2XXAB

The crystal structure of the signal recognition particle (srp) in complex with its receptor(sr)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
283
structure length
283
Chain Sequence
b'ISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFARED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL RECOGNITION PARTICLE PROTEIN
publication title The Crystal Structure of the Signal Recognition Particle in Complex with its Receptor.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Protein transport
total genus 82
structure length 283
sequence length 283
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00448 SRP54 SRP54-type protein, GTPase domain
B PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2xxaB01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xxaB02
1EFHA 4P4SA 2ZSBA 4B74A 4DLYA 1Q22A 1KSGA 2FSIA 2VL7A 5L8VA 1WA5A 3HU3A 4W7SA 4J0QA 3OEEA 1NP6A 3EXAA 2ASEA 4TLAA 5C4GB 3ECCA 1SQ5A 1X8KA 1TUEA 2OSBA 4C2UA 2O8FB 5JRJA 3BFVA 1T9HA 2CJWB 2X1VA 4HI0E 1K6MA 5JCZA 2HJGA 2R65A 5D3QA 2FNAA 5FBWB 1GAJA 3CKLA 2D7DA 3LQQA 3U3OA 1M7BA 4HAVA 5DI3A 1RPZA 3BJIC 4XH9B 1TPZA 2WJHA 1GG2A 1R6BX 4TZ0A 4G1UC 3GJ0A 4KBFA 3O8CA 2V8OA 1JR6A 5KDOA 1OKKA 4LV8B 4HB4A 2QM8A 2OCPA 1DEKA 1N6LA 3MAAC 5JCPA 5L3QB 3NBYC 2IS4A 4OJQA 3CNNA 4MA4A 4OHXA 4MRNA 5FL7A 2IYWA 3A37A 3BH7A 3RS5A 4FN5A 1FMJA 1JXOA 5F3WB 3W9YA 1NNEA 2P3SA 4MGKR 4V0KA 1JR3A 2IUTA 5IHPA 1AQYA 1N0VC 2C04A 1Z07A 3PG5A 4LYFA 3M0EA 2O8EB 2CBZA 1IXRC 1PLJA 4RVCA 1ZNYA 3SYLA 1NIJA 3BE4A 1JECA 1S96A 1W5TA 3QKSB 4DT1B 2GF0A 1II8B 4PC2A 4EQ6B 1RKBA 4B44A 2H8KA 4LJ4A 4PSAA 1SZPA 1TQ4A 2NGRA 2FOLA 1NLZA 4NKRA 2OFXA 4US2R 1TX4B 1I2DA 5G3YA 3BXZA 5IT5A 4Q5IA 3SFVA 2BEKA 3NG1A 1GUAA 4XJXA 1XCMA 2GK7A 4LHWA 3BIFA 2IK8A 3E5HA 2QEQA 2QENA 4I4LA 1IY2A 4LJ5A 2PMDA 4HLCA 3W3ZB 2WHXA 3W5IA 2YOHA 2GCPA 5IRCD 1MKYA 3PVSA 4M0LA 3HPRA 1VG1A 5FUXA 1B0UA 1G6OA 1S4QA 1SVKA 2JLRA 2OV2A 3A1UA 1Z83A 2JASA 1CR1A 1XTRA 3CIOA 2OBLA 2CHGA 3U44B 3THOA 2WWGA 2OLKA 3AEZA 3QXJA 1N6OA 4AI6A 3MLEA 2RGNC 2OFOA 5FUYA 4LYAA 4A15A 1U8AA 2QAGA 4RFSB 4I1VA 1AQUA 4LPSA 5FL7D 4OK3A 4EPXA 4DDWA 1ZUNB 4GZMA 2BKEA 4MGZR 1KK0A 1E1QA 2R6CA 2VA8A 4W5JA 2CNWA 3FDIA 3K70C 2XZPA 1OIWA 4JLDA 3MWLA 2LKCA 2EQBA 2ZIAA 4JJZA 4NBSA 4UNNA 1OFUX 4YDSA 4TMKA 3SJZA 3Q5EA 1F60A 1QHYA 2ZJBA 4O0MA 4QM6A 5JSZA 2OXRA 1Q3HA 2ERYA 1NKSA 3K0AA 3GPLA 3THXA 3B60A 4EJSC 2HF9A 1NY6A 3Q7QA 3HR7A 4QXAA 1AJEA 1Q20A 5IF9A 3VMFA 4TMXA 4E5UA 3VU9A 1HQYE 1R0XA 4TLBA 1FX0B 3A4MA 3HR8A 2NO1A 2W0MA 4NTZA 1E2GA 1GILA 4PC1A 4Z1MD 4D6PA 4BFVA 5E7IA 1MO5A 4Q4LA 1E1RA 3OAAA 2V9PA 1UKYA 4M4SA 3BFXA 4LHXA 4RZ2A 1NLYA 1YZTA 5CJPA 1D2EA 1W36B 1EFRD 3ZD7A 1D2MA 1KI6B 2HJVA 4URZR 4Z51A 4IEIA 3UG6A 1HH4A 2ZJOA 3A1WA 3K9NA 4GPTA 4JYCA 5H1YA 1OXXK 2NZ8A 1ZIPA 4QL3A 4YC7A 4B73A 2CVFA 2P0EA 3P4XA 2G77B 2ZRDA 3LV8A 4NCJA 1G4UR 2DFTA 3AGQA 2CE7A 3GMTA 4LY6A 1TAGA 4DCSA 4Q9IA 4U5XA 1W5SA 4YMUA 2IF2A 4KYIB 3L8YA 4NDZA 4PANA 4BGDA 4C0SA 1E2MA 3MWKA 2QBYB 5LD2C 4JT4A 2JLYA 2B8TA 1ZM7A 4DLSA 1XXHE 1E9RA 3BWDD 4FI3C 5CITA 4Q4JA 2JDID 4MYHA 4R98A 3EZ6A 1MT0A 4JLJA 1JB1A 1QHIA 3LD9A 3SEAA 4CEJA 2J0QA 1RIFA 1YR7A 3T5GA 2QMUA 1G5PA 3RS2A 4Q7MB 3K0EA 4RZ3A 3T1QA 1X6VA 5CK4A 5EP4A 3RRNA 1UBCA 2O8DA 1WBBA 1CR0A 1L2TA 4IOLA 1NIPA 2N46A 2A9KA 4M9XA 4A8JB 4G5OA 4DSNA 1I4LD 4U00A 3FVQA 1I4DD 5EXSA 3ZVRA 2N42A 1E99A 2O0HA 2CL7X 1LTQA 4M9ZA 3VX3A 5E3HA 2P6RA 5JWHA 2GZDA 3D7MA 2WJVA 4PC3A 1QG2A 5KSOA 1ESMA 2VO1A 1KI3A 1VECA 2RGEA 1F2UB 4XTCS 5FPKA 1NN1A 4II7A 4RD6A 4LBYA 2WMNB 4A6PA 2NMVA 1QHGA 1M7GA 2HLDA 1V5WA 4B2IA 4LHZA 5JHHB 1TF2A 2HXSA 4MRSA 6Q21A 2RGGA 4HSEA 2BJVA 3FMIA 2C03A 2IYUA 4RCZA 2XX3A 3TJZA 2H92A 1KAOA 1IOZA 2J0UA 4HAUA 4PQYA 4AY2A 2HCBA 1XXHB 4Q02A 2QGNA 1R5OA 2WICA 3LXRA 5JLJA 2I1VB 2OBMA 2FU5C 5L3QA 2BBOA 5FTJA 3UATA 4HLUA 1CJTC 1XZQA 3T06B 521PA 2AK3A 2WMOB 4BZXA 1XMJA 4B35A 1YQTA 1JPNA 2GWHA 1TL7C 3DKPA 3PFIA 2A5JA 3RS0A 4RY2A 2JGNA 2IF0A 1P4SA 3C16C 3I3SR 2UZIR 1JJVA 2OCBA 4YONB 5FTLA 4BFTA 1FQJA 2HF8A 1IONA 3NXSA 3KTAB 1U9IA 2ZJYA 2QP9X 3FFAA 2CK3D 5HCIA 2B21A 1R5BA 2PX0A 3QY0A 2A5FA 5TY0A 5CM8B 4A0HA 5KSYA 4LJ6A 4EIWA 3DKVA 2YV5A 3QKSA 4GMDA 1II8A 4EQ6A 2J0VA 3T12A 4F93B 1LFDB 2VSFA 1P60A 4TT3A 3X1ZA 1E6CA 2WJIA 2YWEA 4MDFA 4N0EA 2FJUA 2GCNA 3BERA 3QVUA 3FWYA 1Z06A 5KDLA 2YOGA 3A36A 3KJIA 5DISB 3ZYCA 1FUUA 4GL2A 3W3AA 1KAGA 1G18A 2D4HA 3SNHA 2NIPA 1XTJA 1YZKA 1N6RA 1Z22A 2HLDD 1U8YA 2EW1A 3CR8A 1U8ZA 3BGWA 1UDXA 5E4FA 4CGZA 4YXWA 5SZIA 1G291 3W34A 2WWWA 4X8OA 1XCPA 3LLUA 2JJ1D 5F9FA 4QNRA 2IYYA 2WPDA 3KB2A 4JYBA 4DWJA 3EZFA 1HT2E 4XD7A 4B43A 3U44A 3MUFA 4CVNA 3A6PC 2ZRHA 1N6PA 1X8JA 2FA9A 3SJBA 4K8OA 1FW6A 4LX0A 5K8IA 3AM1A 1F5NA 2BM0A 4RFSA 3KXKA 1O87A 1TF7A 2OZEA 4A2QA 1NG9A 4LJYA 1Q1BA 1NJFA 1WCV1 4FMDF 2BMEA 5EXPA 2B92A 1IJEA 4LJAA 3A4NA 4D0LB 3U3JA 1N6KA 1E79A 2VSXA 1P9NA 3IGFA 2GXUA 4JKIA 1G8YA 1ESNA 2F1IA 2ORIA 4PPFA 2JCSA 2D7CA 4B3BA 2AXNA 2QMHA 1II0A 1LF0A 3L43A 1Z3IX 4MKGA 5F2EA 2REXB 4NYJR 5E95A 1DELA 3U60B 4M1OA 1G16A 1KK1A 3EC1A 1XJCA 3WHLA 5JS7A 3OFNA 1GL9B 2PZEA 4GRAA 1AGRA 1NJGA 1NN3A 3GLHA 3MFYA 1RFLA 4Q19A 1EFUA 2VSOA 1P61B 3QXHA 3QXCA 4TT3D 1FX0A 1U0JA 3E1SA 4G5SA 4B6EA 3IPYA 1OB2A 2H5EA 2P67A 4ZIRA 1MRSA 2WWHA 4N3NA 3IQXA 3T34A 4HUTA 1Z0FA 2ZRNA 5AJVB 3GEHA 4AKEA 3RWOA 2LWIA 3EW9A 2XZLA 2ZRLA 2GF9A 1ZNZA 4QHTA 1E0AA 3CF6R 2GKSA 4ASUA 3MRSA 5DLQC 3LLMA 1DS6A 2J87A 3CLVA 1KI6A 2ZANA 5AUOB 2YVUA 1N5JA 2H57A 4OKSA 2F1JA 4IOKA 2Q9BA 1RJ9B 1W4RA 3GQBA 2IWRA 4CW7A 4HZIA 4TZ6A 2WIBA 4XD7D 3B5JA 1JBKA 4JLMA 3V4RA 3X2SA 1XEWY 5FI1B 1WGWA 2I4IA 3TR0A 2J9RA 2W83A 4WA7A 1YRBA 3C5HA 3P4YA 3NDPA 3AUYA 2C5LA 2GCOB 4FMCB 4JIMA 2W6ID 3IEVA 3RS4A 2IHBA 5SZJA 2QBYA 2RGDA 1CP2A 1NVWQ 4LYJA 2ZPTX 4XWAA 3MCAA 3MG9A 4A9AA 1OLOA 4P4SB 5JI2E 1J8YF 3VR4A 4B48A 3T61A 1FFHA 1EX6A 1KDOA 4HLDA 2IYSA 4KSCA 3WXMA 2IXFA 3CR7A 2YHSA 4DLRA 5BN3A 4KFRA 2CLSA 2GEVA 4IDNA 1OE0A 1GL6A 1WF3A 3GD7A 4OHZA 3RLFA 2OM2A 4RFVA 5BN5A 1Z08A 3NC0C 1KI8A 2E87A 5AUQA 1WDTA 2GAAA 2QQEA 3PXGA 3OFND 4US1R 3TK1A 4F7WA 3QF4B 4QBIA 2CEAA 4ZKDA 2I1QA 4TWZA 5KPJA 3N2EA 1KGDA 2ZYVX 1HUQA 1Q1EA 2YNMA 1P72A 4TMWA 2AKAB 1R0WA 4NYJQ 1MOZA 2CVHA 1VKJA 4Q03A 1GNQA 1G64A 1D5CA 4CRWB 4L16A 4DLWA 1F2UA 4MQBA 2D74A 2C9OA 3CH5A 3AVYA 1KOFA 5B57C 2A3RA 4G5GA 3BAFA 4JVMA 1XPOA 4P4UA 4FWTA 4ASUD 3NKVA 5FL3A 3QI2A 2H18A 2R44A 2ZTSA 1WB9A 5IDVA 1M1YE 4QHYA 1VYVA 4TLEA 1TQ6A 1EX7A 3E2IA 5HE9A 4NCIA 5FOSA 3TAUA 2XNDA 5H68A 3H86A 5DSZA 4Q9JA 4OHYA 2WKQA 4KU4A 1YZGA 1S1CA 4KLZA 5CYOA 5K8TA 4BASA 3KQUA 5CIWA 2KB0A 3CRVA 5EQTA 5L3SB 5BYKA 2H16A 1E98A 3AF0A 4UJ3A 4BUJA 4LC1A 1E3MA 1RYHA 4M53A 1QBKC 1MR3F 4IDOA 4PAOA 4BLOA 1GSIA 2FGKA 1ZYUA 5J4HA 5JEEA 4L4UA 2YWGA 3AB3A 1KHTA 3ZIAA 4BLTA 4E22A 3I4LA 3ICQB 2XEXA 3KJHA 3U7FB 1QHHB 1G5TA 1VG0B 2ZU0C 2IEYA 2PH1A 2FSGA 2GXSA 2IYZA 5EE9A 2FFAA 3IO3A 2P6NA 3DHWC 4AG5A 2IW3A 3SQWA 3NEYA 4G01B 1TNDA 1HEIA 3MMPA 3QPUA 4CZ2A 3PV0A 4BFSA 5CJ2A 1L4UA 2LKDA 2UKDA 2WWIA 2CCJA 2RGBA 4D0NA 3WNBA 5JMTA 2BWJA 1AS0A 1E96A 3AH8A 4MYUA 5EZ5A 1JQJC 2BMFA 3CX8A 2FPLA 2W6JD 1KMQA 3ZVMA 1R5NA 3M4YA 3SE0A 3CPJB 3KL4A 4JJKA 4PO8A 4LDJA 2QY9A 2VP5A 3MJHA 1E9DA 3AF4A 4ZI2A 1GOTA 2JATA 1OFHA 1HQCA 3B1YA 1DBSA 3KXIA 1DARA 2A5GA 5GJBA 3RC3A 3FHTA 2AL7A 1XD9A 4GDFA 1LF5A 2AFHE 1Q3TA 2X19A 3CX7A 2RAPA 1D8TA 3EZ7A 2RGCA 1MH1A 2A5YB 3AP3A 4BLQA 1G8PA 1XU4A 2YKGA 3BB1A 1XMSA 4DDTA 1IN7A 3DZ8A 3K09A 2FG5A 2IYTA 2QMEA 1UDWA 3RS3A 3K0AB 3WYAA 1T4GA 3CPEA 4LUCA 2J41A 3MWJA 2OT3B 1CLUA 2VHJA 3TNFA 1NY5A 3C7KA 4P31A 4S2EA 4KBGA 421PA 4TTQA 1N0UA 3THYA 4KYUA 3B9QA 5IK2A 2QN6A 1BKDR 4OQNA 4WAUA 1FP7A 1T91A 4PAMA 3KB1A 4WZBE 3V9PA 4Q18A 2ZREA 3DOEA 5KUTA 1DE0A 2W58A 3I5YA 1Z63A 5F9HA 1AK2A 3I1FA 2J46A 4LHYA 5FOXA 2FPKA 1NG1A 5CLLA 4OJKA 3K8YA 4YMVA 5KNBA 1CJKC 3TIFA 4M1MA 1DAFA 2GZAA 1S2MA 2CE2X 4A2PA 5C1BA 3B1VA 2Q21A 2Q3FA 2ZEJA 4NONA 3ADKA 5H70A 4AURA 1P5ZB 2QZ4A 2PJZA 2W00A 3IIJA 3SBEA 5FPYA 3UMRA 5G53C 3WRYC 3U6BA 1ZD9A 4Q7KA 4O25A 2FV8A 4GP6A 2J7PA 4NCHA 5LPNA 4AYTA 5JECA 3K70D 1EG7A 1Z6AA 3GJ6A 4B2PA 1C1YA 1QZXA 1DAKA 2NO0A 1DAEA 1ZIOA 2N1BA 5BXQC 1M6NA 1BYIA 4BECA 1ZU4A 1JAHA 4JZKA 5HPYB 5C4MA 1MV5A 4A82A 3K9HA 1CKEA 1LB1B 1EXMA 5FBLB 1OIXA 3B78A 3I73A 2O8BB 4CEJB 3N70A 1NSTA 2GCOA 5BYJA 5FOWA 4RZXA 1Y63A 3NHAA 3PITA 3R20A 3TSZA 1L7VC 2Z6VA 3NIBA 1OFTA 4KV9A 3ASYA 1OH5A 2O8DB 3F8TA 1XD2A 4E09A 3KKNA 1VHTA 1VIAA 4IXNA 3ZGXA 1WQ1R 1ZVQA 4TL8A 3RYTC 5IK2D 4B3XA 5AWFC 2RH5A 1W36C 1X86B 5TV2A 2ZJAA 1S1MA 3U7EB 4H1UA 2D62A 2B7BA 3PENA 3SI7A 1S9DA 3A1TA 1ZJ6A 5KNDA 2BVNA 1P7CA 3QF4A 5A5GA 4AWXA 3HJNA 4HEJA 1IHUA 2GJ8A 4RJLA 2XSZA 4MH0R 1Z47A 2FFHA 1AKYA 3HYTA 4QC2A 4V0NA 5KHOC 1PZNA 1TU4A 2XOKD 2R6GA 3P1JA 1N3BA 2A78A 1AGPA 1UPTA 1ZM4A 3LRPA 1SVWA 2GBLA 2J0UB 1P73A 2X8AA 2F1HA 2J7PD 4CEIA 2OEPA 4MRRA 5DNYB 1XZPA 1IJFA 2LCFA 4ZDWA 4BFWA 3ADBA 3GJ3A 2OBNA 2QRZA 1XTKA 4IVPA 2Q9AA 3GEEA 5A0FA 3LBNA 3B1XA 2PT7A 3NTUA 3RABA 3R7WB 1E32A 4BE7B 3AP2A 4R71A 5BWMA 2VLIA 4A8JC 1Z8FA 1VYTA 5L3SA 4B34A 1FMLA 2BM1A 4F4JA 1KMHB 3LVQE 3KQNA 3BORA 3KQHA 2FH5B 1V43A 3SHWA 3B82A 4BWYA 2H17A 2WJJA 1G19A 1UAAA 3X1XA 4BRWA 3GCGA 2QPAA 3LW8A 1M74A 4OQFA 3SHFA 2V4ZA 4EPVA 2VHQA 4JLNA 3OIWA 4QJ5A 4MDEA 1KY2A 4Q7LA 4FIDA 4RD3A 1VIYA 1UEIA 1CULC 3H1TA 2VHUA 1QHHA 2Z5FA 1XX6A 1YZUA 1TEVA 1DO0A 2ORVA 2PLFA 4RKFA 4Y0VA 2ZE6A 3FYHA 2OAQ1 1K5GA 4FXPA 4Z1MA 2DY1A 4L9SA 2ZRFA 3TKLA 4JLOA 4ZDIA 2PJRA 3ONWA 3E70C 3SFZA 3ADCA 2XB2A 3GLHE 1ZP6A 4RCYA 4HATA 3I8XA 2G83A 4NHOA 1ZUHA 3U3RA 1W46A 3UPUA 1NVXQ 2XSZD 1EFRA 1XB2A 2ZAMA 4OHWA 4L15A 4Q9KA 3EPLA 3GLGA 2QU8A 5TMPA 1OXVA 1E9AA 4Q1DA 4PX9A 3IDQA 4R9UC 4KFTA 4OYHA 1YVDA 3IHWA 2RHDA 3SOPA 2V1UA 5F98A 1KJZA 1X8LA 3RHFA 1A5TA 1WXQA 2BDTA 2O0JA 1TUIA 3U7GA 1KZGB 1P6XA 3O8BA 5ELXA 4HAZA 4DRZA 4IW3B 2VHTA 2DWQA 3GJ8A 1J99A 1CJVC 3SDZA 1RRFA 2NO6A 1YHNA 1G21E 1J90A 2JDIA 4AD8A 4Z8YA 4G3XA 1NVVR 4WXRA 1A7JA 2YC4C 2QI9C 5FPSA 1CS4C 2WKPA 3BBPA 5J40A 4A0GA 1G7CA 1JQLB 1AN0A 1AM4D 5J4LA 3R8FA 4TSFD 1E0KA 4JL6A 3ZZUA 1WE2A 4PHFA 1VCOA 4O2RA 3TUZC 4HLQB 2ZI7A 4WZ6A 4X8HA 1ETUA 4DCVA 1H8ED 1QG4A 2F6RA 4QG7A 4PC7A 5DN6A 5EZ6B 3GLHB 1N6IA 2ECKA 5HZKA 2DFLA 1Z0KA 3RSOA 3FTQA 2AD1A 4YMTA 2W2TA 3IPXA 3PJRA 2ZXUA 2AHOA 2IEZA 1BO6A 5AJXA 4ZIRB 2VYFA 2ZSAA 2MSDB 1R8SA 2ZI6A 4HUQA 1T6NA 3KZ1E 4FCWA 4GFDA 3WHKA 3TR5A 4QM7A 1PVOA 4MGYR 1EFCA 1X3SA 1CBUA 1GL7A 3P20A 2HV8A 4XSGA 3DO6A 2EFDB 1VCIA 3VTKA 1ZINA 1YZNA 2ZRJA 3C15C 2ZM5A 2G88A 1XEFA 4NZYA 3CRRA 3VR6A 5BQ5A 3TQCA 2ZJ8A 4LC0A 1G4AE 5EUQB 4LHVA 2PLRA 4XOIA 2RMKA 2ANBA 4OQLA 4DCNA 4IVRA 4LJ9A 5KOYA 3KKPA 3AVVA 2ODEA 1E9CA 1T3SA 1GIAA 1SVMA 3AGPA 4AIIA 4V03A 2ZI9A 3B1WA 1G7TA 2F43B 5AJWA 2ZRPA 1W44A 4PO9A 2VEDA 1E4VA 3QPWA 4PHHA 2IWHA 2R6DA 2FMXA 2ZQ5A 2AX4A 3K0CA 2CXXA 2ZRIA 2UZ3A 2O8BA 5TXGA 3MWYW 1N5KA 1N0WA 4FW9A 3QSYA 2Q3HA 2Z83A 2C99A 2IA5A 3WRXC 2CK3A 4KSBA 4Q1FA 5EP1A 2PX3A 1P9RA 4C4PA 2JLWA 3WP1B 2PCJA 1NVVQ 1Q1QA 5FR2A 1G3UA 1DADA 5EP3A 4E03A 2RGAA 3OF5A 5DN6D 3QVVA 4W5HA 5C2JB 3ZD6A 2NPIA 2ZSEA 3EARA 2PZFA 3KUDA 1SXJD 1W48A 1RRPA 2FWRA 4URXR 2AKYA 1BS1A 3KKMA 4A6XA 2GNOA 4B75A 4TYWA 1G17A 1XF9A 1H65A 1FOEB 3TLXA 1EWRA 4DSTA 5B64A 4D4JA 1W49A 3WMEA 4UXIA 4PR0A 3PEYA 1CXZA 4ZCMA 4PPNA 4ERNA 4QHSA 3OEHD 1P2TA 1G3QA 4D26A 1P2SA 1OYWA 4K46A 5HCNA 1ZUIA 1JI0A 1KI2A 3P32A 2OXCA 4TQ9A 5GJCA 4A2WA 1EESA 2NO7A 3ICEA 1N6NA 4JVLA 2JJ1A 3ZJYA 2CL6X 4OQMA 4BFXA 1W7AA 4I1OA 4M1KA 3QENA 2GJKA 3I5XA 1OT3A 5DGXA 5FOVA 3GLIE 1J8MF 3RNLA 4BEBA 2HT6A 1E2EA 2OO7A 4QGHA 3EA5A 4X8LA 3R7WA 1NN5A 5JWRA 2NQ2C 3GJXC 3TE6A 1NMXA 3ZQ6A 4GP7A 3NBXX 4MYCA 1KMHA 3SC3A 4M1TA 3HYRA 3QG5A 2QAJA 4IXMA 1UBFA 2RKOA 1E2NA 2WJYA 2J0SA 1O3YA 4M21A 5LB4A 2WWYA 1BOFA 1N5LA 1E9EA 4MRVA 4AYWA 4NCNA 2WSSA 3C5CA 4NP6A 3BD9A 4JL5A 2OILA 4URYR 3AVPA 2DB3A 2QP3A 1I4TD 4OI2A 3DDCA 4UXJA 3HPQA 2I3BA 5J4KA 5EP2A 2C96A 5GJWC 2IS1A 1KO5A 5HKKD 3B85A 5KYKA 3S1AA 1HT1E 1TF5A 3PUYA 4U7DA 4QJ3A 2X2EA 3DZDA 3FFBA 2R2AA 3PUWA 4ABYA 4PC6A 2P2LA 2EFGA 2IYQA 1BIFA 721PA 3L2OB 4HB0A 1QHXA 1Q57A 4YMWA 1VMAA 3K70B 1OSNA 3GLIB 1KI9A 2ZJ2A 4DCUA 1DTSA 2ZUCA 5KO2A 1ELOA 5GVSA 4C0JA 1E2QA 4FCVA 1GRRA 4UKDA 3PUZA 3B6EA 5HE8A 1CTQA 4A92A 3EIHA 5EE5B 5B2ZA 2Z4SA 3AP1A 3RVBA 4B2LA 5J47A 8OHMA 5CIQA 2W6IA 3L82B 5KNCA 2ZJZA 1W0JD 2ATVA 2ZROA 5JS8A 4EPWA 4HDCA 3EWAA 4DJTA 2WSMA 3D3QA 2ZYWX 2GHIA 2FFQA 3A1SA 5AR1A 2MSEB 1P2VA 4K81B 5JFGA 4OI4A 3THYB 1BMFA 5J4YA 1AZSC 2C8VA 1E0JA 1E2DA 1GRNA 4C0LA 2J59A 3OIYA 4JLBA 1LVGA 2XXAB 2RGXA 4DZZA 3O47A 3NH9A 3PEWA 4KVGA 3NEJA 2WSSD 3VQTA 3V4FA 2ZRCA 1QVRA 1ZM9A 3H4MA 4HDQB 4Q9LA 4C0HA 1XJQA 3F0TA 2EWVA 4D4LA 3NHBA 3IBYA 4BEJA 1UF9A 1IM2A 2ZYUX 3WNCA 1JXMA 3CRQA 2QAGC 2GJ9A 2ATXA 1U2RA 4QBHA 4TMTA 1G8HA 2A2ZA 5HR5A 3R8CA 3UIEA 2ZYTX 4QRHA 1A82A 2VF7A 2V6JA 2JLQA 3SZRA 3PIRA 4R7ZA 3T15A 1XP8A 1QF9A 4NMMA 4HZUB 3ZLJA 4PFSA 4EUNA 1CRQA 3EG5A 2XJ4A 4B3DA 4DDUA 2O8CA 2V55B 5G41A 1KKLA 1JJ7A 2CCGA 1Q1ZA 5DHAA 1FPMA 2OE2A 3QXSA 3QBVA 1GFIA 4B71A 3TVTA 2FSFA 2BIFA 1G3IA 4QJ4A 2F7SA 1VCNA 1Z6GA 2ZRAA 3RS7A 4BLSA 2F43A 2ZETA 4LBZA 2Q0HA 4URVR 1XD2B 3QUSA 3SU8A 4HYYA 2HXYA 3LNCA 1GVNB 1BMFD 2O52A 2IT1A 1KJYA 2ZVQX 4M9QA 2AD5A 1P2UA 4IOMA 4CF7A 4MRPA 2RHMA 2F55A 3JVUA 3RDPA 4KHZA 2PMKA 3M1IA 2H7VA 2GAOA 4IJMA 3Q9LA 1NBMA 2GK6A 4KAXA 4Q4AB 1G7RA 2FEMA 1IY0A 1OXTA 2XTZA 3GJ4A 3ZS9A 4TLDA 3I32A 4XTRA 1D6JA 1YKSA 4JVSB 2WOJA 4OQXA 1FL9A 3AVWA 4WIAA 1SKQA 3QKTA 3GEIA 5DI9A 2BCGY 4AYXA 3ND8A 1U99A 4Q01A 4C0BA 3T1VA 2W6JA 4MYTA 4A4DA 4TYYA 4DIDA 4ACBA 1VHLA 4CEIB 5KSPA 1XTQA 5ANRB 4TMZA 3TSWA 1T0JB 1XMVA 4QGAA 2QORA 2ZR0A 3GLGE 3FKQA 4R2HA 4PSVA 2CMKA 1OH6A 4IVQA 4S35A 4P32A 3VNVA 3ND9A 2NZJA 1G9XA 3I8SA 3HDTA 1OHHA 4HAYA 4LBWA 2XAUA 2G9NA 2XNSA 4JLKA 4LRWA 4ESHA 2GJAA 3I62A 1JNYA 3BC1A 4I1SA 3RANA 3OHMA 1XBTA 2KJQA 2DFKB 4WOPA 2FFBA 5DYGA 4CYMA 3QKRB 2AXPA 5JEDA 3KKOA 3ZVNA 4LSGA 4M1WA 5E7MA 1IN8A 4B3FX 4DEXA 3OESA 3WYGA 3ZH9B 3FKSA 4GOXA 3WP0A 1S8FA 3THWA 5FI0B 3BB3A 2EVWX 4FMCF 3CW2A 4PZLA 3ZVLA 3Q8XB 4ZDKA 1F48A 2VQSA 221PA 3U3KA 2P65A 2JJ8A 1OFIA 3KDSE 1S9HA 1G5RA 2KWIA 2WJGA 3IEUA 4D81A 4QGGA 3B7GA 3LBHA 2NPFA 1WMSA 1NBMD 4IOJA 2PCLA 4TL6A 1E94E 1AZTA 621PA 1KO8A 5CDFA 2CHQA 2EFEB 2R9VA 1SXJE 5JJLA 4PPQA 3WBKA 4HLUC 5JZVA 2JLUA 5JBQA 1DOAA 4B47A 4CIDA 3GLGB 2CL0X 4DC9A 2RGNA 1T5IA 3VKGA 4GI7A 4NYIR 1MABA 3IIKA 4UXHA 1W1WA 1YE8A 3FE2A 2WM9B 3VR5A 3GJ7A 4KO8A 1AS2A 1RC8A 1YR6A 3TW4A 2EYUA 3G0HA 2ZI5A 3GLIA 1U9IC 1CR2A 3EASA 1G3RA 3ASZA 4GNKA 3T1TA 5DH9A 3A1VA 3DPUA 4PZZA 2KI5A 5AUNB 1HE8B 1R10A 3C14C 3T1OA 1OHHD 2QNRA 4TYNA 2L0XA 2OCYC 1KKMA 2QE7D 3RC8A 4TL9A 1W2HA 4ESVA 2IUUA 4KITB 2VP2A 4NE2A 4EJSA 4IFEA 1DVRA 1OJLA 4IDHA 2G3YA 4BPBA 4ACAA 4I81A 2Q9CA 3WYFA 3FKSD 3KFXA 4LCBA 2YOFA 3SYNA 1QHSA 2XTMA 4EAQA 1COWA 1NF3A 3EWSA 2PEYA 1XMIA 1GM5A 2Q6TA 2X2FA 3DVLA 1N25A 2XTNA 1VG8A 2IYXA 5JHGB 3LA6A 4PZYA 3Q7PA 3SYKA 4LGMA 2IS2A 3NBZC 2XXAA 1SXJB 4GT1A 1ZM3A 3V00A 2FF7A 1E0SA 3EIQA 3K53A 3LH5A 3WMGA 2NTYC 2UVQA 3L0IB 1RRCA 3FOZA 3C4JA 1IN4A 2WKRA 1FQKA 1T0HB 4CT4B 1GKUB 4MKHA 4TQUS 4HUQB 1E9SA 1QHNA 1SKYE 3LQRA 3H2YA 2GZHA 3ZZ0A 1XEXB 4EDHA 2RCNA 3OE7D 3PUVA 1RZ3A 4EKDA 3EC2A 1I2MA 4H9GA 3CUEF 4DXAA 1DAMA 2GESA 2XOKA 2HCJB 1ZCBA 2MMCA 1ZMXA 4DB2A 1E2PA 1EGAA 4FINA 2EYQA 5FOTA 1F3OA 4CT5A 1W0KD 1KZ7B 3AF3A 3VR1A 1TQ2A 2V54A 4HZUA 3UG7A 4PO1A 2ZRMA 4C2TA 2BOVA 1UM8A 4B76A 1Z0DA 4NYIQ 1ZBDA 1D9XA 1AS3A 1OYYA 2G0TA 4YMSA 3KQKA 1KO1A 1NMZA 3LDAA 4MKFA 2C98A 3CO5A 1ZRHA 4LV5B 4DUGD 2F3RA 1OIVA 1XD8A 3HP1A 1VCMA 2ZUBA 3TSOA 4ZPXA 2BKUA 2JEOA 4DLZA 4LZZA 4HAXA 4TLCA 3EPJA 1HA3A 1R2QA 1US8B 4Q1BA 1N5IA 4NPHA 2ZUDA 5EE3A 2FDCA 2ZE7A 1COWD 4XVUA 3AKDA 1FNMA 3P27A 4M2LA 3NVAA 1SKYB 3DMNA 3UXMA 3BH6A 5EUMA 1CJUC 1KTVA 4M22A 2KE5A 2OHFA 3PEVA 3B1ZA 4TTRA 1P62B 4B32A 2IC5A 1ZC3A 3CF0A 4HB3A 1GP2A 2XZOA 4UNPA 2BBSA 2QA5A 4KODA 2ONKA 4Q4AA 1VPLA 4XVRA 3LWNA 1DG1G 2VRWA 5CB6A 2V7QD 4O2LA 4EPYA 3L8ZA 2IUSA 4OI0A 3VR2A 3MGCA 1JEEA 5FBRB 2FPMA 1HURA 2OLJA 4LV6A 1KK3A 2C95A 1M2OB 3EPKA 3U7HB 4DSOA 3FMPB 4KI0A 5AJYA 1H8HA 3QEJA 2IS6A 1PJRA 4NL4H 5C46F 1P9WA 2A7QA 3D31A 2QSZA 4BFYA 2C9YA 4IDQA 3AF1A 3TVDA 1HTWA 1DAIA 5B30A 2XB4A 3VHLB 3LY5A 4GOKA 2QTFA 1IXSB 2ONJA 3H84A 3IIMA 3QPVA 2Q3MA 1U81A 3T35A 3PQCA 4D4KA 4PXAA 1SVLA 2EWWA 4QOSA 2J5XA 4C9BA 4M1YA 4D80A 3QKRA 5JJKA 1T3HA 2VP6A 1G1MA 3CX6A 1OH8A 1VYUA 4O3MA 4NU0A 3VNUA 4GMXA 4TSFA 1QRAA 5JWOA 3TH5A 4D4MA 4B3CA 2ODWA 1WRBA 3CZQA 3QIAA 4JBXA 4LYHA 4PQRA 4B33A 1H8EA 3LBIA 3Q72A 3TGPA 2F1RA 3AKYA 2VF8A 2GILA 3NDBB 1WP9A 1UKZA 2F3TA 2ZI3A 2VHCA 3KJEA 4P33A 3S1AB 2BJWA 4W5WA 4PSKA 4DEYA 2QGZA 2NG1A 1ZC4A 2QSYA 2GEUA 3I61A 4GOJA 4C0KA 3C8UA 2C2HA 4Q47A 2D06A 5AK0A 1ZNWA 2ZRBA 4JSTA 4Q4HA 1DAHA 1W2GA 1ZD8A 2JJ2A 3HU1A 1KIMA 4BFZA 2XGJA 3OEED 5SZHB 1H8HD 1MO4A 3AV0B 3UANA 4GBMA 3RRMA 1Z0IA 1KO7A 1E9FA 1X1SA 4JLPA 3HU2A 4L8GA 2ZR9A 4POAA 4B6FA 4ZDJA 2V6IA 1NI3A 5H8WA 4D25A 3TRFA 1OXUA 2W2VA 5GJVC 1TTTA 2MMGA 1BH2A 1R8QA 2GETA 3A8TA 821PA 3EZ2A 2ZJ5A 3NBFA 4MUAA 4JSYA 3CNLA 1OKKD 1R7RA 4C7OB 1XDBA 2QL6A 3ADDA 2DWPA 3ZQJA 3P26A 5TARA 3X1YA 5FFMA 5DE3A 4DLTA 2JA1A 1A4RA 2ZE8A 3DEFA 4E07A 2DPXA 2DWOA 4U02A 1MO3A 2HYDA 1EFTA 1ODFA 1A2BA 2QTVB 2WWFA 3MSXA 4JL8A 1KYIA 1UEJA 4QBGB 4A0FA 3KKQA 4F92B 1XPRA 2ANCA 2FZLA 3A58B 1K5DA 1SXJA 1UADA 2AK2A 3FMFA 1JR3D 2WVJA 3SN6A 3K0SA 3PEUA 3KXLA 2IXGA 1KNQA 3ZDQA 1E2IA 1LS1A 3GLFE 2IXEA 1RRGA 1KSJA 2BBTA 5EXTA 4MGIR 1KSHA 1NBME 5LB2A 4D0GA 3B8HA 3EIEA 1NKTA 4PTLA 1JPJA 1Z0JA 1ZU5A 4PHGA 4DSUA 2REOA 3CRW1 3OEHA 1OB5A 1XEXA 2YZ2A 2O8CB 1WBDA 2JJ2D 3K09C 5CLQA 3SQXA 5AJZA 2X77A 4RD4A 1XTSA 2WAYA 1Q0UA 2ZR7A 3QQ5A 4I99A 4US0R 1LS6A 1ONBA 2W0SA 3LXXA 3QF7A 2GA8A 2OFWA 1IQPA 2FX3A 4AKIA 2KBEA 2F9LA 3VKWA 3LW7A 3VKHA 2G0NA 3W6OA 2REBA 3JZAA 3A4LA 4HDOB 1J2JA 5FUVA 1NRJB 1JALA 2C78A 4F4CA 1QVAA 2W2XA 2ZS8A 4ZI3A 1P3JA 2WZQA 5K8LA 1KI4A 1G20E 2P5TB 3PR1A 2J7KA 3I92A 4XVQA 3TUJC 2DCUA 2FZ4A 3L0SA 4KJZA 1Z2AA 2P5SA 2BMJA 3OIUA 1Z6TA 2V3CC 2PEZA 3SJCA 1CJMA 3U6KA 2JLSA 4ARZB 4QKQA 5L3RA 1PUJA 4KFSA 3EPHA 2PL3A 1US8A 1G8GA 1IY1A 4IRUB 3GLFB 5TB5A 3REGA 1J7KA 2A30A 4ITRC 2ZVPX 4P4TA 1HV8A 1XNJA 4LJ8A 1Q44A 4UNQA 3U3MA 1L8QA 4RKEA 4CEHB 3AVXA 1E1QD 2CNWD 5BN4A 3BK7A 2AWOA 3J81k 5P21A 3DOFA 1CR4A 3IBGA 4JBWA 4ON9A 3VFDA 3AVTA 5HKKA 3BS4A 2VP0A 2YYZA 3W6NA 3R9XA 3BRWD 1KNXA 1SGWA 4Q48A 2WBLC 4JKYA 3SJAA 2HUPA 3TW8B 3MD0A 1U94A 3K9LA 1PUIA 4JLVA 2VP4A 1JAIA 1W47A 4EFMA 1AIPA 2FGJA 2EU8A 5CDFE 3AVUA 2E1RA 2ZRKA 3QOFA 3B2EA 5FTNA 1A2KC 2K5UA 3AKCA 1CRPA 5DHFA 4ZCIA 4G0NA 2GRJA 2O8FA 5LDDC 2J1LA 1E2HA 3IUYA 3WNDA 4JBYA 5BW8A 4G5QA 2CJWA 2JLVA 2TMKA 3U4QB 3IO5A 3ETLA 3L0PA 3BB4A 4UNSA 1E1RD 2Z0MA 3OAAD 3Q5DA 3EX7C 2VIIA 2G1KA 2CHVA 2VH5R 3IILA 3UWKA 4H1VA 1IN6A 2Y8EA 3F5FA 4HB2A 3VX4A 3K0FB 1W0JA 2QT0A 5GADl 4RZUA 4HAWA 3THWB 1FZQA 1P75A 1C9KA 2CLCX 1X1RA 4KLNA 4CDGA 4RD1A 1Z28A 4OI1A 4XWKA 4P3YA 1OW3B 1GKIA 4IDPA 1PV4A 1M8PA 5J4VA 3SR0A 4UJ5A 1M7HA 3CM0A 1CF4A 2ZSFA 4NH0A 4FMDB 1T8TA 3GP8A 1BYUA 2DBYA 4LOAA 2YJTD 4YLGA 1KY3A 2GBLC 1DPFA 2WAXA 3VHXA 1XTIA 2GXAA 1Z2CA 1S3SA 3HWSA 2HEIA 1DO2A 1QDEA 1N2CE 1E2FA 2AN9A 1U98A 2QROA 4Q00A 2WOOA 4BQSA 4DBLC 2JLXA 4C0AC 5JJIA 1II9A 1XPUA 4BZQA 2CCKA 2IYVA 1AKEA 1GTVA 2YC2C 4OK6A 4PAQA 3O8RA 2B6HA 3CBQA 4F91B 2O8EA 1MABB 4L5BA 3BH0A 2D3WA 1A1VA 4ZCLA 1UJ2A 4ZV4A 1GITA 4DT1A 4DKXA 3R9WA 1YZLA 2PZGA 3EAQA 2E9SA 5JI3E 3QE0A 1OPXA 3LFUA 3LAWA 3QNUA 1ZD1A 1N6HA 4EPTA 4YDHB 2FE4A 4KVAA 4M1SA 4TQAA 4A1FA 1XCGB 4EJSB 3CNOA 5CM9C 4QNMA 3ZZTA 3QJYA 1S3GA 5FBQB 3OIVA 5HTKA 1UKEA 3QXXA 2O5VA 3NWJA 1YR9A 4FD2A 3FPAA 3CF2A 1CU1A 2HT1A 1YJ5A 2B8WA 3Q85A 5LBIA 3WMFA 4NYMR 1F6BA 2V1XA 2ZI4A 4LJ7A 5L3VA 4BLRA 4C7OA 2F9MA 1OV4A 3PUXA 4V0ME 4AC9A 3CPHA 1C4OA 4TL7A 1E2JA 1SHZA 3AKEA 4JT2A 4BZPA 1U0HC 4Q66C 2G6BA 3FHCB 5CK5A 2QUZA 4C3ZA 4YQFA 1EWQA 4WVFA 1TEXA 5KTYA 2OG2A 1RE0A 5D3MB 5FTKA 4DVGA 3TAHA 1YZQA 1RVDA 1W4AA 3UWOA 3WBJA 1OH7A 2KBFA 3U2QA 2ZSDA 4R2IA 5LD2B 2R6AA 1GKYA 3DM5A 3IQWA 2DYKA 2OCAA 2P6UA 3FB4A 5FR1A 4V0OA 1UBEA 2BMDA 1FP6A 1D9ZA 4TTPA 2ZE5A 3U61B 2BCJQ 2WTUA 1KJWA 1VG9B 5AUPB 1F2TB 2D2FA 3N2IA 4XSHA 1EK0A 1MRNA 1NSFA 2NOAA 1VDZA 2RB4A 4A36A 1NN0A 4AKHA 4Q1CA 5FPTA 1SXJC 3DMDA 2CDNA 1DG3A 3NC1C 3W5JA 3GFPA 5A4JA 3TMKA 4YXWD 4OBEA 1G6HA 3JZMA 1XWIA 4NCKA 4MKIA 2DHRA 3KUCA 1PLKA 2MSCB 3D6TB 3VR3A 1OXSC 2WPDD 4QFMA 5TVKA 3M6AA 4N1AA 1NLFA 1TQDA 4LK2A 4ARZA 2A5DA 3SBDA 5DIFA 3CZPA 1OF1A 4NYMQ 2GVZC 2JIZA 3GLFA 2ZAOA 4DDVA 4PQFA 1RW4A 2R6FA 1Z29A 3KX2A 3W8NA 4WW0A 4XWOA 1GZSA 4CEHA 1Z6YA 2XITA 4DLVA 1NVUQ 4F38A 1KI1A 3GFOA 4RSGA 4AK9A 3CRMA 1JR3E 2QTHA 3JVVA 1E79D 3O8DA 4N0DA 4V0LA 2GDJA 3MJRA 3TQFA 4FMBB 4MITA 3TBKA 1CIPA 3QEOA 5KSZA 2YWFA 5CB8A 2AFIE 4KFUA 2PBRA 3GJ5A 3K0CC 5DO9A 2ODNA 2SHKA 1IN5A 3K9GA 4Z54A 3DM9B 1SHKA 3CWQA 4A8JA 2IYLD 4DIEA 3T5DA 1UFQA 2NO9A 1Z5ZA 4DCTA 2OUKA 1HYQA 5DI3B 1UBGA 5TDHA 2VPPA 2WV9A 3DL0A 3U4QA 2R62A 2QE7A 2BBWA 4V02A 2D2EA 5E7JA 3AQ4A 1E4YA 2ZRGA 3R9IA 1E2KA 1NL3A 4WZAE 3KQLA 3K0FA 2GXQA 3LO5A 2CLDX 4URWR 5EE1A 4ZO4A 1W36D 4Q7JB 2OESA 1LW7A 2O0KA 3CB4A 5G3ZA 1E2LA 1MO6A 5EXXA 2ZITA 2BV3A 3B9PA 4KCGA 4JS0A 1XXHA 2XJ9A 5SZKB 3X1DA 1YU9A 3PCRB 3RRYA 1KDTA 2JLZA 2VTKA 1VTKA 3H0KA 4IHQA 2JIZD 1Y3AA 3UK6A 3G82C 1T5LA 3N5CA 1IXZA 5CYPA 1XJ0A 1Z0AA 4URUR 4Q1EA 3W6PA 1XEWX 3FHOA 3RRZA 4Q1AA 3LX5A 1ZNXA 4RD2A 4JLAA 3OE7A 4PHTA 2DR3A 2EFCB 4X8MA 5G40A 2QPOA 2Z43A 2FSHA 1KO4A 2H1LA 1SULA 3IKJA 4Q4HB 4BRUA 4UNRA 3QKUA 4Z8XA 1NMYA 4DB4A 4I1UA 3UMSA 4B3GA 3KTAA 5HZHA 1L4YA 1SVOA 2QQ0A 1YRAA 3FMOB 3VAAA 3FGNA 3U5ZB 1W0KA 3CH4B 4P0TA 4TMVA 3UKDA 4OHVA 1XRJA 2ORWA 2ERXA 5B58C 1DAGA 5KPDA 1GWNA 3RSLA 2G1JA 1KDRA 3L0OA 1ZAKA 1GNPA 3W90A 3CONA 4QBFA 1KK2A 3NH6A 3RAPR 4IKEA 4FWIB 4Q9HA 1FUKA 2JAQA 4TYPA 2WWXA 3GFTA 2AR7A 4C0QC 3WY9A 1S0UA 1GNRA 4LWZA 4DUGA 1ZW6A 3EA0A 2ZS7A 4JMPA 4ILEA 1KSFX 5FTMA 4Q21A 3RWMB 1GDDA 4A0RA 2QMOA 1HE1C 3C41J 2C9CA 3AVQA 4Y0AA 3AUXA 5FBVB 2IX3A 4FCTA 5K8UA 5FOUA 2QAGB 3LX8A 4DHEA 4EFLA 3KFVA 4AKGA 4C30A 2XNDD 2Z4RA 2IYRA 3QG1A 3BOSA 1G3MA 3CWZA 2WIAA 2FN4A 1G41A 4TN1A 1HY3A 2B7CA 3K1JA 3EZ9A 3Q3JB 1J70A 2OAP1 1R0ZA 5C18A 2QP4A 1KI7A 4IFBA 2VBCA 5JSZB 5JRZA 1YR8A 1LY1A 2EFHB 5EE0A 2YINC 3I72A 2V7QA 3THXB 4OL0A 1U0LA 4WXPA 3ZIAD 1SVSA 1Q21A 3IHLA 4DLUA 4JVNA 4KXFB 5D3MA 4UQOA 1KDPA 3SS8A 5FUWA 2GVDC 1Q12A 3BFKA 4RD0A 3VU9B 2FEOA 1PLLA 5UKDA 1Z6XA 1R4AA 3D8BA 4IEEA 2VP9A 2J3EA 2QPTA 1IAQA 1K8RA 2IBMA 2QM7A 4BLPA 5FPHA 1ZM2A 1FTSA 4M9SA 4OK5A 5M04A 4WBSA 2ZU6A 1ZCAA 3F3YA 5KDDA 1FNNA 4PPGA 3TUIC 2J45A 2R8RA 2BHRA 1F2TA 3KJGA 3REFA 2ZS9A 2PT5A 2ODBA 1LNZA 1T3LA 5KU1A 1SVIA 1TMKA 5GVRA 1U90A 4L9WA 3B13B 5J5CA 4GSYA 2GTPA 1E69A 1AA9A 2AWNA 2IHYA 2C77A 3AF2A 1UKVY 1GRQA 4V0MA 3ZS8A 2KSQA 2GEDA 1IBRA 1FTNA 1T8UA 2QRNA 3QBTA 1TU3A 5DYIA 4DLXA 4QGFA 4F4IA 1ANKA 1G7SA 2GJSA 4MUBA 4W9MC 1RJ9A 2YWHA 4BFUA 4AG6A 4LBVA 1B23P 1RYFA 1W4CA 1E9BA 4ZKEA 4LI0A 3UMFA 1TADA 4D82A 2DFNA 2BC9A 4M8NE 4Q4JB 4TYQA 3W8RA 1XFAA 3OZXA 4LPKA 2HYIC 2BEJA 3X1WA 4D2IA 1D2NA 1LV7A 1M34E 2QT1A 4EFNA 121PA 5EJEA 4GZLA 4XIGS 2QG6A 2HDNB 4EPRA 1R0YA 3LVRE 1W4BA 4G5RA 1G8FA 1JEDA 3AVOA 2IL1A 5FH9A 1CEEA 3G5UA
chains in the Genus database with same CATH superfamily
4E5KA 4I8DA 3L7KA 5TSDA 2Y1OA 3CLTC 3OEEA 1NP6A 2R5FA 1N4AA 1O9HA 5HM8A 4WKGA 4XJVA 2VQ6A 3EVGA 5DLDA 1C41A 1TDJA 4C7MA 4AJOA 5I7WA 2WKSA 1WXXA 1HBJA 2NXCA 3ZW8A 4N3BA 1EA5A 2AOXA 1Z07A 1PJQA 4B3SB 4JGIA 1E3LA 3DZJA 8AT1A 3IELA 4LJ4A 5B36A 1NLZA 4US2R 4TV8F 5ISMA 4DMGA 1IY2A 4GH5A 1WZ2A 1F8XA 3HLZA 4B7CA 1IHPA 8ATCA 1YDHA 1BA2A 4H31A 2WZFA 3U44B 4IGGA 3NHJA 4N01A 1D4AA 2D5RB 2JAXA 2KHZA 2X8LA 5FUYA 1OXMA 2NTNA 3C5VA 4W8OA 4OK3A 4P81A 2P2NA 5AH0A 1F14A 5COGA 3SC4A 1CUYA 1RLMA 1G98A 3K70C 3QTBA 3H1AA 3SJZA 2O50A 2X4DA 1JHPA 3LHSA 4N6CA 3SG0A 3DHEA 3NJ4A 1P0FA 3OHSX 3FZGA 3G5AA 4MQMA 4TMXA 4YMIA 3I09A 4ENWA 2VNJA 1MO5A 1M2HA 2H1HA 1E5DA 1EFRD 1KI6B 2HJVA 1KYTA 2GYUA 3OCWA 4B73A 4IX9A 3UJ6A 2A33A 2E49A 3FBWA 3NKDA 4CHTA 4K1OA 1UFRA 3IALA 2Y1XA 3PNYA 1G5PA 3SF8B 5THQA 1NUHA 4M9XA 4L8YA 3WK4A 4CV3A 4P3PA 1E99A 1F51E 4HN9A 3P9CA 3Q9NA 5CUQA 2YL0A 3IIEA 1YQXA 2HLDA 3HL4A 1V3TA 3CNEA 3JQ8A 2PJDA 1K0UA 2H92A 2J0UA 2Q4BA 4GWKA 3B5IA 2PIDA 3SXUA 5FTJA 1YK1A 1SU6A 1YQTA 2QUIA 5C51B 3FHDA 3UK2A 3N2GA 1P4SA 4I4NA 5DWQA 4X1OA 2DWUA 1U9IA 4CM9D 1WN0A 1R5BA 2NUPA 3QY0A 1WJGA 1XLVA 4J0GA 5FORA 4GSLA 3DF9A 2IY7A 2Q50A 1LFDB 4E21A 5D5PA 3BERA 3VBEA 1DJQA 4MJ7A 3ROKA 8MHTA 1XG5A 2J8WA 2P41A 1ST2A 4EVQA 3BGWA 4IHJA 4TWIA 4N0QA 2MINB 1SA0A 4TXNA 1PJTA 3EZFA 4XD7A 1RQ2A 1ZKMA 4R1PA 4CV1A 5DOVA 1RYEA 3RQFA 3Q15C 1Z88A 3VVBA 1VGVA 2VCBA 4L0QA 5B4UA 3IGFA 4JKIA 1R6VA 1ESNA 2ORIA 2QMHA 5F2EA 2I7DA 2Q8QA 1DO8A 3A11A 1OR8A 1G38A 4CIPA 2RJ3A 1FX0A 3DE2X 4RK4A 4JBGA 3T34A 4P6IC 5JZOA 3GROA 2LWIA 5BSRA 4UOEA 1ZNZA 4YUVA 1DBQA 3H4VA 3GQBA 1LPNA 3MC1A 1TWHA 1YU6A 3SQNA 1SUEA 2F90A 4R3NA 2QBYA 2ENUA 4LYJA 4MS4A 3KWJA 1HDIA 4S0XA 3R7BA 3UMCA 4KFRA 2GEVA 1OE0A 4DXDA 1G5ZA 1SHUX 1CETA 2F8LA 3PXGA 1P1CA 3PNSA 2J3QA 3LL4A 5K05A 2ZUEA 4NENB 5GP1A 1UT6A 2KJGA 4MWSA 2UUBB 1OGJA 2X76A 5AW2A 3N58A 3AJRA 4DV2B 1M1YE 1VYVA 4MROA 4HWGA 4RESA 2GSWA 4MVUA 5JAPA 4Q9JA 4LG1A 2QRPA 4ID3A 5E1BA 5D6NA 2DUMA 5A06A 1IY9A 3OCYA 4AUEA 3ZIAA 4BTLA 4QOFA 3I9OA 4AZTA 1E89A 3CJQA 4Y2YA 3WL6A 4AG5A 1P4HA 3OWOA 1UT8A 4CLRA 2YNMD 1VB3A 3HZOA 5H80A 4C03A 4NZZA 2XKBA 2HL6A 3CX8A 2OTCA 3IQZA 1UODA 5JZSA 2AYYA 3B1KA 3ZV4A 4YRGA 1SOUA 3VYUB 4I4CA 1OFHA 2ZSUA 4EUEA 4HDRA 2AI2A 1OROA 2RGCA 1RMTA 2E21A 2OP1A 3QWBA 4OQEA 1MN6A 3DZ8A 1RCUA 4NTBA 2JZOA 2JAPA 3PHIA 3U49A 4JUAA 4I1YA 5TEWA 2ZIZA 3AUKA 1U2TA 1BGWA 4TTQA 1GZ7A 5HDQA 2PZ8A 1M5RA 3DULA 1QB8A 1AK2A 1M2JA 3UWDA 5KNBA 3C6KA 3EHEA 4TRRA 4JHLA 5C1BA 2Q3FA 4RSRA 4MI6A 5H70A 4J32B 3KU4A 2CYBA 2XR1A 3DTTA 3CX4A 4IYJA 1BN6A 4DA6A 3TLJA 1ZHZA 1Z17A 1EG7A 2FMKA 1QZXA 1XALA 2BKVA 3CAXA 4U0KA 2RAUA 5JOQA 2O8BB 2AEJA 2J5QA 1Y63A 4WJLA 1VB5A 3NIBA 1LLCA 2QUHA 1K5PA 1Z39A 3P19A 3AEKA 2C3MA 1W36C 2Y92A 3FJOA 2R6JA 3JYHA 1PG2A 3K6SB 2W6PA 1GPJA 3GGJA 1I3CA 5A5GA 3KYIB 3SPXA 3SXJA 3ESXA 3A31A 2L9JA 2Z6QA 3FTEA 1M2WA 3N07A 3VNRA 4C2BA 2BL2A 3U3FA 5I48A 2IHJA 1Y3FE 1EB8A 2D54A 1PE0A 4AW9A 2CXNA 2HGSA 3KQHA 4O2AA 1V11A 2Y2VA 4E5PA 1BW9B 1K97A 1PEKE 2WVAA 4H0NA 3S27A 3AJEA 2XCIA 3DQPA 2H5IA 4XLTA 4CU2A 3SZOA 1DO0A 3PCVA 1L5WA 4YRPA 2A35A 2OAQ1 1K5GA 5ERYA 4DVZA 3PLAE 2D1SA 1NVXQ 2WL8A 4BWFB 1M1YA 4Q9KA 3FTFA 3GLGA 3ROFA 4EYKA 1E9AA 4PX9A 3HUFA 3IP7A 4BO6A 3U7GA 4HAZA 4DRZA 5F5HA 3E3OA 3MT7A 3UN1A 4ZRDA 1UBSB 3K33A 3P2OA 4GQBA 4OGFA 2YC4C 3X2FA 2ZQYA 4PHFA 2ZJFA 3JWPA 5ECWA 3WNQA 4QVIA 4N5DA 2PPVA 3V3TA 1D1AA 4MWDA 4MW0A 1OLUA 3C5WP 3ZWPA 2OFPA 3B3JA 2PD3A 4ZALA 1JS1X 1Y6FA 2MSDB 4ZVNA 3W0LB 4AJHA 4RTOA 3F49S 1PJ2A 4EHFA 3FOWA 2V7BA 1U3TA 1Y6RA 2RMKA 4IF4A 5KOYA 3WE7A 1D0XA 4EKNB 1MH9A 4MXDA 1AKNA 1KJ8A 3F6EX 4BQRA 1NQUA 1GT6A 2RKBA 2D3TA 1N5KA 1N0WA 1J8FA 3I01A 4EIYA 4Q16A 4TM8A 1QU2A 4BKPA 2BFFB 1ZCZA 3BK1A 3BL6A 2QZ9A 3G9ZA 1ATIA 4NMHA 1WMEA 1NF9A 4D4JA 3JYNA 2D5LA 4FFPA 1P2SA 3KSDO 4BV2A 4B83A 4UDXX 1XPJA 4F4UA 1ZRSA 5FULA 2FQQA 1Q50A 3R7WA 4CDVA 2BHTA 5C8YF 1MQAA 3K1IC 3HYRA 5MF6A 1BHJA 4IXMA 5I5EA 5ADHA 3E3NA 1BOFA 3O9MA 5FFFA 4JP5A 1JG1A 3OCVA 1P2GA 4YACA 4E33A 3G6KA 5HKKD 2AF3C 1N1GA 4MS1B 5EKUA 3FFBA 2IIBA 2P2LA 5J23A 4OUDA 1JKJB 4QDXA 1WNTA 2V7UA 1ZX1A 5KO2A 3EVAA 4DY4A 3BE8A 3PUZA 3P0JA 1MQ8B 3GFRA 3US6A 2W6IA 2VRBA 2CJYA 2MSEB 4QOEA 3Q3EA 4OI4A 1EU1A 2DTEA 5KQMA 3QZUA 4H7PA 4ALMA 3H4MA 3ENZA 3F0TA 4FPXA 2GYVA 3ME5A 2Q6IA 1OC2A 4AJ4A 2J67A 1QLWA 4ICIA 4R7ZA 3NHUA 4NMMA 4KLAA 1CRQA 1N2ZA 4U5EE 4D7AA 4PSUA 3MTBA 1B8NA 1LXCA 2VDMB 1SUWA 1E1CA 2TMDA 2Q2VA 3HKBB 1E59A 8ADHA 2F3QA 2IT1A 4P93A 4M9QA 5DYNA 2V96A 3S8MA 4CF7A 4OQQA 1ZAYA 3M1IA 3PYLA 3Q9LA 2QE9A 4CV0A 3I04A 4P83A 1QYCA 2WOJA 4DWWA 3BMNB 1E62A 2NSYA 2FEWB 4CUJA 2AXQA 1GRVA 3IHKA 3TSWA 3SIRA 1S2LA 4MV0A 3ADPA 4ZOLA 5ALYA 3JD3A 4BP1A 1BEEA 1YBAA 1IDN1 2GJAA 3U19A 3H5AA 5KOIA 4BB5A 1R4MA 1K6XA 3BB3A 2PM8A 1NXSA 3DWWA 221PA 4OX9Y 3NDIA 3W8EA 1LFAA 5K9ZA 1U0TA 1E94E 5CDFA 3EBOA 2R9VA 4DG5A 4DC9A 1TWAA 4UXHA 4EM6A 3LQ2A 1Z6QA 1H6BA 1CR2A 2DFVA 3L1MA 1MPTA 5IY5C 1K3UB 2QNRA 4UPEA 4IWNA 1OT5A 3EXIB 4RADA 3N2YA 1H6GA 3GRCA 1WETA 2Q9CA 1GNTA 4RK5A 5HOQA 2QTBA 3R5FA 1D0ZA 2X2FA 2JPDA 5JHGB 2CDRA 4PZYA 5HKOA 3SYKA 2IS2A 2E6KA 3C7DB 3WMGA 2JZNA 3N3BC 5HKLA 3LJBA 1Q0RA 5EYPB 2E5WA 2PKYX 2PNOA 1A77A 2CV2A 4N47A 3VOSA 5FOTA 4CT5A 1NULA 1C7ZA 1ZWLA 4ARVA 3S40A 3M70A 3BWCA 2MSNA 3SS7X 2KS6A 1QFJA 1OIVA 3KYCA 4AZSA 1ZR4A 1US8B 1OI2A 4Q1BA 1S2DA 3PQ3A 5DASA 3A70A 4MW9A 1FNMA 3NATA 1XZIA 4CG1A 2QVCA 1FYWA 2QA5A 1EFDN 1DEHA 3KEGA 3R6GA 2I6GA 5EJAA 3H1EA 5BRNA 4LRTB 1NVAA 2PGIA 3I9FA 3U4MA 3RYIB 1VYUA 2VCAA 1HFKA 1TUBB 3TH5A 4D4MA 2OCDA 2QW0X 2SBTA 3EPRA 4YAKA 2HHCA 2W4QA 4YCCA 1L7MA 4PSDA 2OGSA 2AB0A 4UMVA 1C30B 1E20A 2WRZA 1W2GA 1MB9A 1UBMS 2GTHA 2ISSD 4X1IA 2QD5A 4OM8A 1RHMA 4YIKA 5FNVA 1XYYA 2ERCA 2DPLA 4WZAA 3H9JA 1KEVA 3CCBA 3EODA 2VUHB 1AQ6A 1BDJB 2HMTA 3ZHCA 1XTTA 3U1VA 2PV7A 1WL8A 5EEGA 2JA1A 3CTMA 2DRIA 4UFOA 1LUAA 3E8MA 4RVFA 3BZBA 4NRDA 3N2KB 4RTPA 4A1OA 2G28A 1ORSC 1YLMA 4PHGA 3A9CA 1GV0A 1VXRA 5AW8A 1ZHYA 3QELA 1XMXA 4L75A 3VKHA 4PLFA 1IJKA 4OSEA 2ZIEA 2X0DA 4ZI3A 1ZI6A 3TQIA 2J7KA 1H0KA 3L0SA 4D3SA 2WM8A 2BMJA 3F96A 4MVSA 3EPHA 3ZQYA 1DKMA 4GI1A 2VRCD 1WEKA 2B4AA 5G0SA 1I5OA 2RHCA 3H83A 3HYSA 4TROA 2VP0A 2YYZA 3R9XA 3D2BA 1U94A 2VP4A 3I12A 2O7VA 3TKAA 4TVSA 1JLRA 2JFXA 4P4GA 1YOVA 1IWBB 2NSLA 5EIFA 2D5IA 1E9VA 3K92A 1M0EA 3K0HA 2R9RB 1C9KA 1U7WA 3F6YA 4RD1A 4XWKA 4NFSA 4XSVA 3FN4A 1WB5A 1RC0A 1MHPA 1N3YA 4D9CA 1KEZA 1IEQA 4YX9A 2RD2A 5EJMA 5F5NA 2D2XA 4KQ2A 2CCKA 4F91B 1VL2A 2ZULA 1UJBA 4ZV4A 3TINA 1EE2A 3EAQA 1MAVA 1YB1A 4FX5A 3FZEA 1H2WA 4KUHA 4AJLA 1U8UA 3L05A 1GG8A 1S3GA 3BE6A 2I78A 3K6RA 3QMVA 2Y4NA 1ACJA 2FOXA 1PFWA 4HG2A 1PFQA 4AJIA 4MR7A 4BL5A 4PLWA 2C2YA 2ECFA 4YQZA 3NFYA 4RHEA 3PWZA 1E4OA 5D3MB 1RVDA 3RW9A 1GZ5A 5BR7A 3U2QA 3KDPA 4DUYB 3W3AH 3V2UA 2H1VA 3T4RA 5J2UA 3BK2A 2HBRA 4XSHA 1JHOA 1GPLA 4YIHA 4X3PA 2NOAA 1GU1A 3NIGB 2DR0A 1NI4B 4HSGA 4TXLA 3DBHA 3U2MA 3ESYA 6REQA 2PGAA 3DEYX 3IA7A 3LPLA 4LHSA 1QYVA 4OD4A 1JIXA 4L51A 1YTUA 3OT1A 3DB1A 1KETA 4XWOA 3HZRA 5FUMA 2QRJA 4F38A 4ER0A 3ER8A 4LTMA 4K7JA 4K6OA 3MJRA 4FMBB 3TBKA 2YUIA 1SKAA 3QEOA 5FWNA 3I0NA 2DKOA 1J07A 2PBRA 5DO9A 2ODNA 1IN5A 1RAAA 3LQYA 1QO0D 4KQXA 1H2FA 1K9VF 2XDYA 1EUQA 2OUKA 1THTA 1HYQA 1ZOLA 4NDAA 3R9KA 2PKRA 2JVIA 5EQJB 1QAOA 4I1MA 2IV7A 3HRKA 1HNWB 2WWVD 2XCSB 4ZO4A 1X7GA 5DTQA 2OESA 3H2VA 1TW3A 3MINB 4MINA 1MO6A 4NNJA 5SZKB 3RBVA 4U6SA 1FYXA 5CT9A 2H31A 2M2IA 1SC6A 4QGSA 4HNVA 3DLIA 4KXXA 1ZNXA 4OFWA 1IBSA 1E84A 4IUBS 3PRHA 4HMQA 4I1UA 2C2KA 4RY9A 4D99A 4LERA 3DVAB 3G0DA 2WQZA 2VN8A 5B58C 1VBFA 5IS2A 1JTVA 3G2JA 1KK2A 2NPOA 1XIVA 5HOEA 2J5RA 2R1TB 4Z3OA 4Y6RA 1JSLA 4K9QA 5DPMA 1UZMA 2I3ZA 2QAGB 3KFVA 4BKRA 4C30A 4D1YA 3S7ZA 1ODKA 4MW5A 3P94A 3RYCB 2EX1A 1RKVA 3KZNA 1LY1A 1LJ8A 4ZEWA 2V7QA 3ZVKA 4UQOA 1Z6XA 1AMNA 5KREA 3JU3A 4BJ6A 1IAQA 2AW5A 3ILVA 4I9GA 1QIFA 4PE5B 3I9V6 2Q27A 4L9WA 1KF0A 2AWNA 3MB5A 3CZMA 3GARA 2GEDA 3GRUA 5EJIA 1FTNA 1T8UA 3QW4B 4YJHA 3Q6IA 3ZZ1A 3NZEA 3WKAA 1K8YB 4KGXA 4D82A 4EFNA 1D6SA 5L53A 3IRVA 4CQLA 1CQPA 3MPOA 3U8PA 1Q22A 2P9EA 4QQKA 2B3TA 4TLAA 2ASEA 4HQ0A 3OCUA 2R65A 1PNTA 1UG7A 1SVNA 2FNAA 3CKLA 4KRYA 5ITZB 3KPUA 2QTWB 4EGFA 1EX1A 1ZL0A 3BJMA 4H7KA 1JG7A 4RPLA 1Q0MA 1GGJA 1FMCA 1Y1LA 1DEKA 1YQEA 3IV9A 1OOEA 4FN5A 4V0KA 5IHPA 4C7JA 2Y77A 2GM4A 3OU2A 2PPLA 3QKSB 3S28A 4BZWA 4Q9NA 2R66A 5A6BA 4LF5B 4NKRA 4EFKA 5G3YA 2P9FA 2EERA 1QO7A 4YCAA 1WU8A 2Z04A 4IIEA 3BIFA 5EL0A 1R5JA 4H2DA 1GTMA 1G6OA 1Z83A 3RC9A 2DZDA 3PQEA 3H05A 3PC7A 5ESXA 3QXJA 1N6OA 4I1VA 1XVLA 1TRHA 2IEAA 2XYVA 3KE9A 3PVCA 1T5DX 3TEJA 2JPUA 2R6CA 2VA8A 1ECBA 1QYDA 1TYAE 1WHSA 1AQLA 3IC5A 1VFNA 1P1KA 1WTYA 3VYVA 2P27A 3HR8A 3G5LA 3JATB 3HEBA 3BFXA 1C8BA 1CE8A 4FJ0A 1CVRA 1YJCA 4IEIA 3F4BA 3H9GA 1CDOA 3N0VA 3OLCX 4CQMB 3T4XA 2IXOA 3PNMA 4XQGA 2QS9A 3OOEA 1RYNA 1PR6A 4H3SA 2YBEA 2H1SA 4PANA 5LN1A 3RH3A 2B8TA 1ZM7A 1V54C 2C29D 4JLJA 2J0QA 2EIKC 4GECA 3RS2A 4Q7MB 3T1QA 1ZXXA 2FMIA 1Z75A 4DSNA 5ALZA 2ZYAA 5NLLA 4PC3A 2QRHA 4YROA 2E4XA 5K0LA 3TO5A 2XADA 1K75A 5KWIA 4LBYA 4MWZA 3WYBA 3F4KA 4FLEA 6Q21A 4MUGA 2XX3A 3AFGA 1SAYA 4JI5B 2X9VA 3BXGA 3Q6NA 4ZMBA 3A6KA 4J3FA 4ZAFA 5IVPA 1UC5B 2A5JA 4RY2A 4BXOA 5BOSA 1XA0A 1H93A 3H04A 1SQSA 3A10A 5CI8A 2IOHA 4J7AA 1SWVA 2FRXA 3KB6A 1J9EA 4F93B 3OT5A 1I3OA 3ZYCA 3FROA 1RWQA 2QLTA 5EHHA 2YLDA 1DP4A 2EW1A 2O3RA 5SZIA 1XCPA 3D3WA 3LLUA 5F9FA 4B43A 1UK9A 2ZRHA 2FA9A 3NTRA 1TF7A 1T6QA 1NJFA 2PA0A 2P2ZA 3OE4A 5H9VA 3U3JA 2C2BA 4DQDA 4YWHA 1DELA 1QMGA 3EC1A 1XJCA 3TBHA 3OFNA 4CDMA 1GL9B 5E9AA 4UHCA 2ZR8A 3TI7A 3GZJA 4NBLA 3CEHA 3ENWA 3LBYA 3IPYA 4AS1A 1GA6A 4RPGA 1RI3A 1NT4A 5CHEA 1EZZA 5FBZA 3TLAA 1EM8B 4IOKA 4MK4A 1PT6A 5TT1A 1F8UA 1KEEB 2I4IA 4PX2A 2W83A 5EZSA 4TXJA 3DMGA 4WHMA 1M76A 1ATZA 2GCOB 3IEVA 5HMLA 2OK8A 5U4QA 1DJMA 5BW6B 5A5DA 2P2SA 3OF2A 4N76A 2VDJA 3ORFA 3EE6A 2CLSA 4M9CA 3DE3X 5KHAA 3ELDA 2PTHA 1KARA 2D0DA 4QBIA 4B3MB 5KPJA 5P8WA 2O9XA 1E3DA 1J5PA 4HHEA 2PX2A 4K9KA 4F4BA 1L4GA 3OPYI 2JGKA 3UVEA 1OW7A 1QTQA 2RFLA 1Y6DA 1SUDA 4Z1OA 4O6NA 1TOAA 3NKVA 2ZTSA 1USWA 1WB9A 1OWOA 3ELYA 5BWOA 1YHZA 5A3VA 4OHYA 1PD1A 4KLZA 4X90A 5BVHB 4NQZA 1MQ9A 3L06A 3QVOA 4IDOA 2FGKA 4E22A 2HA7A 3QYFA 4R0NA 1ODTC 3OA0A 1D1PA 2ROQA 3EUWA 4DUZB 1M2VA 4DXWA 1G8SA 4ZAWA 5EXDA 4E2WA 1XQVA 1A04A 3QVYA 1JQJC 2AWCA 4M3NA 3SE0A 2FETA 4M6WA 5I4KA 1SB9A 4HMOA 4ZI2A 5E0KB 1EZ1A 3N0WA 4E5YA 3H3FA 1NSGB 5AXAA 2A5GA 2E55A 2AFHE 2X19A 4URFA 5IMBA 2E82A 1XU4A 2NZXA 4R4JA 3T6BA 5JFTA 4U7FA 4G0HA 1KZ4A 4KBGA 5F73A 3N8GA 1YNOA 1PK8A 5ALMA 3ED1A 1Z63A 1YCFA 4QO8A 4N3CA 3IE0A 6GPBA 1P5ZB 4WERA 3S2GA 3O03A 4NOKA 3BXPA 4Q7KA 4EX7A 5B7PA 1WHTB 5LPNA 1QH1A 2GPJA 2WT4A 3PRKE 3GJ6A 4C5BA 1DAKA 3MYIA 2WVGA 2P6MA 1DC3A 3VC1A 5IEJA 1FFDA 3I73A 2JFOA 1G2QA 1NR7A 5BWCA 3OURA 3N70A 3FAKA 4KHPB 5BYJA 5SICE 1FMVA 5TPZD 2V3VA 1G66A 4R6WA 3ABRB 5TV2A 4EL0A 2VC2B 3K16A 4HEA6 4IDEA 4MVZA 4JHXA 2PK3A 4ZO7A 3QX9A 3T5MA 2FFHA 3HYTA 3UAXA 4ENQA 2PVSA 2R6GA 4BKMA 4DA0A 2EARA 4P7KA 5JSLA 3V1LA 3SLKA 3RS8A 3D3NA 3B1XA 3NTUA 3L1UA 2UYOA 2QYHA 3E18A 5BWMA 1M6YA 1MGOA 4PYQA 3W4JA 4MW3A 1MNEA 1FMLA 1Z33A 4Y6QA 1G19A 2W93A 5AFSA 5EUCA 3LW8A 4Q7LA 2PYZA 1UAYA 4DLPA 2B4TO 2ENWA 4MUYA 5JTTA 3T52A 4ZDIA 4F3CA 1J42A 3U4DA 4XW2A 3U3RA 5IUNC 3VR2D 1RLJA 1XB2A 3FGOA 3W4IA 1SR2A 1DFIA 2DBQA 1M5UA 1KYXA 1KJZA 5FBKA 2MIIA 3QOYA 2YYSA 3F3KA 2Y99A 4AUNA 4AY3A 5JD3A 1EFPB 3T9AA 2Z8YA 1G21E 1FA9A 3RUCA 4N41A 4L2IB 5FAKA 2P4QA 1JQ5A 4DCVA 3BSYA 1TO2E 1UK7A 2HPVA 3UICA 1UEXC 3FTQA 3KOXA 1VYIA 3PT9A 2NZYA 5KYYA 4RXTA 2Q62A 4PYNA 4FCWA 4WBNB 1CBUA 1BZYA 1ISSA 2REQB 3VTKA 5K3AA 1GSOA 1Q7TA 5DXFA 4XOIA 2AFHA 4P35A 2FB9A 5JV5A 2BL4A 2IVZA 3B1WA 4AZ3B 2CHEA 2XYRA 3MWYW 3GPBA 3UV7A 3TFQA 3WYCA 3EIUA 5BN5B 4C4PA 1QRUA 3DBLA 1DADA 4E03A 3FPJA 1LLUA 4BNHA 4CN8A 1FOEB 4RK7A 4BIIA 4JV5B 4KGVA 1ZUIA 2OZLB 2ZSKA 1EESA 5DNEA 3GVIA 1G20B 1YCDA 4LNUB 4LXIA 1EJ0A 1VKNA 1TMGE 1K98A 2VHWA 1EDBA 3A25A 5EIBC 2RKOA 2PS3A 3IPLA 4NP6A 4EW3A 5C5EA 2WFLA 3E2MA 2A1TR 5AKIA 4Z6KA 1JG4A 4QTXA 1PHRA 3VXKA 2DI3A 4C07A 1KO5A 3QWIA 4U7DA 1MC1A 3ZD8A 2QZZA 3NCTA 1BIFA 1TVKA 4GMGA 3ZBUA 3ESRA 2LIPA 3UGTA 5IAOA 4PLGA 3AHGA 3UMJA 4UKDA 3SC2A 2HWYA 4A92A 2F67A 1IOWA 2VT2A 4GZ6A 5AW0A 8OHMA 3UPDA 4U4AA 1TM4E 3IMEA 5JUAA 2W8BA 4XIIA 1UOOA 3O47A 3B71A 4C0HA 5DM1A 4D4LA 4YHBA 3IBYA 1JXMA 3RRFA 3A9VA 4KAFA 4C22A 1A82A 2VF7A 3V4LA 2JLQA 2NVWA 4RGYA 2WU1A 1ZGZA 3JQGB 3Q6MA 3B7WA 3TZEA 3EG5A 5DVZA 4R7TA 4E1VA 2PKQO 2XECA 2CCGA 1U8XX 2BIFA 1Z7YA 1HTBA 1Z6GA 1EDDA 4DYDA 2Q0HA 4URVR 4CM1A 2LW7A 4K87A 3ZJUA 2O52A 4MRPA 5B3LA 3RDPA 3KYJB 2I2BA 5CFLA 1RRVA 4C78A 3CYFA 2FK8A 4HNAB 4DIDA 1T9GR 1XTQA 2DSNA 2JI6A 3JYLA 3HDTA 3B3AA 3CKKA 3ADOA 3C8ZA 1K4YA 3UCEA 1IK4A 3ABZA 5A7HA 3FPLA 4L73A 1ABEA 3TW0A 2XMSA 3IQHX 1S8FA 3NYIA 4W5TA 2EVWX 3OICA 3GUHA 4GQAA 1YR1A 4PZLA 3IE1A 4ZDKA 4RIGA 2ET6A 4K6KA 1YAUO 3R6LA 4IIXA 3TTWA 3EG9A 1WMSA 2PUTA 1A8IA 3QNMA 3HFJA 2HMUA 5AW5A 1UK6A 3JWIA 5JBQA 4B47A 3IIKA 1RC8A 2H00A 1ZHHA 4LF4B 3EASA 4O1MA 3OFJA 4EL5A 2ACVA 2IYAA 4MZDA 1W2HA 2G3YA 4BPBA 4DQVA 3QLEA 4NC3A 3KFXA 3LPCA 3ZLUA 2FPUA 5GOTA 4CBVA 1AUOA 4TS3A 1VG8A 2IHUA 3TSCA 4KW7A 5ICEA 2FE1A 2YCBA 4CT4B 3AYZB 1ADGA 4R2WA 2Q45A 4LXGA 1MAWA 3FTNA 3FG9A 4MWOA 1ZCBA 3GP5A 1WSAA 1AN9A 3WGVA 3BXXA 4WCVA 4UVEA 4ABTA 1Z0DA 4QUKA 3VJKA 3CVOA 2OVFA 4LV5B 1MJGM 1SG6A 1R0LA 4B0OA 3TSOA 4XAQA 3EVTA 4HAXA 3AIOA 2D00A 4U2CA 2EL7A 3P27A 1CY1A 3U7IA 2R05A 3BH6A 4R40A 1F5SA 2QR2A 5H83A 4YUWA 3HKDA 5B37A 4D3FA 1DG1G 2VRWA 1SURA 3L8ZA 2X8JB 5AJYA 3TD9A 1W5BA 4CIHA 1P9WA 2A7QA 3VJLA 4Z99A 3MTJA 2ZYDA 3GPDG 4PGAA 3MGGA 2AVKA 4F9TA 1IXSB 3RO7A 3GJZA 4K28A 3PSAA 4DG9A 2HLHA 4C9BA 3WDSA 3KEOA 1P6QA 4JA2A 1GRCA 3CX6A 1QRAA 2XIJA 2H2HA 3LBIA 3TGPA 2J6HA 1WP9A 2VZ9A 5ILGA 4QO7A 4UDNA 4PG8A 1GA4A 1ZC4A 5K0BA 5T3WA 1AMOA 2G17A 1VJTA 1P7ZA 1TA4A 2ZRBA 4QPNA 1C3LA 1ZD8A 4GXTA 1JR4A 2H65A 3NRJA 1Z0IA 3RRMA 4JC7A 2XBLA 1Z45A 3CY6A 1ULSA 4YASA 3HDQA 1INLA 3F90A 4HQOA 2D1QA 5TPWA 3OTOB 3TK0A 1A4RA 3DZAA 2QTVB 2H4YA 5EOVA 3T7IA 1EP9A 3A1NA 5EFOA 3LNRA 4F2GA 3AOEC 1J0EA 4GBED 4YUXA 2A1DD 1XO1A 3NP7A 3P71T 1WBDA 2JRCA 2X77A 2BGWA 3OQ1A 4I99A 5A4IS 2GA8A 5AVQA 5AM3A 3CC8A 1ESZA 4Y67A 1XNGA 2ZSIA 1T34A 1DC7A 2O2GA 4BLWA 3UEOA 3L0BA 4JR2A 3HJAA 5K8LA 3FI9A 3L93A 3LS1A 2WTMA 1Q0QA 4EF4A 2Q5OA 4WX2B 2WHEA 2V3CC 5I5GA 3SJCA 5GZ3A 4RHCA 1VI6A 4F9FA 4ZJYA 3TOMA 4BO0A 1OZGA 3SZ3A 3BBLA 5C8YB 1F7VA 1Z7Qc 4FLFA 5EMHA 2OBBA 3TW8B 3PP8A 2DBVO 4O4IB 4NH4A 4QFCA 1WVGA 1YUNA 5FTNA 1X77A 4TXMA 4WBNF 1C0IA 3MCVA 1WDLA 1OZHA 4PXSA 2G1KA 3IILA 4H1VA 4PHCA 3A05A 2CLCX 1WM1A 4ZYVA 7AT1A 3CMMA 3CUKA 1PV4A 3T4UA 1QVZA 4Z9FA 4KR3A 1LSJA 4M0CA 3WHNA 2PVPA 3HWSA 1L4LA 1GPAA 4G4SO 1U98A 5EVJA 4JOBA 4KWTA 4JNCA 4L78A 4BZQA 2GN9A 2AOUA 2QYOA 2Y6UA 4F2PA 2P3LA 2Q4DA 3LS0A 3BA6A 4JQYA 3EEQA 4YDHB 3JQDA 4X84A 3IJRA 1X2EA 2K87A 1XCGB 5CM9C 3G4XA 1QGUB 1V4AA 1UKEA 5IF3A 5FHQA 1O97C 3CF2A 4GX2A 1Y0BA 1E2XA 1LKZA 4DS3A 5FHRA 4LF6B 5KYXB 4L85A 5CNJA 4JT2A 3LQKA 3DE1X 4AY4A 1F0PA 1UPXA 3JASB 2O4CA 4DJDC 3DVSX 3GRRA 5JALA 5BMVA 1VRCA 2RE8A 3DUWA 1N9GB 2OQMA 2PKCA 4ZAZA 3S3TA 2X4GA 2JBAB 5BW4A 5IXSA 4YUAA 3NORA 4JCHA 5E2IA 4YXWD 4R8MA 4AX4A 3RK1A 1PLKA 2FKNA 5TVKA 1JG6A 1I14A 3MEQA 4J1TC 2JGMA 2A1UB 4B8WA 3N53A 5G0WA 2NU9B 3OLVA 3SZLA 1GUBA 1N2EA 4ZTZB 1LK5A 3LUAA 3DOHA 3JQAB 4JP3A 1Q2UA 5D1HA 3RBZA 5K0NA 1GAWA 1DJPA 1UBGA 4X9XA 1FB5A 1N7HA 4N6OA 4OQ4A 2BELA 2DE0X 4F3RA 4URWR 1OXKA 4Q7JB 1O2DA 2VKTA 1CUAA 2CLLB 4H4KC 4CQMD 5IN5A 1OCZC 3I58A 3PCRB 5CX4A 1HLFA 1Y3AA 4M54A 3ZX4A 3KSBC 1Q6YA 1IXZA 3WQRA 5CYPA 1XJ0A 3GHHA 1XEWX 2QD4A 3TXYA 4EWCA 1PSWA 6AT1A 4X8MA 5C53B 2JCGA 3DQQA 4INJA 5C5CA 4AX2A 1MTZA 4B3GA 2CUNA 2W2NA 2JFWA 3UKDA 5BWBA 3OQVA 3V7NA 4WNYA 4TUYA 4D9HA 4II2A 2H7OA 1BJKA 1TYZA 3I6QA 4P53A 1Z7WA 2ZCJA 1U6KA 3F4LA 4G9EA 4JMPA 3BIJA 4UM9B 3VPFA 5FBVB 4FCTA 3F2VA 4KXUA 4D3XA 1V8BA 3NWEA 2QX9A 2AJ8A 4ZOBA 3WL8A 1DL5A 4H3HB 1PRYA 1E7YA 3G9QA 1OC4A 3HB7A 4X5OA 4C5AA 2Q8NA 1BAPA 3SS8A 2GVDC 4B6JA 5JYBA 4EG7A 2XYHA 4DYVA 1O7JA 4WACA 4R9SA 4YJ2A 3H17A 2IBMA 4RF4A 5EIEA 3RWBA 4WBSA 4Q9AA 1OQAA 4TKVA 5JD4A 2QNLA 4CKEA 1HDEA 3M1CB 2Q5IA 2VPQA 1EHIA 1BDBA 3HJFA 3B13B 3OKAA 1UKVY 3ZS8A 4RTJA 5JDCC 3SC6A 1TU3A 1ANKA 1DEXA 2GJSA 2ZB7A 2VAXA 1EBFA 1B23P 2G1PA 1V0JA 1E9BA 2CW0F 4TYQA 1NU9C 2BMVA 1R6XA 3MTAA 1CJSA 1AHHA 2A5LA 4JUBA 1DCKA 5ULLA 5KNBH 2ZSBA 1KSGA 2IUFA 3ZY3A 1NDQA 1SQ5A 2COKA 4CL3A 2ONZA 3K1IA 1TRKA 2A4MA 1TPZA 2H3EA 1A0BA 4ZVPA 3RARA 1V7PC 2QRUA 3GCZA 2MWQA 2ZWMA 3QXGA 2A58A 4JFAA 2C2OA 3N0TA 2GNAA 4PINA 3EGVA 1B0PA 1N0VC 5E9WA 2A6HF 4ZT6A 1IXRC 1WLSA 1Z8NA 1ORTA 1UJCA 3M82A 4LA4A 3SXPA 4CI0B 1II8B 4B44A 3STVA 3G2PA 4UHBA 3W7BA 3OP4A 1GUAA 3DZKA 4YT2A 1D7AA 3M2PA 4AS3A 2QN9A 1NYQA 4LJ5A 3CNQS 5T1DB 4OMUA 1GPYA 1B0UA 2V65A 2AA3A 4JJIA 1YAHA 3B6MA 3AEZA 4AI6A 2KK1A 2N3ZA 1L5HA 2J0XA 3LZ6A 4CNQA 3MUEA 4GZMA 5JQWA 1E1QA 1QYWA 3FVRA 2EQBA 3SOZA 1NKSA 3EXFB 3I9JA 3Q7QA 1Q20A 3A4MA 2OCLA 4GC5A 4NTZA 3H5LA 4MVJE 2QQFA 2X3UA 1AVTA 2WJ3A 2V9PA 5AICA 4FIZA 3K32A 1UKYA 1B00A 1TKAA 1YZTA 5EWLB 3EZHA 2ZJOA 3HC7A 1OCRC 2NZWA 1VZ3A 4YC7A 1I2BA 5A4FS 3OSUA 3P4XA 4CNBA 4RL4A 3I2FA 1G4UR 2WIKA 3ZXXA 4YMUA 2WA2A 3BGOS 1ZHOA 1JDBB 5LOVF 3W7AA 4CEJA 5TEVA 3B1FA 1CP3A 3EBPA 3I9NA 5EP4A 2FI1A 4H18A 1WBBA 1Q7GA 2TMVP 3MJEA 1QRRA 1UMCB 2RG7A 4L9RA 1O9BA 3TNJA 3QEAZ 5FNZA 3CLSD 3RASA 1CUJA 3AM4A 1WZCA 3R74A 1POWA 3I39X 1JG3A 4BNTA 1NTOA 2IYUA 1T2FA 1ZY2A 4HAUA 1X0XA 2HCBA 4JX8A 2QGNA 2IDJA 2FU5C 4L8VA 4GAEA 4B35A 4DQKA 1VFPA 1VJRA 4YRQA 3HGTA 4AF6A 4RTQA 1KEKA 1U3CA 3KTAB 3QK7A 3TIGA 4BB0A 3BGDA 2OCIA 4G8BA 4KK3A 3PNBA 2P4UA 4O4IF 2PX5A 2JFHA 1P60A 3X1ZA 2RSEB 1R74A 2GCNA 4C05A 1J22A 3CLRD 4FP9A 4QLAA 3I83A 3RC1A 4CGZA 3G1TA 3HP4A 1TZKA 3W34A 2WWWA 4DRYA 4E08A 1L5VA 4JYBA 3A6PC 3OJCA 2NUAA 1CCWA 2A69F