3W4YA

Crystal structure of yeast erv1 core
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
113
structure length
113
Chain Sequence
b'SRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPCNWCAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDGWD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial FAD-linked sulfhydryl oxidase ERV1
molecule tags Oxidoreductase
source organism Saccharomyces cerevisiae
publication title Crystal structure of yeast Erv1 core
rcsb
total genus 40
structure length 113
sequence length 113
chains with identical sequence B, C
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3w4yA01
1JRAA 3O55A 3U2MA 4E0IA 4LDKA 3U5SA 1JR8A 3GWLA 3W4YA 3LLIA 4E0HA 3GWNA 3TK0A 3TD7A 3MBGA 3R7CA 3U2LA 1OQCA 2HJ3A 3LLKA
chains in the Genus database with same CATH superfamily
1I5NA 3A9CA 1M2OA 3EH1A 2H7VC 1EKYA 2EILC 2WVNA 3Q7GA 4AL1A 1G5ZA 3FDQA 3HNLA 4CDVA 1KTMA 4ER9A 2IXNA 5KYXA 1E86A 3PDMP 3I5PA 1NBBA 2LFDA 2HS5A 3K1HA 2R7VA 3H2UA 1QQ3A 3HTKC 4P9FA 4E18A 2AWCA 4Z9JA 2J7PA 1D0XA 2NPUA 4PJLA 1QSPA 5JS5A 1TQGA 1M6TA 4LLEA 1RKEA 1JMWA 1XWJA 1TKNA 1QZXA 3JSEO 4M63A 3X1OA 4DRJB 1Q0DA 4O6YA 5KYYA 1JPNA 3DXJF 1KU2A 3EHMA 4YWQA 1YA9A 1EQ1A 2JPUA 3GEIA 4JC7A 4NQFA 4WABA 1ZHZA 2YL1A 4P6IC 5COMA 4CS8A 3BRJA 3NMIA 4L6RA 5KYWA 3FOOA 2V26A 2LQGA 3MYFA 5T1DB 4G7ZF 1T5OA 1FMWA 3SXKA 2PX0A 3Q6MA 2ZXPA 1O5HA 3UMIA 3ZSUA 2EIJC 5A69A 5L0CA 1FNTc 2R7RA 3LESA 3VAYA 5D92A 3RF3A 2CDQA 4MTGA 3SXYA 1S7ZA 4JURI 5COFA 4JTAB 3SEOA 3T9OA 3M4CA 3AOUA 1QKRA 5L0JA 2WZLA 4GYTA 2R7SA 1OR3A 3JYHA 3DWWA 2QUPA 2XS8A 3OEOA 4DVYP 2J46A 2DI3A 2X0CA 5JT4A 4QI2A 2M64A 2KSFA 1YDIA 2M4EA 2HMQA 4HE8D 2IXMA 3SXMA 5L0DA 1WTYA 4ZLDA 4DBRA 3MFNA 4A2NB 2BC5A 1O3UA 4YK5A 5E2QA 1PD0A 4OD4A 4U5EE 3HNKA 4U5FE 1SMYF 3LAYA 3RYLA 2Y69C 1BR4A 4CDAA 2Q9CA 3RIPA 1SF8A 5DS4A 3LEVA 3EFOB 5F28E 3GM3A 3AQCA 2WZFA 1VOMA 4BJ5C 1RJ9A 3K66A 4E17A 1WATA 1ZU5A 5JP7A 4PJNA 2LCHA 2YZSA 2ZPAA 4MVUA 3RFYA 1SZIA 3H65A 3EFOA 2XLOA 2H7BA 1HY5A 1T6QA 3GWNA 5L0IA 1D0YA 1RMVA 4XEKA 4CSAC 2J9VA 2P0NA 3CZ6A 4IJJA 5KYNA 4KC9A 4C3EA 1RXQA 2A68F 1YYJA 4LDKA 2R7UA 3GANA 1C02A 4AE4B 1ST6A 3IEEA 5JVEA 2J45A 1VLSA 1GM5A 4HEAJ 1EA8A 3NYLA 4MVRA 3SYNA 1D1CA 3DM5A 5TJ5E 3JTLO 1WOLA 4IB4A 1KNYA 4PR9A 4CJOA 3VM6A 3O6XA 1L3PA 2C03A 2XL8A 2KW3C 3IQCA 3QMKA 4H54A 1J8YF 2VCCA 3DJNB 2PFDA 3GODA 2R02A 3S84A 3B0PA 3ZVRA 1ZHTA 4FESA 4QI0A 4N06A 1QLEC 3VYWA 1OCRC 4CIHA 3S90A 4G7OF 3ABMC 5BQIA 1NZEA 1Y6DA 1LE2A 2ZXOA 4XPWA 5GPGB 1H7IA 1F1MA 3KMIA 1A7EA 4NC3A 1OKKD 1JR8A 3A11A 3PCVA 4J7TA 2AU5A 2QY9A 4JEAA 4JEBA 3IQ6A 3L34A 2ASRA 3C62A 2YLGA 3ZC4A 3TULA 4YL3A 4DRIB 2JX0A 5T3TA 5K0IA 1NLXA 3AGTA 1U6HA 2A0BA 5E3CA 3UMHA 5B3SC 2XXAB 4XPXA 3JYYA 2FGYA 2Q4FA 4K7BA 5FCLA 3GORA 3LLKA 2WVQA 4MVZA 5BQHA 4CDYA 5L0FA 2W4MA 4I1MA 4BG0A 4HFFB 1TWGA 1ORJA 4K1OA 4BJ6A 4FAPB 4EKWA 4O79A 1GQAA 3W8IA 4U9DA 2LK4A 3EH2A 2NSFA 3K1IC 3R7CA 1LS1A 3ZQYA 3LNMB 3AQBA 5CIVA 3EHNA 2HJMA 1BR2A 3HKKA 2OCCC 2GA0A 1ZU4A 3JRTA 2AP3A 3FMSA 4JKVA 5AGFA 3E70C 2H8AA 3NKDA 2I8BA 4DRHB 2A6EF 3SXZA 3N24A 3EGXA 4NTFA 3LNRA 4JJFA 4YL0A 2MHRA 2PBEA 3CSKA 2VASA 2XS1A 5DQTA 1MMGA 1YZCA 2IXPA 2KK1A 3CAXA 4G78A 3M4BA 4N6HA 4MVSA 4X0RA 5A6JA 4FX5A 1BDJB 3C7JA 1LIHA 3EGXB 2G62A 3EG9B 4IAOA 4JJGA 4CIPA 2RD9A 5A6KA 5L0HA 2KQ9A 3GM2A 4YJWA 1FFTC 4IWBA 2NUPB 3TQOA 4OD5A 2CYDA 4J7YA 1OXKA 4NY3A 3EZIA 4O7GA 4OIPF 3JRMO 4I1OB 4DOZA 4D4NA 256BA 1K04A 2F22A 4ONSA 2IXOA 3TJ5A 1V4AA 3R2PA 1TFOB 4JIOA 4WGYA 2A69F 4EWCA 2J9WA 2R25A 4U5CE 1SYQA 4JTDB 4LERA 3C8GD 2C04A 2PX3A 2XSEA 3JZ0A 3B0VC 1ZHYA 4E7ZA 1D1AA 4O6NA 3FAJA 2H7OA 4JW1A 1MQVA 4NTAA 5E33A 3JT1A 4E7SA 2YL7A 4U5DE 3ASOC 3E9VA 2B0JA 5L3QA 5CI8A 2R7WA 2JD3A 2UUHA 2YRFA 3C8GA 5L3VA 5A6BA 3SP1A 3H2VA 2A6HF 4CSAA 4PFPA 3T4RA 1IZMA 2NG1A 1AUEA 3MBGA 2GAQA 2ICWG 2E87A 1G4US 4N4WA 4XEVA 5T3WA 2IYLD 4YT8A 2P61A 2YKZA 4CS9A 3KKBA 4NTBA 1PD1A 4KI2A 3RQGA 1LKXA 2Q9BA 4EBJA 2YHSA 3GEHA 3IPMO 4MVOA 3DI5A 3FAPB 4MTFA 2IOQA 2EPOA 4LACB 4O6MA 3UNGC 5A6BD 3NMKA 2OEVA 2L6GA 1FFHA 3Q7LA 2EPLX 3QW1A 2OQMA 3RQEA 5KYXB 5A6AA 3FHDA 4U5BE 5EHHA 1JAFA 2Y3GA 4PJMA 1H9GA 2DGJA 2P7VA 1HE1A 1HMDA 3EPVA 3HNJA 5COGA 1RKEB 4J30B 3S0XA 4C7OA 2HKVA 3OWTA 4LLCA 4MW8A 3LS1A 1LPEA 3ASNC 1ORYA 3ZWIA 3ITFA 4OIQF 3HLZA 3VF0A 3ATPA 1YLMA 1LI7A 3M79A 2DYRC 2KNHA 1ZW2A 2QLAA 2WB7A 1FMVA 2L6HA 2J9UA 2MYSA 4PK4A 1CPRA 1CPQA 2NUTB 2CGEA 1ZHXA 4IRUA 4PJJA 1S05A 3K6BA 4WJ0A 1LVKA 3KL4A 4OINF 1B68A 3UR3C 3UMKA 2FFHA 1M2VA 4E0HA 4F4BA 1OCOC 1R4TA 2J7PD 3DAGA 2PNOA 4N6CA 2G3VA 4RDAA 4W8KA 3NRHA 1D0ZA 4JZAA 2YL0A 4C3DA 3KH2A 2YLIA 3LS0A 3DD7A 1DOVA 5EGYA 1A0BA 1VK5A 1Z7Qc 3U0CA 2HZ8A 4DBQA 3S28A 2J0WA 3U9MA 2HV6A 2W4BA 3M1CB 3O55A 1Q0GA 1UG7A 2EIKC 1WASA 3VRCA 2VC9A 3RQFA 1ZYRF 1APCA 3SZRA 3LUTB 3WAQA 3QTHA 4D4XA 4HFKB 2HSQA 2YL3A 1L7CA 3L8JA 2LIGA 1FTSA 2L7AA 3DE9A 5DQZA 4CS9C 3DAFA 4U5HA 2O9XA 3W2VA 5JLIA 2V3CC 1U0BB 2R7TA 1RJ9B 3M15A 4XLPF 3GM1A 4XTKA 2FAPB 2KYHA 2CNWD 2PF4E 4YL1A 2VCAA 5F5FA 3EGDA 4G0HA 4ANJA 2Q00A 2XLVA 1U89A 3N0TA 5AC4A 3W2WA 1VLTA 2XLEA 1YJGA 1G4WR 2L81A 3B0UX 4MW3A 1YYXA 2XLDA 4K0DA 1TR2A 5B1AC 4RD9A 2W9YA 4IGGA 1GS9A 1WWPA 2Y3BA 4H4KC 2P6VA 2LSEA 5L0GA 3V7OA 3S9OA 2L9JA 4U5GA 3MX3A 2XLWA 3ZQVA 3Q6NA 4EHPA 1MNEA 1E85A 2NUPA 3AG4C 3OA1A 3DM9B 4IARA 2R7QA 1WN0A 3U8VA 1TWCA 2WL8A 1ZVZA 3JSZA 1H6GA 1HE9A 2J9BA 1AVOB 3G50A 3U9JA 4GEHA 1AEPA 4JTCB 2ZD9A 3AG1C 3RKOF 4BPMA 2OEXA 2D4UA 3I4UA 4QDLA 2J0XA 1RCPA 3AG2C 3U2LA 1D1BA 4KNVA 2AVKA 2Q9AA 2QE9A 2IM8A 2QTVA 4Q7CA 1JRAA 1TWAA 3EZHA 1A7VA 1K40A 3G4ZA 3I5QA 4EBKA 3V5YA 3TD7A 2OG2A 2EIMC 2RSEB 4NCQA 4EBBA 2OJQA 1Z5ZA 1NG1A 4OIOF 1FR0A 3ECSA 3AGUA 1A41A 3T6JA 1Z6AA 4Z9IA 5BUOA 5IY5C 4AK9A 1A7DA 4CBEA 2OJED 4RBNA 4Z9HA 3TOMA 1E84A 4IAQA 3W8HA 4MQ9F 4BJ1A 4MVMA 2XXAA 1OR2A 1NU9C 2UUIA 5D91A 1ZZPA 3W4YA 4I3MA 3N2ZB 1V74B 3IQ5A 1JPJA 3L0IA 4U9EA 3NG1A 2TMVP 4XQ1A 2Q7RA 1CGNA 3F47A 2XM4A 1MMDA 4XWJA 1BZ4A 2ZXWC 3FXHA 5BQGA 4AL0A 3O39A 3IQTA 2A0UA 1O87A 3JCUQ 2A1DD 1DOWA 4JCHA 3DZAA 4W8PA 3S29A 1G8XA 2XM0A 4OIRF 3NYJA 4KBLA 2L6FA 1NFOA 3U5SA 1VB5A 1Y4CA 1I4YA 1YVIA 2EPKX 1MMNA 1V54C 2LD6A 3K7DA 3ABKC 2Y3DA 2DB4A 1V55C 1PV3A 3FVYA 1C17M 2IBFA 5HSWA 4A4AA 4DXWA 2OOCA 1UFBA 4JE9A 1BR1A 2HJ3A 1YZAA 4CJGA 1R5ID 1HW2A 1W2WA 2BE5F 3NYMA 1Q0KA 1HW1A 4AE4A 1MMAA 3G4XA 4YT2A 4BEJA 1EI7A 1N1CA 2XL6A 2GDCA 3ABLC 3L1MA 4JCZA 1VMAA 3T6GB 4BJ5A 2VH3A 3NMJA 2D5RB 1OKKA 1RKCA 2KJGA 2P1AA 4JRZA 3WHNA 2R03A 3U3BA 4CX9A 2HUJA 2KC3A 2Q3TA 3WG7C 1OW6A 4KNWA 3C63A 2YEVA 4AX2A 4EIYA 3L8IA 2YLDA 4MVQA 3EQLF 3C8ZA 4LDQA 2NSGA 4MTOA 3POVA 3RH3A 1CGOA 1GGQA 1LI5A 3B9QA 4C3BA 1NU7D 4ULWA 4JVSA 4PACA 4EUKB 1NSGB 2Z15A 2YVKA 2VCBA 3QVYA 3TOLA 2WZGA 1LE4A 1T01A 2XL4A 3T6BA 3CQZA 5KYYB 5KYWB 2I15A 5FZTA 3NDBB 2YQYA 3RW0A 4J32B 4XPYA 5E3AA 3SNHA 4CS8C 3ZTMA 5B3IA 1Z63A 2NUTA 3EGDB 2EPMX 4YT4A 2EPNA 3DKAA 3KPHA 1XZPA 1OCZC 3B29A 3U2MA 2J8WA 4G7HF 4Q5SF 3WODF 2CNWA 2OKUA 3J06A 3ZG1A 1WGWA 1SR2A 4DVZA 3C8GB 2X51A 3GEEA 3NKEA 1E83A 3FOPA 1LM3B 2G3KA 4BJTA 3ZIBA 5JUAA 3DMDA 4GQHA 3RVZA 1YA7O 3CEXA 2WVOA 3V5ZA 5AC5A 3HNIA 3LJBA 2LFFA 1IW7F 4UDVA 3V5XA 2W45A 1CGME 1VYIA 3TJ6A 1Q0MA 5JRAA 1ORSC 3KYIA 2R7OA 5JSLA 2R9RB 3TK0A 3KYJA 1OW8A 4R32A 2VB6A 4XEFA 5DLJA 3MYIA 3F46A 4WGZA 2EINC 3BEHA 4XLNF 2B0HA 3O10A 2KGOA 3US6A 4ZLCA 1OW7A 5EK0A 4Q4ZF 1YARO 1YAUO 2XLMA 2XLHA 3PHF2 1T6IA 4C7OB 1NFNA 2PP4A 1M2VB 2QNLA 3DE8A 3ZTZA 5F5HA 5DS6A 1TFKB 2BL2A 4YT5A 2GFHA 5KYUB 4MS2A 2HSBA 4CS7A 1K05A 3C18A 1C03A 3U8PA 4I44A 4BEMJ 1Q0FA 2R7XA 2YWAA 3EG9A 3LEOA 5HV9A 1E2XA 1QPUA 3AG3C 3B71A 4PFOA 5B1BC 3QZCA 4YN0B 2LP4A 3RVYA 4MNDA 4DJ9A 3QVZA 3GWLA 1OXBA 5CI9A 1J8MF 5DS5A 1BBHA 2CCYA 1ZHWA 2MWQA 1I4ZA 2XRHA 3K33A 4P9TA 1OQCA 2ETSA 1ZW3A 2R05A 3S27A 1TWHA 4E0IA 5KYUA 1VTMP 3LLIA 3U3FA 2Y39A 2HFIA 4B6IA 1XZQA 2Y3HA 3DJUB 3IHUA 3UGPA 3PMRA 1MNDA 2ZXRA 1FAPB 1OCCC 5DVWA 4FWVA 2OU6A 3X2QC 3MLGA 4BJ6C 3QW0A 1H9TA 2GWWA 4LDRA 1PCXA 1T6UA 3ZDLA 1JOGA 3K1IA 2HMZA 1QVXA 1Z23A 3AJMA 1M56C 4ULVA 1Z3IX 2AWYA 1T9KA 2HV7A 3UGOA 1HMOA 1VYKA 2DYSC 3HJCA 2CW0F 1M57C 1LS4A 3EJNA
chains in the Genus database with same CATH topology
1JRAA 3O55A 3U2MA 4E0IA 4LDKA 3U5SA 1JR8A 3GWLA 3W4YA 3LLIA 4E0HA 3GWNA 3TK0A 3TD7A 3MBGA 3R7CA 3U2LA 1OQCA 2HJ3A 3LLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRA A;  3O55 A;  3U2M A;  4E0I A;  4LDK A;  3U5S A;  1JR8 A;  3GWL A;  3W4Y A;  3LLI A;  4E0H A;  3GWN A;  3TK0 A;  3TD7 A;  3MBG A;  3R7C A;  3U2L A;  1OQC A;  2HJ3 A;  3LLK A; 
#chains in the Genus database with same CATH topology
 1I5N A;  3A9C A;  1M2O A;  3EH1 A;  2H7V C;  1EKY A;  2EIL C;  2WVN A;  3Q7G A;  4AL1 A;  1G5Z A;  3FDQ A;  3HNL A;  4CDV A;  1KTM A;  4ER9 A;  2IXN A;  5KYX A;  1E86 A;  3PDM P;  3I5P A;  1NBB A;  2LFD A;  2HS5 A;  3K1H A;  2R7V A;  3H2U A;  1QQ3 A;  3HTK C;  4P9F A;  4E18 A;  2AWC A;  4Z9J A;  2J7P A;  1D0X A;  2NPU A;  4PJL A;  1QSP A;  5JS5 A;  1TQG A;  1M6T A;  4LLE A;  1RKE A;  1JMW A;  1XWJ A;  1TKN A;  1QZX A;  3JSE O;  4M63 A;  3X1O A;  4DRJ B;  1Q0D A;  4O6Y A;  5KYY A;  1JPN A;  3DXJ F;  1KU2 A;  3EHM A;  4YWQ A;  1YA9 A;  1EQ1 A;  2JPU A;  3GEI A;  4JC7 A;  4NQF A;  4WAB A;  1ZHZ A;  2YL1 A;  4P6I C;  5COM A;  4CS8 A;  3BRJ A;  3NMI A;  4L6R A;  5KYW A;  3FOO A;  2V26 A;  2LQG A;  3MYF A;  5T1D B;  4G7Z F;  1T5O A;  1FMW A;  3SXK A;  2PX0 A;  3Q6M A;  2ZXP A;  1O5H A;  3UMI A;  3ZSU A;  2EIJ C;  5A69 A;  5L0C A;  1FNT c;  2R7R A;  3LES A;  3VAY A;  5D92 A;  3RF3 A;  2CDQ A;  4MTG A;  3SXY A;  1S7Z A;  4JUR I;  5COF A;  4JTA B;  3SEO A;  3T9O A;  3M4C A;  3AOU A;  1QKR A;  5L0J A;  2WZL A;  4GYT A;  2R7S A;  1OR3 A;  3JYH A;  3DWW A;  2QUP A;  2XS8 A;  3OEO A;  4DVY P;  2J46 A;  2DI3 A;  2X0C A;  5JT4 A;  4QI2 A;  2M64 A;  2KSF A;  1YDI A;  2M4E A;  2HMQ A;  4HE8 D;  2IXM A;  3SXM A;  5L0D A;  1WTY A;  4ZLD A;  4DBR A;  3MFN A;  4A2N B;  2BC5 A;  1O3U A;  4YK5 A;  5E2Q A;  1PD0 A;  4OD4 A;  4U5E E;  3HNK A;  4U5F E;  1SMY F;  3LAY A;  3RYL A;  2Y69 C;  1BR4 A;  4CDA A;  2Q9C A;  3RIP A;  1SF8 A;  5DS4 A;  3LEV A;  3EFO B;  5F28 E;  3GM3 A;  3AQC A;  2WZF A;  1VOM A;  4BJ5 C;  1RJ9 A;  3K66 A;  4E17 A;  1WAT A;  1ZU5 A;  5JP7 A;  4PJN A;  2LCH A;  2YZS A;  2ZPA A;  4MVU A;  3RFY A;  1SZI A;  3H65 A;  3EFO A;  2XLO A;  2H7B A;  1HY5 A;  1T6Q A;  3GWN A;  5L0I A;  1D0Y A;  1RMV A;  4XEK A;  4CSA C;  2J9V A;  2P0N A;  3CZ6 A;  4IJJ A;  5KYN A;  4KC9 A;  4C3E A;  1RXQ A;  2A68 F;  1YYJ A;  4LDK A;  2R7U A;  3GAN A;  1C02 A;  4AE4 B;  1ST6 A;  3IEE A;  5JVE A;  2J45 A;  1VLS A;  1GM5 A;  4HEA J;  1EA8 A;  3NYL A;  4MVR A;  3SYN A;  1D1C A;  3DM5 A;  5TJ5 E;  3JTL O;  1WOL A;  4IB4 A;  1KNY A;  4PR9 A;  4CJO A;  3VM6 A;  3O6X A;  1L3P A;  2C03 A;  2XL8 A;  2KW3 C;  3IQC A;  3QMK A;  4H54 A;  1J8Y F;  2VCC A;  3DJN B;  2PFD A;  3GOD A;  2R02 A;  3S84 A;  3B0P A;  3ZVR A;  1ZHT A;  4FES A;  4QI0 A;  4N06 A;  1QLE C;  3VYW A;  1OCR C;  4CIH A;  3S90 A;  4G7O F;  3ABM C;  5BQI A;  1NZE A;  1Y6D A;  1LE2 A;  2ZXO A;  4XPW A;  5GPG B;  1H7I A;  1F1M A;  3KMI A;  1A7E A;  4NC3 A;  1OKK D;  1JR8 A;  3A11 A;  3PCV A;  4J7T A;  2AU5 A;  2QY9 A;  4JEA A;  4JEB A;  3IQ6 A;  3L34 A;  2ASR A;  3C62 A;  2YLG A;  3ZC4 A;  3TUL A;  4YL3 A;  4DRI B;  2JX0 A;  5T3T A;  5K0I A;  1NLX A;  3AGT A;  1U6H A;  2A0B A;  5E3C A;  3UMH A;  5B3S C;  2XXA B;  4XPX A;  3JYY A;  2FGY A;  2Q4F A;  4K7B A;  5FCL A;  3GOR A;  3LLK A;  2WVQ A;  4MVZ A;  5BQH A;  4CDY A;  5L0F A;  2W4M A;  4I1M A;  4BG0 A;  4HFF B;  1TWG A;  1ORJ A;  4K1O A;  4BJ6 A;  4FAP B;  4EKW A;  4O79 A;  1GQA A;  3W8I A;  4U9D A;  2LK4 A;  3EH2 A;  2NSF A;  3K1I C;  3R7C A;  1LS1 A;  3ZQY A;  3LNM B;  3AQB A;  5CIV A;  3EHN A;  2HJM A;  1BR2 A;  3HKK A;  2OCC C;  2GA0 A;  1ZU4 A;  3JRT A;  2AP3 A;  3FMS A;  4JKV A;  5AGF A;  3E70 C;  2H8A A;  3NKD A;  2I8B A;  4DRH B;  2A6E F;  3SXZ A;  3N24 A;  3EGX A;  4NTF A;  3LNR A;  4JJF A;  4YL0 A;  2MHR A;  2PBE A;  3CSK A;  2VAS A;  2XS1 A;  5DQT A;  1MMG A;  1YZC A;  2IXP A;  2KK1 A;  3CAX A;  4G78 A;  3M4B A;  4N6H A;  4MVS A;  4X0R A;  5A6J A;  4FX5 A;  1BDJ B;  3C7J A;  1LIH A;  3EGX B;  2G62 A;  3EG9 B;  4IAO A;  4JJG A;  4CIP A;  2RD9 A;  5A6K A;  5L0H A;  2KQ9 A;  3GM2 A;  4YJW A;  1FFT C;  4IWB A;  2NUP B;  3TQO A;  4OD5 A;  2CYD A;  4J7Y A;  1OXK A;  4NY3 A;  3EZI A;  4O7G A;  4OIP F;  3JRM O;  4I1O B;  4DOZ A;  4D4N A;  256B A;  1K04 A;  2F22 A;  4ONS A;  2IXO A;  3TJ5 A;  1V4A A;  3R2P A;  1TFO B;  4JIO A;  4WGY A;  2A69 F;  4EWC A;  2J9W A;  2R25 A;  4U5C E;  1SYQ A;  4JTD B;  4LER A;  3C8G D;  2C04 A;  2PX3 A;  2XSE A;  3JZ0 A;  3B0V C;  1ZHY A;  4E7Z A;  1D1A A;  4O6N A;  3FAJ A;  2H7O A;  4JW1 A;  1MQV A;  4NTA A;  5E33 A;  3JT1 A;  4E7S A;  2YL7 A;  4U5D E;  3ASO C;  3E9V A;  2B0J A;  5L3Q A;  5CI8 A;  2R7W A;  2JD3 A;  2UUH A;  2YRF A;  3C8G A;  5L3V A;  5A6B A;  3SP1 A;  3H2V A;  2A6H F;  4CSA A;  4PFP A;  3T4R A;  1IZM A;  2NG1 A;  1AUE A;  3MBG A;  2GAQ A;  2ICW G;  2E87 A;  1G4U S;  4N4W A;  4XEV A;  5T3W A;  2IYL D;  4YT8 A;  2P61 A;  2YKZ A;  4CS9 A;  3KKB A;  4NTB A;  1PD1 A;  4KI2 A;  3RQG A;  1LKX A;  2Q9B A;  4EBJ A;  2YHS A;  3GEH A;  3IPM O;  4MVO A;  3DI5 A;  3FAP B;  4MTF A;  2IOQ A;  2EPO A;  4LAC B;  4O6M A;  3UNG C;  5A6B D;  3NMK A;  2OEV A;  2L6G A;  1FFH A;  3Q7L A;  2EPL X;  3QW1 A;  2OQM A;  3RQE A;  5KYX B;  5A6A A;  3FHD A;  4U5B E;  5EHH A;  1JAF A;  2Y3G A;  4PJM A;  1H9G A;  2DGJ A;  2P7V A;  1HE1 A;  1HMD A;  3EPV A;  3HNJ A;  5COG A;  1RKE B;  4J30 B;  3S0X A;  4C7O A;  2HKV A;  3OWT A;  4LLC A;  4MW8 A;  3LS1 A;  1LPE A;  3ASN C;  1ORY A;  3ZWI A;  3ITF A;  4OIQ F;  3HLZ A;  3VF0 A;  3ATP A;  1YLM A;  1LI7 A;  3M79 A;  2DYR C;  2KNH A;  1ZW2 A;  2QLA A;  2WB7 A;  1FMV A;  2L6H A;  2J9U A;  2MYS A;  4PK4 A;  1CPR A;  1CPQ A;  2NUT B;  2CGE A;  1ZHX A;  4IRU A;  4PJJ A;  1S05 A;  3K6B A;  4WJ0 A;  1LVK A;  3KL4 A;  4OIN F;  1B68 A;  3UR3 C;  3UMK A;  2FFH A;  1M2V A;  4E0H A;  4F4B A;  1OCO C;  1R4T A;  2J7P D;  3DAG A;  2PNO A;  4N6C A;  2G3V A;  4RDA A;  4W8K A;  3NRH A;  1D0Z A;  4JZA A;  2YL0 A;  4C3D A;  3KH2 A;  2YLI A;  3LS0 A;  3DD7 A;  1DOV A;  5EGY A;  1A0B A;  1VK5 A;  1Z7Q c;  3U0C A;  2HZ8 A;  4DBQ A;  3S28 A;  2J0W A;  3U9M A;  2HV6 A;  2W4B A;  3M1C B;  3O55 A;  1Q0G A;  1UG7 A;  2EIK C;  1WAS A;  3VRC A;  2VC9 A;  3RQF A;  1ZYR F;  1APC A;  3SZR A;  3LUT B;  3WAQ A;  3QTH A;  4D4X A;  4HFK B;  2HSQ A;  2YL3 A;  1L7C A;  3L8J A;  2LIG A;  1FTS A;  2L7A A;  3DE9 A;  5DQZ A;  4CS9 C;  3DAF A;  4U5H A;  2O9X A;  3W2V A;  5JLI A;  2V3C C;  1U0B B;  2R7T A;  1RJ9 B;  3M15 A;  4XLP F;  3GM1 A;  4XTK A;  2FAP B;  2KYH A;  2CNW D;  2PF4 E;  4YL1 A;  2VCA A;  5F5F A;  3EGD A;  4G0H A;  4ANJ A;  2Q00 A;  2XLV A;  1U89 A;  3N0T A;  5AC4 A;  3W2W A;  1VLT A;  2XLE A;  1YJG A;  1G4W R;  2L81 A;  3B0U X;  4MW3 A;  1YYX A;  2XLD A;  4K0D A;  1TR2 A;  5B1A C;  4RD9 A;  2W9Y A;  4IGG A;  1GS9 A;  1WWP A;  2Y3B A;  4H4K C;  2P6V A;  2LSE A;  5L0G A;  3V7O A;  3S9O A;  2L9J A;  4U5G A;  3MX3 A;  2XLW A;  3ZQV A;  3Q6N A;  4EHP A;  1MNE A;  1E85 A;  2NUP A;  3AG4 C;  3OA1 A;  3DM9 B;  4IAR A;  2R7Q A;  1WN0 A;  3U8V A;  1TWC A;  2WL8 A;  1ZVZ A;  3JSZ A;  1H6G A;  1HE9 A;  2J9B A;  1AVO B;  3G50 A;  3U9J A;  4GEH A;  1AEP A;  4JTC B;  2ZD9 A;  3AG1 C;  3RKO F;  4BPM A;  2OEX A;  2D4U A;  3I4U A;  4QDL A;  2J0X A;  1RCP A;  3AG2 C;  3U2L A;  1D1B A;  4KNV A;  2AVK A;  2Q9A A;  2QE9 A;  2IM8 A;  2QTV A;  4Q7C A;  1JRA A;  1TWA A;  3EZH A;  1A7V A;  1K40 A;  3G4Z A;  3I5Q A;  4EBK A;  3V5Y A;  3TD7 A;  2OG2 A;  2EIM C;  2RSE B;  4NCQ A;  4EBB A;  2OJQ A;  1Z5Z A;  1NG1 A;  4OIO F;  1FR0 A;  3ECS A;  3AGU A;  1A41 A;  3T6J A;  1Z6A A;  4Z9I A;  5BUO A;  5IY5 C;  4AK9 A;  1A7D A;  4CBE A;  2OJE D;  4RBN A;  4Z9H A;  3TOM A;  1E84 A;  4IAQ A;  3W8H A;  4MQ9 F;  4BJ1 A;  4MVM A;  2XXA A;  1OR2 A;  1NU9 C;  2UUI A;  5D91 A;  1ZZP A;  3W4Y A;  4I3M A;  3N2Z B;  1V74 B;  3IQ5 A;  1JPJ A;  3L0I A;  4U9E A;  3NG1 A;  2TMV P;  4XQ1 A;  2Q7R A;  1CGN A;  3F47 A;  2XM4 A;  1MMD A;  4XWJ A;  1BZ4 A;  2ZXW C;  3FXH A;  5BQG A;  4AL0 A;  3O39 A;  3IQT A;  2A0U A;  1O87 A;  3JCU Q;  2A1D D;  1DOW A;  4JCH A;  3DZA A;  4W8P A;  3S29 A;  1G8X A;  2XM0 A;  4OIR F;  3NYJ A;  4KBL A;  2L6F A;  1NFO A;  3U5S A;  1VB5 A;  1Y4C A;  1I4Y A;  1YVI A;  2EPK X;  1MMN A;  1V54 C;  2LD6 A;  3K7D A;  3ABK C;  2Y3D A;  2DB4 A;  1V55 C;  1PV3 A;  3FVY A;  1C17 M;  2IBF A;  5HSW A;  4A4A A;  4DXW A;  2OOC A;  1UFB A;  4JE9 A;  1BR1 A;  2HJ3 A;  1YZA A;  4CJG A;  1R5I D;  1HW2 A;  1W2W A;  2BE5 F;  3NYM A;  1Q0K A;  1HW1 A;  4AE4 A;  1MMA A;  3G4X A;  4YT2 A;  4BEJ A;  1EI7 A;  1N1C A;  2XL6 A;  2GDC A;  3ABL C;  3L1M A;  4JCZ A;  1VMA A;  3T6G B;  4BJ5 A;  2VH3 A;  3NMJ A;  2D5R B;  1OKK A;  1RKC A;  2KJG A;  2P1A A;  4JRZ A;  3WHN A;  2R03 A;  3U3B A;  4CX9 A;  2HUJ A;  2KC3 A;  2Q3T A;  3WG7 C;  1OW6 A;  4KNW A;  3C63 A;  2YEV A;  4AX2 A;  4EIY A;  3L8I A;  2YLD A;  4MVQ A;  3EQL F;  3C8Z A;  4LDQ A;  2NSG A;  4MTO A;  3POV A;  3RH3 A;  1CGO A;  1GGQ A;  1LI5 A;  3B9Q A;  4C3B A;  1NU7 D;  4ULW A;  4JVS A;  4PAC A;  4EUK B;  1NSG B;  2Z15 A;  2YVK A;  2VCB A;  3QVY A;  3TOL A;  2WZG A;  1LE4 A;  1T01 A;  2XL4 A;  3T6B A;  3CQZ A;  5KYY B;  5KYW B;  2I15 A;  5FZT A;  3NDB B;  2YQY A;  3RW0 A;  4J32 B;  4XPY A;  5E3A A;  3SNH A;  4CS8 C;  3ZTM A;  5B3I A;  1Z63 A;  2NUT A;  3EGD B;  2EPM X;  4YT4 A;  2EPN A;  3DKA A;  3KPH A;  1XZP A;  1OCZ C;  3B29 A;  3U2M A;  2J8W A;  4G7H F;  4Q5S F;  3WOD F;  2CNW A;  2OKU A;  3J06 A;  3ZG1 A;  1WGW A;  1SR2 A;  4DVZ A;  3C8G B;  2X51 A;  3GEE A;  3NKE A;  1E83 A;  3FOP A;  1LM3 B;  2G3K A;  4BJT A;  3ZIB A;  5JUA A;  3DMD A;  4GQH A;  3RVZ A;  1YA7 O;  3CEX A;  2WVO A;  3V5Z A;  5AC5 A;  3HNI A;  3LJB A;  2LFF A;  1IW7 F;  4UDV A;  3V5X A;  2W45 A;  1CGM E;  1VYI A;  3TJ6 A;  1Q0M A;  5JRA A;  1ORS C;  3KYI A;  2R7O A;  5JSL A;  2R9R B;  3TK0 A;  3KYJ A;  1OW8 A;  4R32 A;  2VB6 A;  4XEF A;  5DLJ A;  3MYI A;  3F46 A;  4WGZ A;  2EIN C;  3BEH A;  4XLN F;  2B0H A;  3O10 A;  2KGO A;  3US6 A;  4ZLC A;  1OW7 A;  5EK0 A;  4Q4Z F;  1YAR O;  1YAU O;  2XLM A;  2XLH A;  3PHF 2;  1T6I A;  4C7O B;  1NFN A;  2PP4 A;  1M2V B;  2QNL A;  3DE8 A;  3ZTZ A;  5F5H A;  5DS6 A;  1TFK B;  2BL2 A;  4YT5 A;  2GFH A;  5KYU B;  4MS2 A;  2HSB A;  4CS7 A;  1K05 A;  3C18 A;  1C03 A;  3U8P A;  4I44 A;  4BEM J;  1Q0F A;  2R7X A;  2YWA A;  3EG9 A;  3LEO A;  5HV9 A;  1E2X A;  1QPU A;  3AG3 C;  3B71 A;  4PFO A;  5B1B C;  3QZC A;  4YN0 B;  2LP4 A;  3RVY A;  4MND A;  4DJ9 A;  3QVZ A;  3GWL A;  1OXB A;  5CI9 A;  1J8M F;  5DS5 A;  1BBH A;  2CCY A;  1ZHW A;  2MWQ A;  1I4Z A;  2XRH A;  3K33 A;  4P9T A;  1OQC A;  2ETS A;  1ZW3 A;  2R05 A;  3S27 A;  1TWH A;  4E0I A;  5KYU A;  1VTM P;  3LLI A;  3U3F A;  2Y39 A;  2HFI A;  4B6I A;  1XZQ A;  2Y3H A;  3DJU B;  3IHU A;  3UGP A;  3PMR A;  1MND A;  2ZXR A;  1FAP B;  1OCC C;  5DVW A;  4FWV A;  2OU6 A;  3X2Q C;  3MLG A;  4BJ6 C;  3QW0 A;  1H9T A;  2GWW A;  4LDR A;  1PCX A;  1T6U A;  3ZDL A;  1JOG A;  3K1I A;  2HMZ A;  1QVX A;  1Z23 A;  3AJM A;  1M56 C;  4ULV A;  1Z3I X;  2AWY A;  1T9K A;  2HV7 A;  3UGO A;  1HMO A;  1VYK A;  2DYS C;  3HJC A;  2CW0 F;  1M57 C;  1LS4 A;  3EJN A; 
#chains in the Genus database with same CATH homology
 1JRA A;  3O55 A;  3U2M A;  4E0I A;  4LDK A;  3U5S A;  1JR8 A;  3GWL A;  3W4Y A;  3LLI A;  4E0H A;  3GWN A;  3TK0 A;  3TD7 A;  3MBG A;  3R7C A;  3U2L A;  1OQC A;  2HJ3 A;  3LLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...