2XXAB

The crystal structure of the signal recognition particle (srp) in complex with its receptor(sr)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
283
structure length
283
Chain Sequence
ISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFARED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL RECOGNITION PARTICLE PROTEIN
publication title The Crystal Structure of the Signal Recognition Particle in Complex with its Receptor.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Protein transport
total genus 82
structure length 283
sequence length 283
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00448 SRP54 SRP54-type protein, GTPase domain
B PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2xxaB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xxaB02
3AVPA 5JS8A 1NY5A 1Q57A 4RVCA 1KNQA 1AGRA 2YINC 4RD2A 4CVNA 2IXFA 2GXQA 1F60A 3KDSE 4OHVA 3C4JA 3NIBA 3O47A 3WMEA 1OIXA 4CIDA 2ZS7A 2ZR9A 1E99A 4US1R 1QHSA 4MRPA 2OXCA 4DDUA 2QTVB 4MYTA 4DEXA 5JWOA 4NL4H 2VQSA 5KDLA 3VKGA 3P27A 4ASUD 2J0SA 4G5GA 1DELA 4QBFA 3UWOA 4CEIA 4PQYA 3M0EA 2NTYC 4DCTA 3R8FA 4TYPA 2FF7A 1NMZA 2H8KA 2EFGA 4YMSA 4B3XA 1Z2AA 4RZ3A 5FI0B 4JLOA 2OCPA 4M1SA 3PR1A 2BC9A 4F93B 1P2TA 1DPFA 2QP9X 3U3JA 1W2HA 5LPNA 1SHZA 2DWQA 1BOFA 1G8HA 1KO8A 1SVOA 1UDWA 4LC0A 1AA9A 4M1YA 1CF4A 2I3BA 4ILEA 1ZYUA 2NPIA 5K8UA 1FQKA 3VNVA 1DAKA 1ZD8A 4MGYR 2Z6VA 3LW7A 4CDGA 2JA1A 2FZLA 4RKFA 5E4FA 2ZE5A 3PCRB 1W36B 1DO2A 4F38A 1G291 4PAOA 3CH5A 4GPTA 1EX7A 2FPMA 4D4MA 5FUVA 4HLDA 2G3YA 5F2EA 3SJZA 3EPJA 3TSZA 2C5LA 2R65A 3MUFA 4CGZA 3QEOA 1XF9A 4PX9A 2BMEA 1G8GA 2FU5C 3RHFA 4E03A 1ETUA 3B8HA 1YR8A 1VHTA 3UANA 1MKYA 2XEXA 4RFSB 3NDBB 2J59A 2WPDA 3CO5A 3R20A 4M1OA 1E79A 2REBA 1BMFD 1XTQA 1RIFA 2BV3A 4NYMR 1R0ZA 1ZUIA 4V0MA 5CLLA 4C7OA 3CNNA 1ZD1A 5JMTA 4UXIA 2LKDA 2P2LA 4JMPA 4NP6A 4D4JA 3AVWA 5FOXA 4DUGA 3OIVA 2J45A 1M7HA 3CR7A 1VECA 4XVQA 5FOUA 2WSSD 2W83A 5J47A 3DM5A 5EP4A 1GM5A 2ANCA 3LWNA 2JDID 2D7DA 1S0UA 4LJ7A 1J8MF 2QA5A 2AXPA 5HCIA 2GXAA 4IEEA 2IYLD 2HXYA 5JBQA 1COWA 1HQYE 2HLDA 4BFVA 4TQUS 4MGZR 4CRWB 5KNCA 2WV9A 3T12A 5J4LA 3UMSA 1OXSC 1L2TA 1KK2A 1XZPA 1W47A 4C0QC 4C7OB 3K70C 3L8ZA 5JHHB 4QGGA 1UKZA 4OKSA 1FL9A 1Q1QA 3B60A 4P32A 3ZDQA 4L15A 4LWZA 1QF9A 1UJ2A 1G41A 1E96A 4Q00A 4C0AC 3HU1A 3B9PA 4CT5A 2AK2A 2CK3A 4ASUA 3BFKA 3PITA 3NXSA 3FMIA 5L3SA 4D25A 3A1VA 1OHHD 2OBMA 1OFIA 1KSHA 4FIDA 1XPRA 3AKYA 4XJXA 3C7KA 4L9WA 6Q21A 2RH5A 5H8WA 2Z5FA 3TVDA 2ZSBA 3CF6R 4ESHA 4FMCF 4B32A 1QG4A 3GJ4A 3CNLA 2FN4A 1QHHA 3KJGA 2ZI7A 3AKCA 4MRNA 5KSOA 3AUXA 3DEFA 4XH9B 2YV5A 2EFHB 1VKJA 3I8XA 1CJUC 3BERA 1Q0UA 3FPAA 4NCNA 2P65A 3MD0A 3QKSB 3UKDA 4LHZA 3ICQB 1AS0A 2FSGA 4E07A 5FL3A 2DPXA 1FFHA 1DADA 5L3SB 4GSYA 4DCSA 4ZPXA 2QAGA 1WXQA 1R5OA 4GNKA 1IBRA 1IOZA 2PEYA 3RRMA 1F48A 4Q48A 5EXTA 4Z8YA 3THXA 1LF0A 2QORA 1E2MA 3NWJA 2OG2A 4QHTA 1Q1BA 1LS1A 3QQ5A 2X2EA 3GFPA 1G3QA 1QHHB 2PX0A 1BMFA 1I4DD 2AHOA 4L5BA 5GADl 1WB9A 3L0OA 2J87A 2P6NA 2Q3HA 2UVQA 4TTRA 4HZUA 4D26A 4IOJA 1F2UA 4IW3B 4EPTA 1JXMA 2GILA 3FFAA 3GLHE 4GMDA 1GRRA 2FFAA 4JKYA 2WSSA 5HCNA 3WNCA 1VCMA 1U0HC 4IDHA 3EPHA 1E2JA 2ZJBA 3DDCA 2JDIA 1GRQA 3EWSA 2B92A 3KQHA 1E9SA 4ZIRA 3VR4A 1ZW6A 4GFDA 1X1RA 1IJFA 3IUYA 3RSOA 3D7MA 1KI9A 1QHNA 3FHCB 1II8A 3MWKA 4A15A 4HAXA 4BLQA 2FZ4A 3FFBA 1NN5A 3LXRA 3PUZA 2REOA 3EZ7A 1UEIA 2YYZA 4GRAA 3EXAA 1XNJA 3RLFA 3TR0A 1B0UA 1AQYA 1P6XA 4HZUB 2JLWA 2LCFA 1F2UB 2R6GA 1FTSA 2IHYA 2QM7A 4HI0E 3MLEA 4LGMA 3H1TA 4YXWD 2AKYA 2PX3A 4CEJB 3UWKA 3T1TA 4W5JA 1JALA 1HEIA 3EIEA 1OHHA 4PHHA 1IAQA 4DXAA 1U8AA 1NY6A 1S3GA 4DLWA 4ZIRB 3FHOA 4WXRA 5DYGA 2MSDB 4ZDWA 4AC9A 4MUBA 3PVSA 2GJSA 2EFEB 2CMKA 1K5GA 2PEZA 2WJIA 5C4GB 2FA9A 3SJAA 4N1AA 1XCMA 1M6NA 3X1DA 1N6HA 2EWWA 3GLIE 2BBSA 3A58B 4DVGA 2JJ1D 3F5FA 4L8GA 3X1XA 2ZS8A 4OI0A 4TZ6A 3RRYA 3P26A 2I4IA 4YLGA 2XOKD 1XEFA 2V3CC 2RGCA 3NDPA 1KSFX 2FFHA 4Q1CA 2YWGA 1T8UA 4IRUB 1FX0A 2BEJA 3R8CA 3TBKA 1NL3A 2ERXA 5JJLA 2VHUA 3VR6A 1C4OA 3L8YA 1MRSA 4MRVA 4NHOA 4TN1A 3T5GA 3NBZC 2C03A 4EAQA 4AWXA 4ZKDA 2CHQA 5J4KA 4RD6A 3EIHA 4FN5A 4D4KA 3T06B 1G9XA 4OQFA 1TQ2A 2GNOA 1NKTA 2H92A 1NKSA 3PUXA 2GZAA 1BO6A 1R4AA 4WZBE 2DCUA 3QKTA 3DKVA 4KSCA 3T1OA 5E7JA 4BLRA 1W0KD 1BS1A 3SFVA 4PO1A 1G5RA 3GJ7A 3JZMA 1YE8A 2DWPA 5H68A 4LHXA 2EFCB 4A82A 5DH9A 5BQ5A 2ODWA 1E2GA 3T1VA 3I61A 1FX0B 2OV2A 5F9HA 4PAQA 8OHMA 1VYTA 3LQQA 1RJ9A 2BM0A 2J1LA 1M7GA 4ZCMA 2ZSFA 2KB0A 2XSZD 3RS0A 1FP7A 2O8CA 2GBLC 4QGAA 3U3RA 1EFTA 1Z6GA 2O0HA 2YNMA 1D8TA 5J4VA 3FVQA 4B35A 2B8TA 3NEJA 1S4QA 4TTQA 3NEYA 4PPFA 2FNAA 2OE2A 4JVNA 3EIQA 2GTPA 1RFLA 2NIPA 2BWJA 4XSHA 1SVIA 4PFSA 3U4QA 2A7QA 4A8JC 5FOTA 4HLUC 2XZPA 1P2UA 3VU9A 4LYHA 1ZAKA 2H1LA 3CPJB 3P1JA 2ZPTX 3K53A 4P4UA 5LB2A 4B2LA 1E2NA 1KSJA 1F3OA 1MT0A 1RJ9B 2IUSA 4PZZA 2LWIA 4PO8A 4WIAA 2GCNA 3GEEA 2ZJAA 3ZZUA 2ORIA 5TXGA 4A1FA 1EWRA 1U90A 5FUWA 2OXRA 3QVVA 4WOPA 4A6XA 4YMVA 1MO6A 1Z06A 2O8CB 4OQLA 3GLHA 4AKGA 1OH6A 3QJYA 2XXAA 2CVFA 4IDPA 2JIZD 2JJ1A 5AUPB 5KYKA 3OEEA 2IEYA 4MYHA 3L0IB 1XPUA 3Q3JB 4AY2A 3O8CA 5L3QA 1HY3A 2VIIA 1P9NA 3HU3A 4NYJQ 4TMWA 1QRAA 4BFXA 3W90A 3U4QB 1GKIA 4LBYA 3SHFA 2VF8A 4EPXA 2AFIE 4JVSB 1YRBA 1IN8A 1UBGA 2ZVPX 4A92A 2O0KA 1SXJC 3ND9A 2RGGA 1EFRA 3T61A 5F3WB 3ZVLA 1XPOA 3WP0A 4U00A 2FSHA 1ONBA 2R44A 3KXKA 4EJSC 4IOLA 1RE0A 2OEPA 3CKLA 3C8UA 2ZJZA 4JVLA 4RZ2A 3GLHB 2XXAB 2H5EA 3OZXA 3SDZA 4OQMA 1RRPA 4ABYA 4DJTA 1ODFA 5FPSA 2HJGA 5AUNB 5L3QB 1MABA 1KHTA 5D3MA 4LJ6A 2QRZA 1A2KC 1PJRA 1GZSA 1XEXA 3DOFA 4FCVA 2ZITA 1FUKA 2XAUA 3LLMA 2C96A 4DCVA 4BGDA 2VYFA 3NTUA 5FOWA 4C4PA 3K0CC 1TF2A 4BQSA 1AKYA 5TDHA 1WE2A 2F1HA 4G3XA 4TLBA 3UXMA 1KYIA 1XD2A 5AUQA 1LV7A 1LW7A 2DFTA 3GLIA 3U5ZB 2EW1A 1KDRA 3EPLA 2PL3A 2NO9A 1NG9A 1QBKC 4TTPA 2JAQA 2E87A 2RGAA 3BK7A 2JLQA 4TQAA 2TMKA 4QGHA 2O8FB 3RANA 4P3YA 3KL4A 1RRFA 4NCJA 1ANKA 3QPUA 2ZROA 4JLJA 5D3MB 4QNMA 1RRCA 3AH8A 4GDFA 4KCGA 3VR5A 1EG7A 1DAHA 5DNYB 2XB2A 3DZ8A 221PA 1KJYA 1D9XA 1JPJA 2WJVA 4CW7A 2IYTA 5TY0A 1JAIA 1E0JA 5HE9A 2ZQ5A 4RSGA 5BYJA 4KBFA 5JHGB 1G4AE 4UXHA 4HB4A 2VEDA 3TQFA 1XD2B 1MRNA 4IVPA 4KAXA 2QTHA 4M9QA 1YR6A 4BRUA 3QF4A 2QGNA 3GMTA 3K1JA 5FOVA 3GJ8A 2CNWD 3RS4A 5IRCD 2JIZA 3ZIAD 4S35A 2FG5A 1E6CA 2V54A 1FPMA 1CJVC 2GWHA 3PQCA 3QI2A 1XDBA 4LV5B 3W8RA 1FNNA 5CK5A 2QENA 4QG7A 1XEWX 2OILA 2R8RA 3CNOA 4C0LA 3CH4B 3B9QA 1NJFA 3C5HA 5IF9A 2ORWA 1KK3A 1S3SA 4JYCA 1U9IA 4E22A 2AD5A 4TMTA 4N3NA 2CLSA 2W00A 5IDVA 5GJBA 1NVWQ 3QKRA 1RPZA 3SOPA 3QF4B 2RGDA 5DI9A 1X1SA 2JLSA 3NBXX 2QU8A 1G3IA 2P6UA 1T3SA 3SJCA 3W3ZB 4CT4B 4ESVA 3LAWA 5AUOB 2Q3MA 3L43A 4IFBA 4UKDA 4OQXA 1G3RA 4TWZA 1KKLA 3SYLA 4B47A 4A2WA 1NMYA 4LJAA 4DDVA 1K6MA 2UZIR 4OL0A 4W7SA 2BKEA 1ZM7A 4HATA 2HT1A 2IT1A 4M1TA 1QHGA 1I2MA 1Z8FA 3LLUA 4G1UC 4JLBA 1HT1E 1N2CE 1IY1A 4OBEA 1JEEA 1VIYA 2QMHA 3N5CA 1EWQA 4RD3A 2Z0MA 3I1FA 3R7WA 1WA5A 3EZ9A 3QKRB 4B44A 2ZI6A 3QXXA 1JI0A 2NO0A 4K8OA 1U8ZA 1RYFA 3GCGA 4JSTA 5JI2E 2GAAA 1VYVA 3VR3A 1NJGA 2PT7A 3B13B 4TYYA 2ZI5A 3THWA 2QE7A 3WBKA 1OFHA 3REFA 1VCIA 2F7SA 2IYZA 3FKQA 1AGPA 3AP2A 4HAVA 2WKRA 4QXAA 5HE8A 2IS4A 2GKSA 2QMOA 1C9KA 1ZM9A 1E1QD 1G1MA 3ICEA 1G7CA 1JB1A 1KO4A 2O8BA 4Q01A 4QJ4A 2W6JD 1ZNWA 4XD7D 5CJPA 4DLXA 2C9CA 4P33A 5CIQA 2G9NA 2ANBA 3T1QA 5L3VA 3R7WB 2J7PD 5EE3A 1U0LA 3R9XA 1JQJC 1VCOA 2A5YB 4BZPA 3IEVA 1NSTA 3LFUA 1P2VA 1L8QA 2Q6TA 1VIAA 2CNWA 4B2IA 4AD8A 2ECKA 1V43A 1E2IA 3ZIAA 2BCGY 2XTNA 4ERNA 5C46F 3THWB 1OYYA 5G40A 1U94A 3KXLA 1OXUA 4DHEA 2D3WA 4PQRA 3NHBA 1JR3E 1ZNXA 2GETA 1HH4A 3JZAA 2QRNA 2YZ2A 3EW9A 1YZTA 3MFYA 5BWMA 1TF5A 4P0TA 4U5XA 4BFYA 2O8BB 3WBJA 1NBMD 4LYFA 1VHLA 2ONJA 5FPYA 2GEUA 2GJKA 5B30A 2IXEA 3A1UA 3JVVA 4A0FA 2GCPA 5FUXA 1DARA 3RS5A 1A1VA 3RC8A 2WIBA 4KLZA 3TQCA 1XMSA 821PA 1YZQA 3ZZ0A 2JLVA 3GJ0A 1YKSA 5KTYA 5E7IA 2IF2A 3TNFA 2PMKA 1XTJA 2RGNA 2WKPA 4O3MA 2GHIA 3VX4A 2PMDA 2OSBA 1W2GA 3U3KA 3K9LA 3R9WA 2V55B 5FTJA 1W4CA 2Q0HA 5C18A 1E2HA 2VHCA 3WHKA 5JRJA 1VYUA 2ZR0A 1JR6A 3WNDA 2WIAA 3OE7A 3RWMB 1G18A 2YWEA 2ZE6A 4QBHA 4LJ5A 3T5DA 4AG6A 5KUTA 4NYIQ 1WF3A 4M22A 3VHLB 1CJKC 1Q3HA 1XX6A 2C78A 4KITB 1JJ7A 1JR3D 3C5CA 4KO8A 2GJAA 3W5IA 4PHGA 1T91A 3RS3A 4P4TA 3IBYA 1W36C 1R0WA 3C41J 3TRFA 1NVVR 2VLIA 2Z43A 2ZRGA 2XITA 2AKAB 1SQ5A 4NCIA 4KFRA 4TMZA 2C9OA 3MWJA 4CEHA 1E1RD 3IGFA 3OEHA 4A4DA 1EFCA 1ELOA 1KMHA 2ZRPA 3QIAA 2FJUA 5L8VA 1DG1G 1X6VA 3MG9A 1DS6A 4Q1AA 5TB5A 3ZH9B 4DSTA 4DLZA 1T5IA 4WZAE 2W6JA 4JLPA 2EU8A 3ASZA 2G77B 5KDOA 4BFZA 1ZCAA 4US0R 3B1YA 1RYHA 3TSWA 2ZRFA 3TVTA 1LTQA 3L0PA 3I62A 3ZD6A 2FFBA 3U6BA 4EDHA 3OAAD 3WRXC 1G20E 1CLUA 2Z4SA 1HE1C 1R5BA 4Z1MD 4TQ9A 3B7GA 4XVUA 1XJCA 3TUIC 4HUQA 5EXPA 2VBCA 4Q7MB 3LA6A 4A9AA 1Z5ZA 1KMHB 4GOKA 3RSLA 4BE7B 5JLJA 3SQXA 1P60A 2WOJA 4LJ8A 3AV0B 4FXPA 3A6PC 2CLCX 2OBNA 3KKOA 2QPTA 1XP8A 3LVRE 5FBWB 3EARA 4D2IA 3HP1A 4O2LA 2GCOA 1SHKA 2BBTA 1DAMA 4LHVA 1N6LA 4MRRA 2GRJA 3TJZA 1P3JA 4DLUA 1E2QA 1AQUA 1KO5A 4CEIB 4IXMA 4DLYA 3K70D 2IXGA 4KV9A 4Q7LA 1N0UA 3NG1A 1YZLA 3A1TA 4DLTA 4BLTA 1G3UA 2B8WA 4PXAA 4HUQB 2AR7A 2NGRA 3DOEA 4GBMA 3I3SR 5GVSA 1Q3TA 2HYDA 3QXHA 4I99A 1HTWA 1TQDA 4IXNA 3UG7A 4A36A 1T0HB 1Z6YA 1GUAA 3A36A 4RZXA 4BEJA 1B23P 5E3HA 2A2ZA 4TSFD 4PC7A 1Q1ZA 1UBEA 2GEDA 2QT1A 2GCOB 2OCYC 1E2PA 1L7VC 2A5FA 2FGJA 4NH0A 1NSFA 4AYWA 1T8TA 4PQFA 2DFNA 3BB3A 1E0SA 3THOA 1XZQA 4PHFA 3M6AA 2QQEA 4ITRC 1JR3A 1FTNA 4Y0VA 1GTVA 2BJVA 5G41A 3P20A 2V8OA 5CLQA 2IX3A 2BEKA 1W0JA 3TW8B 2VP0A 1VCNA 4UNSA 3I4LA 2V6JA 4EUNA 4OK5A 3D3QA 1Z0AA 2BBOA 1A5TA 4D0LB 2IS6A 4KLNA 1E2FA 3GLFE 4GP7A 5B57C 4RCYA 3EZ2A 3A1SA 3DMNA 5GJVC 2ZIAA 4UXJA 5EQTA 4PO9A 4R71A 4CF7A 5KDDA 1T0JB 3HJNA 2ZSEA 5ANRB 1Z6TA 3A4LA 1ZUNB 2OUKA 3OAAA 1XXHE 1U0JA 2YC4C 4RD4A 5ELXA 1P61B 4KBGA 4Q1DA 4BLPA 4Z1MA 1GILA 1JAHA 3PEUA 3I32A 3FTQA 4TMKA 4O0MA 4EKDA 3RS2A 4HAWA 2QZ4A 2WWXA 4P4SA 2VP9A 1I4LD 3GLGE 4JVMA 2F1IA 1RZ3A 2ODBA 3LX8A 1SKYE 3GJ6A 2F43A 4B6EA 3D8BA 2G0NA 4MUAA 1Q21A 1CRQA 1X86B 3BXZA 2RKOA 3W6NA 3LNCA 5G3YA 2OESA 3QNUA 2HDNB 3MWYW 1G21E 2GF0A 4M1KA 4KSBA 2H57A 4QHYA 2FEOA 2V7QD 3OIUA 2ZU6A 2OO7A 3QUSA 3SC3A 4Q1FA 1UBFA 1GNQA 2R2AA 4NMMA 3HYTA 4ZKEA 1OFTA 5SZHB 2EVWX 4MYCA 1MO5A 1CTQA 1NI3A 3CX8A 3MMPA 4RD1A 3K8YA 3N2EA 4MKGA 4Q03A 1GDDA 2NO7A 1W5SA 2F43B 3VTKA 2Q3FA 4URYR 1OH8A 1Z08A 5E95A 2BMDA 4Q66C 3UMRA 3V00A 3CPHA 1E98A 1LY1A 2NOAA 3ZZTA 5JRZA 1BKDR 1DAIA 2XNSA 4L9SA 5JEEA 2GZHA 3X1YA 3LH5A 1TTTA 2DR3A 2G0TA 1E2LA 1R5NA 1KKMA 1WCV1 2QAGB 4NCHA 5DISB 4XWOA 5JS7A 1Z6AA 1F2TA 2QN6A 3TUZC 5GVRA 4KFUA 2GVZC 4B3BA 1ZNYA 3THXB 4WAUA 5CYOA 4R98A 2H7VA 2ZXUA 2IF0A 1TADA 1SVWA 1Z6XA 1KTVA 4C2TA 3FOZA 1PUIA 1ESNA 3I8SA 4NKRA 1PZNA 3U44A 1GKUB 2GZDA 2OAP1 2WTUA 1MOZA 4C30A 2QNRA 2RGEA 4Q9IA 3U3MA 2GVDC 4V0OA 4Q9JA 3U6KA 4HUTA 3ETLA 4MDFA 121PA 3A4MA 1NVUQ 3K9GA 1ZRHA 3V4FA 4AG5A 3PFIA 2Z4RA 3WNBA 721PA 1OB2A 1CXZA 1S1CA 3G5UA 3B1WA 3QXSA 3U60B 4JBYA 2OAQ1 4QHSA 4FW9A 3BH7A 5TMPA 2ZTSA 2RHDA 3MJRA 2KSQA 3NHAA 5HZKA 1DAGA 1II8B 4IFEA 5J40A 4DEYA 5HKKD 5JCPA 3ND8A 2B7BA 3AF1A 1W4BA 4KFSA 5EJEA 3SHWA 1SVKA 3HR7A 4FINA 4MKIA 3TE6A 4B3CA 4D80A 3PUVA 1OFUX 3K0EA 1DTSA 2AD1A 2C04A 1SVLA 2C98A 1QZXA 1CR2A 4HYYA 3TAHA 5CITA 3LX5A 1F5NA 5DN6D 4TZ0A 1KSGA 3VFDA 1SXJE 2WOOA 5FBVB 3LY5A 2IL1A 1W49A 2OZEA 1E94E 3AQ4A 3ADDA 5CB8A 2V7QA 1BYUA 3A8TA 4HDCA 1N25A 3UK6A 1S9HA 1XFAA 1P73A 1R8SA 1Z28A 3EZ6A 4IVQA 1OPXA 1N5IA 3RDPA 1KOFA 5LBIA 2GK7A 4IDNA 1GNPA 2V6IA 2DY1A 3GLFA 2BKUA 1NIPA 2FWRA 3FB4A 4OHYA 2CL7X 1UADA 3EG5A 2YWFA 1EESA 2CHGA 3K9NA 1UDXA 5DO9A 5F98A 1KAGA 5HZHA 3AUYA 2KWIA 1XMJA 2W6ID 5AR1A 5GJWC 4JL5A 4KYIB 3QSYA 1XXHA 4JT2A 4Q1BA 1I4TD 1A2BA 1P2SA 2ZRLA 4Z54A 1ZM4A 1VG8A 3U7FB 3AP3A 4OHXA 1FMLA 2NO1A 2ZS9A 3T35A 1DE0A 4LHWA 4ON9A 4D4LA 1QHYA 2B21A 1WBBA 1G3MA 2ZE7A 3GLGA 4NYJR 3GLFB 1YQTA 1KO7A 5C4MA 1Y3AA 3RRNA 1UAAA 1GVNB 4TLAA 4DLVA 2ZSAA 1KJZA 4URVR 3IILA 4R2HA 3QE0A 2NG1A 3CRVA 3BB4A 4YDHB 5KHOC 3RWOA 1SXJD 3AM1A 5LD2B 5CDFE 3E1SA 3AGPA 5IT5A 1ZMXA 3IQXA 2JLXA 1XXHB 3PXGA 1CKEA 4KODA 1W4AA 4HEJA 3K0AA 1G19A 3GQBA 4OI2A 4YXWA 2Q9CA 2IK8A 1FUUA 4KYUA 2C77A 2X8AA 3CWQA 2H17A 3VQTA 4TMVA 4DSOA 2FDCA 2ZRMA 4RJLA 3EAQA 1KI3A 2YOGA 4TYQA 2WWGA 1GWNA 1NVXQ 2WVJA 3GLGB 5DIFA 2GXUA 2WAYA 1II0A 4Q7JB 1IY0A 1SKYB 2AXNA 1KI2A 2XZLA 2VPPA 1R0YA 5HKKA 1KJWA 4X8HA 5SZKB 3BH0A 4UNRA 1OE0A 1BYIA 1JJVA 1Q44A 3MJHA 2IA5A 2CCJA 4M9SA 4GT1A 2JLUA 4I1OA 2OLJA 3KQUA 3KB2A 2W2XA 2ZANA 3LD9A 4EFLA 2NZJA 3LBNA 1IJEA 1BIFA 1TMKA 1PLLA 3K0AB 5AJWA 4TT3D 3HU2A 3HWSA 3TMKA 1XCPA 4II7A 4PTLA 3TUJC 1OIWA 4EQ6A 2XOKA 3SFZA 1T3LA 5LDDC 3VU9B 4TLDA 5BYKA 1K8RA 2IEZA 4TMXA 2FOLA 1OW3B 5EP1A 3T34A 5HTKA 4IHQA 3I72A 2D2EA 4EFNA 2WWYA 3BIFA 3VKHA 2KBFA 4HLUA 5AJYA 3K0SA 2ZYTX 3P4XA 4C0BA 5M04A 5JSZA 2WWWA 3KJIA 4Q1EA 4NU0A 5BW8A 4GMXA 3KFXA 5IK2D 2QGZA 2IBMA 1W0KA 1CS4C 3AF2A 4BLOA 2GJ8A 4NE2A 3ZS8A 1WP9A 1KI8A 2F9MA 5CB6A 1XU4A 4RFVA 3RVBA 2DFKB 4YC7A 1ZVQA 5TVKA 4KFTA 2W0MA 2ZYUX 3HR8A 3LDAA 4A2PA 5TARA 1Z83A 4WXPA 1U2RA 5FUYA 1CU1A 3SS8A 4FWTA 4LY6A 3GD7A 4ZI3A 1XMIA 1U8YA 4IDOA 3ECCA 3GEHA 2VSXA 4GZMA 5JSZB 3S1AA 2XSZA 1NLFA 2O8DA 4LV8B 2CL0X 4Q4LA 4Z8XA 1BH2A 4A2QA 1HQCA 1SXJA 2HXSA 5FTNA 3IO3A 1KGDA 4DZZA 4LSGA 1E3MA 2QROA 1MABB 4FWIB 4EJSA 5J4YA 3W8NA 2QT0A 1X8JA 2CJWA 5K8LA 1CRPA 3BFVA 1XEXB 5E7MA 4ZDJA 4ARZA 1E2KA 1FQJA 2ONKA 2UKDA 2F3TA 3X1WA 1G5TA 4B3FX 1E69A 5JCZA 3Q9LA 4NTZA 5K8TA 1AKEA 5J4HA 2JASA 1JEDA 3KXIA 2P0EA 3W6OA 1KAOA 4KHZA 1LFDB 4B43A 2N42A 4TL8A 3GLIB 3SJBA 1GITA 4YQFA 3LW8A 4QOSA 3S1AB 1YU9A 2O8DB 5FR1A 3KKMA 3CBQA 1L4YA 1C1YA 1SXJB 1WDTA 3KB1A 2CE2X 1TU3A 1G16A 1N6NA 2B7CA 3CF2A 3K0CA 3VR2A 3AVTA 5TV2A 4WBSA 4LC1A 3E2IA 4PPNA 5EZ5A 1D2EA 1XTSA 3AP1A 4H1VA 4IVRA 4F91B 2VL7A 5LB4A 4TT3A 4EJSB 1E32A 1TQ6A 1GG2A 2ZRIA 4TLCA 1IM2A 3GFOA 1EXMA 2QMUA 5AWFC 4U02A 4DKXA 1KIMA 2QM8A 4JIMA 1U99A 2EYUA 3ZJYA 4D81A 2BOVA 1TUEA 2DB3A 4KJZA 2OBLA 2X2FA 3SBDA 2BMFA 2P3SA 1CR4A 1ZINA 2IYWA 5CDFA 4LBWA 4TYNA 5KSYA 4GL2A 3BAFA 1IN6A 1N3BA 2JEOA 4M0LA 2Q9BA 1TQ4A 3W34A 1XD9A 5JWHA 1QDEA 3IDQA 5IK2A 1DG3A 1L4UA 2DBYA 3GJXC 2G6BA 1O87A 1S2MA 2IYRA 1OT3A 2R62A 3GEIA 5FPTA 3F0TA 3EC2A 2IWHA 2A9KA 4IKEA 1G64A 1LNZA 2ZRDA 2OT3B 3TIFA 2IYUA 1W7AA 5EP2A 3V9PA 2ZEJA 3VMFA 5DSZA 3OESA 1LS6A 1O3YA 1P7CA 5DHAA 2PLRA 1IQPA 1KI6A 3L2OB 1NBME 1Z29A 3B85A 2F6RA 4JSYA 4URZR 1YZGA 1HA3A 3JVUA 3RC3A 4K46A 1M7BA 2BDTA 2WJHA 3QVUA 3DHWC 5KSPA 1EFUA 3LQRA 2AWOA 3B6EA 3QPVA 4MITA 2ZM5A 4OHWA 2GF9A 2QL6A 4ACAA 5EUQB 3VKWA 2N1BA 4XVRA 2G88A 5DGXA 4TLEA 3Q5DA 1IXSB 2H16A 2XJ4A 2C2HA 3NC1C 2CL6X 2CE7A 2VRWA 3PENA 5CIWA 2ZRJA 5A5GA 1KI6B 4FD2A 1SZPA 4BFUA 2EYQA 4AKEA 4MH0R 4JL6A 1ZU4A 4LZZA 2VHQA 1D9ZA 1ZC3A 1CJTC 2JLYA 2H18A 1S9DA 1Y63A 2FMXA 1GOTA 1K5DA 2CCGA 2VSOA 4JBWA 3ZQJA 3BOSA 3MWLA 2WMNB 2N46A 5KO2A 4FI3C 1RRGA 2K5UA 1R8QA 4JLNA 2QP3A 1GL9B 2V4ZA 4OYHA 3EWAA 3PIRA 4NYIR 4QJ3A 1CULC 1DVRA 1X8LA 4ZDIA 4LBVA 2RGNC 1XWIA 1W36D 1G6HA 2XJ9A 1DO0A 4ZI2A 2ZSDA 4A0GA 2ERYA 2HT6A 2QEQA 3FKSD 4UNPA 3ZVMA 3DPUA 1N5KA 4BPBA 2ZUDA 1HURA 4NPHA 3MGCA 2HF9A 3CRQA 4MGKR 4HB3A 1Z63A 1OKKD 2ZE8A 2WHXA 4DSNA 3O8RA 1N5JA 1HE8B 4UJ3A 5CJ2A 1YZKA 3PEYA 2W0SA 2XZOA 2P6RA 2D74A 1Z0IA 2BHRA 3D6TB 2GESA 4PPQA 3G82C 4LYAA 1CP2A 2XB4A 1IONA 4JYBA 3CW2A 3U2QA 2PCJA 5FBRB 2HCBA 4B3GA 4AI6A 2C95A 521PA 2GXSA 2BM1A 5BN5A 1N6IA 4M21A 1OV4A 421PA 4IOMA 1E0AA 1IN7A 4IDQA 4YDSA 1S8FA 1VDZA 4BEBA 4EPRA 2D62A 2WWFA 1G5PA 3AF0A 1N6RA 1PV4A 3WMFA 1T4GA 2J5XA 3AB3A 3QENA 2F1RA 2C8VA 3ZVNA 1MV5A 3NVAA 3H0KA 1A82A 2QY9A 1E9AA 4Q9HA 2WKQA 3H84A 2E1RA 4KVGA 3BE4A 3AVQA 1SGWA 3A4NA 1KZGB 5UKDA 2RAPA 3NBYC 2CBZA 4JT4A 1E2EA 1VG1A 3Q8XB 3QBTA 4Q19A 4U7DA 1IN5A 2J9RA 1OXVA 2Q21A 2FSIA 4DBLC 5JI3E 3DM9B 3FHTA 1E1QA 4URWR 4PC2A 3HYRA 4DIEA 2IUTA 5FFMA 4XD7A 2RGXA 4FCWA 3UIEA 1JXOA 3FDIA 3CR8A 4K81B 2J7PA 2ZRNA 3C15C 4A0HA 2QBYA 5L3RA 3V4RA 3K09A 2OCBA 1WRBA 3NKVA 2FGKA 4Y0AA 1NIJA 1ZUHA 1F6BA 4DLRA 4UQOA 3ZVRA 5KOYA 2HV8A 3LO5A 1P9WA 2AWNA 2VP4A 3BS4A 2ATXA 1JNYA 1AZSC 3ASYA 1XTRA 2ZJ8A 4PC6A 4PC1A 3EZFA 4QJ5A 4CEHB 1OYWA 4B74A 4AYXA 3LVQE 2XX3A 2QP4A 4LK2A 3ADKA 2WICA 3WHLA 1JECA 2BCJQ 1NBMA 1T6NA 2VTKA 5HPYB 2NMVA 1CIPA 2R9VA 2J46A 3ZLJA 3CX6A 5EP3A 3KQLA 4D0GA 2ZU0C 1WGWA 2CK3D 2V9PA 3FKSA 2QBYB 3N70A 1SVSA 1Z3IX 1Z0JA 3A37A 3AKDA 4JLMA 3MRSA 4PZYA 1OKKA 4XWAA 4BECA 4XIGS 3EX7C 2OCAA 1DAFA 1NN0A 2J3EA 4GOXA 3IPXA 4I1VA 4RFSA 1KK1A 2XTMA 1QVRA 3IO5A 4EPVA 5C2JB 3SR0A 2VP5A 1OF1A 1US8A 3WRYC 1PVOA 4OI1A 2VA8A 1W5TA 4AYTA 1NVVQ 3TGPA 2NZ8A 2R6DA 3C14C 4UNNA 5K8IA 1FMJA 2RHMA 4PHTA 3IIKA 3PV0A 1E9RA 4V0KA 3QG1A 4LPSA 5FTKA 1R10A 3SE0A 1W48A 3B5JA 1VMAA 1G6OA 3K9HA 1W44A 4DB2A 5A0FA 1OSNA 4WA7A 2IUUA 5D3QA 5FOSA 5P21A 1OH7A 1AN0A 3CRW1 4N0DA 3U61B 5KSZA 4WZ6A 1RVDA 5FTLA 1US8B 4RCZA 1E1RA 1N6PA 4MA4A 1CJMA 1II9A 2ZREA 1KI1A 2IS2A 4MKHA 2WJGA 1Q1EA 3LXXA 5DE3A 4B76A 5FTMA 3HDTA 1YR9A 1ZCBA 3EC1A 3BRWD 1QHXA 1D2NA 3AEZA 3AKEA 3GJ5A 4LX0A 1QG2A 3THYA 1ZU5A 5F9FA 1FZQA 3A1WA 1E9DA 3IHWA 4PC3A 1RW4A 4HB2A 3HPRA 1CR0A 3OHMA 1IXZA 1PLKA 1T9HA 1OJLA 2O8EA 1H8ED 1G4UR 3BJIC 3GP8A 1Z0KA 2QAGC 4KVAA 4RY2A 3OFND 4JLAA 2J41A 1OXTA 3KQNA 4AK9A 1FP6A 1UKEA 5EUMA 2FPLA 2EWVA 3QKSA 3SYKA 4QNRA 4X8OA 4B34A 1GAJA 4NYMQ 3WYFA 3BFXA 4AKIA 4D6PA 4HZIA 1E9BA 2MMGA 4BUJA 4YMUA 3THYB 3EA0A 3CIOA 2VP2A 3FMFA 1E4VA 1ESMA 5EE0A 4R7ZA 4US2R 1TU4A 1GNRA 2OFOA 2HJVA 4B3DA 4Q4JA 5FL7D 2ZYWX 3ZYCA 3D31A 4AKHA 4Q9KA 2PBRA 1DAEA 2O8EB 3AF4A 4MYUA 2YVUA 3QBVA 1KO1A 2LKCA 1EX6A 4FCTA 4P4SB 5J5CA 1Q20A 4YONB 1W4RA 4V02A 3B82A 3VX3A 4TSFA 3CLVA 2ODNA 3FYHA 1UEJA 3OIWA 1E9CA 2MMCA 2O0JA 1MO3A 1NF3A 4LJ9A 1WMSA 4PANA 4Q18A 4JZKA 5DLQC 2YJTD 4EIWA 3W5JA 1E4YA 2PH1A 1KK0A 1AJEA 4NBSA 2UZ3A 3TR5A 2IW3A 3F3YA 1P62B 3U7EB 3PJRA 2ZUBA 2W2TA 3K70B 2C9YA 4TL9A 1VTKA 2ZAOA 1U81A 1LVGA 4Q4JB 1M8PA 3OF5A 1P75A 3L82B 1GSIA 4HLQB 3SQWA 4OK3A 1D5CA 3RAPR 4PR0A 3CUEF 1JBKA 4Q7KA 4DB4A 1WBDA 2DFLA 1J70A 4R2IA 2ZYVX 2AFHE 1IN4A 2ZJOA 1NLZA 4LHYA 1AZTA 2HF8A 3W6PA 2QPOA 1Q12A 1MR3F 4QM6A 3P32A 5EXSA 2ZRBA 3ZGXA 2IC5A 4BRWA 1XMVA 4TL7A 1N5LA 2DHRA 4CEJA 4GP6A 1KZ7B 3ONWA 3CWZA 3K0FA 4KI0A 3VHXA 2YOFA 1UKVY 1HT2E 2KBEA 4E09A 2P5TB 1EFHA 4B73A 2QUZA 1F2TB 3TW4A 1KY3A 2FEMA 3CPEA 1ZNZA 3DZDA 2W58A 2E9SA 5CM8B 4OJKA 2FSFA 3WXMA 4MDEA 4LI0A 1H8EA 3GFTA 1VG9B 1KMQA 4F92B 2RMKA 4DRZA 1J99A 3IIJA 3OFNA 1S96A 3U44B 3PUWA 1I2DA 3ADBA 4DDTA 1XB2A 1EK0A 1G8PA 1TUIA 5SZJA 4QBGB 2OFXA 2WJYA 4DLSA 4EPWA 2ZRHA 4B71A 2GDJA 4E5UA 5CM9C 1WQ1R 3CB4A 1UBCA 1X3SA 3K0FB 3X2SA 2WZQA 3DO6A 4HLCA 3SBEA 2ZETA 3CRMA 1T3HA 2PZEA 5LD2C 2CHVA 1OXXK 4BWYA 2ZI9A 2QAJA 5FL7A 3QG5A 5FR2A 2YOHA 4URXR 3SU8A 2OHFA 4RD0A 4ZO4A 1N6KA 3BH6A 3FE2A 1TEXA 5FH9A 1E2DA 1P4SA 2NQ2C 1GP2A 1XCGB 4X8MA 2WWHA 5JEDA 3IHLA 3OEED 3QEJA 4EFMA 1J8YF 4LRWA 5KNDA 2RB4A 5SZIA 2DYKA 5G3ZA 1R7RA 3OIYA 2BMJA 2PT5A 2QQ0A 3CZQA 1KDPA 1R2QA 5B64A 2OFWA 2AN9A 1P72A 4P31A 4Q4AA 4G5SA 4MRSA 4Q4HA 2V1UA 1GFIA 3KQKA 2JLRA 3RS7A 1UFQA 1KI7A 4JBXA 4R9UC 3UATA 3ZQ6A 4QGFA 1DOAA 1U98A 1YHNA 1EFRD 2D2FA 3B2EA 3EPKA 1LF5A 3QY0A 4ZCLA 4DC9A 2ZJ2A 1XBTA 1AK2A 3RRZA 2XNDD 4LJ4A 2ZJYA 1TPZA 2GJ9A 4M4SA 5HR5A 1H8HD 2VF7A 4QFMA 5FBQB 2WJJA 1OH5A 4H9GA 4M9ZA 1XRJA 2GEVA 3U7GA 4Q4AB 4Q4HB 1N0VC 1T5LA 1G8FA 2YC2C 4PPGA 1Z0DA 1NLYA 2L0XA 4NZYA 3H4MA 4ZDKA 1JQLB 2FV8A 1RKBA 2EQBA 1H65A 4GOJA 2PZFA 4FMDF 1R6BX 1XTKA 2FX3A 4B48A 3AVXA 3I5YA 3I73A 1J90A 3TK1A 3PEWA 1AS2A 2KI5A 3C16C 3BORA 2CDNA 2CXXA 5BXQC 1M2OB 3IQWA 4C0SA 2F9LA 2DWOA 2QMEA 2QI9C 2A30A 1GL7A 3Q85A 3PG5A 2ODEA 3KUDA 2O5VA 5CK4A 1AIPA 1OIVA 1ZIPA 2BIFA 2ZAMA 1SVMA 1M34E 3QXJA 4JLKA 2AX4A 2ZR7A 4HDOB 4PSVA 4G5RA 4DT1A 4G5OA 4LV6A 5DN6A 2F3RA 4XTRA 1G8YA 4BFWA 1IXRC 1GL6A 4Z51A 2W2VA 4F4CA 3KKNA 2JJ2D 1CBUA 1E9FA 4CZ2A 1XEWY 2GBLA 2QTFA 3RABA 3LBIA 5DYIA 4JJKA 2JGNA 2ZVQX 2J0VA 4LJYA 3Q7PA 4BLSA 4C0JA 3WMGA 4F7WA 3AF3A 4FMCB 3B78A 3AVYA 3PUYA 1KDOA 1P5ZB 3I5XA 4NCKA 2HCJB 4A8JA 3G0HA 3PEVA 3WY9A 4DSUA 3CX7A 3B1XA 3U3OA 3FGNA 2CVHA 4DT1B 2W6IA 4LBZA 2G83A 1E9EA 4M2LA 5JJIA 3DMDA 2PJZA 2QSYA 5H1YA 1N6OA 2FFQA 3BC1A 1IHUA 4EQ6B 3NBFA 2F1JA 3Q5EA 3QPWA 3MSXA 2IYQA 3R9IA 3U7HB 2CLDX 1X8KA 2XNDA 3E5HA 4XWKA 2SHKA 3AVVA 4Q47A 5GJCA 3X1ZA 2P67A 3VR1A 3O8BA 5DHFA 4A8JB 5BN3A 1GRNA 2X77A 1Z0FA 2O8FA 4JLVA 1H8HA 4QC2A 2GA8A 3QOFA 4YMTA 3BGWA 1J2JA 1YR7A 1HUQA 1YZUA 2VHJA 2Y8EA 2R6CA 2AK3A 1G7RA 1Q22A 2HEIA 2YWHA 4Q02A 3LV8A 2A5DA 3GJ3A 2R6AA 4ACBA 4POAA 2X1VA 2XTZA 4V0NA 2IS1A 1MH1A 2BVNA 5AJXA 1TX4B 3FMPB 2IWRA 1ZBDA 3AGQA 3T15A 3L0SA 5KPJA 3ADCA 4TL6A 1G7TA 4HB0A 2AL7A 4ZCIA 3SNHA 1UM8A 1TAGA 2B6HA 3M4YA 1AS3A 4C0HA 3IEUA 4OJQA 5KU1A 3P4YA 2ZUCA 4XTCS 4BFTA 1XD8A 3CRRA 4I4LA 2HYIC 2KE5A 2ASEA 2ORVA 1G17A 2QE7D 1U9IC 1A4RA 5FPKA 3SYNA 2IYXA 4WVFA 3Q72A 3RYTC 3I92A 1YJ5A 2FPKA 4S2EA 4A0RA 1GKYA 4NONA 3DL0A 3J81k 3FWYA 4Q21A 4FMBB 2WWIA 1V5WA 2C99A 2IHBA 3F8TA 3MAAC 3WP1B 3SEAA 3KJEA 3LRPA 4OI4A 2JATA 2CJWB 4I81A 1P9RA 4UNQA 1A7JA 5EE5B 2JJ2A 3FMOB 5EZ6B 3EA5A 2OLKA 4ARZB 1XJQA 2YHSA 4D82A 5JZVA 3UPUA 1S1MA 1NMXA 5C1BA 4AURA 3EASA 2G1JA 2VH5R 3KKQA 3BB1A 4Q5IA 3NC0C 1GIAA 1OLOA 1VPLA 2NO6A 2A5GA 5IHPA 1EGAA 3SI7A 3QKUA 2XGJA 5G53C 1KY2A 4QL3A 4DCNA 1SULA 1ZM3A 2ZRKA 1TNDA 1NRJB 2PCLA 4YMWA 2NPFA 3AVOA 1D6JA 4JKIA 3W3AA 1CEEA 1DEKA 1FNMA 1RC8A 2ZRCA 3H86A 1DBSA 5AJVB 4UJ5A 5FPHA 2QSZA 1NG1A 4BZXA 1HV8A 1XTIA 4QBIA 2RGBA 3E70C 4M8NE 1TEVA 3DVLA 1Z22A 2V1XA 4G0NA 4LOAA 3KFVA 5B2ZA 4PSAA 1AM4D 2ZRAA 4V0LA 4BASA 4HAUA 5AJZA 3HPQA 1IY2A 3CF0A 4LCBA 3CM0A 1PLJA 3KJHA 1UPTA 4Q9LA 2J0QA 1YZNA 3BD9A 2ATVA 3CONA 3Q7QA 4HSEA 3UG6A 3B1VA 2P5SA 4HDQB 2HUPA 2GAOA 4QRHA 1N0WA 2ZI3A 2PLFA 4LPKA 1LB1B 3TKLA 4A6PA 4M9XA 5EE1A 4W9MC 1W1WA 4B2PA 4JS0A 4MKFA 2WAXA 2D7CA 4H1UA 3OE7D 2REXB 4FMDB 4OHZA 3SZRA 1YVDA 2GK6A 2VO1A 4L16A 3IPYA 2MSEB 1ZP6A 4D0NA 3CZPA 4J0QA 4PAMA 4BZQA 5JWRA 1FW6A 4OQNA 5EXXA 2J0UA 5B58C 1M1YE 4IEIA 1G7SA 4M53A 3KTAA 4W5WA 4XSGA 2G1KA 3OEHD 4G01B 1KDTA 1OB5A 4CYMA 2QG6A 4DDWA 1UF9A 3NH6A 4EPYA 4C2UA 1ZD9A 4O25A 4MQBA 4IOKA 4AIIA 1NN1A 3BWDD 1Z07A 4XOIA 2WBLC 4KU4A 4TYWA 1ZC4A 1D2MA 4HAZA 2I1VB 5DI3A 3SN6A 3WYGA 3BBPA 4V0ME 1QHIA 2CCKA 1KI4A 3KX2A 3KUCA 3TSOA 4F4JA 1PUJA 1XJ0A 4GI7A 1E0KA 3GPLA 1FOEB 2JCSA 4PZLA 4RZUA 5BN4A 5JECA 2J0UB 4N0EA 4B6FA 2WM9B 2IYYA 4DCUA 1ZM2A 4KXFB 3KTAB 2JLZA 4M1MA 4DIDA 1Z2CA 2A78A 3VNUA 2FE4A 2I1QA 4W5HA 2ZJ5A 3M1IA 3LBHA 2QPAA 1NNEA 5FBLB 3H2YA 4B75A 3UMFA 4BFSA 5KPDA 1HYQA 3REGA 2F55A 1Z47A 4DWJA 2VSFA 1CR1A 2BBWA 4PSKA 4ZV4A 4OK6A 4M1WA 5CYPA 5KNBA 2ZI4A 2FH5B 4O2RA 4C0KA 2BJWA 3B1ZA 4JL8A 4LUCA 4WW0A 5DI3B 3W9YA 2RCNA 3RNLA 1M74A 5FI1B 5AK0A 3KKPA 4NDZA 4QKQA 621PA 2A3RA 1ZIOA 4HAYA 4L4UA 3O8DA 2A5JA 2WSMA 3N2IA 4MGIR 3AVUA 4RKEA 4X8LA 4G5QA 3ZS9A 1YRAA 3IKJA 5A4JA 5JFGA 2VP6A 2X19A 4F4IA 1ZJ6A 2D4HA 2WPDD 4GZLA 3QF7A 1R0XA 1E79D 3K09C 2EFDB 3MCAA 3WYAA 2Q9AA 1J7KA 2Z83A 3VAAA 3TH5A 1SKQA 2O52A 4C9BA 2YKGA 2PZGA 1JPNA 1MO4A 5EE9A 4IJMA 2PJRA 2VHTA 4LYJA 2D06A 2MSCB 4B33A 1W46A 4I1SA 3DKPA 1TL7C 3IBGA 1QVAA 2JJ8A 4LDJA 4JLDA 4QM7A 4DUGD 3TAUA 1NN3A 3IIMA 2IYSA 2WMOB 2J7KA 2KJQA 4JJZA 5H70A 1NP6A 4V03A 3ZD7A 1TF7A 3KZ1E 1KNXA 2CEAA 1UKYA 3QXCA 2IYVA 2R6FA 4URUR 1COWD 1W0JD 3TLXA 2HLDD 4C3ZA 5JJKA 1VG0B 2OM2A 3NH9A 4I1UA
chains in the Genus database with same CATH superfamily
4IZHA 2VK1A 3L79A 4CSAC 3A7EA 5KDLA 2J9FA 3DE5X 1FIUA 1A5SB 4M1SA 3ROPA 4E0BA 1KO8A 3UMMA 2QLNA 2VHWA 1G1AA 4KRFA 4GPTA 1T1SA 5A6BD 3O6XA 3O8OB 2H63A 3ZJVA 3JAWB 5I8WA 1PYGA 1MKYA 2VAWA 3TI9A 4CKBB 5DGTA 4YYEA 1RIFA 1VMKA 4EQZA 1R0ZA 1X38A 3IIEA 4EFKA 2OOCA 4XWJA 3TZBA 1M7HA 3DM5A 4FFNA 2GXAA 2JANA 1BHO1 4M0FA 3VJLA 4UBIA 2VHVA 1G5IA 1KGSA 3WWYA 1OXSC 3C7CB 2J6CA 4IHJF 2XMZA 3FYCA 1Z0SA 3DMYA 3K1TA 1UMCB 4Z86A 2WU3A 3H2GA 1OHHD 4XJXA 1BDHA 4WFKA 1G2OA 2HMTA 3P45A 2ZI7A 2PSJA 2ZIUB 3AHEA 3RSCA 2N9UA 2YYAA 3L7AA 2Q3EA 4HN2A 1DQNA 2P65A 4NFLA 3KUXA 1QIJA 2PEYA 3EB9A 3OTWA 3N05A 3SBOA 5AC5A 3VR5H 1ESEA 4HUJA 2Y6VA 3EIUA 1AVOB 4L5BA 2IP1A 4KYVA 2XYVA 4FOLA 1Y1SA 2O5CA 3O83A 1F06A 3EIFA 1G8XA 3LS1A 3K5IA 5FIUA 3JQ7A 2HA3A 5D86A 3F4LA 4O8CA 1BDBA 2BH9A 1F1JA 5EJGA 4INOA 1F2UB 2IHYA 1XVTA 4YXWD 3OURA 5KS2A 1LXCA 3CEJA 1S3GA 4BX9A 3TE7A 3NEPX 3RRBA 2CW0F 4N6NA 2EFEB 4QO7A 1QAQA 4EHNA 1K92A 4N1AA 4BDTA 1QKIA 2L42A 2JJ1D 1D2AA 3NP7A 2Q1XA 4FYXA 1AB6A 2Z6UA 2I4IA 2H4JA 3IUSA 2FFHA 4LLEA 1HZZA 5FI5A 4AWXA 1Q0GA 4QUHA 4X00A 5DTQA 1ES9A 3WGTA 4CBVA 3QX7A 4ZEWA 3DKVA 5JXIA 1ZPDA 2DWPA 4DR1B 1X1BA 2VWQA 2ZIFA 4OP1A 2DP4E 3WBBA 4U63A 4CLOB 2BM0A 4ZU1X 3GRAA 1HK7A 2ZSFA 5BMVA 4I4TB 3CZ6A 1S2NA 3FVQA 3V1KA 3L0IA 4X1YA 4M7RA 1N8SA 3P1JA 2H4ZA 4B2LA 2XOXA 3TKAA 2RC5A 1F3OA 1RJ9B 3Q7GA 3PC6A 2REQA 1XHLA 5G1NA 1Z56C 1UPCA 2R7RA 4G0QA 3VZBA 3H5TA 3X1JA 5KYKA 1QVXA 2Y1XA 3JYLA 3HU3A 3D2CA 4BFXA 2B5VA 5C1PA 5IT4A 4ZMRA 3T61A 1QYVA 2WHEA 1X13A 1RE0A 2OEPA 2PIDA 3WK9A 1ZZPA 4HGZA 4BIIA 3DL2A 5DTMA 5I7SA 1ZW2A 1DWPA 2WLSA 3VZSA 3EA4A 3DOFA 4I5EA 1PBNA 1RT9A 4JELA 2FYTA 4Z4IA 4UUOA 1ABBA 2IIVA 1SOMA 3GLIA 4Q7CA 3C3WA 1M72A 1PYDA 3BMNA 1RACA 3FW1A 3JQ8A 1CFJA 2ZROA 3EIWA 5JZOA 3BGDA 4P38A 1E0JA 4UXHA 1W581 3TQFA 4O2AF 2I22A 5EJMA 3FPLA 2IHKA 5E8RA 4AY5A 2BC5A 2BUBA 3WE7A 1YKGA 2XMGA 5IRCD 3T3PB 3ENKA 2FJPA 1I80A 2EF0A 4TYMA 1NVFA 3B36A 3MLGA 4ESVA 4Z5XA 2D5RB 5EL0A 1MJNA 3TIVA 1XN4A 2IZ0A 2QVGA 1ZM7A 2VEOA 2QMHA 4NABA 1P7YA 1WA5A 3EZ9A 3GCGA 4HQ6A 4YN0B 1UXJA 1JA1A 1RCTE 1OFHA 4F4UA 1JLKA 1VCIA 3RU7A 3EQLF 3AU8A 3D8RA 3C87A 5CJPA 4P33A 3VMMA 5EE3A 2IHTA 5JQGF 3ODPA 3R9XA 4BZPA 3GX1A 4B2IA 3CLTD 1ZZEA 1E2IA 2XTNA 4JW1A 5G40A 2AFIB 1OXUA 4G81A 5FD8A 2D3WA 4H0NA 5A4IS 2POCA 3EYWA 3OJLA 4UMVA 3R5JA 2ONJA 3EZNA 1A1SA 3FNQA 3IQFA 2ASRA 4AQ7A 1E7WA 5FUXA 2C2KA 3WK5A 5K3EA 3H17A 5LQCA 3W1VA 5LQMA 3G4XA 2QQGA 3TINA 1Q2XA 2YHBA 2IOHA 2OZKA 4E5KA 1XZBA 4K9MA 5B7QA 5BURA 4H15A 4HWKA 2XCOA 2X6RA 4ONSA 3BKWA 1OW8A 2YWEA 4QBHA 1H0RA 5A9SA 1GV0A 2XB9A 2WSBA 3NHJA 5JMWA 5BWOA 3UGQA 3E3AA 1G8AA 3QIAA 4KIFA 1YS7A 1B4DA 4E5MA 4BJ1A 5KDOA 1ACMA 3I62A 1M66A 1X3LA 5AMXA 1NTOA 3V6LA 3WWZA 4XVUA 5JLJA 4NMLA 4XLLA 4BE7B 4DAOA 1PGOA 3KU4A 3TJZA 2XXJA 3LT2A 4K6GA 1CERA 3QVTA 4D46A 5U4QA 1JPVA 3DZJA 1BA2A 1X7ZB 2I03A 3WGGA 4J2HA 3RFYA 1T35A 5JT1A 2Q3TA 4GIBA 2GCOB 3Q88A 2VAVA 1QIGA 3H4TA 5AJHA 1T8TA 1L8XA 5JMOA 2C2GA 3M6AA 2QQEA 2IUEA 4GEHA 4UNSA 3R23A 4EUNA 4R31A 3K33A 4XJVA 2Y3HA 1FS4A 1K75A 3DMNA 2O2SA 2WVHA 3WK7A 1IH8A 4LNHA 3NYQA 3RBAA 1W5FA 1V6CA 4FPXA 1GR1A 3EXEB 4E2XA 4Z4FA 1GILA 4ID9A 4JDPA 4RA9B 3F6RA 1RZ3A 4B6EA 4IFIA 3KBOA 2D2VA 2NTJA 3ZWBA 4LMPA 3GY0A 1TMGE 3LP6A 5B3JA 2ON6A 2H07A 1GNQA 1PF7E 3GARA 3IPAA 4Q03A 5KYYA 1FJGB 1T6ZA 2SICE 1DAIA 1U1IA 2GZHA 3A27A 3DYVA 4XWOA 4HZGA 2QAGB 1WF6A 5CIVA 3G6WA 4MUYA 4B3BA 4WAUA 4OLFA 3AFHA 4WZAB 3QEKA 2RGYA 4C2TA 2PFDA 4AX8A 1MOZA 3FZQA 4ISBA 3TZQA 4HUTA 5LP1A 3GXOA 3V4FA 1JH9A 2Z4RA 2XTJA 5ALTA 3BH7A 1GGVA 5BQPA 3IALA 2KSQA 2YMQA 1ZN7A 3PQ5A 4QUKA 4PBRA 5JCPA 1Y82A 4IMPA 4BCDA 3RUIA 9GPBA 3Q8LA 2C5EA 1L6IA 5KI6A 3UM9A 1U2GA 1CR2A 1F5NA 5E2IA 3VFDA 1SXJE 2OZEA 4HDCA 1PK9A 2IQIA 1S9HA 1XFAA 2RBEA 4N65A 1G0OA 4IDNA 1PTJC 2XLWA 3K9NA 1J9GA 4PN3A 3NYRA 3RV3A 1J0BA 4EB6B 4Z54A 3E3NA 3L0ZA 3N0XA 2Y2UA 4HF7A 1YQTA 4U9HS 3QE0A 5DDIP 4KYTA 5CEEA 3TQTA 5IT5A 1SY7A 3PXGA 1FMWA 3FI0A 3QVGB 1L8OA 2ADFA 3ANLA 5DIFA 2WAYA 4R16A 5BRAA 3A2KA 4WCFA 4FGUA 2AXNA 4X8HA 1RHKA 3SXUB 3KSAC 3H2KA 4I1OA 3ZC4A 4RSMA 2NZJA 2OHVA 4S24A 1HTTA 4TMXA 4CQNA 3RVMA 4IP0A 4D9MA 1DWQA 3OQIA 4EHFA 2PQ2A 4UVIA 4HLUA 1BOOA 4ND7A 3I01A 2A88A 3AM5A 4E7PA 3D5QA 2V26A 2WP0A 3E9DA 4JJ8A 4DGQA 4F3RA 3K9FC 4TRMA 4B3JA 3DDNA 3JASA 4OU4A 2QRJA 2HDHA 3HR8A 5TARA 1Z83A 1L3IA 1QANA 2ETVA 2QWXA 2GM9A 2J09A 3H1PA 3IUMA 4G2NA 2CJWA 2F4VB 4G25A 3Q9LA 4Q3AA 4U2EA 4QU8A 4BOYA 3W6OA 1KAOA 1G2IA 5CG2A 3ZJUA 5ICCA 1WDTA 2CE2X 1ESDA 3E2IA 1E62A 5T8KA 2M6LA 1RWBA 5AWFC 2FW1A 1IZ9A 1TUEA 4BP8A 1XP5A 1EVLA 3V46A 3QTHA 1JIXA 3E23A 3DR3A 3S6JA 4MA0A 4ZI7B 5C35A 1B1CA 5D8DA 3W34A 2DT8A 3VU3A 4G9EA 2WUVA 2HHJA 1NJ5A 3GEIA 1G64A 2J4FA 3DD7A 4LGVA 1T9CA 3ZGYA 1W7AA 3IBSA 4PX2A 4EGSA 1LS6A 4GOMD 2BISA 1KI6A 2HRBA 2C4NA 2OP1A 1X7XB 3PDHA 3ROQA 1OQCA 3KYCB 4AJKA 2EW2A 4ZT4A 4JUIA 3I9NA 2N1BA 3AGUA 4R8MA 5JJCA 4A7PA 2JCVA 1F8XA 5DW0A 3V97A 2BTQA 1NUTA 4ZVMA 4BUCA 1TA9A 1J1IA 3HBLA 2HMZA 1FU7A 3O4RA 256BA 1J9ZA 4L8YA 1Z37A 2Q2QA 4ALLA 1R8QA 1TT5B 2P69A 2P79A 4KN5A 2WHPB 3NUZA 3P96A 2NT3A 2VXCA 5JCJD 3PGJA 4ILKA 2WABA 3RUPA 3T54A 2P6RA 2I4TA 1VLLA 1BFKA 2CXOA 1TIPA 2PCJA 2Y39A 4Z4QA 3MT8A 1IN7A 1PV4A 2GHTA 4XW2A 3QENA 3KHKA 4QDZA 1A82A 5FFFA 3C8GB 1FF9A 1SGWA 2QR5A 2D59A 3QY9A 2CBZA 4JT4A 5FKJA 4ZVQA 4D92A 2C1XA 1P0IA 1XOIA 4DKJA 1BQ4A 4BFCA 1T8RA 1GFZA 1O6FA 3J80A 1JXOA 3VKFA 1QE0A 2DLNA 1Z4OA 5CH8A 5DASA 3WL6A 1XTRA 4JOQA 4AYXA 1WD7A 3ADKA 1BN7A 2PUTA 3RRXA 4KVZA 1CIPA 2ZLBA 2Z08A 1KZ1A 1WMEA 5HXAA 1M6HA 3DJNB 3T3MB 4BECA 4P34A 2XY4A 1DAFA 3NAGA 3ZKWA 2C4UA 2FG6C 2C9ZA 3ZDXB 1IE3A 1QVWA 3GLVA 1EWVA 5C2JB 1XA4A 1LSJA 3CUYA 2MHRA 1DAPA 4GG1A 4NC3A 3RAGA 4ZEOA 4YRLA 2C0QA 1NVVQ 2W6ZA 2O3UA 3JAKB 1GLNA 1W4LA 2OSVA 2P6OA 1QCDA 4IF4A 3JQAD 1G6OA 4LF6B 3NRBA 2P7HA 4WA7A 2EXXA 5P21A 3LYLA 3AY0A 1I4WA 5FTLA 1AH2A 1W35A 2BPOA 3I6ZA 3ZD9A 2P4EA 1VL5A 3HDTA 2BEVA 3BGVA 2ET6A 2OP0A 3WBFA 4BTVA 3HLYA 3AESA 2QIOA 3KR2A 4KBLA 3ZEIA 2VN8A 2QUJA 4JODA 4CMIB 4CM9A 1UZNA 4O4LB 4QNRA 1YB1A 4PGFA 3GGDA 2W8BB 3ZK8A 5JAHA 1VHQA 2MMGA 4CJGA 4R7ZA 3HE3A 3ENWA 3JATA 1E7SA 2HA7A 1I7DA 2BMVA 1FYXA 1GAXA 4FCTA 2A4MA 5LLDA 3L18A 5LA6F 5KNDD 3DOIA 5TT1A 4E0HA 3FYHA 1UEJA 4C4YA 3S1SA 4EIWA 5FV4A 1JVSA 1AJEA 2IW3A 1X0XA 2FRVA 2BFBA 4R2LA 1U81A 1AF4A 4OK3A 2Y2VA 1SBZA 3D6VA 4Q7KA 1P0QA 2ZJOA 3OBBA 4J4TA 4MR7B 2R1VB 3ASUA 2BF7A 3VVCA 3PHIA 2C9BA 2ZBVA 4EI9A 2H7OA 3JD1A 3LJBA 3FWPA 2OXIA 2WPNA 1OAKA 1C3OB 4AJJA 4Y2VA 1HZZC 1IHPA 3IULA 1CEXA 4L73A 1QIDA 3CB4A 1I7NA 3V2IA 1C2TA 3VHXB 1YJQA 4K6CA 4E3WA 3SU8A 5CFRA 4GLJA 1TEXA 1Q7TA 1Y6FA 3K6BA 5F2NA 4Z53A 2ZB4A 1PJSA 2I4NA 1KDPA 4RTQA 3L6OO 1X9HA 3HKDB 5SICE 1JA9A 1VLMA 3HI6A 3IL2A 4PZUA 2GFHA 2GJ9A 4K6KA 1JFLA 3UNGC 3AR5A 1UBMS 1KY4A 1O95C 1BD4A 1XGKA 4X24A 1MAWA 2D5LA 2PZFA 1PK8A 1QKRA 2VDQB 3KOZA 1XTVA 3DE8A 1GL7A 3BRCA 1Q0TA 3RSFA 2FZVA 2XM0A 1K6EA 4R1OA 4LV6A 3KR9A 4XPIA 1G8YA 5C5DA 1GL6A 2W2VA 2F8MA 3GBSA 5CHEA 5CUQA 4C08A 1DX9A 3SM9A 4GPAA 2IEDA 4Y2XA 4EJ6A 1T9ZA 2XOEA 3GPDG 3TMYA 2W2PA 3FGNA 4GDMA 1TYCA 2PZMA 3LGAA 3IHKA 4DAEA 1JSCA 1JQKA 3CEAA 3QPWA 2I3GA 3C43A 4B6GA 2CFOA 4AW9A 1G5QA 5BV1A 3S8YA 2Z5LA 2VHJA 1RWOA 2VNJA 2QY6A 3EVAA 1AHPA 4UHEA 4BXOA 5I4CA 4KMSA 4I3FA 4EB8A 2AL7A 2P0YA 1UM8A 1TAGA 3P4YA 5EZSA 3RIYA 2ORVA 2DULA 2P62A 1A4RA 5IAAA 3J81k 3ZDYB 2RD2A 4TX1A 3B12A 2QTGA 4BAGA 4R0VA 5E3CA 4F6LA 5ES4B 2G1JA 1DFGA 1USUA 3UTDA 2NO6A 4L0QA 2XKJE 5AVRA 2Y0DA 1RC8A 2HB6A 1LZKA 4BNMA 4GM0A 3P9KA 4UJ5A 3UJNA 5BUQA 5EMJA 3FA2A 4CMKA 4UTRA 1H42A 2DPLA 4PLFA 3ZCPA 3ISVA 3FTDA 3A3PA 4HRVA 2Z9CA 2ATVA 4HDQB 3WWCA 1Q14A 4XXHA 2CC2A 3PUHA 2R47A 3QXGA 3WLSA 4MKFA 3D0KA 2SKEA 4B81A 3PNYA 2QRLA 1NSYA 1RZUA 2J5KA 4B6PA 1FW6A 3NJRA 1W76A 1M1YE 1PZXA 2QG6A 1BHQ1 1Z4LA 1ZD9A 2AQHA 4B45A 3DDWA 4AIIA 3K5WA 2GSWA 3KT8A 3E7PA 1Q91A 4MB0A 4LWPA 2A0WA 2XUJA 3ABOB 3N8GA 3CS3A 3LDHA 3SEQA 4KXFB 4A91A 4ZCTA 5K45A 2GPTA 4DPKA 3M1IA 3OT1B 3M6LA 3RJ5A 3N3BC 3T3EA 4DWWA 3PNLA 2BJWA 4OUDA 5FI1B 1U0SY 2FF5A 2COKA 3P2EA 3GGCA 2GLTA 3MFQA 4X8LA 5K0LA 3DUFA 2P68A 2VP6A 4F4IA 4TV8F 3QF7A 4G78A 1QAMA 3GD5A 2Q9AA 3PDCA 4MRAA 3U9TA 3V8PA 2X8JB 1A4IA 2IXOA 4MVUA 3MCUA 1GRCA 3MERA 3IRVA 3U7QA 5DP2A 1T3GA 5ILOA 4ZT7A 1B73A 2CEAA 2IEAA 2ZSUA 2AX3A 4OA8A 1F60A 3KDSE 2H06A 3GYBA 1Z5GA 1E99A 4O4HF 5BR4A 5EWMB 1SQGA 3M0EA 3KDPA 3GRKA 1JHXA 1C9EA 1MHPA 4ARUA 1W2HA 1SVOA 1UDWA 1FQKA 3EZYA 1XE3A 2JA1A 1C29B 4WA8A 3EPJA 4KAFA 3EXFB 1JXAA 2AWCA 2YQ4A 3VHRA 1TQHA 3KJQA 2VCBA 3B29A 1TM1E 1V6SA 4BO9A 3HDVA 2XKAA 2H59A 5F4BA 1KVSA 2WHYA 3O3MB 3PKIA 6ABPA 4LJ7A 2N3ZA 1TVKA 4BFVA 4MGZR 1WMDA 4HX2A 3JQEA 5DULA 1LSOA 3M9LA 2IU0A 2C7BA 2DEUA 2UZ1A 2EHJA 5B3JC 1V1RA 4FZRA 3BFKA 5AVXA 1YIDA 5L3SA 5CDTA 3TULA 1KSHA 2JJQA 1XZAA 1SB9A 3IEMA 4B32A 2PRKA 5KSOA 5JNVA 2XHEA 3TTSA 1CVRA 1Q6ZA 1RM3A 2QL7A 3N8NA 1R5OA 3FM9A 1CUGA 4QHTA 4F2DA 1BMFA 2AHOA 5K6AC 3ELYA 4QQNA 4CM1A 4UTPA 2VYNA 3QWHA 4N5HX 3IQTA 5F12A 1BWSA 1E4EA 5DM70 1WHTB 4IDHA 3OLYA 4DQUA 3K0HA 2J6IA 1SWWA 5T4BA 4DBZA 3KQHA 5IJ9A 1N75A 1II8A 3AETB 1YZVA 2FZ4A 3KVYA 1YHYA 3LXRA 2XUAA 4AY4A 1XNJA 1O9GA 5SYMA 3KJZA 1U0GA 1GQOA 2A0YA 2PX3A 2AKYA 1MMDA 4CEJB 1OFUA 4B4UA 4TTIA 3D2LA 1I7LA 3EIEA 3ZW9A 3WLAA 4Z3DA 3VOSA 1Z7EA 3ZNPA 2UZ0A 5IC6A 3P94A 3NWOA 1DP4A 3L01A 1VPDA 2C7OA 4O4JF 3A6DA 2HUNA 3CF4G 2C1ZA 2X4LA 4DDMA 5AVSA 3KLMX 3ORRA 6REQB 3IAEA 4GQIA 4OQFA 1GPYA 1IUNA 3QKTA 3D3KA 1ZWKA 3FH0A 4WCFC 3PRYA 3I61A 1V95A 2GRUA 1Z7WA 4L08A 1Z8DA 1EE1A 4R7GA 5JG7A 3SDBA 3Q2KA 4QGAA 2YV2A 3WWPA 2IXDA 4I55A 3NEJA 2XUIA 5DTJA 1ZIXA 1ENPA 1SVIA 4HLUC 2XZPA 3ATPA 4LYHA 3COPA 1PFGA 4WIAA 4RVGA 1M2EA 4A1FA 5FUWA 1QX3A 1J5XA 2X1MA 2CVFA 3QOYA 1ORTA 4X7RA 4KQKA 3Q3JB 4NBRA 3O8CA 3R6LA 2QTMA 2HV9A 1GY8A 2JFFA 2OJED 5T6MA 1HG0A 4TZKA 1ONBA 3R0ZA 4IOLA 3W5VA 3VGJA 5B7PA 3DT9A 3QMPA 1IHXA 4TV9B 1BEZA 2K6GA 4RC9A 1FDOA 2BFDA 1GZSA 3RH3A 1WDLA 3NTUA 4TS9A 1TF2A 4EBKA 2IJGX 3IJPA 5T8KC 3PWSA 1FS5A 2X0CA 4WBNF 3ZGZA 1EG7A 4BWVA 1EWYA 4CW7A 4HT3B 1W25A 4RSGA 2VTEA 2VEDA 3M6FA 4RE5A 2Q2NA 1YR6A 4GPIB 4DV4B 3A70A 3V4PB 4L8VA 2P9ZA 1PR9A 1SHJA 1ZITA 3MJVA 1FDVA 5DGIA 5KVVA 1TWCA 4C04A 2V5AA 4JYCA 5T67A 4D74A 5H3CA 3RKRA 4B8WA 1ZVJA 1ZJ4A 5DI9A 3FTNA 4XGRA 5JXJA 1G3IA 5JPDA 5C7IO 4RGQA 4NFYA 2WYUA 4NV0A 4IYJA 4W7SA 4HDKB 2IT1A 3AFOA 1I2MA 5A6SB 1QQAA 2RC6A 1JEEA 1I13A 2FMHA 3I1FA 3H9CA 5JI2E 2L82A 3GJTA 1W2WB 2ZI5A 3EZLA 3QWFA 3CC8A 5L7YA 3ICEA 1LD3A 4QJ4A 1ZYRF 1H5QA 3UGTA 2H5LA 1U0LA 1JQJC 1NSTA 1P2VA 4ZI5A 3DT8A 2RGUA 3JRNA 4HN9A 1U94A 1V8DA 1I1QB 4CETA 5JDIA 2O8BB 2HK6A 4UQPA 2EERA 3JVVA 1U4SA 4B3MB 1U3FA 1M33A 1JE0A 1M54A 2J9YB 3SIPA 1C0KA 1SQ0A 2W71A 2JGDA 2YHIA 2R96A 3QU4A 5C18A 3WHKA 4UHDA 3U1BA 1JR6A 1IM5A 3SC2A 1QH1B 1WF3A 3VHLB 2Q1WA 1AKQA 2R48A 4B7ZA 3KKBA 4KFCA 4OY3A 1F14A 4X95A 2KW3C 2C9OA 2BE7A 3NEAA 1LX7A 2FJUA 1PRYA 3MG9A 1DS6A 3NJ8A 4PNZA 4YPFA 1UJMA 3HJTA 3CGGA 3TOXA 4EK9A 2BY4A 1RYHA 3TVTA 3V5YA 3L0PA 3CMMA 4PLCA 2IUFA 1S7ZA 4JC0A 4M0KA 1JKJB 4HUQA 3WKAA 2Q5IA 1LBTA 1DIOB 4XQ1A 3JRTA 5CA1A 4L3OA 2XKBA 3HP1A 3H75A 1DAMA 4DLUA 3EMDA 5F3RA 3HNIA 1R6VA 5G4KA 2NGRA 3DOEA 3TW8A 2Z5GA 1DQSA 5IFKA 2AMLA 3QWIA 1QRSA 5A4DA 3E27A 1BA3A 4QYIB 1OR2A 1L7VC 4M76B 3IH5A 3QW1A 4AAYA 3RU3A 1Y1LA 3LU1A 1TQGA 1NXWA 4KLNA 4MCIA 2A5LA 3OUZA 2E4XA 4EKIA 5CFZA 3ND6A 4CF7A 4EZEA 4AXXA 4CIHA 3ZV5A 4KBGA 2B0HA 4KXXA 4YRMA 4Z1MA 3GBVA 4OJTA 4GWLA 2YMMA 1A9SA 1ZRMA 3HM9A 4RDXA 2ACEA 2RKOA 4Z0NA 2HDNB 1SKUA 2FQYA 2V7QD 4KN8A 1O5HA 4HYQA 3I9FA 1NOJA 2AUMA 4GOLD 3K5HA 4PRZA 1LE4A 4DFDA 4DLAA 8MHTA 2A57A 3L1KA 3UMRA 5JRZA 2XCTB 4WZZA 3SZMA 1W19A 5G0VA 3F4KA 2HLPA 1NP7A 2ZULA 4MVJA 2YRFA 4KFUA 5HFNA 3NHPA 2H7VA 3CSUA 3ORFA 4R51A 3FAKA 3U9JA 2QNRA 2O2XA 3WYCA 2I6GA 1U3WA 5BSGA 4AG5A 2R4UA 1B43A 1KYZA 3ER6A 5AI8A 3G5UA 3WLNA 5A0VA 2EQAA 4YQYA 5HKKD 1I5NA 4BU0A 4A1OA 2JFWA 3DWWA 4ZWNA 5KWJA 2XMQA 4LRYA 3KPHA 2OD2A 4D57A 1FSFA 4NCQA 4WESB 4ND1A 1PJ2A 1RC1A 4FT2A 5F3DA 3GLFA 1KYWA 2WYVA 3N75A 5TEVA 5C3MA 1Z8HA 2IOYA 4GBGA 3OT4A 1JB9A 4ZEVA 5TPWA 1AG9A 4JC4A 3AP3A 1DEHA 4CM5A 5F77A 1WM1A 1KAEA 1NVTA 4QOFA 4XUGB 4KODA 5D84A 3GIDA 2QT9A 5FNVB 3TRDA 4KOAA 5T3WA 4A26A 4YHBA 2OKCA 1Z8NA 3G2IA 2CFTA 2E2WA 1P6QA 3UFXB 3MJHA 3VR2D 4BNLA 4LI3X 5AJWA 3HU2A 4RQTA 2AQKA 2WVQA 2XL8A 1X80A 2REQB 4YUXA 3HC7A 3LGSA 3OHSX 2P3OA 4UCXA 2ID4A 3ZXSA 2GOYA 1TKRA 2MYSA 4RSRA 4S2UA 3LDAA 3B6ZA 1L5WA 3RUHA 5JH7F 4JKVA 4J7CA 2X0EA 3PLRA 5HK9A 1NLFA 3PNPA 4FHZA 4LV8B 1HQCA 4ZOCA 2IOQA 2EL9A 3W8NA 3LPLA 3RHSA 5E7MA 2WWTA 2CVQA 5EG5A 1SG9A 2F3TA 5BVGB 1ECFA 3KXIA 2VH2A 5KQGA 3UMKA 3VBCA 3WK8A 3GLIB 5DCUA 1SXJB 1VLVA 3L9WA 1F0PA 4LC1A 4QYMA 4F91B 4MRMA 5LB4A 1E32A 1IM2A 2BD0A 1O77A 3OD1A 3NGLA 2AJCA 1UK6A 1MCZA 2FEKA 1RQNA 2NU6A 4L3WA 1IN6A 3C8GD 4M0LA 3BREA 1JDZA 3DGFC 1OX4B 1JFFA 2BKLA 4AL1A 2ZTLA 1I3CA 4HGPA 3IDSA 3TIFA 2IYUA 4ND4A 1CUZA 5DHAA 1JYFA 4EL0A 1IQPA 5C32A 2GX6A 2VZ8A 4MLZA 2NP7A 3VSCA 1SCIA 3S84A 3DKRA 2HQSA 5E9WA 4L6IA 1F1BA 5K51A 2IEGA 1HW1A 2V74B 2G88A 1NJSA 4EGFA 2XJ4A 2XB8A 2PX5A 3NBQA 4YT2A 4KDRA 4QODA 1SHLA 4M9RA 1FFTC 2FWIA 4X7BA 3Q3VA 4RTKA 2VSOA 4EB0A 3ZQJA 3BOSA 3CA8A 3FRHA 5DLYA 2H8AA 1TEHA 4PLYA 3UK0A 4A03A 1JWAB 1WG8A 2WD9A 2ZSDA 4LXQA 2IOFA 2H1RA 2ZUDA 3R9XB 1JRAA 4J1QA 1HDYA 2XLBA 1BR2A 3UJ7A 1MAAA 4JYBA 4JB3A 3EOAI 1E6LA 4F9GA 1C8BA 3S27A 2QHXA 3KHTA 3PDIB 3GYGA 1BCRB 3KM0A 3G0IA 4YFVA 2DGJA 1WASA 2LUOA 2FSIA 1F1MA 4ZJZA 2LXNA 2WSIA 4PS1A 3WL4A 3H5VA 3HJHA 3OKCA 3ZCRA 8GPBA 5KOYA 1Z5UA 1MPTA 4PC1A 1UUFA 4B74A 3VR6H 3EPRA 2EWMA 1DMSA 1T13A 1RWXA 4ZO8A 2WUDA 4NTAA 4NS1A 4LMAA 1TJ3A 4L50A 5CEJA 2CXTA 5IN5A 1LDBA 2J3EA 1H2WA 2PA0A 4EHPA 2GAIA 2O6HA 3EPPA 1SD1A 2VP5A 5IDXA 3GXBA 4MVCA 1T6YA 1HE1A 4LYYA 4EMUA 3RIGA 4KK3A 3E8MA 4LPSA 4J6EA 3OZTA 4DB2A 3O2NA 1W9MA 2VDKB 3A4IA 3MJDA 3AUTA 3PX7A 3T9OA 1US8B 5LYYA 3WTBA 2WJGA 2QAIA 4IUCS 2NSJA 1WUTA 1ENOA 3AKEA 3THYA 1C5KA 3PHBE 5TJ5E 3DNMA 4OXXA 3E15A 2C2ZA 3DEJA 3N1UA 2OXFA 1CR0A 5DGCA 3M9XA 3KQNA 2I71A 1QO0A 1JWBB 4AKIA 1D4OA 1AN9A 2PTGA 3K32A 1DKPA 3QBVA 2XNKA 2ODNA 1TFKB 2VPXA 1MO3A 1Z2OX 2ALJA 4DL9A 3OJCA 2I8LA 2PT9A 1M1ZA 1Z38A 3OLZA 1JTFA 5CU7A 5AQ1A 1RXIA 4RK1A 3FF4A 1H9AA 2ZYVX 1NLZA 4O79A 2VDPB 3ZBTA 3IPMO 5GMOA 4KWCA 1HYEA 4B73A 4F92B 3JYYA 3JU3A 1XB2A 5BXYA 2PZAA 2IU6A 1V8FA 5FRDA 3EQ8A 3G8YA 1GTZA 3UAGA 2D2XA 2OHFA 4ZO4A 4EY5A 3EVTA 2R5NA 3WR5A 4PSDA 3NOQA 8AT1A 5HCUA 1ZSNA 4YGXB 1PNRA 1YFJA 2GN6A 3G6KA 1WHSB 1EFRD 2POQX 3LE8A 1AK2A 1TM7E 1M2OA 3IAFA 4MTLA 1JKFA 4XEVA 4BBPA 3JY6A 2WJJA 4M9ZA 1FRQA 2YC2C 4J6FA 2MSWA 3OM8A 4EHHA 1RP1A 1GZHB 4XR4A 1QMPA 2IV3A 3HL4A 3S5JA 5H16A 3P9RA 2DWOA 3BMCA 2V65A 2FW0A 1ZKMA 2BIFA 2E49A 4OG2A 1RXVA 3O90A 4HDOB 2C92A 2YASA 5DN6A 2FP4B 3DBLB 4LXIA 2GBLA 3NHLA 4JJKA 1CGOA 3USES 1UJNA 2YLDA 3WY9A 1F20A 3W4IA 3S2FA 4I1OB 3MIIA 4DT1B 5AOAA 3DMDA 1OWOA 2QSYA 5BT8A 2WIKA 3QPBA 1U31A 2JBWA 2CLDX 1QF7A 4JXXA 3G7UA 1IW7F 1G4WR 2X86A 4P54A 1RXUA 4JLVA 2EIHA 1RS0A 3AG5A 3SZLA 2HFJA 1GNVA 2DBVO 4DV6B 4BV3A 3QV2A 2IS1A 3SK0A 3T15A 2CUTA 4MB2A 1DEAA 5K99A 3L07A 2DUWA 3RC1A 4OLBA 4QPCA 2KE5A 3QLTA 3RI3A 3DE9A 5DK6A 5LNK1 4XM2A 3FYDA 3I2KA 2ZWIA 2CJWB 1XWWA 1P9RA 4UNQA 2X9QA 3EA5A 2HUJA 1UPUA 4ZQCB 5EJ9A 2Q29A 4XCVA 3DZHA 3ZWMA 2C29D 3KG2A 5GOZA 2QJRA 5FA8A 1TNDA 1NRJB 3HXLA 5IAJA 3MS4A 2BLLA 1DBSA 3B6IA 4M8NE 2HLNA 3DEIA 2V1XA 4LE1A 9LDTA 4U5BE 4HFKB 3QYPA 5B2ZA 4HNHA 4V0LA 1YAJA 3RC9A 4CF4A 1GGJA 1ZQ1A 3KJHA 2GAOA 4G1MB 4XUEA 4CTKA 2REXB 3DCJA 4QGSA 3CYFA 2RH4A 2YJ5A 5JDIC 3COSA 4M53A 1NUHA 6YASA 2YDYA 4AF7A 3AW9A 5CGQB 4XOIA 2VCEA 4V0RA 3OTHA 4Z4GA 1PR2A 3H1FA 4LNUB 4I5FA 4MYRA 4DCUA 4LZNA 4X66B 4WXYB 3VNUA 1QFXA 3ENQA 4YJFB 1CZRA 1CZLA 4ALNA 1T0BA 1NYRA 3HH8A 4WOBA 4LE0A 2IQ5A 4CMJA 5BN4B 2G9VA 1YTLA 4MWDA 1U2SA 1UIRA 4NZPA 3G8BA 4E5DA 1E79D 3GVPA 5KKNB 1RCPA 4Q9AA 5C1IA 4B33A 1TL7C 1KE1A 4YJ3B 3VYUB 1OVGA 1ADYA 3WV4A 1BKSB 5IANA 2M6RA 1SIWA 1KNXA 4D3YA 3QEMB 4URUR 1IM8A 5K0FA 1VFNA 4RVCA 4RD2A 4TVKA 4MP8A 2GAJA 1EINA 4YTEA 4P6IC 1DELA 3QYAA 1AXGA 4ZHQB 3Q6MA 1NAHA 1E3WB 3BJMA 4FEEA 2I3BA 3CURA 1BXGA 3CUWA 5K7SA 1EX7A 3AHHA 3LT0A 1R12A 5DLJA 1XF9A 1EM8A 4MUJA 1WMFA 4PLWA 4UW9A 1Z36A 1P1FA 3K66A 1M2GA 5HQJA 3DFUA 3EXIA 3LUJA 1A69A 1WZNA 4DUYB 3ZWIA 1FJ2A 4DJFC 3OIVA 3PNOA 4H6PA 3CR7A 1VECA 1M1YB 4LA4A 1KYYA 2BGMA 5EP4A 2OZPA 2ZZMA 4JA0A 4WLUA 1JDBB 1JHDA 4C7OB 4NX2A 4XYBA 4IDEA 4PE5B 4ETMA 1JHMA 2YY5A 3G68A 2WJWA 1GQ2A 2XUFA 3LC7O 1XPRA 1PBTA 4DR7B 4ENWA 3UF0A 5E8JA 2P9CA 2YXNA 4JIOA 2YV5A 5TLSA 2YWBA 3PS9A 4RHYA 3UY4A 2RAFA 4X41A 2G3KA 3MD0A 4LHZA 2H7VC 3ICQB 2FZWA 2OM6A 4RORA 5AJUA 5DCWA 3IT0A 2EP5A 3THXA 3L46A 1LS1A 4PCVA 4B7XA 1HYGA 3VDNB 1GSAA 1WWPA 5A3RA 3L8DA 4L5CA 3L0OA 2J85A 4ZN6A 1XDSA 2R79A 1GRRA 4GU5A 4X71A 5EINA 2YWCA 1VCMA 3AKZA 3EWSA 4I08A 4ZIRA 4GFDA 2BFBB 2R2GA 2QTBA 3AG4C 2XUPA 4RLFA 4MLDA 4M49A 2HRDA 2R6GA 3QYFA 2Y0CA 4R3UC 1GG9A 1CDDA 5IUJC 5MFPA 4W5JA 1K5HA 1FMTA 2Y68A 4ZDWA 4RWEA 3RTBA 4EIYA 2CLEB 1Z4KA 2FA9A 5JBIA 3GLIE 3A58B 5DM0A 3FVYA 4O2BF 1H4SA 1YJBA 3U0VA 2RGCA 1KSFX 1T5HX 4HGOA 5ALGA 1QRDA 5CTAA 3GEPA 3TLEA 3ZX4A 5EN4A 4KTVE 2QUKA 2VT3A 4EY8A 3R75A 4OB8A 4PYKA 1R4AA 3AI3A 2LPMA 2GDZA 2O5EA 1HY5A 4RVSA 5EIWA 1CIVA 8OHMA 3U7RA 1JSZA 5EZYF 3LVFO 3FSEA 2XSZD 2Q3BA 2O0HA 1PT7A 2CSUA 3AEKB 2KC3A 5CBKA 3ITDA 1KORA 2JHAA 4X1IA 3BG5A 1CYEA 2IX9A 1EDOA 3PPIA 1U89A 4AS3A 4QJBA 4WOPA 3Q11A 2XXAA 3T7SA 3LDGA 2LGJA 2VWGA 4AICA 4RK5A 1IG3A 3GAMA 1IN8A 3D9QX 1I0LA 4U00A 3S90A 1U8UA 1FVHA 4RZ2A 1FCJA 2VDOB 1I2ZA 3O82A 4LDPA 1EJBA 1GTSA 4F4FA 2RIPA 4DCVA 1M1NB 4KGXA 3K35A 2F1HA 1KYIA 2DFTA 2FXVA 1DOVA 4CG3A 5TE9A 4MKXA 2WJVA 1QU3A 3I23A 1RAIA 5T7BA 1E3EA 4KAXA 1UOOA 3H5WA 2C3UA 4Q12A 5IABA 3L7CA 3SMVA 3IHUA 1ZR4A 3PP8A 4C0LA 3UBMA 1S3SA 4E22A 4TSRA 3UOAB 4BO3A 1C30B 3SOPA 2V7XA 3SJCA 4CT4B 1D1BA 4OD4A