M2VA 3U2MA 1FNTc 3EHMA 4YT5A 3ZWIA 2V3CC 2ASRA 1PD1A 5L3VA 1IZMA 2AWYA 3RQEA 3M4BA 5B3IA 1A7VA 2XSEA 1R4TA 2L9JA 5D91A 3B0VC 1ZHYA 3UMKA 4JE9A 3W2VA 1LS1A 1A0BA 1ST6A 4PACA 2R7SA 1YA9A 3U3BA 3UR3C 3S28A 4LACB 2ZPAA 2XL8A 3K66A 4JRZA 2YZSA 4WGZA 2YHSA 3OA1A 3OWTA 4MVSA 3B0PA 1YZCA 3ZSUA 5KYYA 4E0IA 2QUPA 3FMSA 2LK4A 2MHRA 2WB7A 1DOVA 4DVZA 2F22A 2XLDA 2R7QA 1UG7A 3JSZA 1RKEA 3FOOA 4W8KA 2XL4A 4E7ZA 2GWWA 5DS6A 1JMWA 5JVEA 3LNMB 5CI8A 5FCLA 2LQGA 3V5YA 4HFFB 1PCXA 2ZXWC 1YAUO 1VYIA 3N2ZB 4OD4A 1E85A 2LP4A 3ABLC 2BE5F 5TJ5E 1O87A 3GODA 3FOPA 3VRCA 2I15A 1JPJA 3WODF 4Q5SF 3I5PA 4LLCA 5IY5C 3DI5A 1M2OA 4WABA 2Q9AA 3ASNC 2CYDA 3AQCA 4NY3A 1EA8A 2Y3GA 3SEOA 4DXWA 3M79A 5E3AA 5JSLA 4DOZA 2XLHA 2P61A 1D1CA 2E87A 1LE4A 1U89A 2QNLA 3NYJA 3J06A 4HFKB 4XPWA 2ZD9A 3K7DA 4HEAJ 1JPNA 2HSQA 4YN0B 2XRHA 3PHF2 1M6TA 3DZAA 1J8YF 4YWQA 4KNWA 5COFA 3AG3C 4PR9A 1MMNA 2Y3BA 3DAFA 4AK9A 2Q4FA 1VLTA 1VMAA 2LIGA 3H2UA 3M1CB 3O10A 4EKWA 1D0YA 1WASA 1BR2A 2R05A 2UUHA 1Q0DA 2B0JA 3CZ6A 2MWQA 4WGYA 4M63A 3IPMO 4RDAA 2TMVP 4JJGA 3A9CA 3NRHA 1G4WR 1ZU5A 3NMJA 1GS9A 4JTCB 3HKKA 1OW6A 3EH1A 4X0RA 3VYWA 4DBQA 4U5FE 3IQ6A 1FTSA 4MVRA 2J8WA 3X2QC 3ATPA 4IGGA 2LSEA 4AE4B 2J0WA 4YJWA 1XZQA 4O79A 1NSGB 1HMDA 4PK4A 5JUAA 1G4US 4KC9A 3TQOA 1PV3A 3RQFA 2XLWA 5GPGB 5F5HA 3AG1C 3UGOA 2HKVA 4Z9HA 2V26A 2JPUA 1MMDA 2G3KA 1S7ZA 3PDMP 1ZW3A 4XPYA 4P6IC 4DBRA 3Q7GA 3EZIA 4I3MA 2L6FA 1Z3IX 2KNHA 1TFOB 3DM5A 2CNWD 2GFHA 4IRUA 3QW0A 4JTAB 4XTKA 2AVKA 4XPXA 5K0IA 4OIPF 4YK5A 4CIHA 3VM6A 3UMHA 3ABKC 4PJNA 1I4ZA 5BQGA 4BJ5C 1JR8A 3SXKA 3FAPB 2PFDA 2J0XA 5EHHA 1SZIA 4H4KC 2H7BA 1SF8A 3FXHA 4U5CE 4RBNA 4XLPF 3QZCA 1K05A 3LLIA 1MQVA 2NUPB 5KYUB 4ULWA 3W2WA 4N06A 2LFFA 4YL1A 2KGOA 3TD7A 1T6QA 1TWCA 2LCHA 2LFDA 3TULA 1OCRC 1YLMA 4JJFA 4YL0A 3EJNA 2HZ8A 1I5NA 1RJ9B 4GQHA 4U5BE 5E2QA 3T6JA 3LS0A 3K1HA 4LDQA 3C18A 3L8IA 1Y6DA 3ZQVA 4EBJA 4A4AA 5AC4A 3L0IA 1YVIA 1T6UA 2NUTB 2OU6A 1MNDA 1WGWA 2HS5A 4CS9C 3TOLA 2GAQA 2YL3A 3JT1A 2J45A 4NC3A 2XLVA 2VCBA 3ZG1A 2EPLX 1YYJA 4KNVA 5E3CA 4AE4A 4CDAA 2XL6A 2WZLA 2EIJC 1MMGA 1QZXA 1ZW2A 5JT4A 3HNKA 2QLAA 3QVZA 3N24A 3K6BA 1KNYA 3WAQA 1O5HA 4PJLA 4BJ5A 3DMDA 4LDKA 4BJTA 2P7VA 2YKZA 2PBEA 2YLDA 1M57C 3E9VA 3EGDB 1OXBA 2XLEA 3GM2A 2OKUA 2CCYA 4ZLCA 1LKXA 4U5EE 5T1DB 3DE8A 2J7PD 3BRJA 4FX5A 1FMVA 1ZHXA 1KU2A 3BEHA 2YEVA 3W8IA 2R7XA 1LI5A 3RQGA 1VYKA 2OQMA 1EI7A 4Q7CA 2YLGA 4BJ1A 1J8MF 2L6GA 3FAJA 1Z5ZA 3L1MA 2L7AA 4PFOA 1RCPA 4Z9JA 2X0CA 1OCCC 4K0DA 3RW0A 4IB4A 2W4MA 3HNLA 2W9YA 4J30B 2IOQA 4ZLDA 3B29A 2NSGA 2YWAA 3RIPA 5KYUA 1Y4CA 2NUPA 3C8ZA 1Z23A 3EZHA 3LLKA 2A1DD 2OEVA 4FWVA 4JTDB 3AQBA 4I1MA 4CS9A 5A6JA 5A6BD 2HJMA 3JRMO 3O6XA 2Q00A 4OIOF 3R7CA 1NLXA 2XM0A 1VOMA 4CSAC 2ZXRA 3DM9B 2KQ9A 2DI3A 3IQCA 5CI9A 5BUOA 1RJ9A 5JLIA 4JEAA 1O3UA 4G0HA 5KYWB 3NDBB 1OCZC 2NUTA 2J7PA 4MQ9F 4P9FA 3U0CA 1NZEA 1D1AA 3NKDA 3GWNA 4NTBA 2OCCC 4J7TA 2C04A 2FFHA 2C03A 1V74B 3RVZA 3W4YA 3W8HA 2HMZA 2OG2A 3ITFA 5BQIA 1FR0A 4O7GA 4CX9A 5CIVA 4YT2A 3I5QA 3K1IC 4E17A 1ZZPA 2EPMX 3DWWA 2HSBA 1K04A 1H6GA 1PD0A 2Y3HA 3IEEA 4OD5A 1A7DA 4IAQA 3HNJA 3EGDA 3LESA 1VLSA 4HE8D 4U5GA 3EFOB 3LEVA 3M4CA 3KL4A 2ZXOA 4XEFA 3T6GB 2BL2A 2D5RB 3ECSA 2J9WA 2H8AA 3KYIA 1D0XA 1FFTC 1C03A 2Q3TA 3U8VA 5JS5A 3MYIA 5DS5A 2PP4A 4OINF 2NG1A 3TJ6A 1ZVZA 3F47A 3NG1A 4DRIB 2L6HA 3KKBA 4MVUA 3Q6MA 3AJMA 3UNGC 4O6YA 4CSAA 4KI2A 1CGME 5JRAA 1CPQA 5COGA 3RH3A 5L0CA 3UMIA 1G8XA 1LM3B 3ZVRA 4Q4ZF 2CGEA 1CGNA 5L0HA 4ANJA 1BDJB 3QW1A 2M4EA 1QPUA 2CW0F 2L81A 4MTOA 1T5OA 4DRJB 3EGXB 1YDIA 1Q0MA 2EIMC 3CQZA 4C7OB 1NBBA 1I4YA 1NU9C 1SR2A 5EK0A 3ZDLA 3GANA 3IQTA 2EPNA 3U9MA 1WTYA 2M64A 3A11A 1HW1A 4XEVA 4D4NA 3G4XA 3JZ0A 4UDVA 3PMRA 4DVYP 3MFNA 1E2XA 1A41A 1S05A 3CEXA 3EG9B 5KYNA 2PX3A 2D4UA 1Z6AA 3DKAA 1TWAA 2VB6A 5DQZA 1RMVA 1NG1A 4F4BA 2W4BA 3S0XA 3S29A 3DXJF 1LIHA 3GEHA 2Q9CA 1WATA 4JCZA 2JD3A 2XS1A 4PFPA 2Q9BA 4E18A 3C8GD 3S90A 1HW2A 1MMAA 1B68A 2KK1A 1EQ1A 1DOWA 4C3BA 2IXOA 3RYLA 1H7IA 2X51A 4MVZA 4D4XA 2IXPA 3IQ5A 3T6BA 4EBKA 1QQ3A 3N0TA 4NQFA 1BR4A 2Y3DA 5BQHA 4B6IA 3SYNA 3S84A 4BEJA 5L0JA 1LVKA 4G78A 2G3VA 3DJUB 3ABMC 1T6IA 1TWGA 3GEIA 3JSEO 4I44A 1CPRA 4NTAA 2J9VA 2R7OA 1OKKD 2VCCA 5T3TA 3AGTA 3GWLA 2O9XA 2WVOA 5HV9A 4W8PA 1IW7F 3SZRA 3FHDA 3U5SA 2VH3A 1YYXA 2JX0A 3ZQYA 1W2WA 2WZGA 3M15A 3HTKC 2XM4A 4JKVA 5HSWA 3JCUQ 3KYJA 4CBEA 1TR2A 1ZHTA 1YARO 3EGXA 2CNWA 4C7OA 3V5ZA 3NYMA 1NU7D 3CSKA 4CS7A 2QTVA 4CIPA 1AEPA 3SXMA 4DJ9A 2HJ3A 1E83A 1D1BA 3Q6NA 2HUJA 3EH2A 3O39A 4JCHA 1RKEB 3LJBA 4QI0A 4WJ0A 3U2LA 2PF4E 5AC5A 4G7OF 1E86A 3NYLA 2ZXPA 1GGQA 2YLIA 3EG9A 2A0UA 2ETSA 5L0FA 3F46A 2A69F 4C3EA 1KTMA 1TFKB 1C17M 4IWBA 2UUIA 1F1MA 3SP1A 1OQCA 1HMOA 2IXMA 4FESA 3C63A 4LERA 5F28E 5A6AA 5F5FA 1CGOA 2NSFA 2EPKX 1QSPA 4OIRF 2A6EF 4H54A 1R5ID 3U8PA 1LI7A 2G62A 3EQLF 3AG2C 3I4UA 2A68F 2YL1A 2WVNA 3L8JA 3S27A 1NFOA 1TQGA 3SXYA 2RSEB 4AL0A 2IXNA 1OR2A 5DS4A 4K7BA 1C02A 1YJGA 3GM3A 2KYHA 2NPUA 2YQYA 3EPVA 3NKEA 4G7HF 4GEHA 3RVYA 2CDQA 2B0HA 3QMKA 2XXAB 1JAFA 1FMWA 1LE2A 4BJ6C 4P9TA 2XS8A 4QDLA 4Z9IA 5COMA 1H9TA 1V54C 4LLEA 1NFNA 3C62A 3CAXA 4NTFA 2EPOA 2PX0A 2R02A 3ZC4A 2OJQA 2VCAA 2R7UA 4XQ1A 1MNEA 2IM8A 5EGYA 2P1AA 4YL3A 3DAGA 4N6HA 4MW8A 3HLZA 1QVXA 1Q0GA 2HMQA 4EIYA 4EWCA 1YZAA 1WWPA 4MS2A 1V55C 2P0NA 2J9UA 3FVYA 4JZAA 4KBLA 4PJMA 2XLMA 3HNIA 2FGYA 1BBHA 3MYFA 4K1OA 5L0GA 2OEXA 2AWCA 3H2VA 2W45A 4MW3A 4N6CA 2R7VA 4EUKB 1XWJA 4CS8C 2WZFA 5DVWA 3TK0A 3JYHA 2R25A 1OXKA 3ZTMA 5E33A 3DE9A 5A6BA 2LD6A 4U9DA 3ZIBA 5DLJA 5L0DA 3ASOC 5B1AC 2YL0A 3ZTZA 4EHPA 1Q0KA 2HV7A 3H65A 4XLNF 3LAYA 1VB5A 4BJ6A 2KJGA 4A2NB 1VTMP 2A6HF 2KW3C 3T9OA 3G50A 2QY9A 3AG4C 3HJCA 3R2PA 1SMYF 4JEBA 1FAPB 3OEOA 3WHNA 2R7RA 1Z7Qc 3NMKA 2H7VC 2IYLD 4IARA 2MYSA 3LEOA 2KSFA 5L0IA 4J32B 3US6A 3NMIA 4JVSA 1ORJA 2XXAA 1APCA 256BA 2IBFA 2VC9A 5DQTA 2R9RB 5L3QA 1HE1A 1BR1A 1JRAA 2Y69C 1K40A 2OJED 3LUTB 5T3WA 1OCOC 1D0ZA 2DGJA 2P6VA 3C8GB 4YT8A 3GORA 1OW7A 1M56C 1WN0A 2I8BA 1L3PA 5AGFA 3Q7LA 3SNHA 2DYRC 4OIQF 2EIKC 3K1IA 4XEKA 4YT4A 3FDQA 3QVYA 1T9KA 4CJOA 1TKNA 5KYWA 4ULVA 4MVMA 3DD7A 4QI2A 5D92A 1GQAA 4CS8A 1ZHWA 3JTLO 3G4ZA 2Z15A 3IHUA 4JW1A 1HE9A 4GYTA 3LNRA 2DYSC 2Y39A 3JYYA 4U5DE 3V5XA 4O6NA 4CDYA 2AU5A 2QE9A 2BC5A 2R7TA 3PCVA 2DB4A 4N4WA 4JC7A 1YA7O 1L7CA 2FAPB 2GA0A 2YVKA 3L34A 2OOCA 3B71A 1V4AA 3T4RA 3EFOA 5KYXB 2J46A 3GEEA 5A69A 3V7OA 4CDVA 1VK5A 4BEMJ 3POVA 1ZU4A 1U6HA 3S9OA 1M2VB 1WOLA 2KC3A 1N1CA 3VAYA 4E7SA
chains in the Genus database with same CATH topology
2BL2A 2DB4A 5TJ5E 2CYDA 4BEMJ 3AOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BL2 A;  2DB4 A;  5TJ5 E;  2CYD A;  4BEM J;  3AOU A; 
#chains in the Genus database with same CATH topology
 4G7Z F;  5JP7 A;  2R7W A;  2GDC A;  4ONS A;  2R03 A;  1EKY A;  4MTG A;  4JUR I;  1E84 A;  1Q0F A;  1ORS C;  2WL8 A;  4EBB A;  2WVQ A;  3TOM A;  4BPM A;  3AOU A;  3E70 C;  1Z63 A;  1ZYR F;  4L6R A;  3RF3 A;  5FZT A;  3UGP A;  2AP3 A;  5B1B C;  3JRT A;  3O55 A;  4MVO A;  1RKC A;  3K33 A;  3SXZ A;  1RXQ A;  3MBG A;  3EHN A;  4MTF A;  4PJJ A;  4DRH B;  5B3S C;  3LS1 A;  2YRF A;  4AL1 A;  3B0U X;  3MX3 A;  5KYY B;  3C8G A;  3WG7 C;  1TWH A;  3C7J A;  1AVO B;  2H7O A;  4JIO A;  4XWJ A;  1U0B B;  1FFH A;  1T01 A;  2Q7R A;  1XZP A;  4IJJ A;  1A7E A;  3KH2 A;  4AX2 A;  4CJG A;  1LPE A;  4LDR A;  3RFY A;  4C3D A;  3DJN B;  4FAP B;  4U9E A;  3QTH A;  3KPH A;  1H9G A;  2XLO A;  4R32 A;  3U9J A;  4MND A;  3X1O A;  2J9B A;  1HY5 A;  1OKK A;  1OR3 A;  4O6M A;  3AGU A;  2RD9 A;  3U3F A;  4NCQ A;  2EIN C;  4E0H A;  2YL7 A;  4I1O B;  4IAO A;  1QKR A;  1ORY A;  1OW8 A;  3MLG A;  2HFI A;  1G5Z A;  1SYQ A;  4J7Y A;  1JOG A;  3GM1 A;  2HV6 A;  4MVQ A;  3TJ5 A;  1LS4 A;  4BG0 A;  2A0B A;  3VF0 A;  2PNO A;  4ER9 A;  5A6K A;  1ZHZ A;  5KYX A;  1UFB A;  2ICW G;  3KMI A;  1BZ4 A;  3RKO F;  1AUE A;  2VAS A;  2EIL C;  4RD9 A;  3B9Q A;  1GM5 A;  1QLE C;  4U5H A;  1M2V A;  3U2M A;  1FNT c;  3EHM A;  4YT5 A;  3ZWI A;  2V3C C;  2ASR A;  1PD1 A;  5L3V A;  1IZM A;  2AWY A;  3RQE A;  3M4B A;  5B3I A;  1A7V A;  2XSE A;  1R4T A;  2L9J A;  5D91 A;  3B0V C;  1ZHY A;  3UMK A;  4JE9 A;  3W2V A;  1LS1 A;  1A0B A;  1ST6 A;  4PAC A;  2R7S A;  1YA9 A;  3U3B A;  3UR3 C;  3S28 A;  4LAC B;  2ZPA A;  2XL8 A;  3K66 A;  4JRZ A;  2YZS A;  4WGZ A;  2YHS A;  3OA1 A;  3OWT A;  4MVS A;  3B0P A;  1YZC A;  3ZSU A;  5KYY A;  4E0I A;  2QUP A;  3FMS A;  2LK4 A;  2MHR A;  2WB7 A;  1DOV A;  4DVZ A;  2F22 A;  2XLD A;  2R7Q A;  1UG7 A;  3JSZ A;  1RKE A;  3FOO A;  4W8K A;  2XL4 A;  4E7Z A;  2GWW A;  5DS6 A;  1JMW A;  5JVE A;  3LNM B;  5CI8 A;  5FCL A;  2LQG A;  3V5Y A;  4HFF B;  1PCX A;  2ZXW C;  1YAU O;  1VYI A;  3N2Z B;  4OD4 A;  1E85 A;  2LP4 A;  3ABL C;  2BE5 F;  5TJ5 E;  1O87 A;  3GOD A;  3FOP A;  3VRC A;  2I15 A;  1JPJ A;  3WOD F;  4Q5S F;  3I5P A;  4LLC A;  5IY5 C;  3DI5 A;  1M2O A;  4WAB A;  2Q9A A;  3ASN C;  2CYD A;  3AQC A;  4NY3 A;  1EA8 A;  2Y3G A;  3SEO A;  4DXW A;  3M79 A;  5E3A A;  5JSL A;  4DOZ A;  2XLH A;  2P61 A;  1D1C A;  2E87 A;  1LE4 A;  1U89 A;  2QNL A;  3NYJ A;  3J06 A;  4HFK B;  4XPW A;  2ZD9 A;  3K7D A;  4HEA J;  1JPN A;  2HSQ A;  4YN0 B;  2XRH A;  3PHF 2;  1M6T A;  3DZA A;  1J8Y F;  4YWQ A;  4KNW A;  5COF A;  3AG3 C;  4PR9 A;  1MMN A;  2Y3B A;  3DAF A;  4AK9 A;  2Q4F A;  1VLT A;  1VMA A;  2LIG A;  3H2U A;  3M1C B;  3O10 A;  4EKW A;  1D0Y A;  1WAS A;  1BR2 A;  2R05 A;  2UUH A;  1Q0D A;  2B0J A;  3CZ6 A;  2MWQ A;  4WGY A;  4M63 A;  3IPM O;  4RDA A;  2TMV P;  4JJG A;  3A9C A;  3NRH A;  1G4W R;  1ZU5 A;  3NMJ A;  1GS9 A;  4JTC B;  3HKK A;  1OW6 A;  3EH1 A;  4X0R A;  3VYW A;  4DBQ A;  4U5F E;  3IQ6 A;  1FTS A;  4MVR A;  2J8W A;  3X2Q C;  3ATP A;  4IGG A;  2LSE A;  4AE4 B;  2J0W A;  4YJW A;  1XZQ A;  4O79 A;  1NSG B;  1HMD A;  4PK4 A;  5JUA A;  1G4U S;  4KC9 A;  3TQO A;  1PV3 A;  3RQF A;  2XLW A;  5GPG B;  5F5H A;  3AG1 C;  3UGO A;  2HKV A;  4Z9H A;  2V26 A;  2JPU A;  1MMD A;  2G3K A;  1S7Z A;  3PDM P;  1ZW3 A;  4XPY A;  4P6I C;  4DBR A;  3Q7G A;  3EZI A;  4I3M A;  2L6F A;  1Z3I X;  2KNH A;  1TFO B;  3DM5 A;  2CNW D;  2GFH A;  4IRU A;  3QW0 A;  4JTA B;  4XTK A;  2AVK A;  4XPX A;  5K0I A;  4OIP F;  4YK5 A;  4CIH A;  3VM6 A;  3UMH A;  3ABK C;  4PJN A;  1I4Z A;  5BQG A;  4BJ5 C;  1JR8 A;  3SXK A;  3FAP B;  2PFD A;  2J0X A;  5EHH A;  1SZI A;  4H4K C;  2H7B A;  1SF8 A;  3FXH A;  4U5C E;  4RBN A;  4XLP F;  3QZC A;  1K05 A;  3LLI A;  1MQV A;  2NUP B;  5KYU B;  4ULW A;  3W2W A;  4N06 A;  2LFF A;  4YL1 A;  2KGO A;  3TD7 A;  1T6Q A;  1TWC A;  2LCH A;  2LFD A;  3TUL A;  1OCR C;  1YLM A;  4JJF A;  4YL0 A;  3EJN A;  2HZ8 A;  1I5N A;  1RJ9 B;  4GQH A;  4U5B E;  5E2Q A;  3T6J A;  3LS0 A;  3K1H A;  4LDQ A;  3C18 A;  3L8I A;  1Y6D A;  3ZQV A;  4EBJ A;  4A4A A;  5AC4 A;  3L0I A;  1YVI A;  1T6U A;  2NUT B;  2OU6 A;  1MND A;  1WGW A;  2HS5 A;  4CS9 C;  3TOL A;  2GAQ A;  2YL3 A;  3JT1 A;  2J45 A;  4NC3 A;  2XLV A;  2VCB A;  3ZG1 A;  2EPL X;  1YYJ A;  4KNV A;  5E3C A;  4AE4 A;  4CDA A;  2XL6 A;  2WZL A;  2EIJ C;  1MMG A;  1QZX A;  1ZW2 A;  5JT4 A;  3HNK A;  2QLA A;  3QVZ A;  3N24 A;  3K6B A;  1KNY A;  3WAQ A;  1O5H A;  4PJL A;  4BJ5 A;  3DMD A;  4LDK A;  4BJT A;  2P7V A;  2YKZ A;  2PBE A;  2YLD A;  1M57 C;  3E9V A;  3EGD B;  1OXB A;  2XLE A;  3GM2 A;  2OKU A;  2CCY A;  4ZLC A;  1LKX A;  4U5E E;  5T1D B;  3DE8 A;  2J7P D;  3BRJ A;  4FX5 A;  1FMV A;  1ZHX A;  1KU2 A;  3BEH A;  2YEV A;  3W8I A;  2R7X A;  1LI5 A;  3RQG A;  1VYK A;  2OQM A;  1EI7 A;  4Q7C A;  2YLG A;  4BJ1 A;  1J8M F;  2L6G A;  3FAJ A;  1Z5Z A;  3L1M A;  2L7A A;  4PFO A;  1RCP A;  4Z9J A;  2X0C A;  1OCC C;  4K0D A;  3RW0 A;  4IB4 A;  2W4M A;  3HNL A;  2W9Y A;  4J30 B;  2IOQ A;  4ZLD A;  3B29 A;  2NSG A;  2YWA A;  3RIP A;  5KYU A;  1Y4C A;  2NUP A;  3C8Z A;  1Z23 A;  3EZH A;  3LLK A;  2A1D D;  2OEV A;  4FWV A;  4JTD B;  3AQB A;  4I1M A;  4CS9 A;  5A6J A;  5A6B D;  2HJM A;  3JRM O;  3O6X A;  2Q00 A;  4OIO F;  3R7C A;  1NLX A;  2XM0 A;  1VOM A;  4CSA C;  2ZXR A;  3DM9 B;  2KQ9 A;  2DI3 A;  3IQC A;  5CI9 A;  5BUO A;  1RJ9 A;  5JLI A;  4JEA A;  1O3U A;  4G0H A;  5KYW B;  3NDB B;  1OCZ C;  2NUT A;  2J7P A;  4MQ9 F;  4P9F A;  3U0C A;  1NZE A;  1D1A A;  3NKD A;  3GWN A;  4NTB A;  2OCC C;  4J7T A;  2C04 A;  2FFH A;  2C03 A;  1V74 B;  3RVZ A;  3W4Y A;  3W8H A;  2HMZ A;  2OG2 A;  3ITF A;  5BQI A;  1FR0 A;  4O7G A;  4CX9 A;  5CIV A;  4YT2 A;  3I5Q A;  3K1I C;  4E17 A;  1ZZP A;  2EPM X;  3DWW A;  2HSB A;  1K04 A;  1H6G A;  1PD0 A;  2Y3H A;  3IEE A;  4OD5 A;  1A7D A;  4IAQ A;  3HNJ A;  3EGD A;  3LES A;  1VLS A;  4HE8 D;  4U5G A;  3EFO B;  3LEV A;  3M4C A;  3KL4 A;  2ZXO A;  4XEF A;  3T6G B;  2BL2 A;  2D5R B;  3ECS A;  2J9W A;  2H8A A;  3KYI A;  1D0X A;  1FFT C;  1C03 A;  2Q3T A;  3U8V A;  5JS5 A;  3MYI A;  5DS5 A;  2PP4 A;  4OIN F;  2NG1 A;  3TJ6 A;  1ZVZ A;  3F47 A;  3NG1 A;  4DRI B;  2L6H A;  3KKB A;  4MVU A;  3Q6M A;  3AJM A;  3UNG C;  4O6Y A;  4CSA A;  4KI2 A;  1CGM E;  5JRA A;  1CPQ A;  5COG A;  3RH3 A;  5L0C A;  3UMI A;  1G8X A;  1LM3 B;  3ZVR A;  4Q4Z F;  2CGE A;  1CGN A;  5L0H A;  4ANJ A;  1BDJ B;  3QW1 A;  2M4E A;  1QPU A;  2CW0 F;  2L81 A;  4MTO A;  1T5O A;  4DRJ B;  3EGX B;  1YDI A;  1Q0M A;  2EIM C;  3CQZ A;  4C7O B;  1NBB A;  1I4Y A;  1NU9 C;  1SR2 A;  5EK0 A;  3ZDL A;  3GAN A;  3IQT A;  2EPN A;  3U9M A;  1WTY A;  2M64 A;  3A11 A;  1HW1 A;  4XEV A;  4D4N A;  3G4X A;  3JZ0 A;  4UDV A;  3PMR A;  4DVY P;  3MFN A;  1E2X A;  1A41 A;  1S05 A;  3CEX A;  3EG9 B;  5KYN A;  2PX3 A;  2D4U A;  1Z6A A;  3DKA A;  1TWA A;  2VB6 A;  5DQZ A;  1RMV A;  1NG1 A;  4F4B A;  2W4B A;  3S0X A;  3S29 A;  3DXJ F;  1LIH A;  3GEH A;  2Q9C A;  1WAT A;  4JCZ A;  2JD3 A;  2XS1 A;  4PFP A;  2Q9B A;  4E18 A;  3C8G D;  3S90 A;  1HW2 A;  1MMA A;  1B68 A;  2KK1 A;  1EQ1 A;  1DOW A;  4C3B A;  2IXO A;  3RYL A;  1H7I A;  2X51 A;  4MVZ A;  4D4X A;  2IXP A;  3IQ5 A;  3T6B A;  4EBK A;  1QQ3 A;  3N0T A;  4NQF A;  1BR4 A;  2Y3D A;  5BQH A;  4B6I A;  3SYN A;  3S84 A;  4BEJ A;  5L0J A;  1LVK A;  4G78 A;  2G3V A;  3DJU B;  3ABM C;  1T6I A;  1TWG A;  3GEI A;  3JSE O;  4I44 A;  1CPR A;  4NTA A;  2J9V A;  2R7O A;  1OKK D;  2VCC A;  5T3T A;  3AGT A;  3GWL A;  2O9X A;  2WVO A;  5HV9 A;  4W8P A;  1IW7 F;  3SZR A;  3FHD A;  3U5S A;  2VH3 A;  1YYX A;  2JX0 A;  3ZQY A;  1W2W A;  2WZG A;  3M15 A;  3HTK C;  2XM4 A;  4JKV A;  5HSW A;  3JCU Q;  3KYJ A;  4CBE A;  1TR2 A;  1ZHT A;  1YAR O;  3EGX A;  2CNW A;  4C7O A;  3V5Z A;  3NYM A;  1NU7 D;  3CSK A;  4CS7 A;  2QTV A;  4CIP A;  1AEP A;  3SXM A;  4DJ9 A;  2HJ3 A;  1E83 A;  1D1B A;  3Q6N A;  2HUJ A;  3EH2 A;  3O39 A;  4JCH A;  1RKE B;  3LJB A;  4QI0 A;  4WJ0 A;  3U2L A;  2PF4 E;  5AC5 A;  4G7O F;  1E86 A;  3NYL A;  2ZXP A;  1GGQ A;  2YLI A;  3EG9 A;  2A0U A;  2ETS A;  5L0F A;  3F46 A;  2A69 F;  4C3E A;  1KTM A;  1TFK B;  1C17 M;  4IWB A;  2UUI A;  1F1M A;  3SP1 A;  1OQC A;  1HMO A;  2IXM A;  4FES A;  3C63 A;  4LER A;  5F28 E;  5A6A A;  5F5F A;  1CGO A;  2NSF A;  2EPK X;  1QSP A;  4OIR F;  2A6E F;  4H54 A;  1R5I D;  3U8P A;  1LI7 A;  2G62 A;  3EQL F;  3AG2 C;  3I4U A;  2A68 F;  2YL1 A;  2WVN A;  3L8J A;  3S27 A;  1NFO A;  1TQG A;  3SXY A;  2RSE B;  4AL0 A;  2IXN A;  1OR2 A;  5DS4 A;  4K7B A;  1C02 A;  1YJG A;  3GM3 A;  2KYH A;  2NPU A;  2YQY A;  3EPV A;  3NKE A;  4G7H F;  4GEH A;  3RVY A;  2CDQ A;  2B0H A;  3QMK A;  2XXA B;  1JAF A;  1FMW A;  1LE2 A;  4BJ6 C;  4P9T A;  2XS8 A;  4QDL A;  4Z9I A;  5COM A;  1H9T A;  1V54 C;  4LLE A;  1NFN A;  3C62 A;  3CAX A;  4NTF A;  2EPO A;  2PX0 A;  2R02 A;  3ZC4 A;  2OJQ A;  2VCA A;  2R7U A;  4XQ1 A;  1MNE A;  2IM8 A;  5EGY A;  2P1A A;  4YL3 A;  3DAG A;  4N6H A;  4MW8 A;  3HLZ A;  1QVX A;  1Q0G A;  2HMQ A;  4EIY A;  4EWC A;  1YZA A;  1WWP A;  4MS2 A;  1V55 C;  2P0N A;  2J9U A;  3FVY A;  4JZA A;  4KBL A;  4PJM A;  2XLM A;  3HNI A;  2FGY A;  1BBH A;  3MYF A;  4K1O A;  5L0G A;  2OEX A;  2AWC A;  3H2V A;  2W45 A;  4MW3 A;  4N6C A;  2R7V A;  4EUK B;  1XWJ A;  4CS8 C;  2WZF A;  5DVW A;  3TK0 A;  3JYH A;  2R25 A;  1OXK A;  3ZTM A;  5E33 A;  3DE9 A;  5A6B A;  2LD6 A;  4U9D A;  3ZIB A;  5DLJ A;  5L0D A;  3ASO C;  5B1A C;  2YL0 A;  3ZTZ A;  4EHP A;  1Q0K A;  2HV7 A;  3H65 A;  4XLN F;  3LAY A;  1VB5 A;  4BJ6 A;  2KJG A;  4A2N B;  1VTM P;  2A6H F;  2KW3 C;  3T9O A;  3G50 A;  2QY9 A;  3AG4 C;  3HJC A;  3R2P A;  1SMY F;  4JEB A;  1FAP B;  3OEO A;  3WHN A;  2R7R A;  1Z7Q c;  3NMK A;  2H7V C;  2IYL D;  4IAR A;  2MYS A;  3LEO A;  2KSF A;  5L0I A;  4J32 B;  3US6 A;  3NMI A;  4JVS A;  1ORJ A;  2XXA A;  1APC A;  256B A;  2IBF A;  2VC9 A;  5DQT A;  2R9R B;  5L3Q A;  1HE1 A;  1BR1 A;  1JRA A;  2Y69 C;  1K40 A;  2OJE D;  3LUT B;  5T3W A;  1OCO C;  1D0Z A;  2DGJ A;  2P6V A;  3C8G B;  4YT8 A;  3GOR A;  1OW7 A;  1M56 C;  1WN0 A;  2I8B A;  1L3P A;  5AGF A;  3Q7L A;  3SNH A;  2DYR C;  4OIQ F;  2EIK C;  3K1I A;  4XEK A;  4YT4 A;  3FDQ A;  3QVY A;  1T9K A;  4CJO A;  1TKN A;  5KYW A;  4ULV A;  4MVM A;  3DD7 A;  4QI2 A;  5D92 A;  1GQA A;  4CS8 A;  1ZHW A;  3JTL O;  3G4Z A;  2Z15 A;  3IHU A;  4JW1 A;  1HE9 A;  4GYT A;  3LNR A;  2DYS C;  2Y39 A;  3JYY A;  4U5D E;  3V5X A;  4O6N A;  4CDY A;  2AU5 A;  2QE9 A;  2BC5 A;  2R7T A;  3PCV A;  2DB4 A;  4N4W A;  4JC7 A;  1YA7 O;  1L7C A;  2FAP B;  2GA0 A;  2YVK A;  3L34 A;  2OOC A;  3B71 A;  1V4A A;  3T4R A;  3EFO A;  5KYX B;  2J46 A;  3GEE A;  5A69 A;  3V7O A;  4CDV A;  1VK5 A;  4BEM J;  3POV A;  1ZU4 A;  1U6H A;  3S9O A;  1M2V B;  1WOL A;  2KC3 A;  1N1C A;  3VAY A;  4E7S A; 
#chains in the Genus database with same CATH homology
 2BL2 A;  2DB4 A;  5TJ5 E;  2CYD A;  4BEM J;  3AOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...