2XXAB

The crystal structure of the signal recognition particle (srp) in complex with its receptor(sr)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
283
structure length
283
Chain Sequence
ISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFARED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Signal Recognition Particle in Complex with its Receptor.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Protein transport
molecule keywords SIGNAL RECOGNITION PARTICLE PROTEIN
total genus 82
structure length 283
sequence length 283
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00448 SRP54 SRP54-type protein, GTPase domain
B PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2xxaB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xxaB02
4OL0A 1QBKC 4M1WA 1DAFA 4XTRA 1JI0A 1S96A 2G0NA 2VHCA 5DI3B 4S35A 1XU4A 5JWOA 3UPUA 3GFTA 3GLIE 1DO2A 4V0KA 2ZUBA 4N0DA 5FPKA 1UKVY 3ZZUA 4BUJA 3THXB 2JLRA 4HAVA 3WHLA 3SDZA 4PPGA 1OH8A 4OQNA 3MMPA 3ZZTA 1NKTA 1N5LA 1CJMA 1NMXA 1Q1QA 1P2UA 2RHDA 2C04A 4D82A 1EFRD 1T3HA 4G5GA 4IDNA 1G8YA 2HUPA 4HDCA 4DCSA 2GDJA 4ZI3A 4TT3D 2GILA 4IXMA 3ND8A 1RC8A 8OHMA 2WOOA 1KMQA 2WSMA 4RSGA 5FBQB 5FUVA 4M21A 3RS3A 4HI0E 1SVKA 1XPRA 5EUMA 3ZD7A 3RNLA 1C9KA 1CJUC 2XZPA 2WSSD 2IYWA 2OSBA 2PCLA 3X1ZA 721PA 4JKIA 2QU8A 4M9XA 1G1MA 2IYQA 3DKVA 4JBYA 2MMCA 1GL9B 3NEJA 1AIPA 1N3BA 1XRJA 2AKAB 3QKRB 5EUQB 3NEYA 4B3BA 3QVUA 1JQJC 1XP8A 1M7BA 2YC4C 3I3SR 3NH9A 3QPUA 3GLGE 4PSAA 3ZJYA 3CPEA 4A6PA 2ZE7A 4ZCMA 2ZJ8A 5TXGA 1X1RA 421PA 4PHTA 3C7KA 4ILEA 4NL4H 3RRZA 1CEEA 3TUIC 2FOLA 1EG7A 1RRCA 2I3BA 1P60A 1UKYA 4YXWD 1D8TA 2QL6A 4L8GA 2ONKA 3IEUA 3LH5A 2KBFA 821PA 2JLYA 3C14C 3TVTA 1L2TA 2R6CA 4EPVA 2VP2A 3B5JA 1GKYA 4LJ8A 2QTFA 3WY9A 2IS2A 5GJWC 3A8TA 1YZTA 5GVRA 3TVDA 2GZAA 3K0CC 2ZI3A 3QBVA 5KNCA 4LSGA 3AVQA 1RRPA 1AS0A 2WAYA 4IJMA 4KXFB 1E94E 2DB3A 3V00A 3AB3A 121PA 2OO7A 2ZI6A 1TQ6A 4AY2A 3OAAA 3KJEA 2ZAMA 4OQXA 3BJIC 4LBYA 4CYMA 2WWHA 2ORWA 2O8FB 5JJLA 4G1UC 4QFMA 3T1OA 2CK3D 4TQ9A 3EIEA 2H5EA 2PEYA 2GCOA 4MYHA 3SBDA 4JLNA 2ANCA 1BH2A 5CLLA 2F43A 5FI1B 1P7CA 5TARA 1ELOA 5K8IA 5H70A 4B48A 2ZRDA 2QBYA 1GIAA 1MO4A 2QT1A 3K53A 2D2EA 1A5TA 2VHTA 2NTYC 2DWOA 1N0UA 4ESHA 5D3MB 1KSJA 4Q21A 3S1AB 1IN5A 1FNNA 1ZD9A 4Q9LA 4GOKA 3AM1A 4FCVA 2HEIA 3RWOA 2G1KA 2NZ8A 3P32A 2ZVQX 3WNBA 5LD2C 4DUGA 4MGIR 1AQYA 1XD8A 4C30A 1VG1A 2WPDD 4DDUA 3TR5A 3X1DA 3ZQJA 4HUTA 4LYHA 4CEJA 2DBYA 2OHFA 3VHXA 4KYUA 1OB5A 3P27A 1NLZA 3QKUA 4EIWA 4NZYA 1P9NA 1JJVA 2W2VA 2F3TA 3TKLA 1CBUA 4PC1A 3A1SA 3WBKA 2O8FA 3GLIB 3B2EA 2W0SA 2VP6A 4BFTA 2VTKA 2W6JD 2NOAA 2EYQA 1U2RA 3CRW1 2G1JA 2VQSA 1SGWA 2YINC 1VYTA 2FPKA 2XSZD 1G20E 2J0QA 2XNSA 3ZVRA 4E09A 1XJQA 2XEXA 4B6EA 1BOFA 4FCWA 5J40A 1YQTA 5LB4A 2V9PA 4O2LA 3WP0A 4DCUA 5CJ2A 2F55A 2QM8A 2F1RA 1RIFA 1TEVA 1P3JA 1HE8B 1Q1BA 2QRZA 3L0IB 4DIEA 1W1WA 3KZ1E 4DIDA 3CX8A 3SYLA 3U7EB 4C2UA 1VTKA 1ZW6A 4HDQB 1Z6YA 4JL6A 1DAGA 3FKQA 4NCNA 2QI9C 2FEOA 2YOFA 2RGDA 2JLQA 3WHKA 2OCPA 2W58A 4BPBA 4A82A 5FTLA 3ZVNA 3B1VA 1F2TA 4JLJA 4RFSA 1I2MA 3L0PA 4ZPXA 3SJBA 2QEQA 2GXAA 1W4AA 3LO5A 4C3ZA 1E9DA 1H8HD 2QMUA 2ZE5A 5EE5B 2QSYA 4X8OA 3ZDQA 5IF9A 5JSZA 2IXFA 1WBDA 2JLWA 3SFZA 1IXZA 4A2QA 1II0A 5EE9A 3I8SA 3PEYA 4P0TA 1G5PA 4KFUA 3SJZA 3VQTA 2FMXA 3A6PC 4DHEA 4KYIB 2SHKA 3JVVA 3FYHA 3FOZA 4B43A 3LFUA 3T5DA 4Q4HB 5B2ZA 3NBFA 4UQOA 3BGWA 3QI2A 2HLDA 4DLXA 4EPXA 4M9ZA 3WP1B 2VP4A 3Q9LA 1K5GA 2DPXA 2ZTSA 4C0QC 4HLDA 1D5CA 1E0SA 3FGNA 2CBZA 2AD5A 2R8RA 4F4IA 2C78A 4M1KA 4GP7A 1FZQA 3WMEA 2JJ1A 1AS2A 2RMKA 4QHTA 4WAUA 5FTJA 3TBKA 4BRUA 1GRRA 3EAQA 5B64A 1JR3A 3BD9A 2F3RA 3E1SA 3QXSA 4OI1A 1UPTA 3FKSD 2CHVA 5BQ5A 3VR6A 1P6XA 3CPJB 3AKEA 2F1IA 2IHBA 2FPMA 3NWJA 4MDEA 1X86B 1TUIA 1OFTA 3LW8A 4JIMA 4L5BA 4HZIA 1TL7C 1Q22A 2ZQ5A 3LQRA 4C0HA 1VYVA 5EP3A 1AZSC 2C9YA 4II7A 4KHZA 3MGCA 1AA9A 4WW0A 1R4AA 2D4HA 3E2IA 2GESA 5FI0B 1JQLB 1G6OA 1P2SA 3GLFA 4BLTA 5B57C 2N42A 1VIAA 3FHCB 2BWJA 3MWKA 4GOXA 4RD3A 3T61A 5CM8B 4L15A 4NDZA 5CM9C 5JS7A 5L8VA 3WYAA 4B73A 1P2VA 2AXPA 2JAQA 1SHKA 4F91B 4IDHA 1KI8A 1G3RA 2AX4A 3CWZA 1E1QD 3RLFA 2GJ9A 2GVDC 4DLRA 4PHHA 1JPJA 1EK0A 1N5JA 1NJFA 4OK6A 4MGZR 4LPSA 4LUCA 2LCFA 2YOHA 5L3SA 1OIVA 2XITA 3C41J 3GJ4A 4CIDA 4CEIA 1VPLA 2ZYTX 3MWLA 3VU9B 1NKSA 2HT1A 1V43A 2FWRA 1B23P 4A0RA 1S1MA 2J46A 1GP2A 4OHYA 4GL2A 1TEXA 5FOSA 3TIFA 1KSGA 1AGPA 1EFCA 3EA0A 5EE3A 3NDBB 4Q4JA 3I5XA 2RAPA 1XZQA 3H2YA 2JLXA 2KB0A 1MO6A 2ORIA 4R71A 2B8TA 4NYIR 4B47A 2O8DA 2REOA 4P4SA 4UNQA 2FN4A 1XNJA 1Z2CA 1JAIA 4N3NA 1OXVA 4MYUA 3I62A 1E96A 2FZLA 1KO4A 3FHTA 5TVKA 3OFND 2FFQA 4QGGA 5FTNA 3NC0C 4TLAA 1H8EA 3GJ5A 4D6PA 1YZNA 1U0HC 5JMTA 5LDDC 2ZROA 4B35A 1W7AA 1G8PA 1NP6A 4CDGA 1SVMA 4A8JA 4DC9A 2QENA 4TLBA 2A5JA 3TAHA 3R9WA 1IQPA 2YJTD 2IS6A 4QRHA 3AEZA 2BMFA 2ATVA 1OYWA 3BH0A 4WZ6A 3U60B 2ZRBA 2H1LA 2ERXA 2IYTA 3QXJA 1CJVC 5B30A 1VKJA 1Q3HA 2ONJA 2J7PA 3AGPA 2XOKA 2OAQ1 1TU4A 1EX7A 2QM7A 6Q21A 2J0SA 4TL9A 1JXMA 2FFHA 3PR1A 3Q5DA 2CHQA 2A78A 2GK6A 2V3CC 1E32A 2CMKA 1H65A 2MSDB 3QXHA 4DLSA 2AWOA 2J7KA 2VA8A 3KKOA 1EWQA 4YC7A 5B58C 3T35A 4B32A 2YZ2A 3M6AA 1ZM3A 1FUKA 4Q47A 1L8QA 2Z4SA 3A1VA 1OB2A 1XTKA 3D31A 4MRNA 4AC9A 2ZU6A 1NBME 3KUCA 4E22A 2W83A 3A1WA 3TQCA 1KGDA 4DSOA 1QZXA 5FOUA 3EZ7A 1AQUA 4LV8B 3PFIA 4LHYA 2CLCX 2QPAA 2QQ0A 2FZ4A 5SZJA 2XXAA 2WWFA 5A4JA 4M0LA 2BDTA 4OI4A 1E9AA 1E99A 2KSQA 3PG5A 1L7VC 5JFGA 2GJSA 3EZ6A 2CE2X 3DMNA 3I4LA 1VHTA 1N6KA 2D62A 5J4KA 2DFNA 3AP1A 1G64A 5HKKD 1AS3A 4PX9A 2CK3A 1KK3A 2XB4A 4ZCIA 1ESNA 3QOFA 5K8UA 4AD8A 2ZRGA 4CGZA 2UZ3A 1ESMA 1VCMA 2HCJB 5HZKA 1Q3TA 4G01B 5GADl 1W4RA 2YC2C 2WKPA 3WNCA 1ZC3A 2JLVA 1YU9A 2HJGA 1E98A 2BC9A 2RKOA 3HP1A 4TSFD 4TYYA 1OSNA 3QIAA 2V6IA 1KK2A 4B3FX 4TMTA 4XD7D 3IPXA 4D0NA 4QJ3A 1E9EA 3MJHA 2FPLA 4L9SA 3SU8A 3VX4A 5AUQA 4LYFA 2G77B 2FFAA 2XX3A 1COWA 3BOSA 3GLGB 1XMSA 4WA7A 4B2IA 4V02A 3LBHA 1W0JA 2ZS9A 2RB4A 1M7HA 4Q19A 4DDVA 1JAHA 1LV7A 3JZAA 3GJ0A 4EJSA 3FKSA 3A37A 4C9BA 1CP2A 3EPLA 2RCNA 1OLOA 2XJ4A 4P4SB 1KJWA 1O87A 1COWD 3SN6A 2O8DB 4OKSA 3QUSA 2ZVPX 1G7SA 3ZYCA 2W6IA 4UKDA 4BZQA 3QSYA 2ZJAA 4IDOA 3LA6A 5FUYA 4C0LA 3R7WB 1BIFA 3OE7D 3KKPA 1KZGB 2IC5A 1WQ1R 4YXWA 4HUQB 3LWNA 2WJGA 4C0KA 1SKQA 1W0KA 2Q0HA 2ZR7A 4Q18A 4BLOA 3EA5A 2DWQA 2QTVB 3DOFA 4WXRA 3SE0A 2CNWA 1G8GA 3ASYA 1N6NA 3VFDA 2XZLA 4C2TA 3THOA 1RRGA 3LW7A 1L4UA 5TB5A 4OK3A 1KZ7B 4XVUA 1LNZA 2IL1A 1NI3A 2R2AA 2CNWD 4B75A 2ZE8A 3K8YA 1EFHA 1Q12A 4F4JA 3VKHA 3DO6A 3ETLA 4DDWA 3RHFA 1VG0B 3FWYA 2JEOA 2OG2A 1NLFA 2QG6A 4RZXA 3TSOA 3N2EA 1EFRA 1M2OB 2CXXA 3K0AB 4TQAA 4ZDIA 2YWFA 1AZTA 1KI1A 2QP9X 1ZNZA 4IOLA 3TUZC 2JJ2D 5SZIA 2BV3A 2DYKA 3UATA 4A8JB 5KDLA 3P20A 2FA9A 1E2GA 3L0SA 4MA4A 2DFTA 2GEUA 4C4PA 4DJTA 1HUQA 5CB8A 1OKKD 5E3HA 4IFEA 2ZRLA 1LS6A 2O8CA 1Q21A 2X19A 1R5OA 2VIIA 3SC3A 1XTIA 3LLMA 3KTAB 4RVCA 1S3GA 1US8B 4NCKA 4Q4JB 3VTKA 1U9IA 1GL7A 1GKIA 4L4UA 3U44B 1XCMA 4KVAA 4AKEA 1E69A 2A5GA 3TE6A 1G9XA 3IO3A 5CDFE 5DNYB 1OV4A 3PUXA 2IXEA 2J7PD 5FTMA 1BYIA 3VU9A 4HZUB 1LS1A 2B8WA 5DSZA 4KBGA 3W8RA 5LD2B 3KJGA 1IAQA 4NONA 1DAEA 1DBSA 3SZRA 4NCIA 3LVRE 1KSFX 1KI6A 2AFHE 2EW1A 5DE3A 5EP1A 3PUVA 4HLQB 1SKYB 2OESA 3DZDA 4QBFA 2A3RA 4C0SA 1ZUNB 3KFXA 1VCOA 4ZKDA 3PENA 3QF4B 1KYIA 2JDID 5JSZB 1ZM4A 3GLFB 5KYKA 2FFBA 4GP6A 3ASZA 3EPHA 1YE8A 3CPHA 5JHHB 1RKBA 4HAWA 2DFKB 3CNOA 4I99A 2GZHA 2H7VA 5DLQC 3TNFA 5J4HA 3KB1A 2FDCA 4U5XA 5FR2A 2ZREA 3IEVA 2HT6A 2PL3A 3PITA 2ZJ2A 4IXNA 1KHTA 1XEFA 3NHAA 1ANKA 3FB4A 3TK1A 1S9HA 2GXQA 2R6AA 4BE7B 2BVNA 2Q3HA 5FBLB 1R7RA 3AVVA 2PX3A 2R65A 3UG6A 4JLPA 2P65A 3RS0A 3W6NA 3D7MA 1HY3A 2CLSA 3NVAA 2FE4A 2GKSA 4Z54A 4M22A 3K9NA 3NG1A 1KSHA 2VF8A 1E1QA 4IDQA 2QE7A 1WB9A 2ANBA 1PVOA 4NHOA 2WV9A 3B1WA 3L8ZA 4JZKA 2AXNA 1KMHB 2OXRA 3B82A 2GXSA 3OZXA 1IOZA 1WP9A 3PIRA 2B7CA 1G19A 3SFVA 3EPJA 1DTSA 3HU2A 3B9PA 4U00A 3Q85A 4I1SA 5JI3E 5J4YA 5J5CA 3WMGA 2D3WA 2YWHA 1UEIA 5AJVB 3G0HA 2QROA 3AVPA 4URXR 4V0NA 1JEEA 1DOAA 4TMZA 5FBWB 2AWNA 5HR5A 2W0MA 4H1UA 4C0JA 4UXHA 1V5WA 4JL8A 1KJZA 3TQFA 2AL7A 3OESA 2KE5A 2HYDA 4GPTA 2FSIA 1Z2AA 2E1RA 2ZYUX 2B6HA 4EJSC 2KBEA 1MRSA 4E07A 4NYJQ 1II8A 4PQFA 4R7ZA 1QVAA 1E2MA 2X2FA 3GPLA 2O0KA 4K46A 4MRSA 3RS4A 4I1UA 1E2HA 4Y0AA 1KNXA 2I1VB 5FL7D 1P75A 2PMKA 1E2LA 4BFYA 3LBNA 1R8QA 2ZJBA 3AVUA 1Z0JA 1TPZA 1W47A 3SYKA 1TU3A 1D2EA 1NJGA 1E79D 1VG9B 1ZD8A 4QM6A 4W9MC 4HLUC 3PEWA 3R9XA 1QG4A 4M1MA 1HTWA 5DH9A 3MFYA 4KJZA 3CO5A 3PCRB 1A2BA 3PJRA 4TZ6A 1IBRA 2H8KA 3A1TA 3AF3A 1Q20A 4JT2A 1ZM7A 2E87A 3EASA 4F7WA 2RH5A 1J7KA 1E2QA 1XDBA 3HPQA 3KKNA 2XJ9A 4G3XA 2VLIA 3BB4A 4JMPA 1TQ2A 4BEJA 2G6BA 2I1QA 3U61B 3IBGA 3BXZA 2UVQA 3R8FA 1MO5A 4V0LA 4R2IA 2CCJA 2EYUA 3K9HA 1BO6A 1SXJE 1TF7A 1ZD1A 3QQ5A 2IWHA 4OJQA 3ADKA 4NKRA 4Q02A 1Q1EA 5IDVA 3EZFA 4M1OA 2WKQA 5G3YA 2YKGA 1NIPA 3RAPR 1FW6A 1TMKA 1F6BA 3C5HA 2ZU0C 1NF3A 1ZCAA 3EZ2A 3PEVA 3HU3A 4Q66C 4O25A 3SQWA 3MSXA 1ZU5A 2B21A 3CRVA 4US1R 4YMUA 2D2FA 1TF2A 1XEXB 2QAJA 1R10A 2DWPA 1G8HA 4U02A 1CXZA 3J81k 2GJKA 2ZETA 3PQCA 4MUBA 2BMJA 4UNRA 5FL3A 3MUFA 1SKYE 3PEUA 4MITA 5FBRB 1YR7A 2BCGY 2WJYA 5D3QA 2WIBA 3REFA 3RYTC 3WRXC 2JATA 2RGNC 1DAIA 2QP4A 3LVQE 5KU1A 1GILA 1Z6XA 2JJ8A 4RD0A 4QBIA 5D3MA 3U3KA 1H8ED 3AUXA 3SBEA 4QOSA 4Q03A 1CULC 1DE0A 2IS1A 5CJPA 2WAXA 4GRAA 3K0EA 1VDZA 2F6RA 1KI9A 3RC8A 4PZYA 1UF9A 1S0UA 2QP3A 1KI7A 4TN1A 4F93B 3TMKA 4R9UC 1J2JA 2ZR0A 1M7GA 4MGYR 2VP0A 4N1AA 2GBLC 4FWTA 4AYWA 3KFVA 1UJ2A 1ZUHA 3IQWA 1ZNYA 3UWOA 1OH5A 2VO1A 1SVWA 1G21E 1NN5A 2O0HA 2DY1A 4JLOA 4MRVA 4BLRA 3BORA 4A15A 3QEJA 5EQTA 4EJSB 1EFUA 1Z29A 1ZMXA 4MKFA 4AG5A 2GHIA 2JLSA 4B76A 2XGJA 2W2TA 1XF9A 1MRNA 2FSFA 1KMHA 3QBTA 1GWNA 3NBXX 4LYJA 2OFOA 1A82A 4MKGA 2PT7A 3QY0A 2FV8A 3NBYC 3TLXA 1GOTA 2NQ2C 5SZKB 2Q3MA 4LGMA 2XTMA 2BIFA 2LKDA 1AK2A 1NY5A 2F1HA 2ZSEA 1NY6A 2R9VA 2YVUA 1EXMA 4DZZA 3IKJA 1QHHB 1E4YA 5HZHA 1Y3AA 2C03A 3QJYA 5TY0A 1OXUA 3W5JA 1ZRHA 1W4CA 1FP6A 3AGQA 2A5FA 4XOIA 2IS4A 1XD9A 2HXYA 4RD6A 4IFBA 3QKRA 1UBEA 4LCBA 4WBSA 1RYHA 4AKGA 1NG1A 3EWAA 5CIQA 3EC1A 3GD7A 1ZBDA 4O0MA 4QL3A 4OHZA 1DADA 3FE2A 1OW3B 2C2HA 4NCHA 3K9GA 3MRSA 4EAQA 5HE8A 2JIZA 4HSEA 4LBWA 1GVNB 3CX7A 4QKQA 5K8TA 2AHOA 4TL8A 2HJVA 2QMEA 2ZYWX 1KI6B 1UDWA 4WXPA 2A5YB 2W2XA 2JJ1D 3C16C 4FINA 3SHFA 4LJ9A 2H92A 2JIZD 4JLKA 2P6RA 1F48A 2WOJA 1LY1A 2CLDX 4JLDA 4ASUD 2BBSA 2I4IA 3OEEA 1N0WA 1P9RA 5JWHA 1S4QA 4TLCA 4MGKR 4US2R 1NSFA 1UEJA 4D80A 2QUZA 1PUIA 4B34A 1XTSA 4EQ6A 1DG1G 1XMIA 3A4NA 2A2ZA 2NG1A 3A1UA 3KTAA 4Q9JA 2VHJA 1RE0A 2XNDA 4HLUA 1QHIA 4DCTA 1II9A 2J87A 1IY2A 2Z43A 4KAXA 4BLPA 4LJ5A 5G53C 3QG1A 1TX4B 2WWWA 3FPAA 2J9RA 4US0R 2W6ID 2QMHA 1Q0UA 2C96A 2QSZA 2ZEJA 2YWEA 4G5QA 4QHSA 5EZ6B 1H8HA 1OHHD 1R0ZA 4FIDA 4HATA 3TRFA 5JBQA 1E9SA 1QDEA 2ODWA 1NMZA 2IYUA 4W5WA 3TH5A 2X2EA 2IYZA 4RKEA 1DS6A 4NU0A 2QY9A 4YLGA 4JL5A 2ZSDA 1AKEA 2J45A 1E3MA 1KI3A 3U7HB 1TUEA 1DAHA 1T3SA 3CIOA 2IYRA 5BN3A 5CITA 1GUAA 1RYFA 2A7QA 2X8AA 3F8TA 3KUDA 2NZJA 3N2IA 5LBIA 3M1IA 4JJZA 4QXAA 4KO8A 4B2LA 1TAGA 1XXHA 4Z51A 3ZIAA 4KODA 5H68A 4TZ0A 2FGJA 4PHGA 2CL7X 1HYQA 1Q1ZA 2ZI4A 3GJXC 3RRNA 2XZOA 4PC6A 4G5SA 2J5XA 1S3SA 5BXQC 3TGPA 1WBBA 2WJIA 4URVR 2WWYA 3BRWD 1T5LA 3SEAA 3PXGA 2Z6VA 1CLUA 3K0CA 4QHYA 5DHFA 1RJ9B 2RGXA 1XD2B 3VR3A 3ZH9B 1E2KA 4DLVA 1GDDA 5L3QA 5DHAA 1OKKA 1XD2A 2BKEA 4RFVA 4WZBE 3NKVA 4QGFA 3OHMA 4LYAA 3PV0A 4URUR 4TYNA 4JBXA 3T5GA 3HR8A 1VYUA 2J3EA 4AI6A 4FCTA 1W49A 4CF7A 4I81A 3OIVA 1XMVA 1JB1A 2IEYA 3BC1A 1E6CA 1M8PA 4QBHA 1P62B 4FI3C 5JRJA 4OI0A 5JRZA 4TLDA 1CJKC 3KL4A 1XCPA 3OEED 4ZDJA 3L43A 3NBZC 3ZZ0A 5KDOA 4BLSA 4DEXA 1E79A 1VECA 1XWIA 2QTHA 3I92A 4IKEA 1Z08A 1E2FA 4JYCA 1YRAA 3H86A 1GAJA 3K70D 4EDHA 5CB6A 4I4LA 1SXJC 4DDTA 1G4AE 1OXXK 5KNBA 4TWZA 2XTZA 4KITB 4DVGA 5C4GB 1JNYA 2ZRPA 1FOEB 1Z6AA 3GCGA 4CT5A 5FBVB 1LB1B 5C1BA 2VRWA 4Q1CA 3RC3A 2ZANA 3QKSA 3QNUA 4JSYA 1CU1A 5IK2A 1EGAA 4ON9A 1LF0A 2NO6A 3ADCA 4G5OA 3JZMA 4OYHA 3X1YA 3DPUA 1N0VC 3P4XA 5DISB 1E0KA 2A5DA 3E5HA 4TMWA 3CB4A 2REXB 5J47A 1W48A 2IUTA 3NHBA 2QN6A 3WBJA 1JR3E 3K1JA 2CJWB 4XTCS 1E1RA 4EQ6B 1KO7A 3QXCA 4KFRA 4YDSA 5HE9A 4OBEA 4TYWA 2EU8A 2VHUA 4AURA 1S1CA 2WMNB 2G0TA 5GJBA 3I73A 3O8BA 4TT3A 1DVRA 3AP3A 3MWJA 1E1RD 3W5IA 1UDXA 2BBWA 3GMTA 5JCZA 1KTVA 3Q7QA 3ZIAD 3GQBA 1NBMA 4M2LA 3EZ9A 5GJVC 2PX0A 1IN7A 3VMFA 4TMXA 1CRQA 3TR0A 2OE2A 1OXTA 4HB4A 1E2EA 3U2QA 5JECA 3T1TA 3VNVA 2O8BA 2A9KA 3CWQA 5KDDA 1HT1E 1FMLA 5LB2A 2FF7A 4A0GA 2EWWA 1W0JD 1CR4A 1E9RA 4RFSB 1UKEA 5EJEA 3CLVA 2QAGB 2WICA 4DLYA 4H9GA 1LFDB 2EFEB 2W00A 1GSIA 3EC2A 3CX6A 1W36B 2V7QA 1S8FA 4Q7LA 1KIMA 4UNNA 3VR2A 2ZRMA 1K6MA 2ODEA 1W2HA 2RGGA 4K81B 1LF5A 2OUKA 2R62A 2P5TB 4BEBA 2UKDA 5FTKA 1N6HA 5FPHA 4U7DA 3GLHE 2CCGA 4C0BA 3CW2A 1KY3A 1QVRA 2VSFA 4DCVA 2BOVA 4LWZA 1SVOA 1HV8A 4B3XA 1GNRA 1D9XA 3O8DA 4ZI2A 2ZSAA 2D7CA 3B13B 5FH9A 4HEJA 4JJKA 1VCNA 1D6JA 2Z83A 4PO1A 3CF6R 3G82C 3VR5A 2ZI7A 1QHSA 4KFTA 4RY2A 2ZRFA 1W0KD 3BH7A 4RCYA 5H1YA 5AWFC 4RKFA 2NO0A 4BQSA 1GRQA 1E9BA 4ABYA 4ACBA 4KI0A 4ZIRB 5E7IA 5G41A 2AFIE 3AUYA 3DZ8A 4RZUA 3N70A 4Z1MA 1TADA 2WKRA 2EFCB 2BM1A 1MOZA 4V0OA 3REGA 3W9YA 2N1BA 2RGBA 4PSKA 4DT1A 3O8CA 3AF1A 3BBPA 3NXSA 2AD1A 5F9FA 2BM0A 1G3IA 3THWB 5IHPA 1KO5A 3I32A 3OEHA 3GFOA 3LDAA 1TNDA 2Z4RA 4PC2A 3CH5A 1SULA 4O3MA 521PA 2V1UA 4AIIA 1Z0DA 5JI2E 1KDPA 2Z5FA 3X1XA 5L3SB 5AK0A 3LLUA 5F3WB 2PLFA 3ADDA 1U8ZA 2WTUA 3NIBA 2IT1A 2QGNA 2FSHA 4O2RA 4XD7A 1XCGB 2JJ2A 3QXXA 3KQUA 1ZC4A 3W34A 1KOFA 1KKMA 4LC0A 2VH5R 2ZM5A 1AKYA 1CS4C 4B3GA 2KJQA 5UKDA 4X8HA 2OLKA 4IOKA 4NYIQ 3EX7C 4EPTA 4B3DA 2QBYB 4IEEA 3FMPB 1D2MA 4MKHA 4OI2A 4ZDWA 2FG5A 4LRWA 3T1QA 2GXUA 4A6XA 1W36C 3BAFA 2H16A 4Q48A 1MABB 4DSUA 4J0QA 4Q4LA 4JBWA 1ZNXA 3QVVA 1TF5A 2C99A 2ZRHA 3H84A 3IIKA 1GG2A 3UK6A 2NGRA 2ZSFA 4LJ7A 4M1YA 1FPMA 4D4LA 4FMDB 1FMJA 3GJ8A 3I72A 3CF2A 3UMRA 4NYMQ 2QGZA 3AP2A 1BMFA 5P21A 2WJJA 3IDQA 3KQKA 1ZVQA 3AVYA 1E2IA 4GT1A 2J0UA 1RRFA 2B7BA 1RPZA 3CH4B 3L2OB 1CF4A 1PLLA 5G3ZA 4P33A 4PXAA 4A2PA 4QJ5A 2D74A 1TTTA 1HT2E 1WCV1 4JVLA 2H17A 3NH6A 3EG5A 4IHQA 1CJTC 3IILA 2QRNA 1OHHA 1SQ5A 3A4LA 3SOPA 1RFLA 1G3QA 3LXXA 3MWYW 1Z83A 1OH7A 4QC2A 4Q4HA 3W6PA 4NBSA 3I61A 3U4QB 1SVIA 2Q9CA 1UKZA 1R8SA 4MYTA 2XNDD 4BGDA 5CYOA 3LQQA 1MH1A 3VR4A 5LPNA 2GAAA 1X1SA 5AUOB 2QAGA 2GVZC 3HU1A 1SVLA 2BHRA 3IUYA 1XZPA 4IVQA 2JCSA 3OF5A 3IIMA 2ZRIA 5A0FA 1II8B 1TQDA 4Q4AA 5AR1A 1KO1A 1CTQA 2ODNA 1WA5A 3PVSA 3AH8A 5TV2A 3WXMA 3BIFA 5KPJA 2CL0X 4Z8XA 4YQFA 2CHGA 4WVFA 5CK5A 1KAGA 4TL6A 4B6FA 4P4UA 3ZGXA 3BWDD 4M1SA 1CR0A 2ODBA 2VP9A 3KB2A 3U4QA 4BASA 3DM5A 5EP2A 2QNRA 1JEDA 1OFIA 3THXA 1GTVA 4KV9A 1U99A 5EP4A 5AJYA 2YHSA 2AKYA 4PFSA 1O3YA 1ZM2A 4B3CA 4QG7A 3GJ6A 1US8A 5DO9A 1WE2A 1U94A 4TMKA 2RHMA 3WRYC 5FPSA 1HE1C 1KI2A 1Z0KA 1ZIPA 3C5CA 1J90A 4LJAA 5L3RA 1F60A 2F9LA 3EIHA 5HTKA 3GJ7A 3QEOA 1XPUA 1XX6A 4K8OA 1D2NA 2GTPA 2J0UB 1W4BA 2HDNB 2ZRNA 4XIGS 4AWXA 1U98A 1JXOA 3DVLA 4GZMA 1T91A 1YJ5A 1R5BA 5DGXA 2REBA 1MR3F 2JA1A 3GLIA 1T9HA 2BBOA 2PBRA 1N5IA 1EWRA 4A0HA 4KVGA 1J8YF 5FOXA 5C18A 1MABA 3VKGA 5TMPA 4GDFA 1ZCBA 4Q1DA 4BFWA 4PSVA 2E9SA 1IY1A 5CDFA 3C8UA 1IONA 4ZKEA 1YZKA 3KX2A 1U0LA 4FMDF 3X1WA 1XFAA 2EQBA 2QZ4A 3GEIA 1T8TA 5IK2D 2WBLC 2C98A 1I4LD 1DEKA 2IYVA 4E03A 1CIPA 2AK2A 2Q9BA 2IWRA 221PA 1VMAA 4DSNA 3OIUA 4EFLA 1FP7A 4XJXA 2QMOA 4MDFA 1A7JA 1MT0A 2V54A 2HCBA 1ZP6A 3HWSA 3S1AA 4A0FA 3RWMB 3Q8XB 4LV5B 3BH6A 4LOAA 1UFQA 1OFHA 2BCJQ 3B1YA 3LX8A 5G40A 3KXIA 3K0FB 4MUAA 4M9QA 4RCZA 2GA8A 1FQJA 5CK4A 5CYPA 2OT3B 5SZHB 4D4MA 4ZDKA 1DPFA 4XSGA 3T34A 3LX5A 5C4MA 1B0UA 3THWA 1WDTA 2ZRCA 2AN9A 4DT1B 3LNCA 4JVMA 4OQLA 1NBMD 3U44A 2GEVA 4IW3B 3D3QA 3QG5A 2Q21A 2VF7A 1F3OA 2O5VA 4RD4A 4B71A 4ZV4A 1FL9A 2GRJA 3FMOB 3SYNA 2IYSA 4ZIRA 2O8CB 1OPXA 5BYKA 4C0AC 1W5SA 5IRCD 2H57A 4FXPA 3VR1A 1N5KA 2IBMA 4FMCF 3EWSA 1T3LA 5JS8A 5DIFA 2ZE6A 1G17A 2ASEA 3RRMA 1XTRA 3Q3JB 4BWYA 3W6OA 4LC1A 3GLGA 1PLKA 2C5LA 2IUUA 4A4DA 1ZJ6A 1QF9A 4A1FA 1C4OA 3M4YA 5GVSA 3C15C 1RZ3A 2V7QD 3WMFA 2HYIC 2P0EA 1HEIA 4HAZA 4HLCA 2IYXA 2NO1A 4UJ5A 5J4VA 2PJZA 4DLZA 1T0HB 4PZLA 5KOYA 3LD9A 1AGRA 5TDHA 4DB4A 3AV0B 3IHWA 2ZJ5A 4N0EA 3RSOA 3B78A 5F2EA 1SZPA 4YONB 4TTRA 4X8LA 2QPTA 1JJ7A 1WF3A 3AKYA 5C2JB 2AK3A 1Z06A 5KSYA 5DYIA 1T0JB 1PUJA 1UAAA 1GITA 1NVUQ 3PUWA 2XTNA 5JJKA 1IY0A 4JYBA 2WJHA 4JLMA 2F1JA 1ODFA 2P5SA 1UADA 1U0JA 4R2HA 2BJVA 4AKIA 3GEHA 4JSTA 2O8BB 1DARA 2ERYA 3HYRA 3EPKA 2QT0A 1JBKA 3A4MA 1KK0A 2IA5A 2XXAB 1NVXQ 4LPKA 3U5ZB 4FD2A 1E2NA 1G41A 4OQMA 4JLBA 5H8WA 1M34E 5AUNB 1W44A 1Z3IX 3R7WA 5JZVA 1RVDA 4IVPA 4A9AA 1P4SA 1G18A 1OE0A 2OZEA 4A92A 4PQRA 3RRYA 4QJ4A 3MLEA 4GBMA 2WWGA 3NC1C 4BFXA 4PAMA 5IT5A 5KHOC 3OAAD 3DM9B 5EXXA 1E2DA 3U6KA 2WHXA 2CJWA 1LW7A 4TL7A 1R2QA 1IJEA 4DLTA 4Q1BA 1Q44A 2P2LA 4HB2A 2C77A 3CZQA 2MSEB 4LX0A 2GBLA 4DRZA 2VSOA 3KKMA 3ONWA 1QHXA 5DN6A 1OT3A 1JALA 3AF4A 2ZSBA 3H1TA 4JS0A 5FOVA 4IEIA 1CR2A 2GCNA 2NO7A 1BKDR 3QF7A 2TMKA 3WYFA 2D7DA 1P73A 2J0VA 2Q6TA 3CZPA 5EXSA 2ZRKA 4JLVA 4QM7A 1FTNA 3RANA 1SXJD 4MRPA 2F9MA 4CT4B 3VX3A 4M9SA 4ITRC 4D4KA 2G3YA 1IHUA 2C8VA 3IPYA 1OJLA 1Z0FA 4MQBA 2NPIA 1FX0B 1SXJA 1XEWY 2FU5C 4PO9A 1Z6TA 5KSOA 4NCJA 1N6LA 4WOPA 3VHLB 4Q7JB 3R8CA 1E0AA 1NN3A 3WNDA 5AJWA 3M0EA 4ARZB 2IXGA 3UWKA 1LVGA 2WZQA 3T15A 2B92A 3F0TA 3ICQB 3CF0A 1PJRA 4LHWA 3HPRA 2HF8A 3MD0A 1OYYA 2FH5B 3CNNA 2OCYC 1ONBA 4RZ2A 4E5UA 2VSXA 4LV6A 4UJ3A 3SI7A 3UG7A 2XB2A 2OBNA 4PC7A 1P5ZB 4PC3A 4AG6A 4BZXA 5BWMA 1XB2A 3UMSA 4Q00A 1Z63A 1Z0IA 3CRQA 2QA5A 3CUEF 1NSTA 2LWIA 1P72A 4TTPA 5E7JA 2OCAA 4EFMA 1F2UA 5JJIA 3B8HA 4QGAA 4PAQA 1F5NA 4DKXA 5EXPA 4XVQA 5E4FA 3DEFA 5FPTA 5J4LA 3KJHA 2IYLD 1R6BX 3B1XA 3U3OA 4B2PA 4A8JC 1MO3A 4GFDA 4Q5IA 4YDHB 3LY5A 4D0GA 4IVRA 4NPHA 2Q9AA 1W36D 3RS2A 1YR8A 2EFGA 2KI5A 5BYJA 1G7TA 3THYB 1N2CE 4GZLA 3CRRA 3K9LA 1G7CA 4QNRA 3A58B 1NN0A 4NMMA 1VG8A 1U90A 4PHFA 1XEXA 2C9OA 1YRBA 1KI4A 1X8JA 1E2PA 1YZLA 1Z28A 2GJ8A 2P6NA 4G5RA 1PV4A 4OQFA 2CEAA 1FTSA 2ZPTX 4P32A 2GK7A 4M1TA 1HA3A 4HDOB 5JEDA 2Y8EA 4BFVA 4YMVA 3KXLA 1GNPA 2WSSA 3A36A 2ZJZA 4L9WA 2WPDA 1WRBA 2OV2A 2BJWA 4A36A 3BE4A 5KTYA 2C95A 1EX6A 1QG2A 2GETA 2ZJOA 4GNKA 3HDTA 3K09C 2BBTA 2VEDA 4P31A 2HF9A 3T06B 4DUGD 1S9DA 3LAWA 2OM2A 4AK9A 1PLJA 2RGEA 1KO8A 4IRUB 4HAXA 4W5HA 3UXMA 4DXAA 4IDPA 1KDTA 4DB2A 3TSWA 3ZS9A 3NTUA 1Z5ZA 4Q9IA 3G5UA 1P2TA 3B60A 2ZUCA 3K0SA 5JLJA 3AVWA 5KO2A 1K5DA 2YOGA 3FVQA 3FTQA 3FHOA 1AJEA 2PLRA 3PUZA 4WIAA 5A5GA 3B6EA 4C7OA 1KDRA 4LHZA 1YKSA 3L0OA 4FMCB 3R20A 3N5CA 2QPOA 2DHRA 5GJCA 4FMBB 3C4JA 4LJ4A 2R44A 5JEEA 2X1VA 3TJZA 4F92B 3DDCA 3Q7PA 1R0WA 1I4TD 5AJXA 4DSTA 5L3VA 3DOEA 1ZU4A 3W90A 2CVFA 4Q4AB 4PANA 2BKUA 4HAYA 2JGNA 2BMEA 3H0KA 2GJAA 1MV5A 2FSGA 4AYTA 1OXSC 3CR7A 2VYFA 4UNSA 2V6JA 3BB1A 4TLEA 4W7SA 3VNUA 4CEHB 4DWJA 2OLJA 2ECKA 3MCAA 3W3ZB 5BN4A 4URYR 4Z1MD 1AN0A 1K8RA 2O8EB 3TAUA 1DAKA 3GEEA 4I1VA 1U8YA 2QE7D 3RSLA 4AKHA 4LJ6A 2IF0A 2VBCA 3GLHA 1E0JA 1QHHA 3F3YA 4XWKA 2ZJYA 4AYXA 3V9PA 4Q1AA 4LDJA 1NRJB 3ZVMA 1GNQA 2OCBA 5DI9A 2PZGA 2ZI5A 3AQ4A 4QBGB 4CRWB 4FN5A 1G16A 1TQ4A 1G7RA 5F9HA 2ZRJA 3VAAA 1N6IA 1JR6A 1VHLA 3TW8B 3EW9A 5CLQA 5KNDA 1OF1A 1G3UA 3IO5A 2WJVA 2HLDD 3GLHB 4EUNA 2Z0MA 1DELA 1GRNA 1S2MA 4LHXA 2JLUA 3L82B 3BS4A 3ZQ6A 2ZXUA 4CW7A 3EARA 1X6VA 4BFSA 3CNLA 1T8UA 2ATXA 1NVVR 2H18A 4TYPA 4F38A 1Y63A 3PUYA 3EXAA 4V0MA 3MAAC 3V4RA 4LBVA 4CEJB 2XOKD 4LHVA 2XSZA 5K8LA 4LK2A 2NO9A 1A1VA 1G291 3P26A 3EIQA 2UZIR 3P4YA 2WWXA 4XH9B 3QF4A 4QNMA 1X8LA 1IXRC 4L16A 1VIYA 1F2TB 2ORVA 2QQEA 4M8NE 3UANA 3IHLA 1X8KA 1IN8A 1N6RA 2ZRAA 4BFUA 2ZUDA 3U6BA 4M53A 4PPFA 1WGWA 4XVRA 5FL7A 1YHNA 1Z6GA 4OJKA 1ZIOA 4C7OB 3AKCA 3QPVA 4XSHA 1G8FA 4NP6A 4HZUA 2GZDA 1ZUIA 3AVOA 3SS8A 3GP8A 3KJIA 4B33A 5FPYA 1Q57A 4EFNA 4OHVA 2PH1A 2O0JA 2JDIA 2GCOB 2YV5A 4UXJA 5JWRA 3DMDA 4NH0A 1L4YA 1A2KC 2VL7A 4D81A 2YYZA 4B74A 3K70B 2R6FA 3NDPA 2Q3FA 5EZ5A 5FOTA 1CR1A 3HYTA 2NMVA 3RS5A 3IBYA 2MSCB 5HCNA 3WYGA 1W2GA 1FFHA 5FUWA 1YR9A 1NIJA 3ICEA 4S2EA 4CVNA 5ANRB 2FJUA 4G0NA 1OH6A 1JECA 4POAA 4GOJA 4HB0A 3DL0A 4IOMA 3RVBA 2IX3A 3UKDA 3W3AA 1U81A 4PPQA 2MMGA 2WMOB 1KKLA 2PMDA 2WM9B 1XTQA 2QAGC 2D06A 2ZITA 5FOWA 2R6DA 4D4JA 3U7FB 1U9IC 2VPPA 2IW3A 3AF0A 1ZM9A 2OXCA 2GAOA 4Q7MB 1AM4D 4YMTA 3CRMA 4RD2A 4MKIA 1RW4A 2G83A 1XEWX 5FUXA 1GKUB 2EVWX 4V0ME 1KK1A 4MYCA 2RGAA 2OBMA 4D0LB 1G3MA 2P6UA 5DN6D 2IYYA 3SQXA 3CBQA 4FWIB 2GEDA 4P3YA 3MG9A 4QGHA 4CZ2A 4R98A 1XMJA 1FNMA 1VCIA 2CVHA 3OIYA 4X8MA 5HCIA 621PA 2K5UA 2OFWA 3FDIA 2OEPA 3GFPA 3LRPA 1P61B 1BMFD 3KQNA 1BYUA 4HAUA 1F2UB 1IXSB 2PEZA 1M1YE 4EKDA 1J8MF 3B1ZA 1JR3D 1SVSA 2F43B 2CE7A 4LBZA 5KUTA 2ZI9A 1Z47A 4JLAA 4KCGA 2GWHA 4DEYA 2P67A 1NMYA 2CCKA 4ZO4A 4BFZA 2PZFA 1CKEA 2G88A 1XXHE 4V03A 2V4ZA 4KSBA 4KLNA 2ZS7A 1E9FA 2AR7A 4D25A 3RABA 2DCUA 3OEHD 1ZAKA 2WIAA 4HYYA 3P1JA 3X2SA 3OIWA 5DI3A 4GMXA 5EE1A 1W46A 3DHWC 3W8NA 1YZUA 1FX0A 1SXJB 3HJNA 2BEJA 2IK8A 1G5RA 1EFTA 1OIXA 1NL3A 1QHYA 2RGNA 4MRRA 1HQCA 1KY2A 2F7SA 5JCPA 3KXKA 3U3JA 1Z22A 1T5IA 1YZQA 3IIJA 4TQUS 1ETUA 4RD1A 1KAOA 3BFKA 2EFDB 3TW4A 1XTJA 3B7GA 2JLZA 3U3RA 2CDNA 3QKTA 3V4FA 1E2JA 3RS7A 1R5NA 3RDPA 3TSZA 1T6NA 1LTQA 4DCNA 2O8EA 3IGFA 2FX3A 3D8BA 3ECCA 1OFUX 4OHXA 5C46F 4NE2A 3Q5EA 2EWVA 1C1YA 4KFSA 1KJYA 3K70C 1IN4A 1HH4A 4XWOA 1X3SA 4CEHA 4KSCA 3DKPA 5AUPB 3T1VA 5HKKA 4EPYA 3IQXA 1A4RA 4RZ3A 4XWAA 4BZPA 1FUUA 1WXQA 4TSFA 1I2DA 2P3SA 4LZZA 1JPNA 3B85A 2OAP1 3UIEA 3ZS8A 4DBLC 4EPWA 4DLUA 3CR8A 3O8RA 4PTLA 1U8AA 4P4TA 2BEKA 4HB3A 2HV8A 3BB3A 1NVWQ 4PPNA 1M6NA 1NVVQ 4H1VA 4Q1EA 2XAUA 3SNHA 4JT4A 2BMDA 4M4SA 1R0XA 1FQKA 3K09A 2FNAA 2J41A 2A30A 5F98A 4NYJR 4TTQA 2ZS8A 1HQYE 4BRWA 4LY6A 2HXSA 3ZD6A 3AKDA 1E9CA 4BLQA 3ADBA 5EE0A 3HR7A 1RJ9A 2PCJA 4Q9KA 3Q72A 2W6JA 4BECA 5CIWA 1NN1A 4TMVA 2QORA 4LJYA 2O52A 4Q9HA 3F5FA 3BERA 4ACAA 3H4MA 4ASUA 3I5YA 4GMDA 3TUJC 2ZR9A 2IF2A 3U3MA 2IHYA 4Z8YA 3U7GA 5BN5A 1NLYA 3LBIA 3SR0A 5KSPA 4OK5A 2VP5A 3QENA 3SJCA 2RGCA 1XXHB 4A2WA 2CL6X 4DLWA 5HPYB 3GLFE 2X77A 2IUSA 2ZYVX 3SHWA 1IJFA 5ELXA 1EESA 1PZNA 5JHGB 2IEZA 3QKSB 4D26A 1YZGA 4KBFA 2N46A 1OIWA 4TYQA 4YMWA 1UBCA 1Z8FA 1GZSA 1ZYUA 1W5TA 3BFVA 3MJRA 4I1OA 4KLZA 4LI0A 1KNQA 2YNMA 3CONA 3VKWA 3KQHA 3K0AA 4KU4A 4URZR 4GI7A 4Q7KA 1Z07A 3KKQA 3BK7A 4Y0VA 1NG9A 1P9WA 2GF0A 2GNOA 1I4DD 1ZINA 2PT5A 4PO8A 1XJ0A 4ZCLA 3SJAA 3QPWA 1GFIA 1XBTA 1DAMA 4D2IA 1D9ZA 1UM8A 2VHQA 3KQLA 3THYA 1XPOA 3T12A 1HURA 2C9CA 1G6HA 2J1LA 3FFAA 3I8XA 3JVUA 1M74A 2R6GA 3FFBA 1YR6A 2V8OA 4JVSB 4JVNA 1QHGA 2L0XA 2OILA 3I1FA 3OFNA 1J99A 1G4UR 4W5JA 4Q1FA 4ERNA 2OFXA 5L3QB 3QE0A 3FMFA 4GSYA 2KWIA 4CEIB 2FGKA 2ZIAA 3K0FA 4HUQA 4UXIA 4ESVA 3KDSE 1UBFA 3B9QA 5E7MA 2OBLA 2V1XA 5FFMA 3AVXA 2DR3A 2WVJA 1MKYA 1GL6A 3R9IA 3O47A 1G5TA 4F4CA 2NIPA 1YVDA 5FR1A 1WMSA 3FMIA 3AF2A 4PR0A 4Q01A 2NPFA 1DG3A 4URWR 3AVTA 4ARZA 2G9NA 2V55B 4NTZA 1N25A 3ND9A 3ZVLA 2FEMA 5KSZA 1CRPA 4FW9A 4NYMR 2WWIA 1R0YA 5KPDA 3GJ3A 3OE7A 4PZZA 3ZLJA 4RJLA 4PQYA 1Z0AA 5EXTA 1XJCA 3D6TB 3LXRA 2PZEA 5E95A 1ZNWA 1QHNA 2LKCA 1N6PA 1SHZA 1KDOA 3BFXA 4PAOA 5DYGA 3LV8A 2J59A 4B44A 3E70C 1E4VA 4OHWA 4WZAE 2YWGA 4MH0R 4EPRA 2ZAOA 1UBGA 4JKYA 2JASA 2PJRA 1BS1A 1T4GA 3CM0A 1GM5A 1IN6A 4UNPA 1DO0A 4YMSA 5BW8A 2GCPA 1N6OA 3L8YA 1NNEA 2DFLA 5AJZA 1QRAA 5M04A 1IM2A 2EFHB 4IOJA 3CKLA 2GF9A 3UMFA 1J70A
chains in the Genus database with same CATH superfamily
5CA1B 1UPBA 2CZQA 4OL0A 1PV1A 5E2AA 3F49S 4M1WA 1DAFA 4RDCA 1JI0A 3LF1A 5JWOA 4FWVA 2VHCA 4XWWA 1XU4A 3L4BA 5LN1A 3HR4A 1CDZA 4HGOA 5CLGA 2D54A 3W6ZA 3GLIE 3D3NA 4FCCA 4GZ6A 1O03A 2ZUBA 4IG4A 4Y8VA 2JD3A 1DRVA 1UAYA 1UKVY 1WVMA 4BUJA 3THXB 1RP1A 2JLRA 3U17A 3UK1A 5HQ3A 1CZHA 1TWAA 3SDZA 3SIPA 4AJ4A 4CM3A 4O5OA 5AHXA 5HM6A 1BCSB 1QV9A 2JX0A 1BU5A 4L57A 1KEPA 4RIHA 3RREA 4EGCB 1FFSA 1W581 3D2CA 4YRZA 1DCKA 4MP3A 5K3AA 3WLKX 3DHVA 1GPYA 3K7DA 1SBYA 2DTDA 5KYUA 1F2DA 1G8YA 2AFIB 2HUPA 4EGJA 4ZI3A 3KEOA 4OMCA 3K1YA 1G5HA 1YDFA 3NONA 4RVHA 4RSGA 2ERCA 2WSMA 1CPRA 2QMQA 1KY4A 4RENA 1XPRA 3RNLA 5ICCA 3HB4X 1JG7A 2DGDA 2IYWA 721PA 1BW9A 5KYYB 1FMTA 1H2YA 2QU8A 3GC6A 2GB4A 2IYQA 3MJFA 1TEZA 2B61A 4JBYA 1ULBA 3M5PA 3D4OA 1GL9B 3NEJA 5D5PA 5E1OA 2XGJA 4JAVC 1XRJA 1CLEA 2AKAB 1HETA 3HP4A 5A71A 3NEYA 2GWWA 3O8OA 4B3BA 2FOXA 1R4TA 4YHHB 2PX2A 1TAUA 2VQ3A 5B3LA 2NU7B 4ZCMA 5IZ4A 2ZJ8A 5TXGA 3OZTA 4JASB 3WL8A 3ZXIA 1W8DA 3Q7SA 3EZNA 1W5FA 3VTFA 3R5XA 2VT2A 4P3XA 4J7TA 2ACKA 4R9NA 3RRZA 2YJ3A 3MYRA 1AH2A 2FOLA 5CX4A 1RRCA 4FB4A 2CCYA 3O4JA 1P60A 3HY6A 4YXWD 4YT4A 3GCDA 3BL5A 4K9NA 4YJHB 2AEEA 1YCHA 2KBFA 821PA 3KLPX 3ZTZA 2XXBA 4IUDS 2X7JA 2H5IA 3C14C 2I87A 2R6CA 4J43A 1ILEA 1QQTA 4MWGA 5HP4A 1N2CA 3EMDA 1GKYA 4IXTA 3IPLA 1G0OA 2QTFA 4LJ8A 3T9DA 2PSJA 4BMYA 4ZMSA 4X44A 4DQ0A 1Q92A 1YZTA 5GVRA 2GZAA 3K0CC 2ZI3A 2JKVA 3JATB 4HVAA 2JFPA 5K45A 1PJLA 5KNCA 1AS0A 1TVKB 1TZMA 2QSUA 2WAYA 4FN4A 2HV6A 4ENUA 1YMVA 5C7OO 3R2JA 3ID6C 2HAEA 3AB3A 3LCVB 3QTTA 4ENPA 3E9ZA 2AMVA 2ZI6A 3I1IA 1HYGA 3L49A 1Y5LA 4OQXA 4HY3A 2R4QA 3WJ7A 2JI9A 2WWHA 2ZK7A 5IHXA 4JGGA 3PQ8A 4CM4A 4LE2A 4QFMA 3LHIA 2VAXA 2IP4A 3AB7A 4A1OA 4XD2A 1HXHA 1ZH2A 3EIEA 2H5EA 4TTAA 4B46A 5DNCA 2GCOA 4UU8A 1T0BA 3QUBA 2P4UA 4JUAA 4XUCA 2AX3A 4JLNA 1AKQA 5E38A 1BH2A 4IZHA 4Z2YA 2V6MA 3BXHA 5CLLA 1EZZA 1OCCC 5FI1B 2JGLA 4LCEA 5AVJA 1HNNA 4EHJA 1JG6A 4JC5A 1ELOA 5EWMA 3D9QX 3GMSA 4BP8A 2VCYA 3IUNA 3OPXA 1SB9A 4UAVA 2C9MA 3ST7A 1A9RA 2QBYA 4KQJA 3JQDA 3PICA 4LNUA 3UUGA 2Y0EA 5I9TA 1A5TA 3RYIB 3UHFA 4ESHA 3DCJA 1KAEA 1KSJA 2AZDA 2XQKA 1FNNA 5D3MB 3WGNA 5IJ9A 2PUTA 3AM1A 1M1ZA 2G1KA 1KH3A 4YJDA 1M2EA 4NARA 5BVGA 2WHYA 3EVBA 5DS4A 3S1SA 2F1OA 4AXXA 1RIIA 3CR3C 4FEEA 1AQYA 1R5JA 3A10A 1XLVA 4C30A 4EJFA 4E0IA 3RD5A 4DDUA 2A6HF 1ZWLA 4NS1A 4CN9A 2DBYA 1W2WB 2HL6A 1EJ2A 3EXFB 3K2BA 3VHXA 1GCAA 5IYZB 2WHPA 3N87A 4X24A 3WAKA 1AQNA 2H2GA 4KAJA 5K0CA 3BIOA 2N3ZA 3RUAA 4FC7A 1RU3A 1W96A 1G21A 1JJVA 3ZEAA 2W2VA 2I7DA 4R8RA 3OZEA 1PQYA 1W93A 2P5YA 1IVNA 1I8TA 1IHXA 1R6VA 2ACEA 2XDQB 3M3HA 3WBKA 4CM4B 3MJSA 3BCSA 2ID4A 2WTAA 2W0SA 3B2EA 2ZCUA 3G7NA 3NBQA 2EYQA 3I9KA 1U2RA 4M83A 2B30A 4II2A 4O2BF 3EOZA 4YN0B 4FQ7A 2YINC 4QQNA 3ELDA 4G26A 5JANA 1U28C 2VJNA 4UEJA 2XSZD 2AC7A 3HYNA 4Y2HA 4NDNE 3RO7A 1G20E 2B0CA 2XNSA 3ZVRA 2XRYA 4RS4A 3SZGA 4INJA 3TW8A 3UAYA 4B45A 5NLLA 2P68A 4NNPA 4MTFA 4ZFNA 3S2SA 1PK7A 1QMGA 4G65A 1SR2A 5CJ2A 4Y2XA 1V8FA 4IHJA 5EZYB 1NKVA 4FXOA 4R32A 1WU8A 3G0BA 1P3JA 1Q1BA 2XLMA 1LRLA 2C2YA 1RAGA 2VUHB 2XWQA 3D4PA 2CDAA 3G0DA 3UA3A 4CIBA 4LWPA 1FFXA 1W7AA 2CZCA 2B4TO 2WLSA 4WOJA 4B7AA 3H9BA 3UFBA 4C2UA 1E6EA 1ONNA 3WIOA 3RQFA 4HPWA 1Z6YA 4JL6A 2GN4A 3FKQA 5K05A 1RI4A 2QI9C 2FEOA 2H59A 3AEUB 4XB2A 1AK9A 2GO1A 5F1YA 3SSOA 2JLQA 1PT6A 3R5HA 4HMPA 1HEYA 2GHQA 2W58A 4BPBA 1R0CA 1XA4A 2HREA 2VJOA 3CLHA 4BZWA 1XVUA 2LPMA 4GE0A 3FX2A 1Y8ZA 3GFRA 5FTLA 3ZVNA 1RMQA 2P3LA 3SJBA 2C9BA 2GXAA 4LE0A 3L34A 3MPUA 3C1OA 1W4AA 3TRJA 2PO7A 2G4VA 4C3ZA 2FMKA 4CPDA 3HTXA 5IUNC 2D5AA 2QSYA 1DU4A 3HWX1 3MBKA 4MINA 1HNWB 3OCYA 3TL2A 1NW8A 3DFMA 4LVOA 1BE0A 1ZUNA 2XI4A 3QV2A 2XF2A 1PFYA 5DNAA 2DJIA 3PL5A 4YRAA 1ZVJA 5TT0A 3V8NA 4XX0A 5EEHA 2L42A 4QA9A 1Y6ZA 5F3WB 3KJXA 5EMMA 2GCIA 2Y69C 3A6PC 1U1DA 4DIFA 1UK8A 2C4TA 3HI6A 1NQ5A 4BTEA 4DA9A 5K6AC 1J42A 3FYHA 1ZK2A 2AQIA 3LFUA 4Q4HB 2TMDA 5CA1F 5KKAA 4KR6A 1RABA 3UOAB 3M4NA 4L3WA 4NMLA 3TZEA 2HLDA 3BWEA 2O0MA 4JTAB 4DLXA 1F4PA 3B29A 4MW8A 1I3KA 2I7XA 2NZUG 2VP4A 3F9IA 2F8LA 1TGVA 2DPXA 2PKEA 3Q9LA 5GPBA 3CN7A 1P7VA 4QARA 1E0SA 3QPDA 2CBZA 1XL0A 2AD5A 2YW2A 2QS9A 2H9YA 2ZPUA 5KQRA 4OU5A 1ADBA 5FBKA 2NP6A 2AYZA 3TBKA 3BGOS 5LP6F 4MVZA 2Z95A 4Z4QA 1JR3A 1A7EA 1DTWB 3E1SA 2UDPA 3P0RA 2CL5A 1DBRA 3FKSD 4WJ0A 1D04A 1SEPA 1H0SA 3VR6A 4K9MA 4L0MA 1RWNA 4DQKA 2FSPA 1YZFA 3ZTTA 3AKEA 2IHBA 1M76A 1YR1A 3LPNA 1X86B 4NE9A 3TLGA 1TUIA 2PSFA 4HS4A 4H1WA 3N28A 1J56A 3HKDA 4L5BA 1ZGAA 3N6XA 5AXCA 1TL7C 3BZWA 4DWOA 5IWCA 5CD1A 5EP3A 2NUPB 1AZSC 3OP4A 3EG9B 4DNOA 5DNUA 2VSNA 1DB3A 2DT5A 1AA9A 4M8LA 5BQ3A 1R4AA 3MUEA 4IWBA 4G1VA 2JGJA 1NNUA 1YFLA 4BV3A 1LSSA 1Y1RA 1G6OA 1W8IA 3DF7A 4BLTA 5IANA 3GLFA 5JP7A 2X3FA 4MTCA 5C1PA 2BWJA 4PYOA 3I2GA 3MWKA 2OYRA 3T61A 5CM8B 4L15A 1I0ZA 2LBPA 1OQAA 5KAPA 4F4FA 1USGA 1DJOA 1Z7GA 3DTVA 3NP7A 2G9RA 3WYAA 1XROA 1SHKA 1KMNA 1Y5RA 4KZPA 4LTDA 4IDHA 4MDHA 3RLFA 2GJ9A 2GVDC 3E35A 4Y67A 2HJMA 2Q1XA 2HSBA 1D6SA 3LQKA 4N0MA 1PN3A 2YJGA 2ZIVB 4MGZR 1CUGA 4OK6A 4LPSA 3VR4D 1CRLA 4LUCA 1VL0A 3CW9A 2ECFA 4G1BA 3OT1A 4CIDA 5IKPA 1RT9A 3OQ6A 1VPLA 4J76A 5CIYA 2ENUA 4F0JA 5ARCA 4NY3A 1IXKA 1YUBA 4C6TA 2FWRA 4DRIB 1EFPB 1PGJA 2J46A 2C31A 2VXYA 4EA9A 3UMMA 2DR2A 4OHYA 1TEXA 1E4EB 1C30A 2JLCA 1MGPA 5B1BC 3M1CB 3UF0A 4QX6A 3EA0A 5EE3A 4Q4JA 2FMIA 2RAPA 4OM7A 3H2YA 3RT1A 1ZUWA 4QDTA 5FWNA 3CLUD 2JLXA 1MO6A 2ORIA 2E49A 2HRDA 2A94A 2XMDA 3UAXA 4NYIR 3DBRA 3FUVA 3H4IA 1Q3KA 2EL7A 1V7QA 1PHPA 2Y1KA 4CGYA 2FR1A 3WQSB 1ZR4A 4IGGA 1RM0A 4N3NA 1ZI6A 2CSXA 2CVQA 1OXVA 3ELBA 1RC0A 2A88A 2FZLA 1QZZA 2FW1A 2VJKA 3BWVA 3LDHA 4X7PA 4U3JA 2I55A 3T3GA 5IMSA 2FFQA 4QGGA 4RH3A 4Q5SF 5DT2A 4J4HA 1N78A 4JEHA 1H8EA 3WFJA 4PGAA 4Z7NB 3M70A 3TM5A 4D6PA 1MA0A 5JMTA 5LDDC 2F1KA 2FVXA 2ZROA 4CDGA 1A0OA 4ND2A 2XCLA 3Q6MA 4NR0A 4A8JA 2A5JA 2XB8A 3VZRA 3R9WA 1IQPA 2CHEA 2I3DA 2D0DA 1V26A 4KJXA 4EG3A 4IV5A 1OX5A 1ZRMA 3MWDA 4WZ6A 1ISHA 1PWEA 2OV8A 4FLEA 3H9CA 4WLUA 2H1LA 3QXJA 1CJVC 3ZLTA 5DSTA 4EGAA 3LGSA 5DBHX 3HVRA 2XOKA 3GJRA 3OJFA 2PFSA 1EX7A 1MDBA 2QM7A 3MJCA 4TL9A 5F5HA 2ZYHA 3H42B 3INGA 2JH8A 2VF4X 3LNMB 2H51A 1OLSB 2V6GA 3Q5DA 1DNPA 2CMKA 3M3PA 5KTTA 5JROA 5THXA 1TKCA 2FPWA 2V5VA 3QXHA 4DLSA 3E7DA 4DUYB 1L6RA 1YA8A 3CS3A 2VA8A 5D84A 1I3NA 2X3YA 3K73O 2CLLB 4YC7A 2F4NA 4KQCA 4D9EA 3CB2A 4B32A 1JS1X 1FVHA 2PRIA 2VJYA 2YZ2A 4RV9A 2NQTA 3M6AA 4BZZA 2OOSA 5JNUA 4Q47A 1BNCA 2CD9A 3C18A 4X7RA 3NV9A 5ECYA 3CIFA 1CS0A 3ZQVA 1GPBA 1ZG3A 4C0WA 4CKCA 3A1VA 4F3RA 2BHLA 4AC9A 5G4KB 2AOVA 1RADA 4FE3A 3LCCA 5DGHA 3TQCA 4Y98A 3PNOA 1QZXA 4UTRA 2SCUB 1SA0A 1KYZA 4LV8B 2QL5A 5LOVF 5I5GA 4WDQA 2J5KA 4U5CE 5DX8A 1EGHA 1AUXA 2PXAA 2HJ3A 3WXBA 5HX7A 3JY6A 3AR3A 3DE5X 1BA2A 2WWFA 3FNEA 4M0LA 3OD1A 4GXNA 1A7VA 1YZVA 1L7VC 4Q3BA 2GJSA 1MU0A 4TMYA 3EZ6A 2CE2X 4NC9A 3L84A 3A27A 3K6JA 4C4YA 2BZ1A 3I4LA 2D62A 2QLLA 4TUYB 1G64A 5HKKD 2LP4A 2NU6A 4PX9A 1RJFA 3R7SA 3RC1A 2I67A 4YCCA 2O6LA 1GCGA 5IN5A 3DWFA 3V5NA 5K9ZA 1POXA 3ACBA 2XLWA 4XJVA 5E0OA 3V4ZA 1RJDA 1AMOA 2UZ3A 5T57A 1CR6A 1GGEA 3A1NA 3POVA 4QU8A 2V58A 3LEVA 4Q4CA 2HWXA 1N8KA 4DV1B 3HP1A 1C29B 1KIFA 1IL0A 3T3IA 2AFHB 3QIAA 2VC2B 4MJXA 3LVBA 4BX2A 2PZ8A 3MMNA 1SZJG 2X0FA 1VE1A 1KK2A 1OUMA 3KPHA 4TMTA 4XD7D 4YK7A 2BRUA 1NJ6A 4QJ3A 1TW2A 3E4DA 1AXRA 3OFJA 4L9SA 4GKKB 4MQMA 3U4IA 3S2FA 1ORSC 3NC4A 4XDHA 2R48A 4QE3A 3CH6A 4RPJA 3BOSA 4XLTA 3ZWNA 4YDQA 3GLGB 1XMSA 3Q3EA 4GX5A 4WA7A 5DQZA 2LRHA 1O1YA 1W0JA 2ZS9A 2RB4A 3H7IA 4HVTA 3GQVA 4ME6A 4A8PA 5FYQA 4DDVA 3NTQA 2RJ3A 3GJ0A 2FLWA 2XE4A 1K8YB 3AEQA 4C9BA 3EPLA 1S8AA 5BSFA 1JYSA 2VK2A 4J7YA 2IP1A 4OHPA 3S55A 1UPUA 4OKSA 1I4WA 5IJZA 1G7SA 1KJQA 3EXHC 1MO2A 3ZYCA 2D1FA 4P58A 5EUBA 1HKUA 2ZJAA 3NYMA 5LSAA 5ELXA 3ZE8A 4PGGA 1XKLA 3MT0A 3R7WB 3R7NA 1YDHA 4L85A 5IN4A 5JALA 5AXAA 1PFKA 3KKPA 1SA0B 1M72A 2ETVA 1Z6PA 4HS9A 1QZ3A 4PACA 2YIDA 1HO3A 1ZVMA 2G76A 4X1IB 1SKQA 2Q0HA 3UJ6A 2C5EA 1H7IA 3HB5X 4UE3S 4BE9A 2DWQA 1TTHA 4U5DE 1NW5A 2W2KB 2IU6A 3K2IA 1GRCA 4ZJPA 4NAHA 1QB8A 2XZLA 4KQIA 1YU6A 3AGUA 1Z4QA 3CUWA 3T4XA 4MS1B 3V4VB 2BCEA 4DA4A 3DP9A 3WGTA 2BJHA 1NBBA 2DJ5A 4TWBA 5FFNA 4XVUA 5KJFA 4O0LA 3QX8A 3ELWA 3LYHA 1W6UA 5FJIA 4EGFA 4PJNA 3THRA 5G1OA 1BDBA 1PQPA 4QDJA 1EFHA 2DLNA 1Q12A 2FP4A 1ODSA 3IXQA 3IFSA 1SBZA 3DXYA 4FUQA 5I7AA 4WY5A 1EYZA 3PVCA 5I3CA 3BMNA 2WI8A 3DA8A 4NEQA 2JEOA 3JRTA 3UEOA 3UPDA 1M73E 1WOYA 3N2EA 3TSOA 4TQAA 2JRCA 1E7RA 1EVZA 2YWFA 4HFNA 3K71B 2NPUA 2E0IA 1ZNZA 1QGZA 2WAMA 3PFNA 4YJ2F 4A8JB 3SSMA 4NJEB 1B74A 5I4KA 2PQ0A 3OOWA 3JSXA 4JT9A 3S99A 2PZKA 3BMQA 1G8AA 1PYOA 3FWPA 3KD3A 3F7OA 2W42A 1GNSA 2GEUA 1Q6ZA 2NXEA 4KH1A 4RLHA 2IODA 1TD9A 2Q2QA 4CODB 5KHAA 5JMWA 1HUQA 1SD1A 3ILXA 5CB8A 1OW7A 4FGKA 4K2HA 2ORYA 2OV6A 2OHGA 1MBZA 4R1OA 3H83A 4IFEA 1TKBA 4EVRA 2MOKA 2X19A 4K6KA 5EKXA 1LVHA 1R5OA 2OZLB 3AESA 2R7OA 1ABEA 2H7XA 2R11A 3TG2A 4I4TF 3P0JA 4UUNA 3OECA 5D87A 4NCKA 4Q4JB 5LP6C 3VTKA 2N75A 1TMYA 3WKBA 3U44B 2BF7A 3I0NA 5B3AA 4FBLA 3RBVA 5JDCA 2WWVD 3FDZB 1RWBA 3GM3A 2A5GA 3WGLA 3IO3A 2P0AA 2VDNB 3GD5A 4J6EA 5KIAA 1CF2O 5A5VA 2J7PD 1WLSA 5FTMA 3VU0A 3OZVA 1YOBA 1CGME 4D46A 4HZUB 2I3ZA 2ADMA 2WJAA 1W4LA 5LD2B 3RVKA 1NF8A 1YJBA 4QQ8A 3RGWS 1IFXA 2X23A 1KI6A 2D1YA 4UEOA 4UU0A 4ZYWA 4TV8A 2V0GA 1SD5A 4HLQB 1Z2EA 1PGOA 1YI8A 3DOJA 3VJMA 2OESA 3H6KA 3ZCXA 3HHPA 1TECE 2E5WA 1B6RA 3KYJB 3R0ZA 4I2NA 4Q24A 4ALIA 3AEYA 5BUSA 2GLXA 1D2GA 4M54A 1LNSA 4R1PA 5EWLA 3GLFB 5KYKA 2FFBA 3ZWPA 3UWPA 1RKCA 3GZTB 3C45A 1YONA 3PXDA 4OD4A 4HKTA 2DQ4A 3SLKA 3UMGA 3WKDA 2GZHA 3D64A 5DLQC 3V33A 3ZNPA 5DTJA 4ZEVA 2FDCA 1M75A 1CETA 5FR2A 3SG0A 3C24A 2PL3A 3CZMA 1JSLA 4GF5A 3STVA 4KNYA 1XZIA 2C5AA 1XEFA 4GKVA 1ANKA 1ZLXA 4JC7A 1C4WA 2P1DA 4BMOB 2G3KA 5IH7A 1S9HA 2R6AA 2XRFA 2I34A 3HKDB 2H54A 2KLBA 4GLOA 3VBEA 4EFDA 3TRKA 3IRVA 1P1RA 3SDBA 4OMUA 2R65A 3LBAA 3MOGA 3UG6A 1GV1A 4DILA 3W6NA 2UZ1A 4CLHA 2XYGA 1X7GA 2OORA 1HY3A 2CW0F 4MGEA 3LK6A 4H2DA 1PWYE 4Z54A 4OP2A 4QOIA 4F1WA 1UPCA 2QVGA 2QE7A 4IDQA 1H9BA 3RSGA 5BVHA 1OXBB 2Q4RA 2W37A 4C89A 4HBGA 3E05A 4UBKA 3ORHA 3SVTA 2WV9A 3T95A 5C1IA 4JZKA 2IH2A 1KMHB 1TAQA 4TZKA 1N2IA 3TL3A 1WP9A 4IRXA 2C0CA 3G23A 3W5UA 1X2BA 1DV1A 3L0BA 3B9PA 3ZHVA 4I1SA 5JI3E 1K06A 3DLTA 4RPIA 1XA0A 3RSQA 1UEIA 1SXGA 2V7BA 1CUYA 3HMQA 4D4GA 5AW1A 4R1UA 3G0HA 3EGWA 5EQDA 3VR2D 5CRIA 7MHTA 2IU0A 1MFZA 3WNVA 4WGFA 2EV9A 4TMZA 3LRXA 2AWNA 5TQ2A 2IYPA 3SC4A 3WLRA 4L2IA 4H1UA 5HR5A 4C0JA 4KRYA 1KJZA 3WLSA 2MYNA 4CIYA 2OP1A 3E9QA 1WMDA 5CT9A 2ZYGA 3HHEA 2KE5A 4G5HA 3IXMA 3JQ8A 3LG2A 1PCXA 4DAEA 2FSIA 5BOSA 1KQFA 1I94B 3FB1A 4Y7DA 3TBFA 2AN5A 3M5WA 3PLAE 4N8SA 4DY6A 4KUHA 1CVIA 1QVAA 2X2FA 3HFJA 3AHFA 1L7PA 2X5NA 3E5NA 2JGEA 4K46A 3BJZA 3TVYA 4IH1A 2FWIA 4FYYA 3ZUGA 3VYTB 1E2LA 4HAIA 4YRTA 2ZJBA 1Y82A 3GAZA 3JTEA 1TPZA 4ENRA 4RL4A 2IHZA 5IVKA 1AVTA 1VSVA 2D5CA 4CCSA 2FCAA 4L4YA 1G2QA 2W2PA 3DDUA 2ZJFA 1PNOA 3PEWA 4QXPA 3SZUA 3OX4A 4M1MA 3USES 3HSSA 5F1KA 4KXUA 1HTWA 1O95D 1Z75A 2VWHA 2V0CA 3D6JA 4KJZA 1TKRA 2Q4EA 2ZIUB 4D8VA 1X77A 3CO5A 1KS9A 1U28A 3EVTA 5LLTA 4YUVA 3AF3A 4F7WA 1Q20A 2GBCA 3L5KA 2E87A 3EASA 4Y9DA 2RH5A 1ENPA 1XDBA 3WB2A 3H3XA 4Z3DA 1LWNA 5AVRA 4QEZA 2XL4A 3NRBA 5EZYA 4EVQA 3NYWA 1UP6A 4KI7A 4F2HA 4MI1A 3H13A 2W5UA 3M82A 4JJFA 1C0IA 2G6BA 5HW0A 1LC3A 4PG7A 5DSXA 1T9GR 3CEHA 5ETJA 2BEUB 2VWGA 3IBGA 5BV1A 3L6BA 1N9GB 1NFOA 3M6UA 2FPGB 1ZR2A 2YFQA 2X9QA 2C0PA 2CNNA 1MNAA 5DN9A 3F98A 5FIUA 4UULA 4R2IA 2CCJA 2DUUA 3IMCA 1XC7A 3QQ5A 3CCBA 4FFDA 2BTEA 4OFBA 3R0IA 3AG2C 3W5DA 1HNXB 5D3ZA 2QRJA 3G9TA 4TOIA 4WRRA 2NTNA 1OWLA 2ORED 3CA8A 3KJZA 1NIPA 1AX9A 2W93A 4CKWA 2REQA 3IAS1 3KDPA 3C5HA 1NOIA 4J0EA 5L0JA 4IO0A 2WABA 2WNSA 3EZ2A 3FYUA 2B9EA 2R1ZA 5GQSA 1ZU5A 2B21A 2B5VA 4US1R 4CKZA 4MKZA 5HZGA 1AMUA 1JA0A 2R8PA 1XEXB 3ETEA 2QAJA 4NECA 1IAVA 1HDYA 5AVOA 4NJOA 2MSWA 2Z8YM 4U6SA 5HK8A 2GJKA 3J81k 3HDHA 2BMJA 4INAA 4B3IA 1FXWF 5T4FA 3JWHA 4MITA 2MU1A 1ULTA 2V5UA 1Z38A 2WJYA 2CXQA 2FUG1 3ZHYA 3TAXA 4GVLA 5FDFA 4BBPA 1K2VN 2JATA 2QM3A 4WUTA 2IOQA 2QP4A 3AEXA 3EQ9A 3PE6A 4MB6A 4BNLA 2WU1A 1GILA 3LZ6A 5IJ9B 2FDXA 1A8IA 1GQOA 5D3MA 2ADFA 5CH3A 4RZIA 4RZHA 3LYAA 4QI2A 3FUWA 4U7JA 2QRPA 3QMPA 5AIAA 3SBEA 4UVGA 3E9VA 5CVUA 4KK3A 4Q03A 3QEBZ 1CULC 3CNHA 2JK1A 3NI2A 4GVXA 2IS1A 2WAXA 2X5KO 3GH3A 3K0EA 4P2GA 2WQ7A 1EMDA 1MB3A 4QTUB 2OVFA 4ICIA 1ZYRF 2QN1A 3L9WA 4QODA 1S0UA 2PX6A 2AMJA 3P52A 1TXGA 5LYJF 1Z73A 3CX3A 4OEHA 1J2JA 2ZR0A 1YV9A 1O54A 2GVNA 4EEXA 2CJXA 5LMNB 1JMVA 1K98A 4UPDA 1UJ2A 1ZUHA 4M9RA 5TQ0A 1Q0LA 1OH5A 1JIXA 3WNQA 1G21E 1NN5A 2B8NA 4JLOA 4WPGA 3SX2A 3DFIA 3OLQA 4ZZ1A 1SCNE 2DFPA 3JRWA 4RPLA 3QEJA 4OO3A 5C8ZA 4C4OA 4MKFA 4AG5A 4DRHB 5ERYA 3UMYA 1TM3E 1UXKA 1KMHA 2Q3DA 4H60A 3D7NA 4JIGA 1A97A 2AMYA 3V7OA 2OFOA 1OR3A 1NC3A 2PT7A 4HMOA 5FKJA 1OXBA 4L28A 3USZA 3ESDA 3NP9A 5F1OA 5SZKB 1JZSA 1MEOA 1AK2A 1NY6A 1PEDA 2R9VA 5ULLA 3SIRA 1TM5E 4J03A 3QX7A 1E4YA 4NU5A 2Z5GA 5DULA 4FFMA 4LXQA 1MIHA 3MINA 1WU7A 3GK3A 1E7SA 2ZSKA 2C61A 4NICA 3TIGA 5KWIA 4WJLA 1FP6A 4YWQA 2I4RA 3ZQKA 3TK0A 4E70A 2A5FA 1XTUA 4XOIA 1F38A 1NFNA 4HEA1 2OCDA 5KJ6A 2IS4A 3ETJA 1EGMB 4RD6A 3HH8A 1UMBB 5CBPB 3WV5A 3ODGA 3U37A 1NG1A 2FWJA 5EIFA 1Y6RA 3JAWA 1T10A 2HQOA 1ENYA 2VHWA 2B37A 1KPHA 5KYYA 2YVAA 3AM5A 3G0CA 4NRDA 4G56A 1O8CA 4OHZA 3HCEA 2HKIA 3MGBA 5JJBA 1FTQA 1K7EB 2E55A 3B2NA 3F7MA 4H15A 1YRWA 2P6PA 4YX9A 4ZANA 4RTQA 2QRLA 3OZRA 4BUCA 2A5LA 2DEUA 4WI1A 5K0GA 3B12A 3EVZA 1ZJ5A 3HBFA 1CUXA 5BWNA 5KHLB 3S27A 4LBWA 3PKIA 1GVNB 2BI7A 3O92A 4E7ZA 4TL8A 1JHYA 1YJCA 2HIMA 3JYQA 4IPTA 5J5AA 4UARA 1KI6B 2QT9A 1VE6A 1GUDA 4I7EA 4K9LA 2A5YB 4IDAA 2W2XA 4TS4A 3K3PA 4WXPA 5H0IA 2VZEA 2JD2A 1EI9A 1XNHA 3C16C 5IU6A 3FROA 3N0VA 3A14A 2O59A 2H92A 2JIZD 4G4IA 4BO2A 1F48A 1N75A 6YASA 4JK3A 1LIHA 3IAXA 1NRXA 3V7WA 2BBSA 4W8OA 5H16A 1LSJA 1P9RA 5JWHA 3RUFA 3PHF2 3ZKAA 4KN5A 4MGKR 1EHYA 1XDZA 1L7OA 1UEJA 5KU7A 2QUZA 5ES4B 4P9NA 4FDLA 3F97A 3BK2A 4A03A 1DG1G 1XMIA 2A2ZA 3R7AA 1JG1A 3AQCA 1AOXA 5E4JA 4E14A 3OLVA 1HT0A 2PL1A 1YARO 3A1UA 4RVOA 4OLFA 2OZLA 2XYPA 1PYGA 1K40A 1II9A 1BX0A 1VBNA 2FSUA 4KAXA 4N7RA 3QVSA 1QQAA 3WTBA 4G63A 1CIJA 2QTMA 2L9JA 5LZ4A 5G53C 1P7WA 1TX4B 1ZS9A 2YY6A 1X1EA 5EJ9A 4FGZA 1WCIB 3RYFB 4G7HF 4IIEA 3T5CA 1SN7A 1NI4A 4K9QA 4RWEA 3G88A 1Q50A 2C96A 1C2TA 1YOVA 3DMTC 5HHTA 1R66A 4QEKA 5JBQA 2J08A 1TUBA 4EJ6A 1QDEA 1HDXA 2IYUA 4CM1A 1M6WA 1DL5A 2RAUA 5AVXA 1KC1A 2EJUA 3MRVA 1DS6A 2YZGA 3ZEIA 4I4IA 4NU0A 2B3TA 4IG9A 3F47A 1A5BB 2QY9A 3FAJA 1RKEB 3FHDA 2DRIA 3EUEA 3FNGA 3QUCA 4GI2A 3ZNQA 4C03A 2P6VA 3KT0A 2GZ3A 4HADA 5A4IS 4YCDA 3U7HB 2RK6A 2H6EA 4YP5A 3UHAA 1SC1A 4GQBA 4MRAA 4J0KA 1T3SA 2HK9A 3K31A 5IVDA 3AL0C 3DNPA 4F84A 5JNSA 2VBFA 3FPFA 4C7XA 1VMEA 3WOHA 4DEVA 1O4WA 1J6UA 3K2QA 5EJGA 5ITVA 4RVFA 4HL6A 3TGWA 4DRJB 3KKBA 2HJSA 5AJHA 2C84A 2YVKA 4YB8A 1NYLA 1LDEA 1YS2X 3IPMO 1LTKA 2Y0BA 2QZ9A 1G5FA 4TZ0A 1WQ3A 2ATEA 4IDBA 4PHGA 3V4LA 3C7CB 4LSMA 4Y6LA 5FB3A 1UWVA 2R79A 4JQYA 1RPTA 3MS2A 3P2KA 5AM5A 4DVZA 1IM5A 3RRNA 3VPBA 3TMYA 5IM4F 1RBMA 2JIQA 3C8ZA 3EGXA 1NDUA 3IR6A 4URVR 1OWNA 2OZVA 2WWYA 1L6IA 3BRWD 4N82A 3KZOA 3PXGA 1X70A 2Z6VA 4F45A 1JDPA 4QHYA 3ROZA 4F2WA 2A0UA 2BY4A 5JSYA 3WNZA 2QPLA 2ZDGA 1VGQA 1XD2B 2O2EA 2RGXA 4ONEA 5JQGA 3PSAA 4D82A 4UU1A 3T5PA 3QU7A 4WZBE 4IIXA 2R97A 3OHMA 3MCVA 3OKPA 3RYCA 1JRAA 3CNBA 4URUR 2NZ2A 3W7BA 4DM4A 4ZJZA 5F5FA 3D6MA 2DM6A 1NZEA 4UU7A 1CGNA 1YIOA 4O1MA 1P33A 1Z4OA 3Q7IA 4CF7A 3LVFO 2C54A 2C4UA 2HNKA 2HTEA 4ZYVA 1YI0A 4S24A 2OZPA 3BC1A 3C97A 3OPYI 5HF5A 2BISA 2A4KA 3UT5A 3URKA 1NMSA 4AJOA 3B7PA 3ETHA 4FI3C 5BR7A 5JRZA 4OI0A 2PYIA 4ENQA 1MJHA 1CY7A 2HOQA 2UXDB 2GPBA 1CJKC 3MJTA 4P4NA 2LQGA 5J9FA 4HNTA 5KQGA 1M8KA 3F6RA 5IG2A 3ZCPA 1FMCA 2QWXA 1QMPA 3ZZ0A 4DEXA 4CHTA 3IEMA 3IURA 4ALNA 1E7WA 2YN0A 2AG1A 1U5CA 1LCIA 4RKRA 3WYDA 2WZFA 1XZMA 4HNAA 1P1FA 4I4LA 2PUAA 5KNBA 2JCXA 3MFQA 4TWZA 3KFLA 2IHKA 4DVGA 4PLHA 5C4GB 4BGIA 1Z6AA 1FOEB 5FBVB 1E59A 2IPLA 4Q1CA 1BN7A 4RNCA 1E3JA 3FPKA 3WSTA 2WWRA 1UT6A 1CU1A 5IK2A 4ON9A 1LF0A 1QTRA 4G5OA 1XR3A 3JZMA 3K6SA 3BXGA 1QVWA 3JASA 4RTSA 5TRTA 3VR5H 1KEUA 5DISB 1YNSA 3SOZA 3FPEA 3NHBA 3RTGA 4M0PA 2NYAA 1PR4A 3GL9A 2BP7A 4WK2B 3DEKA 1BXRA 3K1JA 3TM4A 3JRXA 4D9KA 3QOYA 2XIJA 2FB9A 3FR8A 5F1PA 1SWWA 4U6QA 1ONPA 2I8LA 1CZLA 3T4UA 1KXZA 3N0TA 4GM4A 4OBEA 5HE9A 5L40A 4TYWA 1KEEB 2VHUA 5EKTA 3R8XA 4AN0A 3O6XA 4ZV9A 4JBNA 3S7ZA 2BGKA 2V7GA 3KZXA 4OLAA 3O8LA 4XE5A 1B15A 1IZMA 2EZUA 1DWQA 3AP3A 3LGAA 4CE6A 4HFRA 4WKBA 3CLTD 4R05A 1GL3A 2CXOA 2D2XA 3GMTA 1V71A 4JP1A 4N6OA 4W99A 3WGZA 4CMIA 5JCZA 4LMRA 2Q5JA 2XUAA 3TNLA 2HHCA 4MPDA 2IYFA 4D96A 2YMLA 2WAOA 1L4GA 1I30A 3VMFA 1DXQA 3DKRA 3P2IA 1LBEA 4TMXA 4BV9A 1U7ZA 3T1TA 3MK31 2R6JA 4QUKA 3ZG6A 3A9CA 1FBTA 1PW5A 4R16A 4YI3A 2VATA 1JR4A 2B4YA 2M6SA 3DOCA 5LYYA 3VNBA 2O8BA 3JD4A 2Q5FA 1FMLA 4FYHA 5LB2A 4F2PA 2FF7A 2IX9A 3CCCA 2EWWA 4YFVA 1CR4A 4ZI5A 1JMYA 1IMJA 4RFSB 5EJEA 1Y3HA 2VF5X 2J0EA 4XQ1A 4GRIA 2M6RA 4H9GA 4WH0A 4Z1OA 1O77A 3QVLA 1Y0BA 3G9UA 4MNTA 5DTRA 3A31A 1CJSA 2VJQA 1BFKA 1V96A 1DKMA 1FXUA 5LXTA 3RF7A 3FBTA 2IZ7A 2C2WA 1C5KA 2RGGA 3TLMA 1LF5A 1OI2A 3GBVA 4F56A 4E0HA 1J1IA 4MEAA 3OLXA 2Y3BA 2VPYA 4K9OA 2JCVA 3F3MA 3CLKA 1QTNA 2CCGA 2ETXA 4TKMA 1IPEA 2HSDA 2B5WA 3KYIB 2O1SA 3ZBPA 1FFTC 1F4LA 3FZQA 4QPCA 5EKDA 1LX7A 2WDZA 3B52X 4B3XA 4PFPA 4DLBA 1E18A 2J9GA 4C3UA 2BR4A 1D9XA 3U5SA 1UMKA 4J0HA 1IWOA 3O8DA 2GBPA 5AVKA 2ZB3A 1CUUA 2E5FA 2ZSAA 3R75A 3AFNA 5ITZA 4PO1A 1UQTA 2OD9A 4UC0A 5KQLA 1B23P 2PWAA 2ZI7A 4IUYA 3G2OA 4Q16A 4JOBA 5DBGA 3STTA 1W0KD 4XEKA 1GG8A 1GQYA 3BH7A 2H1CA 2NO0A 3CKYA 2P79A 3EQ2A 3KG2A 3L1IA 2LZ0A 4RKFA 5DHTA 4ABYA 4KI0A 2K6GA 4WWHA 4ACBA 4EHLA 4RJKA 5EGNA 5G41A 4E3ZA 2AFIE 4TLLB 1GCOA 1ICEA 4MHTA 3V7YA 4PIVA 1WPXA 4ILKA 4OIMA 4TGLA 3E23A 5GY7A 5LU8A 2PP4A 2DE0X 1EVQA 3NPMA 4ZZ3A 3REGA 1U8TA 3O3OB 2N1BA 4PSKA 3O8CA 3A04A 1WHSB 4DT1A 3D54D 2Z56A 1RCTE 2X7XA