2XXAB

The crystal structure of the signal recognition particle (srp) in complex with its receptor(sr)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
283
structure length
283
Chain Sequence
ISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFARED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Signal Recognition Particle in Complex with its Receptor.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Protein transport
molecule keywords SIGNAL RECOGNITION PARTICLE PROTEIN
total genus 82
structure length 283
sequence length 283
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00448 SRP54 SRP54-type protein, GTPase domain
B PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2xxaB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xxaB02
4BPBA 1G291 3H0KA 2R44A 1GM5A 1G5RA 4WW0A 4A15A 4FWIB 1VKJA 1DG1G 1UFQA 2OO7A 5TXGA 1SKQA 1IN8A 4DCSA 2OFWA 1CS4C 1KO7A 2PJZA 1E1RD 1N0UA 3WRYC 1OFHA 1P6XA 2YWEA 1JB1A 2EFHB 2HLDD 1GKUB 3SYLA 4AK9A 4ZI2A 2GK7A 4RZ2A 3V4FA 4YMWA 5EUQB 1JI0A 1Q20A 4IFBA 1XX6A 3K9GA 2WJJA 4B43A 1R0ZA 4E22A 3SFZA 4MYUA 5DI3A 1NLZA 2GWHA 1KK1A 2GA8A 2ZRFA 4GT1A 2F55A 4PO1A 2HYDA 4RD1A 4O0MA 2PT7A 4KI0A 4MA4A 1P2TA 4BFWA 4I99A 1ZIOA 4HZUA 5IT5A 2W2TA 4QGFA 3B9QA 1Z0KA 2DYKA 2GCNA 3M0EA 4Q4HB 4AYWA 4Q1FA 2OE2A 1FMLA 4MITA 3QXJA 4P3YA 1DAKA 5E7JA 4I1SA 4XJXA 4PC7A 4L8GA 1XMVA 4HDQB 4HAUA 4C0JA 3DZ8A 1N25A 4FXPA 5A0FA 1NN5A 3NDPA 3PCRB 3UG7A 5F98A 4DB2A 3B85A 3X2SA 3TLXA 2V7QD 1OIVA 2AN9A 3U3RA 2OCYC 1S4QA 5JS8A 5JSZA 4OHYA 1ODFA 2GXSA 3THYB 2ZI5A 4V02A 2IHBA 2OXCA 1CU1A 1IBRA 2ZREA 4MRNA 1AM4D 1R5NA 4S35A 2IF0A 1CR2A 3IILA 4URVR 1QF9A 1SXJD 1ZVQA 1IY1A 4LV5B 2P6RA 2XSZD 3PEUA 3LBHA 2REOA 1R5BA 2W6IA 4HAXA 4P32A 1P73A 1YJ5A 2G1JA 1Z6TA 2VEDA 2BBWA 4TLCA 1LF5A 2C96A 4NE2A 1Z0DA 3LAWA 3OIWA 4IXMA 3SJAA 8OHMA 1X6VA 4C0AC 5F3WB 2JEOA 2FSFA 1Z29A 3KJGA 4Z8YA 4G5GA 1N2CE 2QAGA 5DISB 4P4SB 1KMHB 3B2EA 2JLRA 3EXAA 4M9ZA 1GNPA 1W4CA 4YONB 5HTKA 4URWR 3EW9A 1KOFA 3IDQA 2CNWA 1N3BA 1KO1A 4JJZA 1FTSA 4HLUA 4QXAA 4Q9HA 3R8CA 2JLYA 5KDDA 2QBYB 1L8QA 4RCZA 4LSGA 2CHGA 4YMUA 3VNVA 1X8KA 4PAQA 1IAQA 4OHVA 1QBKC 1TF2A 4HATA 2GXAA 5GJBA 4PX9A 5HE9A 3T1QA 3WP0A 3U6BA 4AKGA 2J87A 4B44A 2C95A 3IIMA 3LBNA 1PUJA 1TUEA 3EPLA 1R4AA 3SS8A 5K8TA 5JJIA 1XEFA 3QG5A 1YZUA 1UM8A 3V4RA 1W36C 4AYTA 1FX0A 3SNHA 2WPDA 1ZNXA 4Z54A 5J4YA 4XWAA 2C9YA 3IIKA 1H8HD 2ZE7A 3W5IA 2R6DA 1G6HA 1KI8A 3RRMA 2HV8A 4NTZA 4LHWA 1DAFA 1BOFA 1OXSC 2CMKA 3REGA 3EPHA 1AQYA 2V55B 3SDZA 3CWQA 4B3DA 3LVQE 1KKLA 1I2DA 5JECA 1JR6A 3L2OB 2PCLA 3EWAA 4BZQA 2YVUA 1KI7A 1U9IC 1QVRA 2R8RA 3RWMB 1JJVA 5C18A 3CO5A 1G7SA 3KQHA 2J3EA 1Z2AA 5FTNA 3SN6A 4Q03A 1VG9B 1ZJ6A 4LV8B 2PJRA 2Z43A 2WTUA 5EZ5A 3B78A 3GLIE 1S3SA 4ZIRB 4QNRA 4WZ6A 2ATVA 2IYLD 1U0JA 2G1KA 4M9SA 4DLRA 2H5EA 2WKRA 4PC6A 1OXTA 3U44B 1OKKD 1IN5A 3PIRA 4Q1DA 1W5TA 1SZPA 1YR7A 4JLNA 4IVRA 1GRNA 4HAYA 3JVUA 3Q72A 2P6UA 1XTQA 2KBFA 1W46A 2NQ2C 4HAVA 3TVDA 4E03A 5B58C 2EWVA 2EFCB 4NYIR 1M8PA 1E9AA 3W9YA 2GJ9A 3VX3A 2C04A 1G5TA 1E9CA 3GEIA 4HYYA 5HZHA 1KK0A 2QZ4A 2GCOB 4TL7A 2UVQA 3SZRA 1F2UB 1YZTA 5E3HA 1KDPA 3OFND 5J4VA 5L3RA 4MUAA 3IEUA 1UKZA 1G21E 3GJ7A 3ZGXA 3ZD6A 1G64A 1SVWA 2Q21A 2WICA 3G5UA 4TL9A 5KU1A 1XRJA 2OXRA 5D3MB 1XXHB 3HJNA 4QGHA 2EFDB 5FPKA 3ZVLA 1G4UR 1W0KD 1OJLA 4X8HA 1FNMA 2B92A 3GJ8A 2IUUA 2WSSD 1W4RA 1OHHA 2J7PA 3SBEA 4QOSA 4A4DA 1XPRA 3IO5A 4TTRA 4DLZA 3CZPA 5JZVA 1KI6B 5DGXA 1OF1A 4LYHA 3ZZ0A 3I62A 3O8CA 4HUQB 5KSZA 1FL9A 1LS1A 3UWKA 1D9ZA 2JJ8A 1CBUA 1X3SA 4LBYA 3LXRA 4KO8A 1JR3E 2FFBA 3C15C 4A2WA 4ON9A 1GITA 3K70C 4EIWA 2CXXA 2IYRA 2GESA 3K0FA 4NPHA 4TLBA 4LJ6A 2PZEA 2ONKA 4JLBA 1DAIA 3FYHA 3AB3A 421PA 4TT3D 1G3IA 4UNNA 5EE9A 4B71A 2UZ3A 1S1CA 4RD6A 1KNQA 4FCVA 3DVLA 2CJWA 3OESA 4MRSA 5F9FA 2IBMA 1XTSA 2DFLA 4ZDKA 4CGZA 2MSDB 3JZAA 4PHHA 3LH5A 1TU3A 4GL2A 5BN3A 2FU5C 3RLFA 3WNDA 2X2EA 4YDHB 5F2EA 4HAZA 1Z47A 2OCPA 3J81k 1SKYE 1CR4A 1WDTA 1YE8A 3K0SA 4CT4B 4R7ZA 5KHOC 5HZKA 2XJ9A 5AJYA 1PLKA 1NJFA 2DY1A 3MAAC 4Q7MB 5TDHA 5B57C 4GZMA 4LWZA 2ZYUX 1MV5A 2GAOA 2QSYA 4FW9A 4LJ5A 2BM1A 2J46A 4OQNA 4RZXA 3E2IA 2A3RA 4JVMA 1QVAA 3I3SR 2XB4A 2QMEA 3DMNA 3K0AB 1HEIA 4ZKEA 1N0WA 2JASA 4CEHA 2ZRGA 3EG5A 1IJEA 1E98A 5FI1B 2GBLC 5DYIA 1YRBA 5JJLA 1N5KA 1LB1B 1P60A 3LO5A 2VP4A 5EE0A 3FTQA 5C1BA 4TMZA 4DEYA 1E99A 4QL3A 4CIDA 2A30A 3TJZA 4BEBA 5KDOA 1G3QA 4Q18A 4Q9LA 4PXAA 1KI3A 3PUYA 2WWIA 4Q4LA 3FHOA 3ZH9B 3FE2A 4EFNA 2ZVQX 5FUYA 3DKVA 1CJMA 1WBBA 4PANA 1KO4A 1T6NA 2X1VA 3TR5A 2LCFA 1GKYA 4JJKA 5FTKA 3X1ZA 4BLQA 4DB4A 5DYGA 4BFYA 2WJHA 4XH9B 3ICQB 1CTQA 1G19A 4KJZA 4Q4AA 3Q85A 2PZGA 3GJ3A 4HB2A 4PQRA 3TSWA 4CEJA 1A5TA 3LA6A 2CVFA 3PVSA 3GJ5A 2F9MA 5ANRB 3RS2A 2DPXA 2QEQA 5KNCA 1JXMA 1P5ZB 2VF7A 3KJIA 3GJ6A 2A9KA 2H1LA 2QAGC 4GFDA 4NMMA 4JT2A 1E2FA 2QBYA 3U7FB 2VP5A 1U8YA 3BC1A 2PBRA 4WVFA 3AVPA 1VYTA 2O0KA 3THYA 4ZI3A 1ZM4A 1KAOA 4IDOA 2KJQA 3H1TA 3X1XA 3GEEA 1E69A 2YOGA 3F3YA 1G3RA 3I72A 4LBVA 3QSYA 4D25A 4JLJA 1CR0A 3AP1A 4Q4AB 5HKKD 4TMVA 1ZP6A 2XZLA 4RZ3A 2VL7A 4KSBA 5L3QA 4MUBA 2QUZA 3ADBA 3MUFA 2V4ZA 4LBZA 3TUZC 2VQSA 3MGCA 4V0ME 4KAXA 3TRFA 4B2PA 2EFEB 3ZS9A 2D7DA 3C41J 3QF7A 4QFMA 5DN6D 1LNZA 4CRWB 3WBKA 1W7AA 5HKKA 1ANKA 1W0JD 1W49A 2WMOB 3IPYA 1E0KA 2EYUA 3E1SA 4Q4JB 5L3QB 2JLWA 2WV9A 1DS6A 1YZGA 2W0MA 3IIJA 3CWZA 2HJVA 3VR1A 1R10A 3UMSA 1E2KA 1E9EA 1WGWA 2CLDX 1P61B 2GVZC 4BZXA 1OE0A 5JCZA 3BORA 1B23P 2O8BA 3ZQJA 4IFEA 2VPPA 4PC3A 1GRRA 3CR7A 3H2YA 4LHXA 3U6KA 2C98A 2FPMA 1IN6A 3CX6A 1Z3IX 1ZNZA 1ZC4A 2DB3A 1TQ2A 3QXXA 1Q57A 4KU4A 5FUWA 4DKXA 3U7HB 1Q3HA 4QM7A 3CRRA 1KK3A 4OYHA 1R0WA 2FSGA 2FFHA 2VH5R 2O8FA 1NIJA 3UMRA 3QEOA 5AWFC 5FR2A 3VHXA 2Q9AA 4US1R 4US2R 3W6OA 3PEWA 3DO6A 4X8OA 4JL8A 2FWRA 3BBPA 3K8YA 1NL3A 3QKTA 3CONA 3LNCA 2VBCA 3SFVA 1SXJB 1XTKA 2NO0A 5TMPA 2I3BA 1SVSA 4BGDA 1FP7A 1MOZA 2IL1A 4KXFB 1T3LA 2VLIA 2HYIC 2O0HA 3DL0A 1N5LA 3ZYCA 3KQLA 2FG5A 1UJ2A 2C77A 3PEVA 1WE2A 1G8FA 521PA 4G5QA 5AUOB 1V43A 1O3YA 5JWOA 5H1YA 3AGPA 2ZI6A 1LF0A 4OQXA 1YU9A 2CHVA 3NBYC 2O8EB 1D2MA 1NY6A 4M2LA 3RS3A 3TNFA 4Z8XA 1T0HB 3NBXX 1FNNA 4TQ9A 1E4YA 1ZW6A 3QKRB 2F1HA 2IYYA 2RKOA 2GNOA 4RY2A 5EXSA 1SXJC 4KLNA 1NVWQ 2GZAA 1M2OB 4YC7A 3L8ZA 5G3YA 1BYIA 1YKSA 3RC3A 3TUJC 2A2ZA 1JBKA 2MMCA 4IOKA 2IYVA 4D0GA 1FFHA 2NTYC 4OK3A 3G0HA 1KDRA 2AHOA 2LWIA 3D3QA 4LHZA 5FBLB 1W2GA 3EZ9A 2WJVA 1SVLA 2RGCA 3OEHD 4NCIA 4Q47A 4JKIA 1QHGA 3A4MA 2RHMA 1CKEA 4TN1A 2O8EA 1T3HA 2FSHA 1NN0A 2UKDA 3ECCA 3THXB 3K09C 4NP6A 3IO3A 1KSHA 3V9PA 3AGQA 3EASA 4DDUA 1TEXA 1F2TB 3EC1A 4Z1MD 2JLQA 4R2IA 4IEIA 4M1WA 2GVDC 5KSOA 4JVNA 2AFIE 3SJCA 1KHTA 3P1JA 2CDNA 3M6AA 4M1SA 2ZETA 4GOXA 5FPYA 1P2VA 2P5SA 1OH6A 2P67A 1DAGA 2XXAA 1DE0A 2REBA 3HPQA 2OCBA 1VIAA 1Q21A 3SR0A 2ZE8A 2SHKA 1TNDA 5HE8A 1Z6AA 3TAHA 4X8MA 1HT2E 1OXVA 2ZSDA 1K5DA 3LLMA 3C16C 1KI4A 5CM8B 2ZTSA 3O47A 3HR8A 2NO6A 4IDNA 1U9IA 4O25A 3ZIAD 2H8KA 2ZAMA 1G41A 2ORVA 4JBXA 4TMTA 2ONJA 3QBVA 3IQWA 1DBSA 3P4XA 3TUIC 3UXMA 2XGJA 1N0VC 5CIWA 1JXOA 1W5SA 4DCUA 4DSOA 2G83A 3OE7D 2IW3A 4O2RA 2Z83A 1VPLA 3HPRA 4B73A 4D26A 4LDJA 5CJ2A 4Q02A 4LY6A 4JT4A 4ACBA 1LS6A 2BIFA 4AKEA 1SQ5A 4U7DA 4P31A 1TQDA 2C8VA 2WSSA 4B6FA 2P6NA 2V1UA 1E9RA 1X1RA 2QAGB 5CYOA 1TQ4A 2IYXA 2CCJA 2KI5A 3NTUA 1XTRA 4P4TA 1KMHA 3T1OA 2G9NA 4FMCB 4UNPA 3AVUA 1DARA 1GFIA 4NKRA 4G5RA 4Q9IA 4ASUA 4UJ3A 1W2HA 4BUJA 2XB2A 3ZQ6A 2AFHE 2IT1A 1HURA 3MWYW 3KKOA 3TW4A 1U0LA 4DJTA 3CRVA 1ZUIA 2ZM5A 3VKWA 1E2NA 1XMSA 4LJ7A 4F92B 4AG6A 3E70C 2ZU6A 4HLCA 1HTWA 2QU8A 1G8PA 2FPKA 4K8OA 4OI1A 1LTQA 1ZUHA 5LD2C 2GEDA 2BJVA 4C4PA 5FPSA 3QKUA 2VHCA 4RD0A 1E94E 1W47A 4Q4JA 2J0UA 3AF1A 5HPYB 1CLUA 1IN7A 1FZQA 2Q3HA 2G0TA 3CUEF 1HUQA 1XMIA 4G1UC 3KTAA 2HXSA 3VNUA 3DHWC 2CL7X 2PMKA 3QVVA 1H8EA 3DMDA 3TAUA 4A2QA 4EPXA 2J0VA 1QDEA 1XTIA 2RH5A 3KL4A 2CBZA 1CIPA 1YRAA 3AVVA 4YQFA 2CCGA 1UKVY 1JPJA 5JWRA 3C8UA 1SXJE 1XP8A 2OM2A 1G18A 4MGZR 3SEAA 3DKPA 1DELA 1XF9A 1D2NA 4Q21A 3IQXA 3L0IB 1KK2A 2ZSFA 1KDOA 1FQKA 3D31A 4LCBA 2NG1A 2QL6A 3I92A 1BMFD 1Z2CA 2A5FA 2E1RA 2CL6X 3CPHA 1JAHA 1ZYUA 4DUGD 4BE7B 2QTFA 4PO8A 2I1VB 3FKSD 4TQUS 3IUYA 3RRZA 3GJ0A 1PUIA 3WYAA 2G0NA 2AD5A 1WQ1R 5L3SB 3GD7A 1LVGA 1COWA 2P65A 2IA5A 1FQJA 2R6FA 5CJPA 1ZRHA 2VSFA 2B8WA 4PZLA 4FIDA 1L7VC 2OESA 3BFVA 3T12A 4YXWA 4PPNA 4W5WA 4NBSA 3IGFA 1AZTA 3OIVA 4IW3B 4W5HA 4M0LA 1J70A 4EPVA 3RRYA 1OHHD 3LX5A 1J8YF 2XJ4A 4MGIR 2GK6A 3A4NA 3R20A 1N5JA 2XOKA 2QPTA 1KSJA 3NVAA 4AYXA 1XD9A 2JDIA 5SZJA 3QF4A 3QKSA 4N1AA 1NMZA 2RHDA 4BASA 2VF8A 4II7A 1N6NA 4NCNA 5DHFA 1YR8A 3X1YA 1OH8A 1E2DA 3ZVRA 2NIPA 4TT3A 4G5SA 1P7CA 4GP6A 1ZM3A 2RB4A 3RAPR 4A6XA 4AC9A 3FHTA 4CEIB 2RGXA 2R65A 3EIHA 1N6RA 1NY5A 2OEPA 4HB3A 1OXXK 4QM6A 2BKEA 1VCMA 1UBCA 3T5DA 4ASUD 4XVQA 4LGMA 4QJ4A 4EPTA 4C9BA 1N5IA 2ZQ5A 2OT3B 4MKFA 1PVOA 1Y3AA 4F4IA 2ODEA 3CB4A 3THWA 2RGAA 3QKSB 1EFTA 1RC8A 3QNUA 2QT0A 3AH8A 3BH7A 3QBTA 4WBSA 821PA 3A58B 4TQAA 3N2EA 4ZO4A 4Q48A 1TUIA 1NBMA 1RPZA 2TMKA 3CNOA 3LV8A 5J40A 3SU8A 2WOOA 4GSYA 1IOZA 3SHFA 3C4JA 2WAXA 5JMTA 2G6BA 4CF7A 2ZPTX 2ZRHA 2ZEJA 2QAJA 2XNDA 1J90A 3WP1B 3HWSA 4XVUA 3LRPA 5JEEA 1KKMA 1KGDA 1Q0UA 3GFTA 3A1UA 4UXJA 1TADA 2J41A 1XXHA 2BJWA 1A2KC 3CX7A 2EVWX 3CF0A 3X1DA 4B74A 4A36A 2ZRAA 4Y0VA 2VHQA 3B9PA 3KFVA 5E7MA 2FN4A 2OFXA 1Z28A 1E32A 3SQWA 4PSKA 4TYWA 3NG1A 3QOFA 5BWMA 3RANA 1XTJA 2QT1A 4DLXA 4US0R 4XSGA 5L3VA 4B35A 4PPGA 3GCGA 1WXQA 4LYAA 4XWKA 1QG4A 2QTVB 2ORWA 2OHFA 3LQQA 1KTVA 1U8ZA 3B13B 3PG5A 2PCJA 3DEFA 4PPFA 4Z51A 2PX3A 1JNYA 4JVSB 3U4QB 1GP2A 4PHTA 2E9SA 4ARZB 3FMOB 3CR8A 3GEHA 5LB4A 1FOEB 3QPVA 2V1XA 1DO0A 3GFOA 2AWOA 2BCJQ 1COWD 2HF9A 1FUKA 3EC2A 3UIEA 4J0QA 4JL6A 1DAMA 3B1VA 4PZYA 3N5CA 1ZM7A 1NP6A 2ZYWX 4M4SA 2FPLA 3NIBA 2AKYA 3CPJB 2P0EA 3GFPA 1X1SA 1BH2A 2REXB 1D2EA 4DSUA 1Z6GA 1AN0A 2YNMA 3RSOA 2IS4A 3U61B 1VCOA 3QENA 3FB4A 4G3XA 2F43B 5TB5A 3MWJA 3T34A 2ZJBA 3CH4B 2W6ID 4HDCA 4DEXA 1FPMA 2FZLA 4FD2A 1YZKA 1S9HA 2Z4SA 5TV2A 4RVCA 3GQBA 1QG2A 4D80A 3FOZA 2AWNA 4B6EA 2ZJ5A 5DO9A 1ZM9A 3K0AA 4S2EA 1CJKC 4OL0A 4POAA 4W5JA 3EA0A 1UDWA 2BOVA 1MT0A 2H16A 2GF0A 4UXIA 1J2JA 1YZNA 2BKUA 4G01B 1P72A 3BB1A 1EG7A 4GP7A 4B3XA 1GILA 2WWXA 3MFYA 5GVSA 2ZR9A 3OAAD 2CNWD 3OIUA 3HR7A 5BYJA 1US8B 3B1YA 1E2GA 4MKIA 4IEEA 4QBIA 2RGEA 2ZRLA 3EPKA 1PLLA 3KZ1E 2WIBA 5KSYA 4LHYA 3DPUA 3I4LA 2HT1A 2JJ2A 1T9HA 1TL7C 3U60B 3GLFE 1KNXA 2ZI3A 4K81B 1KYIA 1W44A 1XB2A 3E5HA 2WJGA 3A4LA 1G8YA 5HCIA 4BLSA 2Q3FA 3B1ZA 3JZMA 3KX2A 1KAGA 4NL4H 3IEVA 1E2IA 4LJAA 3L8YA 3B5JA 1VMAA 2A5JA 2OILA 3UPUA 5E7IA 4DBLC 4F7WA 5DN6A 1FX0B 2AK2A 4LRWA 3IBGA 3KXKA 4GZLA 1ZIPA 4AKIA 5KDLA 3MWKA 1KZ7B 5CDFA 1FW6A 3GLGA 3PEYA 2FMXA 2VP9A 3BE4A 1L4YA 4NYJR 4RZUA 4KSCA 5GJCA 1LY1A 2FFQA 4JSTA 3ADCA 3K0CA 3ZZUA 4JS0A 1KIMA 2ZYTX 2KBEA 4GBMA 2K5UA 2FA9A 5FR1A 3SYNA 4ZDWA 4MGKR 5AUNB 4ZCLA 2O8CB 4Q66C 2N1BA 3B8HA 2QP4A 4TSFA 3I8SA 1X8JA 3I32A 4JIMA 4B3FX 4WZAE 4DLYA 2QM7A 4M9XA 5TVKA 3M1IA 4A1FA 1Z07A 1RRFA 3CRW1 3W90A 4A82A 1KJYA 1YR9A 5H70A 2KSQA 4XOIA 4C0LA 5EXPA 3AVQA 3FHCB 4A2PA 3QY0A 1FTNA 1XD2B 1R0YA 3UK6A 4PQFA 3TGPA 2YOHA 1XMJA 1ELOA 4P4UA 3UMFA 1GKIA 4DSTA 4CEIA 2ZRJA 1NNEA 5JHGB 3LY5A 2WWYA 3NXSA 4HDOB 3HU3A 4TTPA 2YHSA 5G53C 2HLDA 2QY9A 2EFGA 1QZXA 4PR0A 3RWOA 621PA 3GLGE 1WRBA 5J4KA 3RS4A 5CDFE 2X8AA 4FI3C 1MKYA 2ZUCA 1DTSA 5UKDA 3T06B 2AXNA 4A8JC 2V6IA 1NVVQ 2ATXA 4WOPA 4XD7D 2F1RA 4NYMR 5EE5B 3RNLA 3U7GA 1Q1EA 3PR1A 1U8AA 3QVUA 5IRCD 3KQKA 2XNSA 4OQLA 3ZD7A 3CH5A 2GCPA 2WKPA 1CF4A 4HLQB 5EZ6B 3RS5A 4IHQA 3AF4A 3B1WA 1S8FA 3AVXA 5KPJA 2A5YB 2YC4C 3FMFA 4EPWA 3TE6A 5JEDA 3BH0A 1WMSA 1KJWA 1ZBDA 1KO8A 1M1YE 3BGWA 1HH4A 5DNYB 3SC3A 5JRJA 4HAWA 2RGGA 3QF4B 4BQSA 5IK2A 4BFSA 3W8NA 3W6NA 4F38A 4IVQA 2AKAB 3SHWA 5SZKB 2I1QA 4JKYA 1ZU5A 1U99A 1TPZA 3NHAA 4HSEA 4N0DA 2NO1A 4A8JB 3KJEA 3ZDQA 3NH6A 1OT3A 2PEYA 2ORIA 2CLSA 2EYQA 4B47A 1P9RA 5J4LA 2J9RA 3M4YA 1VG1A 2O8DB 2ZS7A 4CEJB 5CLQA 2ZRCA 2BVNA 3AF3A 1KSGA 4U5XA 5IHPA 2GXUA 3AVYA 1I2MA 1OW3B 2VTKA 4ARZA 1Z5ZA 2OAP1 4CW7A 1E2JA 2FGJA 4A0GA 2AX4A 2RGNA 2R62A 4TYYA 2QG6A 3BH6A 2F9LA 4PSAA 4HI0E 4W9MC 2F6RA 5JI3E 2CHQA 2GF9A 1RRGA 2ZI4A 3K53A 1E3MA 4A9AA 2NZJA 1R6BX 2ZE6A 5GJWC 2OBLA 1P75A 5L8VA 1Y63A 2W2VA 2DFNA 2C9OA 2KWIA 1NVVR 4ILEA 1MR3F 3I1FA 1GAJA 2QNRA 4PPQA 1PLJA 4D0NA 1U2RA 3A1WA 1AJEA 5LDDC 3CKLA 2ZRNA 2IS6A 3THXA 1MO4A 4C0BA 2PEZA 3KKMA 4M8NE 4RD3A 2FJUA 3FDIA 4NH0A 1VCNA 1ZCBA 3D8BA 1ZINA 2GJAA 2QE7D 4A92A 2D7CA 1AKYA 4M22A 3C5HA 4GMXA 3ADDA 1MRNA 3BFXA 5B64A 5HR5A 2NZ8A 1EFHA 1E2QA 2H17A 1SHKA 5J4HA 1KI9A 2IHYA 5DLQC 1VECA 2IUTA 2ZSEA 4RD4A 1HYQA 2DWOA 3OEED 2GDJA 3U4QA 2BDTA 2WHXA 3PQCA 1A2BA 4L15A 1XEWY 3IHLA 1EX6A 3K9LA 3Q5EA 4RFSB 5LB2A 3TSOA 3FFBA 1UBEA 3VTKA 4BLOA 5H8WA 2QPAA 2ZS9A 3WHLA 2IXFA 1YQTA 1W0JA 1DADA 1IY0A 3Q9LA 2WJYA 2X77A 2IX3A 4UNSA 2DWQA 2JDID 1Z0JA 2YINC 1XFAA 2XZOA 2OUKA 5AK0A 4BECA 3KKNA 1RFLA 1Z0FA 2FF7A 2QMHA 4KFRA 4TWZA 4L4UA 4ZDIA 1J99A 4DT1B 2QGZA 4TL6A 5AR1A 2GXQA 3LQRA 3GLIB 2EQBA 1XNJA 4IOLA 1XDBA 1ONBA 4GI7A 5F9HA 1E2HA 2IF2A 2QQEA 1TQ6A 1JEDA 2WSMA 3EZ2A 2W6JA 3LX8A 2GJ8A 3WMFA 4DCVA 4AY2A 4Q9KA 4RFSA 3DM9B 4KHZA 5AJVB 4KV9A 3VQTA 4Q7KA 2OLJA 1J7KA 3BK7A 3FKQA 2YKGA 1IM2A 1EFUA 1NSFA 1Q44A 3NC0C 3RABA 4DDWA 2YWFA 3IHWA 2Z4RA 2G77B 3KTAB 1E2PA 3QE0A 4KYUA 1IN4A 3U3KA 4QC2A 4DDTA 1H8HA 3R9XA 1NN1A 3V00A 1U0HC 3PUVA 1WB9A 1WCV1 3PV0A 1VDZA 1YZQA 4QHTA 1X86B 1TEVA 3CW2A 4L9WA 3P4YA 1QHXA 3EA5A 4IXNA 4FCWA 2W0SA 4WA7A 3WBJA 3CNNA 4NHOA 1NSTA 1MO6A 4EFLA 3T61A 3OAAA 3TR0A 5EJEA 1E96A 1S1MA 1Q1QA 2ZANA 1E0AA 1H8ED 3ND9A 3EX7C 4I4LA 5FOTA 4LX0A 3OF5A 3BB3A 3NEYA 4TLEA 2XITA 3TBKA 1AS3A 1KJZA 2BMFA 4IKEA 4OHWA 3BERA 4V0OA 4EPRA 1YVDA 3QXCA 1DVRA 2IYUA 4FWTA 4PAOA 2EU8A 5D3QA 4LHVA 3PENA 2WWHA 4TMXA 1F3OA 5LBIA 2CVHA 4HB4A 4BRWA 1V5WA 3AP2A 1G17A 2J0SA 4PTLA 3RSLA 2D4HA 2GJKA 4OQFA 4OBEA 4KITB 4EFMA 4WIAA 2X19A 2FGKA 1NRJB 1L4UA 3LVRE 5FUXA 1P62B 5CM9C 3U44A 5FL7D 4D2IA 1MABB 4JMPA 2XSZA 4IDHA 3VX4A 3ZLJA 4JYCA 1KSFX 1Z63A 1CRQA 3PUWA 1KY2A 4PQYA 1XJCA 2ZJZA 1NG9A 1NLFA 1G5PA 4N3NA 3WYGA 3I73A 4LZZA 1OLOA 4C2TA 2WJIA 4Q7JB 3L0PA 1LFDB 2GETA 2GKSA 2J1LA 5TY0A 4BLTA 4ACAA 2PL3A 2BCGY 1ZCAA 4MKHA 4OQMA 2IS2A 1SVIA 1TF7A 4DRZA 4DCNA 4DLTA 1Z22A 4MKGA 3UWOA 3G82C 4B76A 4Q9JA 4ZKDA 2XAUA 2PZFA 3KKPA 1CJVC 1IJFA 1QHYA 4ZV4A 3KDSE 3HU1A 5SZIA 2V6JA 4TLAA 4KCGA 1E0SA 1QHHA 3K9NA 4OHXA 6Q21A 2ZXUA 2N46A 5K8UA 2FE4A 4C0QC 1ZNYA 4IJMA 2C78A 1WA5A 4ZPXA 1KI6A 4HLDA 2QI9C 1K6MA 4EQ6A 2V54A 4MRVA 4NCJA 1HY3A 1QRAA 3SJZA 1RYHA 5FPHA 5LPNA 2DFKB 5IDVA 1SVMA 4JLDA 2W6JD 2JLUA 3K0FB 5CB8A 4EUNA 2BV3A 1AIPA 5EQTA 1NBMD 1N6LA 4QKQA 1E1QA 1E1QD 1E0JA 5CK5A 3VHLB 2CK3D 3N70A 1F2TA 2FX3A 3VR2A 2BEJA 3GJXC 1AGPA 1XD8A 2CJWB 2Q9BA 3X1WA 2HXYA 5HCNA 5C4GB 4ESVA 4D6PA 1UPTA 2ZAOA 3EIEA 4JBYA 4WAUA 3Q7QA 3S1AA 2W00A 3B82A 5EP4A 1F5NA 2ODWA 2YV5A 3MCAA 3BWDD 1GNRA 2VA8A 1E79A 3U5ZB 2B7CA 5D3MA 4UKDA 2Q0HA 2D62A 1MH1A 2KE5A 1R7RA 5CIQA 1BMFA 721PA 2WWWA 3ND8A 3SJBA 1II8B 1G4AE 1KO5A 3I5YA 4QHSA 2ERYA 3AUXA 1F6BA 3NC1C 4HEJA 2ZJYA 2QE7A 3MJHA 2WZQA 2OG2A 3P26A 4HZUB 1GZSA 3K1JA 4TYQA 1VG0B 3HP1A 5FFMA 5KUTA 2XOKD 4DZZA 4NCHA 3NDBB 4Q4HA 1EFRA 4R2HA 1Z06A 2P2LA 5DH9A 1W48A 2ZVPX 3BRWD 3Q3JB 1CXZA 2MSEB 2BMDA 1XEXA 1M6NA 3AVOA 1QHSA 1W4AA 2D2EA 1FUUA 3FFAA 4F91B 2NO9A 4MRPA 4V0NA 5JSZB 1E2EA 3MWLA 2W58A 4FN5A 3GLIA 1K5GA 2Z0MA 2PX0A 1EFCA 1OB5A 1GNQA 1LW7A 3EARA 4DIDA 1OFUX 2WIAA 2YWHA 2VRWA 2C03A 3CLVA 3LFUA 3Q5DA 3RS0A 3UANA 4DDVA 4YMTA 5JHHB 1ZNWA 3C7KA 1GUAA 4UNRA 4ZCMA 2Q3MA 1US8A 1C9KA 4KBGA 1VTKA 2IWRA 1XEXB 3AQ4A 4XD7A 1S9DA 3K70B 3NBFA 2DWPA 2NO7A 2QP9X 2ANBA 2NOAA 4UQOA 2BBSA 4I1VA 2G3YA 4A0HA 3MJRA 1UBFA 2QENA 2ZSBA 1JQLB 3TMKA 1WBDA 4G5OA 2GILA 2J0QA 1W1WA 4LJ4A 3I5XA 3W3AA 2QP3A 1E4VA 1XU4A 1T3SA 1U81A 1IXZA 4F93B 2FZ4A 3A1SA 2F43A 5G3ZA 4IDPA 2HUPA 2C5LA 1AS2A 1GRQA 1VHTA 2OBNA 3TQFA 1CJUC 5FBQB 1NIPA 5SZHB 4RCYA 1VYUA 3QG1A 4C2UA 1Z83A 5BN4A 1SVKA 2AR7A 5KTYA 3TSZA 3GP8A 4BRUA 4V0MA 5DIFA 4EJSB 4PO9A 3CNLA 2PT5A 2RGBA 4C7OA 3CRMA 2C99A 1HA3A 1DG3A 1F60A 1P2UA 4M21A 4QGAA 1A1VA 5KNDA 1TF5A 2ERXA 4TSFD 4AURA 3EAQA 2WMNB 3K0EA 3R7WB 4Q19A 5GVRA 1T0JB 4KLZA 4NYIQ 1EWQA 1A4RA 2IYSA 2YWGA 4NYJQ 1XPOA 4QJ5A 3ASYA 1U98A 4XIGS 1N6PA 4PFSA 5AJZA 4EPYA 2O8BB 5BN5A 5EUMA 1DAHA 3FGNA 5FBWB 5EP1A 2H18A 4JZKA 1VG8A 1DAEA 3I8XA 5FOVA 2O8CA 2Z5FA 2ZIAA 1DPFA 3UATA 4TZ0A 2W2XA 1GG2A 3LD9A 3OE7A 4QRHA 4KODA 3JVVA 2RGDA 4O2LA 3WYFA 4HUTA 3AVWA 1VCIA 1II0A 3KQNA 5J5CA 1SULA 1UEIA 2ZYVX 1NI3A 1RE0A 4MDFA 3ADKA 2Q6TA 3DM5A 4LC0A 4B75A 3OEHA 1HV8A 3O8BA 2R6CA 4BLPA 2A5GA 3NBZC 5EXTA 4RKEA 1JR3D 2J5XA 4R71A 3FMIA 5FI0B 4LV6A 4M9QA 3U2QA 5DI9A 2ZSAA 4QG7A 2D74A 2HCJB 1Z6YA 3RRNA 5JS7A 1XJQA 4LK2A 3WHKA 2CCKA 2BMJA 1S3GA 4EQ6B 3NWJA 3AKDA 3PXGA 5KPDA 2B6HA 4AKHA 1RJ9A 2P5TB 2WVJA 4ZDJA 4BFUA 3KKQA 4H9GA 1G7RA 4E09A 3EWSA 1E9FA 1Z08A 1XD2A 3P27A 5DHAA 2ZR7A 1GTVA 3C5CA 5B30A 3CPEA 3TIFA 3DOFA 2WWGA 1GSIA 4KFSA 4NCKA 1RIFA 3IPXA 3HDTA 4CT5A 3H86A 1SHZA 1AGRA 3KUCA 2JIZA 1RVDA 4RSGA 3O8RA 1JJ7A 1TMKA 5JCPA 2WOJA 2ECKA 2O8FB 4MYCA 1TU4A 5FBVB 1G6OA 4RD2A 2A7QA 2DFTA 1R8SA 1ESMA 2X2FA 4QBFA 2PMDA 3ONWA 4DSNA 5JLJA 2E87A 1CJTC 2NGRA 4JL5A 2ZE5A 2BEKA 3QIAA 3U3MA 1OXUA 5C4MA 2ZRKA 3K09A 2ZI7A 3RYTC 3WRXC 1B0UA 1U94A 1KDTA 4TYPA 4ESHA 1W36D 2YC2C 4RJLA 3A37A 2IEYA 2HJGA 3AF0A 4GNKA 1QHHB 4L9SA 1XBTA 2YJTD 1UF9A 1XCGB 1BS1A 3U7EB 4YDSA 3RVBA 3IKJA 4C0KA 4URXR 1UEJA 4OI0A 4YMVA 1JR3A 3ZZTA 1P4SA 1W4BA 1YHNA 2ASEA 3NKVA 3SE0A 4L5BA 3VU9B 2CE7A 3DOEA 2B7BA 3SI7A 4HLUC 3AKCA 3KB2A 1ZD1A 3GLHA 5BW8A 1QHIA 3T15A 2QM8A 2IYWA 3VFDA 4A0FA 4OI2A 4BFVA 1RZ3A 5A5GA 3CZQA 3BS4A 4BZPA 3PFIA 1II9A 4A8JA 3RHFA 4JLAA 1UAAA 2IUSA 5G41A 3KQUA 4FMDB 3B6EA 3S1AB 1GWNA 4OK5A 4CEHB 4D81A 5JRZA 2O8DA 3CF2A 4L16A 3Q8XB 4LYFA 2ZRIA 1VHLA 2J7PD 3NEJA 3MLEA 3EPJA 2R6AA 4LJ8A 5GJVC 1GIAA 1PV4A 3GLFB 1OH5A 1AKEA 1ZC3A 2CL0X 5C46F 4XWOA 2NPIA 4N0EA 1OIXA 4C0HA 2GBLA 3ASZA 1F48A 3MRSA 2ANCA 4F4CA 2D06A 2ZUBA 3K0CC 4MH0R 4YMSA 3U3JA 2GRJA 2RMKA 4QGGA 3RDPA 1HE8B 4Q1BA 4AWXA 1M74A 4B3BA 2OFOA 4WXPA 4BFXA 4JLOA 2HF8A 2PH1A 2FV8A 4UXHA 4A6PA 3CRQA 2ZRMA 1W36B 3W34A 4Y0AA 1SVOA 2F3TA 1E9SA 5C2JB 3TK1A 2VSOA 1NMYA 3SOPA 4DHEA 1XXHE 5KOYA 2XTZA 1T5IA 4I1OA 1KI1A 1S0UA 3WXMA 5CITA 2BHRA 1OPXA 2CE2X 1UADA 4U00A 1IY2A 2I4IA 1XWIA 2QQ0A 1T5LA 3AF2A 4OJKA 5EP2A 3SBDA 5FOSA 1GL9B 1G3MA 4WZBE 3OIYA 3BB4A 3GMTA 3DDCA 4D4MA 4FCTA 4LPKA 1PJRA 4XVRA 1TX4B 2P3SA 3B1XA 3IBYA 1R0XA 3LDAA 3HYRA 4YXWD 2HEIA 4P4SA 2VHJA 4NZYA 4BFTA 2ZRPA 5KYKA 1OIWA 2R6GA 1I4DD 3L82B 4M53A 3VR6A 5E95A 2Z6VA 4DCTA 2O5VA 4QBHA 5M04A 2ZJOA 3AVTA 2ZRBA 1M34E 1HQYE 4AI6A 3GJ4A 5EP3A 3R9IA 2OSBA 3F8TA 2VP2A 4B3GA 2V8OA 1GL7A 1Q1BA 3PITA 2H57A 4LBWA 1N6OA 2JJ2D 2JJ1A 3MMPA 5FOXA 5FL3A 2VYFA 3O8DA 4YLGA 1BO6A 3UG6A 1ZD9A 3NHBA 221PA 3QI2A 3I61A 3FMPB 4OHZA 4MQBA 5B2ZA 3LWNA 4W7SA 2PLRA 2L0XA 4JBWA 4TL8A 1M7GA 3FPAA 1IXRC 3A8TA 2AD1A 3QUSA 1XJ0A 1XZPA 2WKQA 2F7SA 1RKBA 4CYMA 3QPWA 2QMOA 1XZQA 2IXEA 1RYFA 1R2QA 1YZLA 3CM0A 3KXIA 3QJYA 5LD2B 1G3UA 3L0OA 4PC1A 4UNQA 1G7TA 4NONA 1EFRD 1AK2A 2OCAA 3A36A 4GPTA 1ZUNB 3W8RA 5L3SA 2QRNA 1OFTA 1N6IA 3A1VA 5FL7A 4BEJA 3T1VA 3MSXA 2BC9A 1MO5A 4DUGA 4JVLA 4ZCIA 5ELXA 4D4JA 1MO3A 1AS0A 3QXHA 1AQUA 4RFVA 5FTMA 1OH7A 1EXMA 2KB0A 4EKDA 2J45A 4QHYA 2OZEA 4JYBA 3OZXA 2WPDD 4M1OA 2YYZA 1UKYA 1NG1A 2V3CC 2FEMA 4B48A 4EJSC 4B3CA 2DCUA 3TKLA 1SXJA 1TTTA 3ZVMA 2ZROA 5DE3A 4LUCA 4BLRA 1PZNA 1KI2A 4ABYA 2XNDD 4ERNA 5P21A 2OLKA 2YZ2A 1NBME 5A4JA 1E9BA 1EESA 1TAGA 4HB0A 3WY9A 1M7HA 2VHUA 1RRPA 3QXSA 2GCOA 2WM9B 1U90A 1JAIA 1JEEA 4FMBB 1G7CA 1WF3A 5EE3A 5AJXA 1DOAA 1OFIA 2JATA 2IYZA 3C14C 3WMGA 4D0LB 4LYJA 3ZVNA 3LBIA 2CLCX 3THWB 2XZPA 4OK6A 4G0NA 1E2LA 2GEUA 2HT6A 1O87A 2XEXA 1XCPA 3BD9A 3OHMA 2JJ1D 3QKRA 3VKHA 2LKCA 2YOFA 3MD0A 3EZ6A 1R8QA 2IXGA 4CVNA 4F4JA 5FPTA 4U02A 3LXXA 1IHUA 2B21A 4B32A 3AV0B 1P9WA 3BJIC 3P32A 4C30A 3K70D 4HUQA 2QN6A 2ZS8A 3CBQA 2IS1A 4LJ9A 4TLDA 3F0TA 5FOWA 3KXLA 4KVAA 4QNMA 2RCNA 3U3OA 3BIFA 4CDGA 2WWFA 4IVPA 2C9CA 4URYR 4DVGA 1DO2A 1JALA 1I4TD 4GMDA 1UBGA 2CK3A 3EIQA 4TMWA 4FMDF 4DLUA 2ZR0A 1OSNA 1W0KA 3THOA 1G8GA 1Z0IA 2JLVA 2ODNA 4PAMA 4TZ6A 2GHIA 2JGNA 4LJYA 2OV2A 3A6PC 2H7VA 4V03A 5TARA 3TVTA 3LW7A 4PHGA 1SGWA 1ZAKA 4Q00A 1BIFA 4E5UA 2DBYA 1GDDA 4M1TA 2DR3A 3OFNA 4X8LA 3OEEA 2JCSA 4GOKA 4AD8A 4JLVA 4Q1AA 2JLXA 1NKTA 2CEAA 4TMKA 1OV4A 1Z0AA 2BM0A 4NU0A 4DLVA 2J7KA 2IYQA 4OKSA 3VR5A 2O0JA 2VP6A 4R9UC 1CEEA 2IWHA 2O52A 2QA5A 5GADl 2QPOA 4Q5IA 3D6TB 5CLLA 2V9PA 1S2MA 1OKKA 3N2IA 4URUR 5JJKA 2RGNC 4XTRA 3QEJA 1D5CA 4LI0A 2C2HA 2IEZA 3CF6R 3T1TA 3RC8A 3BXZA 3W3ZB 4EDHA 4MYTA 1FP6A 3KJHA 1OB2A 5FTJA 4MGYR 1SKYB 1E1RA 3CIOA 4B2LA 4BWYA 5CYPA 1DEKA 1JPNA 1II8A 3W5JA 3T35A 4PSVA 2F1JA 3KFXA 1UDXA 1Q3TA 3FKSA 5FOUA 1NVXQ 1NKSA 2AK3A 2FH5B 3VAAA 1T8UA 1H65A 4LOAA 1P3JA 4KFUA 5E4FA 5J47A 2A5DA 2MMGA 1T4GA 1HQCA 1GVNB 3BFKA 1CULC 3NH9A 4M1YA 4P0TA 2XXAB 5DSZA 1VYVA 1Z8FA 4C0SA 2RAPA 1Q12A 2IK8A 3B60A 4NYMQ 2BMEA 2VIIA 3T5GA 1D8TA 2N42A 2FSIA 1G20E 3PUZA 2XTNA 1FMJA 2GZHA 2XTMA 4TYNA 2GJSA 4EAQA 5IF9A 1NVUQ 3VMFA 2BWJA 1JECA 2BBTA 5DI3B 4IOMA 1NF3A 5FH9A 1NMXA 1G1MA 5CB6A 3HYTA 1G8HA 3CX8A 3LLUA 1ESNA 1BYUA 3VKGA 1M7BA 5IK2D 3MG9A 1KZGB 3ZS8A 3TH5A 1Q22A 4FINA 1R5OA 3L43A 2QSZA 121PA 3AM1A 3WNBA 2ZJ2A 2Q9CA 3VR3A 5EXXA 4D4KA 1X8LA 2VHTA 2OAQ1 5JWHA 2B8TA 1A82A 2IC5A 3PUXA 4V0LA 4B2IA 1OYWA 5FUVA 2IYTA 5CK4A 4MYHA 3TQCA 1AA9A 1OYYA 3GLGB 5KNBA 1T91A 1HE1C 1CR1A 1EWRA 2JIZD 4DT1A 2FOLA 4M1KA 4DLWA 1XEWX 1JQJC 3AP3A 2FDCA 2FEOA 2QRZA 1D6JA 4FMCF 4R98A 4UJ5A 1G9XA 2G88A 4D4LA 5KSPA 5JI2E 1LV7A 3D7MA 1D9XA 2PLFA 1NN3A 2MSCB 3F5FA 3ZIAA 4IOJA 4DC9A 4JLKA 2R2AA 2FNAA 1ZD8A 4DXAA 2F1IA 2JLSA 3SQXA 4KVGA 1AZSC 4NDZA 1Q1ZA 1N6KA 5BYKA 3TW8B 4DIEA 3L0SA 4P33A 2BBOA 4EJSA 2V7QA 1MABA 3B7GA 4C7OB 4K46A 1S96A 4ITRC 2ZJAA 3VR4A 2H92A 3QPUA 4Q1EA 3FWYA 4XTCS 2DHRA 5H68A 5K8LA 3R7WA 4GRAA 3R8FA 2J0UB 4Z1MA 4H1VA 1Z6XA 1XCMA 4PZZA 2AXPA 3AKYA 1KMQA 3SYKA 3UKDA 5JFGA 2ZITA 1P2SA 2OBMA 4ZIRA 2ZRDA 1E2MA 2GAAA 2JLZA 1NLYA 2UZIR 2HDNB 3PJRA 1G16A 1I4LD 1IXSB 4QBGB 5BQ5A 1NJGA 2D2FA 1BKDR 4LC1A 4V0KA 4PC2A 4O3MA 1ETUA 4E07A 2LKDA 4DWJA 2XX3A 4I1UA 2FFAA 4JLPA 3QQ5A 5BXQC 2QMUA 2AL7A 1RRCA 2R9VA 1E6CA 2ODBA 4PHFA 3REFA 2NPFA 4D82A 2GTPA 1ZU4A 3HU2A 3AUYA 5FTLA 3W6PA 2QTHA 4OJQA 1K8RA 3P20A 2JA1A 3EZ7A 3KB1A 5FBRB 3ICEA 1UKEA 4Q01A 3Q7PA 2ZJ8A 3KUDA 1IQPA 4GDFA 4MDEA 3FVQA 2A78A 3K9HA 1GOTA 4H1UA 2D3WA 4URZR 4AG5A 4CZ2A 3AKEA 5AUQA 1VIYA 2VO1A 3H4MA 3BAFA 1E9DA 1QHNA 2GEVA 4BFZA 2EW1A 5K8IA 2ZU0C 4KFTA 4C3ZA 3GPLA 2ZI9A 1YR6A 2VSXA 5G40A 2J59A 4IDQA 4OI4A 1EGAA 3ZJYA 3H84A 1CP2A 2NMVA 3EZFA 4KBFA 1IONA 3VU9A 5AJWA 1RJ9B 4AIIA 4XSHA 2W83A 2EWWA 1P9NA 1GL6A 4JSYA 4DLSA 1EK0A 5KO2A 2ZUDA 3GLHB 2HCBA 2GZDA 2VP0A 2F3RA 1T8TA 1ZMXA 3GLHE 4I81A 1J8MF 1ZM2A 2WBLC 1C1YA 1MRSA 3WMEA 4TTQA 1L2TA 1EX7A 1N6HA 3DZDA 4RKFA 4GOJA 4WXRA 4A0RA 1F2UA 5AUPB 4MRRA 3A1TA 3AEZA 1CRPA 2Y8EA 4Q7LA 3BOSA 1HT1E 3RS7A 4LPSA 2QROA 4B33A 1XPUA 3LW8A 4QJ3A 5JBQA 2QORA 1A7JA 3ETLA 1C4OA 4M1MA 4JLMA 1RW4A 1KY3A 1WP9A 4B34A 3GLFA 3R9WA 2QGNA 4HZIA 5EE1A 2WAYA 2JAQA 4IRUB 4Q1CA 1E79D 3WNCA 4KYIB
chains in the Genus database with same CATH superfamily
4BPBA 3CZ9A 2R44A 1EGQA 1F2VA 4RK4A 3DWWA 3G9UA 2WAOA 3VPCA 2OO7A 1QP4A 1XQXA 1IN8A 2OFWA 3VISA 4ND2A 4WI1A 3RVYA 3EC7A 3WRYC 4KXUA 1Z73A 1OFHA 4R2LA 1RFGE 3A04A 1STOA 2HU5A 2EFHB 2HLDD 2WT9A 4AP6A 1E77A 4BNVA 5HIAA 1GKUB 3L7IA 4WDQA 4ZI2A 1R8JA 3U0BA 2C2WA 2YMMA 3LUFA 1VE7A 5EUQB 1BHSA 2PUTA 1JI0A 5TS3A 4GKAA 3BEHA 3H0CA 3AC0A 1Q0RA 1XX6A 3K9GA 3X43A 3NDIA 4AS2A 4B43A 3M4CA 4MYUA 3NHUA 3L6UA 3NYJA 1KK1A 1L4BA 2ZRFA 1JHVA 3HLTA 2F55A 2PT7A 1RBMA 4JUAA 3EZHA 1F4VA 1R3UA 4I99A 4PIVA 3IEEA 2Y76A 2RSEB 4F4HA 1IH8A 1NSGB 3QFHA 1GRVA 4HDNA 5IT5A 4XXHA 1G8XA 4OAOA 5CEFA 1G2OA 5LQRA 3WLEA 1Z0KA 2CXRA 1JSZA 2HHJA 2ST1A 4Q4HB 3ZNPA 3UAYA 4ALMA 5F2NA 3KSDO 4QYIA 5JLIA 4F4BA 4NZNA 2DI3A 3RVLA 1DAKA 2JZOA 1VJGA 4I1SA 2NTJA 4PC7A 5A9SB 1SBNE 1XMVA 2ZKLA 4J1QA 4NEGA 5ADUS 3IQZA 1W85A 4WJLA 3DFMA 1UMKA 5A0FA 3NDPA 2H29A 3W7AA 5F98A 3ROMA 3HEMA 4JJGA 1O6GA 1HETA 1U2TA 3B85A 2V7QD 4G26A 2BLNA 4P84A 3B3AA 1ZJWA 1OFGA 2ZB4A 1WKCA 2ZI5A 2XHEA 1JUDA 4P7GA 3ZZNA 4EB6A 2OXCA 5AKLA 1C0KA 1IBRA 1HE9A 1AM4D 2GBPA 2CVZA 4QYMA 3RWBA 3WHIA 4DR7B 3U0CA 1K7SN 1W59A 1X1TA 1YRLA 2QRPA 2Y1GA 3C3DA 3IILA 4X93A 3WK9A 4ZJZA 1UK6A 1M34B 3KTFA 1Q0GA 1J9ZA 1FU4A 2GN9A 4D92A 2PKQP 3M6IA 1WZCA 1KAQA 1M9NA 2V0NA 1UJCA 2XSZD 1UK9A 1TFRA 1V48A 3LBHA 3PEUA 3QVKA 4HAXA 3ZV3A 4ER6A 1YJ5A 4ZYZA 3B0UX 1TWHA 2JI9A 2P35A 5E6UA 2WU8A 2PR2A 1R8YA 3D3JA 3LQFA 4TLCA 2X3UA 3RFFA 1R12A 4L3OA 2JCBA 3MM4A 2PAFA 1ZOIA 1RHMA 3SJAA 3T0GA 1RXEA 5F3WB 5CD1A 1Y4CA 3LQKA 4W9NA 2QAGA 4BGUA 2SKEA 5JUAA 2QTGA 3GDHA 2JEYA 4REOA 1LBHA 4U2KA 5I7VA 1RLTA 4PWZA 4ZVNA 1LKZA 3ECSA 1PQPA 2Y9PB 3A9TA 3DLAA 3EW9A 3IJRA 1Z37A 3MYYA 5IDYA 2CB0A 2RKWA 2YJZA 3IDQA 4HT3B 3ER9A 4UTNA 1JDZA 5ED4A 2CNWA 3UAXA 5A6KA 2HTEA 3I64A 1JG2A 5EC8A 1PDOA 1TZBA 2W2OA 3VNVA 2XBMA 1X8KA 2R7KA 2R86A 4PAQA 1IAQA 4DXDA 2BL2A 1ACLA 2WV7A 4Y2VA 1FSPA 3NV7A 5EPEA 1QLEC 2OKCA 3T7JA 4F2WA 1AUOA 1HBJA 3K66A 2C97A 4NXMB 2WHPA 3T1QA 3WP0A 2P6PA 1DFHA 2J87A 3U6BA 1OASA 3LBNA 3R3WA 4KK4A 5AO9A 5JJIA 2G5GX 4YUYA 5K8TA 2B5WA 4P9FA 4CF5A 1F14A 1YZUA 1W36C 5GMOA 3ZJ5A 3JQ9A 4EY7A 1ZOLA 2X5NA 5FAKA 5K4AA 1FX0A 1NW5A 1AXEA 1P0CA 4LF8B 3SNHA 4M55A 1GTSA 2BGLA 1D1PA 2D1TA 2PL1A 2C9YA 2WC1A 4FFMA 1H8HD 1U3WA 1ORJA 1VHDA 4Y1EA 4Z9AA 3LT4A 4B81A 2UYHA 1KI8A 3RRMA 3AESB 2HV8A 3CCCA 2X0NA 2CMKA 5CVCA 4E1BA 4ZHSA 4A03A 1R50A 3WMRA 4PZCA 5BMVA 2XRYA 4FHFA 1EEXB 4R9NA 3U81A 4GXTA 1QVRA 1CD5A 3RWMB 1JJVA 1N1DA 3MBGA 1G7SA 1TEHA 3LA8A 4HDMA 1K0FA 2J3EA 3T0IA 1Q7BA 2RHRA 4DLAA 1B2RA 4L0QA 2GR9A 3TQQA 1VG9B 3ICWA 2Z43A 4HPJB 1O9GA 2A1DD 4FE7A 4ZRMA 1QJCA 2ZPAA 1Q1GA 5KSWB 3FMSA 4EX6A 3K1AA 3O5AA 2HR1A 4ZIRB 4QNRA 1FS4A 2ATVA 5CXUA 3L9WA 4CM8A 2G1KA 3ABQB 3AHCA 3QYAA 4PGAA 4KPUB 2CDAA 4P9TA 2WKRA 3RQFA 1P1RA 5BSKA 1VFNA 2WYVA 1MNQA 3TFOA 1P5RA 2LBPA 2NVUB 4M9RA 1B0ZA 4FFDA 1JFTA 5HJ7A 1ZH0A 1SZPA 3IKVA 2IS4A 3HN7A 1M0TA 4IVRA 4KMSA 3OUZA 2VYVA 4HAVA 3RJTA 5BNWA 3IPAA 1FDUA 5C5EA 4LQLA 2EFCB 1LX6A 1M8PA 2QLNA 3AWDA 3NORA 4G97A 1HF3A 4PLGA 2OO3A 5GONF 4E3WA 4PICA 4LRSB 5E4JA 2C04A 1G5TA 1XTPA 3GANA 2HU2A 1VPTA 4PONA 5DJ5A 4NULA 4OU4A 2QZ4A 5G1OA 1JLRA 3ZD9A 2F8SA 1F2UB 4CSAA 2VVTA 3NX4A 5J4VA 3K7EA 4WOJA 4EY5A 2Q8QA 3PTLA 4MUFA 4QUAA 3M81A 1G64A 1NZEA 4KRXA 2ZIVB 1E1DA 1EBUA 3V97A 2B4RO 2Z30A 4O08A 5HZGA 3K20A 1FZTA 1XRJA 1WLSA 2OXRA 3JQRA 2O05A 1RMQA 3FTDA 5D3MB 2WMYA 3TIIA 1HZZA 4KACA 4NNOA 1W0KD 2BPOA 1FLDA 3TD7A 4I8DA 4F1KA 1TT5B 1FNMA 2B92A 3D7LA 1D09A 1ADBA 1P80A 2WSSD 3GJ8A 1URPA 1ITZA 1KFEB 1TE2A 4QOSA 1XPRA 1R4NA 3AL2A 1XV5A 1YI1A 3S2ZA 1HDZA 4V3CA 4Y1GA 2NUAB 3VYUB 2I7CA 2JFBA 3L84A 3PQFA 1YGPA 2WE8A 1J06A 5KSZA 4GVXA 5DCLA 1CBUA 1HDXA 4XM0A 4G4SP 1X1AA 3AL0C 3LXRA 3H87A 4KO8A 1JR3E 2QIOA 2YXPX 1OXBB 3BD6A 1OU0A 3I83A 4DA6A 4GI2A 4K87A 2JVIA 5ULLA 4DWVA 3K70C 3GZTB 1TMYA 2ILVA 2GESA 4LJ6A 4BFCA 2IEAA 4O4JF 5AOVA 3TLEA 3HGMA 1M5UA 1DAIA 3FYHA 3AB3A 3U7IA 4TT3D 1TUBA 3T7DA 1I14A 5JRAA 1KJQA 3KYIB 4LXHA 1MW9X 2Q29A 2GA0A 5A3SA 1WHSA 3R9KA 2D8MA 5KKAA 3LHDA 2CJWA 1T8SA 3I1IA 5CEEA 1J0BA 4PVCA 3JZAA 4PHHA 2XOEA 1YUBA 1BZYA 2FLVA 2FU5C 4HQKA 5BN3A 1Z47A 2HLHA 1F0NA 4KRGA 3KETA 1CUSA 5CB4F 1NASA 1SKYE 1CR4A 4EGJA 4DAEA 3H3XA 2DZDA 4JT8A 3OIGA 4R7ZA 1CQJB 1RM5A 2IHTA 3WJ7A 5HZKA 1OX4B 4JURI 2XJ9A 3FOBA 5AJYA 1NJFA 2WFAA 4R05A 3UMMA 1HDGO 2WVOA 3HUDA 2PTHA 4Q7MB 3KOOA 3VH1A 3LCMA 5B57C 3ROFA 1JLMA 4LJ5A 2GAOA 4BEWA 4E4YA 3ZV4A 4P08A 1POWA 3ZNNA 3RG2A 5EQFA 2Q5EA 2PKRA 4GLOA 4MS4B 1QVAA 3I3SR 2QMEA 3DMNA 3QLJA 1H4TA 4RHCA 1N0WA 2C9ZA 2JASA 4JP1A 1CR6A 1V25A 4LNAA 3WO1A 1X80B 2ZRGA 4ETIA 1IJEA 5KTSA 1K6IA 1R9GA 1L4FA 1ECCA 1YRBA 4FFBA 2GPBA 5DYIA 5EY5B 5A3VA 3V33A 4A82A 3FA2A 1N5KA 3PDWA 3ASNC 4IH4A 3K2QA 2GDZA 2VP4A 4RTPA 2GYYA 2X9LA 4QAJA 1WEHA 2O19A 4R01A 1MAUA 2C4NA 2Z2XA 5JU6A 2G82A 3I6QA 1Z4OA 1Z75A 3IXQA 5KDOA 4BEBA 1KR2A 4NPCA 4AE4B 1BCSA 1Z56C 4PXAA 1JG7A 1W9MA 4EY8A 1XNRB 3LESA 3R7BA 2D0OB 2ZBDA 1D0IA 2JIRA 1W94A 4QASA 4E7OA 1A9XA 2ZVQX 3FCOA 1CJMA 2AQIA 2QJWA 1WBBA 4TV8A 1T6NA 2AI3A 2VCHA 2LCFA 3GA0A 3GR6A 3TR5A 2WT4A 5J43A 4TV9A 3A6HA 1SOWA 3UJDA 2FZVA 1XZKA 4DB4A 2I22A 2HHCA 3AG5A 3DPIA 4DQVA 5KVAA 2F3SA 4KJZA 4YX9A 1ULSA 4HB2A 3MQ4A 2Q4DA 2QV0A 1UIMA 4FX5A 2CVFA 4MVYA 5EYPB 3PWZA 3KALA 4NV1A 3RS2A 3V7UA 1VRCA 1ULTA 3ICPA 2DSNA 1H05A 5IM4A 1I9GA 1PDVA 1VP3A 3KJIA 1J42A 5AW4A 2H1LA 4NMMA 4JBIA 3RKSA 4AJOA 1E2FA 1BOOA 4WVLA 1XLWA 2GZ1A 5ARCA 2VP5A 4NMWA 1U8YA 2GEKA 2DSTA 2J9YB 3BC1A 3FWKA 4OSOA 3CF4G 1M57C 4F60A 5C9ZA 3DEAA 5K0FA 3N8NA 1LCIA 1XL1A 3O8QA 4OH1A 1GGHA 1QXSA 2L69A 3IEKA 4DIBA 4IDOA 1O0BA 4EHHA 2KJQA 1JAZA 1PJ8A 3KJFA 3GEEA 3F3YA 2HS5A 2YOGA 3L79A 3OQJA 3X1XA 3QSYA 4D25A 1QWOA 3OO1A 3PC6A 4RANA 3DB2A 4N5IX 4TMVA 1ZP6A 2VDMB 3L4BC 4KVFA 4HSGA 1FMFA 1DQSA 3M49A 2FYTA 2W11A 2IEGA 3HY3A 3UMBA 1FIUA 2V4ZA 1AB6A 6REQA 2P7IA 1EA7A 3ZYZA 1B73A 4TVKA 5DX1A 2VR1A 3C4QA 1Q77A 1RIIA 1UMBA 1ZITA 2VQSA 3H17A 4EW3A 4V0ME 4HO1X 2CHUA 4B2PA 1U0GA 4P5EA 4LNUB 3RYFA 4IGGA 1BXGB 4M0DA 2ZXFA 3LL4A 1SQ0A 4HWRA 2FWNA 5TRTA 3RIPA 1GYPA 1UXKA 1JN0A 3C41J 4CM7A 3QF7A 4QFMA 5DN6D 1LNZA 4CRWB 4R2JA 3KQSA 4XR9A 4E14A 2HM7A 4U6SA 2GLUA 1JEYA 2Q7RA 3L01A 4J0FA 4S1WA 2FF5A 1EK1A 1U4OA 4FGUA 5LSAA 5DX8A 3O7WA 1DS6A 5DN9A 5EN4A 3OF3A 3QV1A 3WB0A 5JR3A 3GYGA 3FZNA 3EBPA 3IIJA 4X9XA 4PFQA 3NMJA 3C8GA 3BSSA 4U6QA 2JFYA 1VYKA 3UJ9A 4DMFA 1NVAA 1T1EA 1WOYA 2JGLA 3HNRA 1P9OA 3JQ6A 3K5WA 4RGBA 3I04A 4KGZA 3PNBA 4BNHA 4ICIA 5DLJA 1E9EA 1WGWA 2CLDX 5T7BA 4TSRA 3RW0A 5JIBA 4KR7A 3SSOA 2VPPA 1GRRA 3H2YA 3F5SA 3N58A 2FPMA 2O57A 1GA6A 1ZUNA 1HMOA 3M15A 4AKSA 2EHJA 2K87A 2H7XA 2DB3A 2VBGA 5T8KC 1CFZA 3PHBE 2QRMA 1YI8A 4Y2RA 4LACB 5AC5A 2DFVA 1KS2A 4G89A 5F4BA 5EKUA 4UCFA 3F47A 1R0WA 4OUKX 1DKRA 2Q07A 4H17A 2RI0A 1Y34E 3BCHA 3E0QA 2XS8A 5LDHA 1QE0A 3VHXA 3NV9A 4B4KA 4US2R 4X1KB 4BO8A 3GPCA 3W6OA 2EZ9A 2PKWA 5DW3A 3PC8C 3DO6A 1T6UA 1JDPA 3IOCA 4BNUA 1JKFA 5CA0B 5T64A 2AQHA 2P1RA 2R00C 1QGDA 2FWRA 3BBPA 5DPMA 3G8BA 5TX7A 3QKTA 2RH8A 2FHSA 2OA0A 2P3QA 2VBCA 2XVAA 1TGYA 3QLEA 2JCGA 1BN7A 4UTXA 5B7QA 1T24A 4FT2A 1JH8A 1U8XX 3N9IA 2I3BA 3JD3A 1MGPA 1Q0MA 3ACDA 3LUHA 3OI7A 2UYQA 3NANA 2XT6A 5DGXA 4FFNA 1RC0A 3CPSA 4KXFB 1N3LA 2Z1MA 3DOJA 1A9YA 1YL6A 4M76B 4RKYA 4DYVA 4EVIA 1Q0ZA 1HYGA 3AUKA 4M0FA 5HIMA 1ABBA 2YWAA 1EE2A 1N5LA 4EYSA 5D2CA 1K4KA 3KQLA 1PFGA 2IYEA 2ZCUA 3O95A 1NZDA 4ZEXA 2A33A 5AUOB 4WLUA 4Z3DA 3PXDA 3M9LA 1O3YA 2DQYA 2JJYA 3H16A 3AGPA 5JYCA 4OQXA 1YU9A 2O5RA 1G55A 3NBYC 2PKXA 2YWDA 3PC3A 3K4QA 3H5WA 4FGKA 3RS3A 4ZEWA 3TNFA 3NBXX 4IIJA 5B6IA 5I4BA 4PW0A 5F1KA 4QELA 1MB4A 1ZW6A 2IIBA 4R9VA 2IGBA 4JOSA 2F1HA 5E9AA 5DWDA 3TIGA 5I3CA 4IIDA 5J59A 3WGLA 5ILOA 4IRUA 4YC7A 4M8KA 1CB0A 3DBRB 5G3YA 2FW0A 1YKSA 3TUJC 4W8GA 1X1EA 4W1PA 1C9MA 2HSJA 4ZU1X 1FP4A 4D0GA 1FFHA 3F6RA 2XDYA 4OK3A 3G0HA 3D3QA 1BDMA 1WTCA 1ZH6A 2FSUA 1J20A 3CU5A 3WGGA 2IY7A 5LYJA 3K0BA 1W2GA 2AQ8A 4JJAA 4L50A 1XU7A 5FUQA 2CCYA 2AZTA 2QN9A 1BQEA 2ZQYA 4Q47A 4JKIA 5G2OA 5K0SA 2RHMA 1P1KA 3FR7A 4V0RA 1ISRA 1K6EA 1NN0A 2ZAIA 1DT5A 1GGMA 1Y9AA 1Y6FA 2A6HF 5JZBA 4J1NA 2ON6A 4EGAA 2YJ3A 4BKOA 7REQB 1Z4PX 1TM3E 2NT4A 2JGIA 3IX7A 4H0CA 2O3QA 3A25A 3FI9A 3IO3A 1XJWA 3DFFA 3V9PA 1BDHA 1PAUA 2HIAA 4HXYA 2R87A 1DUIA 1O8BA 1P74A 2JLQA 2XIJA 3GFSA 3JQGB 2AOUA 4XWTA 5AKKA 1F0YA 1WVIA 1R88A 4JR1A 5A04A 3R76A 4JNCA 1SY7A 1Y7HA 2GWWA 3CKMA 4EJ6A 4E94A 5DYTA 1R74A 3P1JA 3MX3A 4GOXA 3R24A 4K6KA 3DV0A 5DLDA 1P2VA 2P5SA 3HWWA 1W6RA 4QPDA 4AWAA 5CBPA 1R00A 3G49A 1QRDA 2J3HA 3LKZA 4LZJA 1VQ1A 1KWKA 3HVIA 1IBSA 1ZEMA 4EY3A 4QT4A 1VIAA 2ZE8A 1Q0QA 1P6UA 1FYWA 1OT5A 1TNDA 1XMPA 4Z4HA 1ZI8A 3EQ9A 3K7DA 4GWLA 4H77A 4E2YA 5M29A 4X8MA 1R6VA 1XVAA 2AF3C 3ZU3A 3LI2A 3GHHA 2PFDA 4UUAA 2WKWA 1K5DA 3IPLA 3Q1LA 4YJ3A 1WXWA 4GIBA 4ZICA 4U3JA 2Y1DA 5A3QA 3DDWA 2VQFB 3ZIAD 2H8KA 5ALXA 2WD8A 4U9UA 5IBCA 2PGAA 2ONJA 4ED9A 2BFFA 3ZDFA 1OWOA 1CIJA 1XA3A 2BISA 3O1HB 4BQQA 3TUIC 4OQQA 2MU1A 1WNTA 2C83A 3R7AA 2AI2A 3SZOA 3H9UA 3DD1A 2OPBA 4EY6A 1CUIA 2R11A 1GT6A 1YDGA 4TVSA 3OE7D 1EWVA 2B4KA 3UJNA 1VPLA 2NO4A 1CUAA 2QLBA 1C3VA 5REQA 5F77A 5IVDA 4Q02A 4EX7A 1A04A 4UEQA 4JT4A 3TEFA 3AZPA 4FFLA 5HS6A 2OHVA 1B68A 4P3OA 3S28A 1DKOA 3FSGD 4RV4A 4B7AA 4U7DA 2FZEA 1U8CB 3VC1A 1QIJA 2HMAA 2RH9B 5F7JA 5CXQA 3KAKA 1PX0A 4MIEA 4XQCA 3RO7A 2OG1A 3H18A 3V4OA 3L1HA 1S3FA 3LUBA 3WLJA 1IY8A 1AN9A 4Z2AA 2V1UA 4YYEA 1I33A 1QNFA 2ODQA 3NTUA 2R1VB 1I6LA 4P4TA 1IOVA 2EEPA 1QAOA 2ID8A 4FZVA 3ZV7A 2G08A 4Q7QA 5IT4A 1ZLXA 4ECEA 4D4NA 1YB7A 3OICA 4OGLA 4QGBA 1FXWA 2XQGA 3MFNA 5A9SA 1UC5B 3NW9A 1GFIA 4ISBA 3OURA 2OK8A 3TLGA 2H54A 1IZZA 1QQ6A 3OQBA 1BAPA 3OMWA 3R40A 3FJOA 1W2HA 4UJ3A 1VE3A 1PEDA 2PANA 3BGSA 4PG5A 4ZVQA 2C92A 3SDSA 2AFHE 5KBYA 2XB2A 4MVJG 3I09A 4HK4A 3MWYW 3UNXA 4O59O 1SEVA 1VE9A 4UMEA 3RGWS 1XMSA 1I2CA 4AG6A 3S70A 2ZU6A 3AU8A 1G8PA 2HHHB 2WYIA 3FSJX 2AG0A 1DKUA 4HC4A 2GEDA 4C4PA 1B93A 1XLTA 4G24A 4PRYA 4RD0A 1GV1A 3Q88A 3CT4A 5CH8A 2M6KA 1W88A 4YYZA 4F3YA 3AQCA 3BXOA 3RSFA 4DQXA 1O6BA 4NSNA 5HPYB 2GARA 4QYTA 4BZWA 3I5PA 4B6PA 2Q3HA 3CUEF 2OB1A 4R0NA 1HUQA 1LLCA 3FMVA 3LP6A 4R8KA 4X0EA 1SMYF 2ZDGA 3FZYA 3WE7A 2V7TA 4BMYA 2W4QA 3V1UA 3UJCA 4UFOA 1VKZA 3DMDA 3VKVA 4GVLA 1JAXA 5DV9A 3KUXA 3GWNA 1V4VA 5BMVB 1EB8A 2J9FA 4ZT2A 5U4QA 4BAUA 2QQ5A 5A5FA 4YQFA 3IKMB 1J39A 1JPJA 2HJ3A 5DBOA 5JWRA 3IYLW 4OJYA 1G18A 1Q2XA 3KKEA 3DLPX 3GH3A 5ALKA 1E3TA 4P2BA 1D2NA 5D6OA 2I9PA 1RLOA 3DL4A 2PK3A 3IQXA 3F71A 2ZSFA 2VFAA 4G65A 4PLZA 2OVBA 4JW1A 4I9NA 1XNGA 4EECA 2QL6A 1RWWA 2E1RA 1T4BA 4YAIA 2WE7A 1ZYUA 1U3GA 3MWEB 4DUGD 5K6TA 4MTOA 2QTFA 1WCIB 4PO8A 4PZDA 3C5EA 3RV3A 3FKSD 5DM1A 3TTTA 2MR5A 1G9TA 3GJ0A 5B37A 4YJ2A 2V7EA 2AD5A 5L3SB 3L7KA 3GD7A 5DYNA 2IELA 3PC7A 2IA5A 3RHZA 3PSHA 3HVHA 4O3FA 2WJPA 4Z0TA 3ZWVA 4FDMA 2B8WA 4CMAA 4YRAA 1L7VC 2BF7A 3SS9X 2VP3A 4YXWA 1XZHA 4FNOA 2NV2B 4IDGA 4PPNA 4W5WA 2ZIXB 1LTHR 4FFPA 4EPVA 4YAKA 2A69F 3BM5A 4MRMA 2A88A 1PO7A 4J2TA 3SOZA 5CVDA 2I03A 1YC5A 4Y2GA 5CDUA 1JLLB 1QGED 2H4JA 4MR8B 5K8VA 1CUFA 4E1AA 2QPTA 2BMVA 2BFOA 3NVAA 4D9BA 1B1CA 3SIXA 1XD9A 5SZJA 1WXDA 3F90A 1TQGA 4QDKA 5JS6A 3QKSA 1NMZA 2RHDA 3TIXB 4RVOA 4BNLA 1BHJA 4NCNA 5DHFA 4CS8C 3GBSA 4G9BA 5LQSA 1E2DA 4J3FA 3VU3A 1N34B 1OH8A 3R5HA 1R6DA 2RJNA 3DDSA 5CG2A 3UOGA 2PR7A 4GP6A 1FFXA 4R1QA 2XADA 2H2GA 2RGXA 3EIHA 4MTGA 1V16B 3POVA 4YDQA 1EXDA 4MR7A 3UV6A 1P1IA 1OXXK 1XAHA 1LPBB 3CWCA 2FX2A 1FR0A 4HB3A 5FEMA 4LZLA 4MQLA 1O0SA 1VCMA 3V9AA 2R5NA 1T8PA 4HN2A 4XVQA 4QJ4A 1PFQA 1ESDA 2FVYA 2QD5A 6GPBA 4XGNA 4JT9A 4ZT6A 4IIJF 3VZCA 1Y3AA 1QO0D 4XPIA 4F4IA 2W42A 2BEWA 2ODEA 1UBNA 3CB4A 3MEQA 4ALJA 3THWA 4GQAA 1JMKC 1CK4A 1QCCA 1I1QB 1Z0SA 2NO5A 3ILYA 5DB4A 3ZEIA 4Z6KA 1N2GA 3HKKA 3QBTA 4F5WA 3E61A 1JFVA 4WBSA 4WOBA 5L6LB 1CEYA 4WKBA 3QVGB 1FBTA 2H7BA 3N2EA 1TRHA 3ABRB 4FC6A 1V5IA 3ABSB 3AI2A 1W9HA 1DIGA 3CNOA 3LV8A 3SR4A 13PKA 3SU8A 2WOOA 3BKWA 3MOGA 4WZBB 3TFWA 4F2GA 5DLEA 5EHQA 4XAQA 4ZK6A 5JMTA 1O4WA 2VZEA 2OYRA 3GP3A 1XDZA 2B82A 3CSKA 1WQ4A 4CKYA 4DCJA 5I4CA 1WDLA 1SR8A 2C9MA 1KKMA 2GLXA 2I8BA 4LG1A 3C7AA 1HX7A 3I3OA 4R40A 1XXHA 3HKDA 5ECGC 3K15A 1DIAA 1AKMA 3I0ZA 1UKCA 4A36A 4FU0A 2HA5A 2OBYA 4Y0VA 2P6MA 5D87A 1T4MA 1FAPB 5FYDA 3R6GA 5IM5A 3NG1A 1QK3A 1Q6ZA 2Q27A 3QOFA 2O2HA 4N18A 4QARA 4U4AA 1L5LA 2B2XA 4US0R 3S90A 2D4UA 1QYVA 2R25A 1K6XA 4PPGA 4JXZA 1WDMA 3EVNA 2XA9A 4YWHA 8MHTA 4F9FA 1QG4A 2QTVB 3H5RA 3MYRA 1Z7Qc 2OHFA 3LQQA 3VZBA 2YQ5A 3PG5A 3CEPB 1MNDA 3TPZA 2V3VA 3QFSA 4P7JA 5TPWB 4JB2A 3PXBA 4Z51A 2EZTA 1JNYA 4M9UA 3S8EA 1JTVA 2FQYA 3HJRA 4ARZB 3FMOB 3HYCA 4X3CA 4MW9A 5LB4A 1IEWA 1BNCA 3N2GB 5F1YA 2C0CA 4M8IA 1M2JA 3R09A 3MLBA 1FRVA 4CMGA 4EI9A 3RBXA 3EC2A 1GQSA 1XYGA 2QZZA 3M2TA 4JL6A 4PZYA 3T3OA 1SA0B 1VSVA 2P1AA 3QP9A 3RJMA 3UAOA 1BH2A 2REXB 4DOZA 3F6BX 1UODA 2RAFA 4J3JA 1Z6GA 3ZUGA 1BX1A 1CY2A 2FG7C 1GTJ1 3DMTA 1FYFA 5SY4A 3TZEA 4G3XA 5MN5A 3AEKA 2F43B 2HQBA 2WVAA 5EYPA 3MWJA 4HPWA 4P4LA 3U1BA 3PP8A 3C6YA 4EQZA 3HRKA 2GCIA 1U28C 4OV6B 4CIAA 3CH4B 3EPHA 4D6XA 1FPMA 1EFDN 1GNSA 1YZKA 3JR3A 3KLPX 3M4ZA 6NULA 3VDNB 2Y1XA 5EIBD 3VR6D 4KN9S 2OY0A 5TQVA 1Q7RA 4D80A 3R7FA 3HCAA 1AO0A 4BO6A 1Y6JA 4Q7CA 1CY0A 3H99A 3K0AA 3KOMA 4AL0A 2O3SA 4B0PA 3O8QB 3DZCA 4FSXA 4MJ3A 2J3KA 1QWSA 5KWSA 3KEGA 4YASA 1MEOA 1K27A 2H16A 3KQYA 4UXIA 2VAMA 3QX9A 3Q15C 2BKUA 4G01B 1HEUA 1GDTA 1P72A 4GP7A 1GILA 1D1CA 3R3YA 4ZOBA 5KX5A 1V47A 1A76A 3OIUA 3ANTA 4I36A 5JDCC 2NU8A 4NFYA 1US8B 1PT7A 1DP4A 1G66A 1UINA 2W2MA 4KQKA 4MKIA 1RJEA 4QBIA 3W2FA 4C7XA 3UAWA 3EPKA 3LSYA 3NUQA 1PLLA 1JHRA 5T4EA 1QDLB 5K3SA 4LHYA 1HM5A 2IY9A 3DPUA 3I4LA 5DK6A 3NQ41 4PLYA 3PS9A 1T9HA 1TL7C 4WJKB 1DIBA 3BMOB 3L1MA 4FDAA 3GRRA 4YT2A 1P8JA 2MIIA 4C4AA 5BWCA 2DQSA 1Q0TA 3AUJB 2WJGA 3BQ9A 5BRJA 1OI4A 1HSOA 1EHYA 4FPXA 3C6MA 4NL4H 3ZY2A 2Z08A 3AF5A 2OLEA 2XE6A 4FYYA 3L8YA 4LJAA 2Y6UA 1OXKB 2OILA 4NG5A 5BUCA 3AETA 2PZJA 1U7WA 3H4VA 4LXTA 5AM4A 1NT4A 3PBKA 1FFDA 2AK2A 5IAOA 1L9XA 2BELA 4GPIB 4GZLA 1NW9B 1NXSA 5I7EA 5B3SC 2XKJE 1KZ7B 2WJ4A 4IO1A 4BQEA 3RVQA 3E9RA 5A03A 3GLGA 1BGWA 1N2JA 4LRUA 1KZ6A 4XDHA 2VXCA 3BE4A 1MN6A 4BPRA 2PS3A 3IE0A 3MTBA 4NYJR 4X1YB 5KKNB 5L9AA 2CUKA 3GEMA 1YFJA 4WLEA 5K0CA 4JSTA 5K0BA 2QN8A 3PHLA 3K31A 5JNSA 3DE8A 1KIMA 2ZYTX 4XX0A 2KBEA 1SBHA 5FWYB 4Y2XA 3ZCRA 2K5UA 1T15A 5FR1A 3SYNA 4ZDWA 3ZDDA 3MILA 4MGKR 3SEZA 4ZCLA 3S4YA 4INOA 3NMUF 2E55A 3C3WA 3R0QA 4N8DA 3D2LA 2CV2A 1LEHA 2HKVA 3I8SA 4JIMA 4PYNA 4B3FX 4DLYA 2UUIA 1R9MA 3M1IA 1RRFA 2AOWA 1XL0A 3R5TA 3WAKA 3H8SA 2XWJI 2OZKA 2JJMA 4ND8B 2VJLA 1AUVA 1NBEA 3EIXA 2ATEA 5CUQA 3R75A 3DHNA 4GXQA 3AVQA 4EG0A 4TKUB 4B6SA 4NNJA 4OJMX 1FTNA 4U2EA 5KOIA 1XD2B 4Z9IA 2GPWA 4YWJA 2VTBB 5GWXA 5CNJA 4S04A 1UG7A 5A0VA 1C9YA 3TGPA 2OHOA 1T1GA 2FX5A 1UP7A 5JMWA 1JBQA 3UWSA 4EKGA 3GODA 4YTEA 1ELOA 3V2HA 2C7VA 1DJNA 1GU1A 3E3AA 4B9AA 4UM9B 1GKIA 1VI2A 2CJPA 5KYGA 1XRRA 1XUOA 5JHGB 3HA5A 2WWYA 1RHQA 1HYHA 4PGGA 2G3VA 1TQ8A 4NZ9A 1Q7CA 3VJMA 2HLDA 2QY9A 1JGTA 1MAHA 2OAEA 4PYRA 4RYLA 3FETA 621PA 3OQMA 2IM8A 3DFUA 4N0MA 5J4KA 1G4US 4V24A 1V37A 1K06A 5UKDA 1Y5NA 3T06B 2ATXA 1QQTA 3HJGA 4WOPA 4EGQA 3PYLA 3PQDA 1QPBA 4C76A 3I2FA 3Q3GE 4RPLA 4LSWA 3EIUA 4BQFA 1TWGA 3L9XA 4HWSA 3QVUA 1U8AA 4QUHA 3E3LA 3D4OA 5EJFA 3PJDA 3VPXA 1XDWA 2H9AA 4JHLA 4N5DA 1YJ8A 4IUDS 2GCPA 1SELA 3Q10A 3IBTA 5D3KA 1SM4A 1PNRA 1FK8A 1NZFA 1PL0A 5GIPE 4BMCA 4KQ2A 5KPJA 5B3AA 2R68A 2BFNA 4EHKA 1EZ1A 3WB9A 5JEDA 1WMSA 1PZEA 1ZBDA 4BU0A 3PXEA 4JZAA 1M1YE 1CUVA 5JO0A 1RWQA 2P0NA 4HAWA 4BQSA 3C45A 2EG5A 3DA8A 1LU9A 3LHFA 3FM9A 1ZVKA 3OEWA 3L4BA 3W8NA 1EVZA 1V6CA 2QVGA 2RCYA 3ITKA 3Q3VA 4IVQA 1YV9A 4V2UA 3O39A 4X92A 5AI9A 5E0OA 5KNLA 4UULA 3T3MB 1QYDA 3KHTA 4K05A 2DFPA 3RSSA 4G8DA 4JEBA 4YO7A 4OQEA 4HSEA 1YQXA 3ZXSA 5CVTA 1QKIA 4JITA 2CLSA 5EXDA 2FW6A 3OZDA 4B47A 1P9RA 1RP7A 3NHLA 3P2YA 4JEHA 3IS3A 2O8DB 4JC7A 3PXCX 4CEJB 2X22A 4IYRA 2D54A 4DMUB 4KTVE 1KSGA 2C5HA 1WB5A 2XYPA 5BMVF 2B4TO 1P9LA 3A14A 1Z88A 4TS9A 5AI8A 3TQIA 4A0GA 4BMDA 2MR6A 2QG6A 1WSAA 4PSAA 3QVGA 3RJ5A 2HC9A 2HXGA 1L7CA 2CHQA 2JFOA 2ZI4A 3EXEB 1XGKA 2J4DA 2N0SA 2UVPA 2ZE6A 1SUCA 5GJWC 1ZHZA 2ECFA 3ASOC 3HB9A 2J9VA 1RPAA 5HFNA 3RAJA 1Y63A 3ZN2A 4G09A 1PZXA 1X92A 3D1VA 2KWIA 1HTTA 3GT3A 3HYNA 3SSAA 1MBZA 4ND7A 1EIWA 3A7EA 1JG1A 1BR4A 1DIOB 5B53A 1TO1E 5JLAA 4ZTUB 1EVYA 2QMZA 3H4TA 1U2RA 3ZHXA 2WUVA 1Q84A 4D9CA 5LDDC 1TYBE 4XPYA 2B36A 3CKLA 3KEFA 3EGWA 2D5CA 3DMYA 2BL4A 4HP8A 3RC1A 2IEDA 1ZJJA 1C1XA 2VUUA 1X9GA 1O2DA 3CH6A 1HT0A 5TSDA 4XM2A 5IC5A 5FQNA 4Z3OA 5AHXA 2ZSKA 4A92A 3E9MA 2P62A 3HADA 3UK2A 1NDHA 3JWGA 2D1YA 3AIKA 1LNQA 1ID8A 1YB5A 1JAYA 1ULHA 5B64A 1AHNA 1QAMA 4I19A 5KYUB 1WXEA 2NZ8A 3ORYA 3QYPA 3WXBA 2R00A 1C3OA 3HVRA 3U4MA 4MPTA 5J4HA 2IHYA 5I9IA 3C8GD 2DWOA 4XGRA 2Q49A 2GDJA 2BDTA 4F9GA 1YAHA 2WFZA 1OMOA 1JEAA 2EV9A 1NE2A 4RHFA 3L8HA 5DTJA 3WWYA 4EFDA 2V5AA 3FFBA 1UBEA 1W76A 2BFDB 4G1FA 2QPAA 1TR2A 1UOQA 3WHLA 3FOEC 1V9CA 1YQTA 1DADA 2X5KO 3SKYA 5KNBH 3Q9LA 2WJYA 3L07A 4RE5A 5KTNA 3JSEO 4UNSA 3PPIA 2JDID 1JMVA 1GJRA 4TV9F 4KLCA 5KTOA 2PUFA 3WGHA 2BI8A 2XZOA 3C3MA 3RVNA 2Y27A 3PVCA 1TAQA 5IN5A 2OZLB 2QGZA 1KDYA 2JZCA 1L7PA 3RTCA 2Z4TA 3HC7A 4GR4A 3U48A 4DPKA 1PQWA 3KFLA 2F3PA 3LQRA 5KQLA 3SJ7A 3EH1A 1EAMA 1KFCB 3II6X 4GM0A 4OD5A 1D8AA 4KIFA 2I5PO 5F9HA 4PFKA 1A72A 2QQEA 1TQ6A 2VWQA 3SSNA 1JEDA 4YK5A 2ZJ1A 2ZVJA 4V0QA 3ZIBA 3JSXA 4AY2A 5IVHA 3DM9B 3SXYA 4HDRA 4KHZA 3VQTA 4EKYA 9ABPA 3D6JA 2W6CX 3VF0A 2IQ5A 2QGFA 1IM2A 1Q44A 1NSFA 2Z9DA 3P52A 2TRSB 1GDHA 2H2IA 3I52A 3KJXA 1UXGA 4DDWA 3IHWA 3JARA 2GYWA 1B74A 1XIVA 3RIMA 2Z4RA 3ZU4A 4DQDA 2NZYA 1V7PC 4W7IA 5GINE 4PCAA 3R1IA 3SZ3A 1XZAA 2C59A 2G67A 2VWPA 3U3KA 2JFGA 3V00A 4Z7QB 1C0PA 1U0HC 4MRAA 3U56A 4AULA 2E6UX 1LPSA 4GU5A 4JBHA 4LZAA 3GJZA 1SCIA 4BC0A 1WB9A 1IRXA 1U6JA 5DRYA 3QX3A 2FN7A 2XUJA 3O4JA 1FW8A 3DVQX 3VSBA 4C21A 2A3NA 5HVNA 4L9WA 3P4YA 1QHXA 3EA5A