3W4YA

Crystal structure of yeast erv1 core
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
113
structure length
113
Chain Sequence
SRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPCNWCAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDGWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of yeast Erv1 core
rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Mitochondrial FAD-linked sulfhydryl oxidase ERV1
total genus 40
structure length 113
sequence length 113
chains with identical sequence B, C
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3w4yA01
3LLIA 3LLKA 3U2LA 3U5SA 1JR8A 3O55A 1OQCA 1JRAA 3TK0A 3TD7A 3GWLA 4E0HA 3MBGA 3R7CA 3U2MA 3W4YA 2HJ3A 4LDKA 4E0IA 3GWNA
chains in the Genus database with same CATH superfamily
1T5OA 3POVA 4OD4A 2B0HA 3MFNA 3UMIA 4G7ZF 4BEMJ 2NG1A 2W9YA 2HJ3A 2LSEA 4YL3A 2OJED 3F47A 1YZCA 4OD5A 4AE4B 4YL1A 1H7IA 4BJ6C 4CJOA 3AG4C 5KYYB 3N24A 3V7OA 3K1IC 3B71A 4PR9A 1JOGA 4R32A 2EPNA 3RVYA 3W2WA 5L3QA 1C17M 1O3UA 4N6CA 3C8GD 3ITFA 5E2QA 1Z7Qc 3U2LA 3KYIA 1E85A 3GM3A 4C7OA 1WWPA 1V4AA 2R9RB 3S9OA 3TK0A 5GPGB 5HSWA 4CS8C 2HJMA 4L6RA 4K7BA 5T3WA 3BEHA 1C02A 3NMKA 4WGYA 3NG1A 4I1MA 1FTSA 2OU6A 4YK5A 1VTMP 2A6EF 2L6FA 3KL4A 1AEPA 3HNJA 3IEEA 1XWJA 2Q3TA 3DKAA 1CPQA 1KNYA 1BDJB 1WASA 3EHMA 4PJJA 5B3SC 3K1IA 3AG3C 1ZHWA 3ABKC 2P7VA 2R7OA 2G62A 2EPMX 2NUTA 4H54A 4JJFA 4U5BE 3ZC4A 5E33A 4EBJA 1H9GA 1TWGA 2KSFA 2XL8A 1PV3A 5FZTA 1MMGA 1EI7A 2VB6A 5A6AA 3CSKA 2PX0A 3KH2A 3VYWA 3IPMO 3LEOA 3K6BA 3DAGA 2P1AA 1TWCA 3AG1C 3FHDA 3EFOB 4EIYA 2EPLX 1O87A 1ZHZA 3IQ6A 4C3BA 5AGFA 2O9XA 4EKWA 1OCCC 2CNWD 1LKXA 2Q7RA 1FFTC 3S28A 2BL2A 3ABMC 3EH2A 4J7TA 2EINC 4JW1A 5JSLA 3PMRA 3MYIA 3S90A 1NZEA 1G4US 2ZXWC 3KPHA 5JRAA 5DLJA 1FFHA 4EBKA 2Q9CA 2KYHA 3KMIA 1E2XA 3L0IA 2LFFA 4JEBA 5E3AA 3DMDA 1OXKA 4MVQA 1LIHA 1OCRC 1YLMA 3SXMA 2L6GA 4CIPA 2H7BA 2ZXPA 3V5YA 1NFNA 2L9JA 3O10A 1HY5A 2J8WA 2YLIA 3IHUA 3K66A 3RKOF 2OKUA 4EUKB 1OR3A 1D0XA 2FAPB 3TOLA 1ORSC 5KYUB 1LM3B 1KTMA 1MNEA 1PD0A 4J30B 2A1DD 1FAPB 4LLCA 5COFA 4DJ9A 3H2UA 1HE9A 1QLEC 1RXQA 1U6HA 3FOPA 3CQZA 3JRTA 4NTFA 3DXJF 1Z5ZA 4N06A 5D91A 3LJBA 5E3CA 2CW0F 3ZDLA 3SXKA 1QPUA 3T6JA 3GWNA 1ZW3A 3DJUB 3FXHA 1C03A 4O6NA 3DE9A 3C7JA 2HSBA 1M6TA 4IARA 1TWHA 4OINF 3IQ5A 3VRCA 4IWBA 4E17A 2FGYA 3NYMA 3K7DA 4ULVA 4YT8A 1N1CA 4MVZA 3HNKA 3V5ZA 3HNIA 3X1OA 4YWQA 1RCPA 3WODF 2KJGA 2ASRA 2GDCA 1JMWA 2RD9A 1CGNA 1OKKD 4LLEA 4FX5A 3OA1A 1O5HA 3OWTA 4U5FE 4BG0A 3C8ZA 3TJ6A 4XWJA 1TFKB 2LK4A 3G4XA 2R05A 4MW3A 3EH1A 1YARO 1OCZC 1D0YA 1SYQA 256BA 3C8GB 2I15A 4GYTA 4CIHA 3EG9B 2XL4A 4K0DA 2DYSC 5A6BD 2Y3GA 4DBRA 2Q9AA 1QSPA 2A0UA 1TR2A 2JX0A 3B0UX 5EGYA 5F5HA 5AC5A 1GQAA 1V55C 1M2VA 2WL8A 4XPYA 5DVWA 2P0NA 2B0JA 3TULA 1D0ZA 1D1CA 1YA9A 5COMA 4CS9A 2YLDA 3M79A 3WHNA 1BZ4A 3R2PA 2YKZA 4AL1A 2KK1A 4ZLCA 2CNWA 4K1OA 4GQHA 5FCLA 4MVRA 5JUAA 2LQGA 1A7EA 4KBLA 3DI5A 4AL0A 4BPMA 3V5XA 2QY9A 1MQVA 3RIPA 5DS5A 1VYIA 2XLWA 3GEEA 3O39A 5F28E 3ZVRA 4Z9IA 4B6IA 3G4ZA 3W4YA 1CGOA 3LNMB 4JTDB 2EILC 1QZXA 2WZFA 1LI5A 4KNWA 4LDQA 4PFOA 3B0PA 4JZAA 5DQTA 4G7OF 4JVSA 3HNLA 4PK4A 1SMYF 4O6YA 1VB5A 1ZYRF 3I5PA 1UFBA 2GAQA 1Q0KA 3Q6MA 3JSZA 1K05A 1PD1A 4JURI 2YEVA 2J9BA 4P9TA 4AX2A 1FMVA 3GEIA 1M57C 1B68A 4DRJB 4HFFB 1E83A 1F1MA 2IBFA 4F4BA 3HLZA 2R7QA 3JT1A 1LI7A 2A68F 2CCYA 4D4NA 3C63A 2XLDA 4JIOA 2XSEA 4XPWA 3UNGC 3UMHA 4QI0A 1T6QA 3LS1A 3HJCA 4WGZA 2UUIA 3C62A 1FR0A 1U0BB 1WTYA 3QW0A 1U89A 5KYXB 3AGTA 4XTKA 3NKEA 4J7YA 1BR1A 3IQTA 1NLXA 3U9MA 2CGEA 2GWWA 4BJ1A 5DS4A 2L6HA 3GORA 2H8AA 4N6HA 1W2WA 1R4TA 2E87A 3QVYA 4DVYP 5CI8A 4KNVA 1G8XA 2H7OA 3Q6NA 5B1BC 3U2MA 3X2QC 5DS6A 4DVZA 3GANA 3K33A 1NSGB 4XEVA 4CDAA 3S0XA 4O79A 1XZQA 2PX3A 2VASA 4AK9A 3DD7A 4IAOA 1CGME 1I5NA 4BJ5C 1T01A 3EGDB 1VLTA 2WZGA 1K04A 3GM2A 4MVOA 3PDMP 3F46A 4PFPA 1V54C 5A6JA 2XLVA 1Z3IX 3U9JA 2JPUA 4KI2A 1IW7F 3JSEO 5KYWB 1APCA 2ZXRA 5K0IA 1L3PA 2YRFA 2AP3A 3RH3A 3EZIA 4XEFA 2WB7A 3GEHA 2XXAB 3BRJA 4MTFA 3R7CA 2XM0A 4C3EA 1DOVA 1ZHTA 3ABLC 2WVOA 3N0TA 2Y3DA 4CDVA 1RKEB 4U9DA 4CDYA 4O7GA 1HMOA 2IOQA 4FAPB 4NCQA 2EIKC 5D92A 3ZG1A 5JS5A 4OIQF 2R7UA 2RSEB 2IM8A 4XLNF 1HW1A 4J32B 3RFYA 2YL0A 3ZTMA 4M63A 3PHF2 2AVKA 1ZVZA 4PJMA 3AQBA 5KYUA 4BJ6A 2NSFA 1A41A 1OR2A 2ETSA 2W45A 2VCCA 3AQCA 4A2NB 2R7WA 1GM5A 2Y3BA 1UG7A 5L0GA 1VK5A 4JRZA 2P6VA 1R5ID 2TMVP 5BUOA 4IJJA 3U3FA 2XL6A 5CIVA 4C7OB 2CDQA 1ZU5A 4JE9A 2ZXOA 1MNDA 3FVYA 1A7DA 1OCOC 1YVIA 3HKKA 4XEKA 1LE4A 1T6UA 3I4UA 1TWAA 3LS0A 1DOWA 4NTAA 3DJNB 3B29A 4PJNA 1YDIA 2J46A 5AC4A 3JRMO 4CSAA 3TD7A 4H4KC 4YT2A 1H9TA 2LD6A 5L0CA 2HMQA 4MQ9F 2W4MA 4RBNA 1WGWA 3AJMA 4QDLA 2NUPA 1MMAA 2Q00A 4NC3A 4UDVA 2EPOA 2M4EA 1AUEA 1NU9C 3JCUQ 1Z63A 3DWWA 3MBGA 1VMAA 2NUTB 2OCCC 3HTKC 2XS1A 1WATA 1Q0FA 3TOMA 3C8GA 2J9VA 4HEAJ 1QVXA 3L8JA 4DRIB 2Q4FA 3UMKA 5KYYA 2NSGA 2LP4A 2QTVA 3NDBB 1NU7D 3QTHA 4P9FA 5A6BA 3Q7GA 3O6XA 4E18A 1D1BA 4JEAA 1Y6DA 1ORJA 3EGXA 4JCZA 3TQOA 1ZU4A 2QE9A 2AWCA 1OW8A 4Q4ZF 3CZ6A 4MNDA 5L0FA 4FESA 1EQ1A 3NYLA 4XPXA 4YL0A 2KW3C 3E9VA 3J06A 1Z23A 1OQCA 1ORYA 4ULWA 2BE5F 1ZHYA 4Q7CA 1S05A 1SZIA 3VM6A 4RD9A 4RDAA 2HV6A 2A69F 3A11A 1RJ9B 4GEHA 3ZTZA 1SF8A 4A4AA 2M64A 3M4CA 1S7ZA 3RQFA 1GGQA 3EQLF 2XLMA 2LFDA 4I44A 1YYXA 3CEXA 4NY3A 1J8MF 2QNLA 4FWVA 3GODA 1EKYA 2HZ8A 3NYJA 1I4ZA 2IYLD 1OW6A 4XQ1A 1FNTc 1RMVA 2VH3A 2MWQA 4KC9A 3SEOA 3T6GB 5JT4A 2PNOA 3EFOA 3EPVA 3UR3C 1OXBA 3N2ZB 3KYJA 2G3KA 2XRHA 4YJWA 1MMNA 2F22A 2L81A 4P6IC 2BC5A 3ECSA 3EZHA 1IZMA 4JKVA 4WJ0A 4YN0B 3WG7C 4G78A 4IB4A 3M4BA 3JZ0A 2W4BA 3RF3A 3W8HA 3FDQA 1AVOB 4MTOA 4DBQA 2PBEA 3FAJA 1ZHXA 4U5CE 2HSQA 2OOCA 3AGUA 2AWYA 5KYNA 2YWAA 2J45A 2YL3A 5BQIA 1Q0MA 4MVMA 2PP4A 4PJLA 2HV7A 2X51A 4MVUA 3W2VA 4D4XA 1Y4CA 4DOZA 2P61A 2UUHA 3ATPA 5JLIA 5JVEA 4JJGA 2GFHA 4EBBA 1LVKA 2YL1A 3NRHA 2H7VC 4ANJA 4WABA 1LPEA 2WVNA 4MS2A 1JPJA 3SNHA 3ZSUA 1RKCA 3MLGA 3G50A 3EG9A 2OG2A 2PF4E 2XLEA 3H65A 4AE4A 4Q5SF 3RQGA 1E86A 3MYFA 5F5FA 4ZLDA 2C04A 3GM1A 4JTAB 3PCVA 4CS8A 2R7XA 1YYJA 1A7VA 3AOUA 3I5QA 4U5GA 1QQ3A 3B0VC 1VOMA 1BBHA 3T4RA 5A6KA 1Q0GA 1YAUO 1HW2A 5JP7A 2IXOA 2V26A 2J9UA 3B9QA 3NMIA 3Q7LA 5KYWA 3S29A 2R7VA 2NPUA 4ONSA 1JR8A 2HMZA 1G5ZA 4CJGA 1ZZPA 2OEXA 3MX3A 1VYKA 1FMWA 2J7PD 5B3IA 3SXZA 1RKEA 1J8YF 3QVZA 3QW1A 2J7PA 4CBEA 1BR2A 1A0BA 1V74B 4LACB 2GA0A 1MMDA 1TQGA 1XZPA 2C03A 1WOLA 4O6MA 3ZWIA 3UGOA 2R02A 2X0CA 2HS5A 2Y69C 1L7CA 1WN0A 1HE1A 3W8IA 3ASOC 4Z9HA 1I4YA 4N4WA 3RVZA 3QZCA 3ZIBA 3A9CA 5A69A 4LDRA 1LS1A 1NBBA 4U5DE 5T3TA 3SYNA 4NQFA 4G7HF 4E7ZA 2EIJC 3U0CA 4I3MA 1YZAA 1GS9A 4U5HA 3TJ5A 5L0HA 3C18A 1T6IA 4HFKB 2ZD9A 5L0IA 2EIMC 3L1MA 2Y39A 5DQZA 4CS7A 1YA7O 4G0HA 2ZPAA 2J0WA 3T9OA 1YJGA 5L3VA 2YL7A 3LLKA 4IRUA 4C3DA 4ER9A 3FMSA 3FOOA 1QKRA 3K1HA 2YZSA 2KGOA 5KYXA 4LDKA 4E7SA 2J9WA 3DAFA 3NMJA 1LS4A 2V3CC 1TKNA 2KQ9A 4CX9A 1G4WR 2A0BA 3LNRA 4U9EA 2Z15A 2YVKA 3U8PA 3GWLA 4YT4A 4NTBA 1BR4A 4X0RA 4DXWA 3FAPB 4MVSA 3LAYA 3WAQA 4BJ5A 4DRHB 3SXYA 2LIGA 2DB4A 3CAXA 1E84A 4IGGA 3E70C 2R7SA 1OKKA 4Z9JA 3EGDA 4JCHA 3JYYA 3VF0A 4IAQA 3OEOA 1NFOA 1TFOB 2Q9BA 1M56C 2R25A 4JC7A 4E0IA 1SR2A 1ST6A 3DM9B 2HUJA 3L34A 3LLIA 4OIRF 2OEVA 3EGXB 3LEVA 2MHRA 1OW7A 3LESA 5CI9A 2XM4A 3S84A 4EHPA 2YLGA 3U3BA 2HFIA 2I8BA 2QUPA 2XXAA 3NKDA 4OIOF 2VCAA 4I1OB 1ZW2A 2R03A 2WZLA 1Z6AA 2ICWG 3AG2C 3IQCA 3S27A 2DI3A 3ZQYA 1RJ9A 3ZQVA 1H6GA 2YHSA 1NG1A 1JRAA 2L7AA 1JPNA 2IXMA 1HMDA 2XS8A 3EHNA 3EJNA 4W8PA 2HKVA 2IXPA 4JTCB 3RYLA 1T9KA 5L0JA 2WVQA 3LUTB 2IXNA 5EHHA 1KU2A 2QLAA 4HE8D 3L8IA 3DZAA 2YQYA 2KNHA 3RW0A 5L0DA 2PFDA 3UGPA 1M2OA 3O55A 4CS9C 5BQGA 3H2VA 2G3VA 5IY5C 5EK0A 4BJTA 1M2VB 1K40A 2J0XA 4OIPF 2FFHA 2XLHA 5COGA 3VAYA 3U8VA 2KC3A 3ASNC 4QI2A 1CPRA 2D4UA 2VCBA 1LE2A 3M1CB 2MYSA 3DE8A 3KKBA 3M15A 4W8KA 5T1DB 2XLOA 3T6BA 2OJQA 1D1AA 2CYDA 2Y3HA 3JTLO 3JYHA 1Q0DA 3RQEA 4PACA 4EWCA 2DYRC 1PCXA 2EPKX 2JD3A 4CSAC 4E0HA 4U5EE 2LCHA 2A6HF 2OQMA 2DGJA 4LERA 3US6A 3QMKA 4BEJA 2AU5A 4MTGA 1EA8A 1VLSA 4YT5A 3U5SA 3DM5A 5B1AC 2VC9A 5BQHA 4XLPF 3SP1A 2R7TA 1JAFA 5HV9A 5TJ5E 2R7RA 3SZRA 2NUPB 2D5RB 4MW8A
chains in the Genus database with same CATH topology
3LLIA 3LLKA 3U2LA 3U5SA 1JR8A 3O55A 1OQCA 1JRAA 3TK0A 3TD7A 3GWLA 4E0HA 3MBGA 3R7CA 3U2MA 3W4YA 2HJ3A 4LDKA 4E0IA 3GWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LLI A;  3LLK A;  3U2L A;  3U5S A;  1JR8 A;  3O55 A;  1OQC A;  1JRA A;  3TK0 A;  3TD7 A;  3GWL A;  4E0H A;  3MBG A;  3R7C A;  3U2M A;  3W4Y A;  2HJ3 A;  4LDK A;  4E0I A;  3GWN A; 
#chains in the Genus database with same CATH topology
 1T5O A;  3POV A;  4OD4 A;  2B0H A;  3MFN A;  3UMI A;  4G7Z F;  4BEM J;  2NG1 A;  2W9Y A;  2HJ3 A;  2LSE A;  4YL3 A;  2OJE D;  3F47 A;  1YZC A;  4OD5 A;  4AE4 B;  4YL1 A;  1H7I A;  4BJ6 C;  4CJO A;  3AG4 C;  5KYY B;  3N24 A;  3V7O A;  3K1I C;  3B71 A;  4PR9 A;  1JOG A;  4R32 A;  2EPN A;  3RVY A;  3W2W A;  5L3Q A;  1C17 M;  1O3U A;  4N6C A;  3C8G D;  3ITF A;  5E2Q A;  1Z7Q c;  3U2L A;  3KYI A;  1E85 A;  3GM3 A;  4C7O A;  1WWP A;  1V4A A;  2R9R B;  3S9O A;  3TK0 A;  5GPG B;  5HSW A;  4CS8 C;  2HJM A;  4L6R A;  4K7B A;  5T3W A;  3BEH A;  1C02 A;  3NMK A;  4WGY A;  3NG1 A;  4I1M A;  1FTS A;  2OU6 A;  4YK5 A;  1VTM P;  2A6E F;  2L6F A;  3KL4 A;  1AEP A;  3HNJ A;  3IEE A;  1XWJ A;  2Q3T A;  3DKA A;  1CPQ A;  1KNY A;  1BDJ B;  1WAS A;  3EHM A;  4PJJ A;  5B3S C;  3K1I A;  3AG3 C;  1ZHW A;  3ABK C;  2P7V A;  2R7O A;  2G62 A;  2EPM X;  2NUT A;  4H54 A;  4JJF A;  4U5B E;  3ZC4 A;  5E33 A;  4EBJ A;  1H9G A;  1TWG A;  2KSF A;  2XL8 A;  1PV3 A;  5FZT A;  1MMG A;  1EI7 A;  2VB6 A;  5A6A A;  3CSK A;  2PX0 A;  3KH2 A;  3VYW A;  3IPM O;  3LEO A;  3K6B A;  3DAG A;  2P1A A;  1TWC A;  3AG1 C;  3FHD A;  3EFO B;  4EIY A;  2EPL X;  1O87 A;  1ZHZ A;  3IQ6 A;  4C3B A;  5AGF A;  2O9X A;  4EKW A;  1OCC C;  2CNW D;  1LKX A;  2Q7R A;  1FFT C;  3S28 A;  2BL2 A;  3ABM C;  3EH2 A;  4J7T A;  2EIN C;  4JW1 A;  5JSL A;  3PMR A;  3MYI A;  3S90 A;  1NZE A;  1G4U S;  2ZXW C;  3KPH A;  5JRA A;  5DLJ A;  1FFH A;  4EBK A;  2Q9C A;  2KYH A;  3KMI A;  1E2X A;  3L0I A;  2LFF A;  4JEB A;  5E3A A;  3DMD A;  1OXK A;  4MVQ A;  1LIH A;  1OCR C;  1YLM A;  3SXM A;  2L6G A;  4CIP A;  2H7B A;  2ZXP A;  3V5Y A;  1NFN A;  2L9J A;  3O10 A;  1HY5 A;  2J8W A;  2YLI A;  3IHU A;  3K66 A;  3RKO F;  2OKU A;  4EUK B;  1OR3 A;  1D0X A;  2FAP B;  3TOL A;  1ORS C;  5KYU B;  1LM3 B;  1KTM A;  1MNE A;  1PD0 A;  4J30 B;  2A1D D;  1FAP B;  4LLC A;  5COF A;  4DJ9 A;  3H2U A;  1HE9 A;  1QLE C;  1RXQ A;  1U6H A;  3FOP A;  3CQZ A;  3JRT A;  4NTF A;  3DXJ F;  1Z5Z A;  4N06 A;  5D91 A;  3LJB A;  5E3C A;  2CW0 F;  3ZDL A;  3SXK A;  1QPU A;  3T6J A;  3GWN A;  1ZW3 A;  3DJU B;  3FXH A;  1C03 A;  4O6N A;  3DE9 A;  3C7J A;  2HSB A;  1M6T A;  4IAR A;  1TWH A;  4OIN F;  3IQ5 A;  3VRC A;  4IWB A;  4E17 A;  2FGY A;  3NYM A;  3K7D A;  4ULV A;  4YT8 A;  1N1C A;  4MVZ A;  3HNK A;  3V5Z A;  3HNI A;  3X1O A;  4YWQ A;  1RCP A;  3WOD F;  2KJG A;  2ASR A;  2GDC A;  1JMW A;  2RD9 A;  1CGN A;  1OKK D;  4LLE A;  4FX5 A;  3OA1 A;  1O5H A;  3OWT A;  4U5F E;  4BG0 A;  3C8Z A;  3TJ6 A;  4XWJ A;  1TFK B;  2LK4 A;  3G4X A;  2R05 A;  4MW3 A;  3EH1 A;  1YAR O;  1OCZ C;  1D0Y A;  1SYQ A;  256B A;  3C8G B;  2I15 A;  4GYT A;  4CIH A;  3EG9 B;  2XL4 A;  4K0D A;  2DYS C;  5A6B D;  2Y3G A;  4DBR A;  2Q9A A;  1QSP A;  2A0U A;  1TR2 A;  2JX0 A;  3B0U X;  5EGY A;  5F5H A;  5AC5 A;  1GQA A;  1V55 C;  1M2V A;  2WL8 A;  4XPY A;  5DVW A;  2P0N A;  2B0J A;  3TUL A;  1D0Z A;  1D1C A;  1YA9 A;  5COM A;  4CS9 A;  2YLD A;  3M79 A;  3WHN A;  1BZ4 A;  3R2P A;  2YKZ A;  4AL1 A;  2KK1 A;  4ZLC A;  2CNW A;  4K1O A;  4GQH A;  5FCL A;  4MVR A;  5JUA A;  2LQG A;  1A7E A;  4KBL A;  3DI5 A;  4AL0 A;  4BPM A;  3V5X A;  2QY9 A;  1MQV A;  3RIP A;  5DS5 A;  1VYI A;  2XLW A;  3GEE A;  3O39 A;  5F28 E;  3ZVR A;  4Z9I A;  4B6I A;  3G4Z A;  3W4Y A;  1CGO A;  3LNM B;  4JTD B;  2EIL C;  1QZX A;  2WZF A;  1LI5 A;  4KNW A;  4LDQ A;  4PFO A;  3B0P A;  4JZA A;  5DQT A;  4G7O F;  4JVS A;  3HNL A;  4PK4 A;  1SMY F;  4O6Y A;  1VB5 A;  1ZYR F;  3I5P A;  1UFB A;  2GAQ A;  1Q0K A;  3Q6M A;  3JSZ A;  1K05 A;  1PD1 A;  4JUR I;  2YEV A;  2J9B A;  4P9T A;  4AX2 A;  1FMV A;  3GEI A;  1M57 C;  1B68 A;  4DRJ B;  4HFF B;  1E83 A;  1F1M A;  2IBF A;  4F4B A;  3HLZ A;  2R7Q A;  3JT1 A;  1LI7 A;  2A68 F;  2CCY A;  4D4N A;  3C63 A;  2XLD A;  4JIO A;  2XSE A;  4XPW A;  3UNG C;  3UMH A;  4QI0 A;  1T6Q A;  3LS1 A;  3HJC A;  4WGZ A;  2UUI A;  3C62 A;  1FR0 A;  1U0B B;  1WTY A;  3QW0 A;  1U89 A;  5KYX B;  3AGT A;  4XTK A;  3NKE A;  4J7Y A;  1BR1 A;  3IQT A;  1NLX A;  3U9M A;  2CGE A;  2GWW A;  4BJ1 A;  5DS4 A;  2L6H A;  3GOR A;  2H8A A;  4N6H A;  1W2W A;  1R4T A;  2E87 A;  3QVY A;  4DVY P;  5CI8 A;  4KNV A;  1G8X A;  2H7O A;  3Q6N A;  5B1B C;  3U2M A;  3X2Q C;  5DS6 A;  4DVZ A;  3GAN A;  3K33 A;  1NSG B;  4XEV A;  4CDA A;  3S0X A;  4O79 A;  1XZQ A;  2PX3 A;  2VAS A;  4AK9 A;  3DD7 A;  4IAO A;  1CGM E;  1I5N A;  4BJ5 C;  1T01 A;  3EGD B;  1VLT A;  2WZG A;  1K04 A;  3GM2 A;  4MVO A;  3PDM P;  3F46 A;  4PFP A;  1V54 C;  5A6J A;  2XLV A;  1Z3I X;  3U9J A;  2JPU A;  4KI2 A;  1IW7 F;  3JSE O;  5KYW B;  1APC A;  2ZXR A;  5K0I A;  1L3P A;  2YRF A;  2AP3 A;  3RH3 A;  3EZI A;  4XEF A;  2WB7 A;  3GEH A;  2XXA B;  3BRJ A;  4MTF A;  3R7C A;  2XM0 A;  4C3E A;  1DOV A;  1ZHT A;  3ABL C;  2WVO A;  3N0T A;  2Y3D A;  4CDV A;  1RKE B;  4U9D A;  4CDY A;  4O7G A;  1HMO A;  2IOQ A;  4FAP B;  4NCQ A;  2EIK C;  5D92 A;  3ZG1 A;  5JS5 A;  4OIQ F;  2R7U A;  2RSE B;  2IM8 A;  4XLN F;  1HW1 A;  4J32 B;  3RFY A;  2YL0 A;  3ZTM A;  4M63 A;  3PHF 2;  2AVK A;  1ZVZ A;  4PJM A;  3AQB A;  5KYU A;  4BJ6 A;  2NSF A;  1A41 A;  1OR2 A;  2ETS A;  2W45 A;  2VCC A;  3AQC A;  4A2N B;  2R7W A;  1GM5 A;  2Y3B A;  1UG7 A;  5L0G A;  1VK5 A;  4JRZ A;  2P6V A;  1R5I D;  2TMV P;  5BUO A;  4IJJ A;  3U3F A;  2XL6 A;  5CIV A;  4C7O B;  2CDQ A;  1ZU5 A;  4JE9 A;  2ZXO A;  1MND A;  3FVY A;  1A7D A;  1OCO C;  1YVI A;  3HKK A;  4XEK A;  1LE4 A;  1T6U A;  3I4U A;  1TWA A;  3LS0 A;  1DOW A;  4NTA A;  3DJN B;  3B29 A;  4PJN A;  1YDI A;  2J46 A;  5AC4 A;  3JRM O;  4CSA A;  3TD7 A;  4H4K C;  4YT2 A;  1H9T A;  2LD6 A;  5L0C A;  2HMQ A;  4MQ9 F;  2W4M A;  4RBN A;  1WGW A;  3AJM A;  4QDL A;  2NUP A;  1MMA A;  2Q00 A;  4NC3 A;  4UDV A;  2EPO A;  2M4E A;  1AUE A;  1NU9 C;  3JCU Q;  1Z63 A;  3DWW A;  3MBG A;  1VMA A;  2NUT B;  2OCC C;  3HTK C;  2XS1 A;  1WAT A;  1Q0F A;  3TOM A;  3C8G A;  2J9V A;  4HEA J;  1QVX A;  3L8J A;  4DRI B;  2Q4F A;  3UMK A;  5KYY A;  2NSG A;  2LP4 A;  2QTV A;  3NDB B;  1NU7 D;  3QTH A;  4P9F A;  5A6B A;  3Q7G A;  3O6X A;  4E18 A;  1D1B A;  4JEA A;  1Y6D A;  1ORJ A;  3EGX A;  4JCZ A;  3TQO A;  1ZU4 A;  2QE9 A;  2AWC A;  1OW8 A;  4Q4Z F;  3CZ6 A;  4MND A;  5L0F A;  4FES A;  1EQ1 A;  3NYL A;  4XPX A;  4YL0 A;  2KW3 C;  3E9V A;  3J06 A;  1Z23 A;  1OQC A;  1ORY A;  4ULW A;  2BE5 F;  1ZHY A;  4Q7C A;  1S05 A;  1SZI A;  3VM6 A;  4RD9 A;  4RDA A;  2HV6 A;  2A69 F;  3A11 A;  1RJ9 B;  4GEH A;  3ZTZ A;  1SF8 A;  4A4A A;  2M64 A;  3M4C A;  1S7Z A;  3RQF A;  1GGQ A;  3EQL F;  2XLM A;  2LFD A;  4I44 A;  1YYX A;  3CEX A;  4NY3 A;  1J8M F;  2QNL A;  4FWV A;  3GOD A;  1EKY A;  2HZ8 A;  3NYJ A;  1I4Z A;  2IYL D;  1OW6 A;  4XQ1 A;  1FNT c;  1RMV A;  2VH3 A;  2MWQ A;  4KC9 A;  3SEO A;  3T6G B;  5JT4 A;  2PNO A;  3EFO A;  3EPV A;  3UR3 C;  1OXB A;  3N2Z B;  3KYJ A;  2G3K A;  2XRH A;  4YJW A;  1MMN A;  2F22 A;  2L81 A;  4P6I C;  2BC5 A;  3ECS A;  3EZH A;  1IZM A;  4JKV A;  4WJ0 A;  4YN0 B;  3WG7 C;  4G78 A;  4IB4 A;  3M4B A;  3JZ0 A;  2W4B A;  3RF3 A;  3W8H A;  3FDQ A;  1AVO B;  4MTO A;  4DBQ A;  2PBE A;  3FAJ A;  1ZHX A;  4U5C E;  2HSQ A;  2OOC A;  3AGU A;  2AWY A;  5KYN A;  2YWA A;  2J45 A;  2YL3 A;  5BQI A;  1Q0M A;  4MVM A;  2PP4 A;  4PJL A;  2HV7 A;  2X51 A;  4MVU A;  3W2V A;  4D4X A;  1Y4C A;  4DOZ A;  2P61 A;  2UUH A;  3ATP A;  5JLI A;  5JVE A;  4JJG A;  2GFH A;  4EBB A;  1LVK A;  2YL1 A;  3NRH A;  2H7V C;  4ANJ A;  4WAB A;  1LPE A;  2WVN A;  4MS2 A;  1JPJ A;  3SNH A;  3ZSU A;  1RKC A;  3MLG A;  3G50 A;  3EG9 A;  2OG2 A;  2PF4 E;  2XLE A;  3H65 A;  4AE4 A;  4Q5S F;  3RQG A;  1E86 A;  3MYF A;  5F5F A;  4ZLD A;  2C04 A;  3GM1 A;  4JTA B;  3PCV A;  4CS8 A;  2R7X A;  1YYJ A;  1A7V A;  3AOU A;  3I5Q A;  4U5G A;  1QQ3 A;  3B0V C;  1VOM A;  1BBH A;  3T4R A;  5A6K A;  1Q0G A;  1YAU O;  1HW2 A;  5JP7 A;  2IXO A;  2V26 A;  2J9U A;  3B9Q A;  3NMI A;  3Q7L A;  5KYW A;  3S29 A;  2R7V A;  2NPU A;  4ONS A;  1JR8 A;  2HMZ A;  1G5Z A;  4CJG A;  1ZZP A;  2OEX A;  3MX3 A;  1VYK A;  1FMW A;  2J7P D;  5B3I A;  3SXZ A;  1RKE A;  1J8Y F;  3QVZ A;  3QW1 A;  2J7P A;  4CBE A;  1BR2 A;  1A0B A;  1V74 B;  4LAC B;  2GA0 A;  1MMD A;  1TQG A;  1XZP A;  2C03 A;  1WOL A;  4O6M A;  3ZWI A;  3UGO A;  2R02 A;  2X0C A;  2HS5 A;  2Y69 C;  1L7C A;  1WN0 A;  1HE1 A;  3W8I A;  3ASO C;  4Z9H A;  1I4Y A;  4N4W A;  3RVZ A;  3QZC A;  3ZIB A;  3A9C A;  5A69 A;  4LDR A;  1LS1 A;  1NBB A;  4U5D E;  5T3T A;  3SYN A;  4NQF A;  4G7H F;  4E7Z A;  2EIJ C;  3U0C A;  4I3M A;  1YZA A;  1GS9 A;  4U5H A;  3TJ5 A;  5L0H A;  3C18 A;  1T6I A;  4HFK B;  2ZD9 A;  5L0I A;  2EIM C;  3L1M A;  2Y39 A;  5DQZ A;  4CS7 A;  1YA7 O;  4G0H A;  2ZPA A;  2J0W A;  3T9O A;  1YJG A;  5L3V A;  2YL7 A;  3LLK A;  4IRU A;  4C3D A;  4ER9 A;  3FMS A;  3FOO A;  1QKR A;  3K1H A;  2YZS A;  2KGO A;  5KYX A;  4LDK A;  4E7S A;  2J9W A;  3DAF A;  3NMJ A;  1LS4 A;  2V3C C;  1TKN A;  2KQ9 A;  4CX9 A;  1G4W R;  2A0B A;  3LNR A;  4U9E A;  2Z15 A;  2YVK A;  3U8P A;  3GWL A;  4YT4 A;  4NTB A;  1BR4 A;  4X0R A;  4DXW A;  3FAP B;  4MVS A;  3LAY A;  3WAQ A;  4BJ5 A;  4DRH B;  3SXY A;  2LIG A;  2DB4 A;  3CAX A;  1E84 A;  4IGG A;  3E70 C;  2R7S A;  1OKK A;  4Z9J A;  3EGD A;  4JCH A;  3JYY A;  3VF0 A;  4IAQ A;  3OEO A;  1NFO A;  1TFO B;  2Q9B A;  1M56 C;  2R25 A;  4JC7 A;  4E0I A;  1SR2 A;  1ST6 A;  3DM9 B;  2HUJ A;  3L34 A;  3LLI A;  4OIR F;  2OEV A;  3EGX B;  3LEV A;  2MHR A;  1OW7 A;  3LES A;  5CI9 A;  2XM4 A;  3S84 A;  4EHP A;  2YLG A;  3U3B A;  2HFI A;  2I8B A;  2QUP A;  2XXA A;  3NKD A;  4OIO F;  2VCA A;  4I1O B;  1ZW2 A;  2R03 A;  2WZL A;  1Z6A A;  2ICW G;  3AG2 C;  3IQC A;  3S27 A;  2DI3 A;  3ZQY A;  1RJ9 A;  3ZQV A;  1H6G A;  2YHS A;  1NG1 A;  1JRA A;  2L7A A;  1JPN A;  2IXM A;  1HMD A;  2XS8 A;  3EHN A;  3EJN A;  4W8P A;  2HKV A;  2IXP A;  4JTC B;  3RYL A;  1T9K A;  5L0J A;  2WVQ A;  3LUT B;  2IXN A;  5EHH A;  1KU2 A;  2QLA A;  4HE8 D;  3L8I A;  3DZA A;  2YQY A;  2KNH A;  3RW0 A;  5L0D A;  2PFD A;  3UGP A;  1M2O A;  3O55 A;  4CS9 C;  5BQG A;  3H2V A;  2G3V A;  5IY5 C;  5EK0 A;  4BJT A;  1M2V B;  1K40 A;  2J0X A;  4OIP F;  2FFH A;  2XLH A;  5COG A;  3VAY A;  3U8V A;  2KC3 A;  3ASN C;  4QI2 A;  1CPR A;  2D4U A;  2VCB A;  1LE2 A;  3M1C B;  2MYS A;  3DE8 A;  3KKB A;  3M15 A;  4W8K A;  5T1D B;  2XLO A;  3T6B A;  2OJQ A;  1D1A A;  2CYD A;  2Y3H A;  3JTL O;  3JYH A;  1Q0D A;  3RQE A;  4PAC A;  4EWC A;  2DYR C;  1PCX A;  2EPK X;  2JD3 A;  4CSA C;  4E0H A;  4U5E E;  2LCH A;  2A6H F;  2OQM A;  2DGJ A;  4LER A;  3US6 A;  3QMK A;  4BEJ A;  2AU5 A;  4MTG A;  1EA8 A;  1VLS A;  4YT5 A;  3U5S A;  3DM5 A;  5B1A C;  2VC9 A;  5BQH A;  4XLP F;  3SP1 A;  2R7T A;  1JAF A;  5HV9 A;  5TJ5 E;  2R7R A;  3SZR A;  2NUP B;  2D5R B;  4MW8 A; 
#chains in the Genus database with same CATH homology
 3LLI A;  3LLK A;  3U2L A;  3U5S A;  1JR8 A;  3O55 A;  1OQC A;  1JRA A;  3TK0 A;  3TD7 A;  3GWL A;  4E0H A;  3MBG A;  3R7C A;  3U2M A;  3W4Y A;  2HJ3 A;  4LDK A;  4E0I A;  3GWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...