3W4YA

Crystal structure of yeast erv1 core
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
113
structure length
113
Chain Sequence
SRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPCNWCAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDGWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Mitochondrial FAD-linked sulfhydryl oxidase ERV1
publication title Crystal structure of yeast Erv1 core
rcsb
source organism Saccharomyces cerevisiae
total genus 40
structure length 113
sequence length 113
chains with identical sequence B, C
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3w4yA01
1JRAA 3GWNA 3O55A 3TK0A 2HJ3A 1OQCA 3GWLA 1JR8A 4LDKA 4E0IA 3U2MA 3W4YA 3LLKA 3MBGA 3R7CA 4E0HA 3U2LA 3LLIA 3TD7A 3U5SA
chains in the Genus database with same CATH superfamily
3ATPA 3MX3A 5KYXB 3WHNA 1RCPA 1ORSC 3HNIA 3FOOA 3KKBA 3N24A 2YL7A 3Q7GA 4U5BE 4E18A 3ABKC 2EILC 4KBLA 2Y69C 3JRTA 4AL1A 2TMVP 4XEVA 3U8PA 3MFNA 1A7VA 2KNHA 4JRZA 4P9FA 4LDQA 1E84A 1E85A 3IQ5A 3N2ZB 4I44A 4IARA 4NQFA 2W4BA 3S29A 2OJQA 3HJCA 1HE9A 3U3FA 3GORA 1KNYA 1V74B 3SEOA 1JMWA 4J32B 2XLEA 3BRJA 3JSEO 3EG9B 2G3KA 1T01A 2R7OA 1Z5ZA 3I4UA 3SXKA 5A6JA 3NDBB 3JT1A 4ONSA 1DOVA 3NYMA 4U5DE 4MTOA 5E3AA 2R7RA 1LE2A 4PJJA 1OXKA 2EPOA 3LNRA 1RKEA 4YT5A 3T6JA 4Q7CA 4CS9A 3JYHA 5L0IA 4I3MA 1OKKD 3MYFA 3IQ6A 3MYIA 4YJWA 4ULWA 3RKOF 4CS8A 5L0JA 3T9OA 3RQGA 3RH3A 1ZU4A 2Z15A 5AGFA 2HUJA 4FX5A 2Q4FA 2J9BA 4U9EA 2W45A 1AUEA 4MVRA 4JJFA 3I5PA 2L6FA 1LPEA 3IQCA 2GA0A 1PCXA 1Z6AA 2PP4A 1BZ4A 3RVZA 5KYUB 3GEHA 2PX3A 2YWAA 2JX0A 2KK1A 3RQFA 2XLMA 3VM6A 4JTAB 2R7SA 2OEXA 3NG1A 1ORYA 2HZ8A 2OEVA 1K05A 3DKAA 3V7OA 1FFHA 2G3VA 2YL1A 2C03A 3JZ0A 3FAPB 5A6AA 1XZQA 2A1DD 2RD9A 2Q9BA 3GEEA 4XTKA 3C18A 1LI5A 3L34A 2CCYA 2DYRC 4AX2A 4BJ6A 3R2PA 4IRUA 2KGOA 4HE8D 4A4AA 3M79A 1EI7A 1V4AA 4CBEA 2CGEA 3HNLA 1OR2A 5COFA 5E33A 3B0UX 3LS0A 4QI0A 1OCRC 1O5HA 3F46A 2H8AA 2C04A 1M57C 4U5EE 2G62A 1C17M 2E87A 1I5NA 1QSPA 3AGUA 4K1OA 4MNDA 4PACA 3NKDA 3EGXA 3L1MA 3T6GB 4WGYA 3TOMA 3SXZA 2EPKX 4RDAA 3DXJF 1H9TA 5BQGA 4PJNA 1L3PA 1JRAA 2YLDA 3G4XA 5JT4A 3M4BA 1YARO 1ZW2A 3GWNA 3K66A 4JIOA 4JURI 5EHHA 1U0BB 3PMRA 2HJ3A 1VK5A 1D1CA 2R02A 2XSEA 4M63A 4DRJB 1J8YF 1FFTC 1TWAA 3S28A 2OJED 1NBBA 2NSGA 4IAOA 5DS5A 2J9UA 2YEVA 1FR0A 3DJNB 1I4ZA 4W8PA 2CW0F 5DS6A 2XS8A 1H6GA 4DJ9A 5HV9A 4D4NA 4CSAA 5L0HA 4LLCA 4JTDB 4DVZA 3GEIA 1T6UA 2EIMC 1FMWA 3HLZA 1MMNA 2J9WA 3HNJA 3S27A 4JC7A 3U3BA 2BL2A 2UUIA 2XM4A 4NTAA 3K1IC 4YT2A 4XLNF 1JOGA 4MVSA 1Z3IX 3LEOA 4O79A 3T4RA 2A69F 1A7EA 2ETSA 3AOUA 2Y3DA 2YRFA 3L8JA 3VYWA 2HSQA 1Y6DA 1RMVA 1A7DA 5DVWA 3TQOA 2EIJC 1ZVZA 3C63A 4LERA 3O55A 2A68F 4AL0A 3RW0A 1O3UA 2Q3TA 2R7VA 2A6HF 3C8ZA 4DRIB 4G7OF 1YJGA 5FZTA 1D0YA 3WODF 4U5GA 3NRHA 1MQVA 4YL0A 3ABMC 2YQYA 4XEFA 2AP3A 5D92A 3EJNA 1PD1A 1LIHA 1OCCC 1Q0KA 2X51A 4O6NA 3W2VA 2D5RB 3W2WA 1GGQA 2XLVA 3M15A 3V5XA 4A2NB 4KNWA 5COMA 5DQZA 2XL4A 3C8GA 1RJ9A 4PR9A 2CNWD 1WTYA 1PV3A 3DE9A 3AG2C 1JAFA 1L7CA 1LE4A 4X0RA 2YLIA 2P7VA 3C7JA 3RVYA 2FFHA 1BR2A 4J7YA 4MW8A 2PFDA 3VAYA 5KYWA 1YYXA 2J7PA 4C7OA 4MVZA 2J7PD 2NUPA 3O39A 3FAJA 2J0XA 4GEHA 1YVIA 3B9QA 3VRCA 5E2QA 2FAPB 4N6CA 3U0CA 3TULA 3W8HA 1VMAA 4OD4A 5JS5A 3L8IA 4LDRA 5GPGB 2A0BA 2L6HA 3BEHA 2WZFA 1FTSA 2KJGA 3NMKA 1O87A 1YZAA 3OEOA 1ZHYA 3U2MA 2MYSA 4Z9JA 3W8IA 1OW8A 1E83A 1OCZC 5DQTA 2HKVA 3TOLA 2YL3A 4OIOF 2R7XA 1SF8A 3A11A 4BPMA 1GM5A 2P6VA 5EGYA 3GM3A 2XLDA 2YVKA 3LESA 4YK5A 3U2LA 5L0CA 4Z9IA 4MTFA 4XPYA 2IXPA 5B1AC 2J45A 2L7AA 4JW1A 4NTFA 4RBNA 3U5SA 2VCAA 4OIPF 2QLAA 1ZYRF 2NUTA 2BC5A 1M2VA 1OKKA 3FDQA 3AG3C 1TKNA 4JKVA 3ZQVA 1IW7F 1Q0GA 1EA8A 1BR1A 2VCBA 4WABA 2EINC 3ZWIA 4Q5SF 4CIHA 1D0XA 3ZVRA 3LLKA 3O6XA 4AE4A 1YLMA 2ZPAA 5AC4A 3PCVA 5FCLA 3N0TA 3KMIA 1WN0A 1D1BA 3FXHA 3EFOB 4I1OB 4CDYA 2R7WA 3CQZA 4CX9A 3R7CA 4BJ5C 3EGDA 4N6HA 4N4WA 4WJ0A 1MMAA 1TWHA 2HMZA 2XLOA 1W2WA 4OINF 2GDCA 3AG4C 1TWCA 2ICWG 2QUPA 3TD7A 1N1CA 2XL8A 3KH2A 4FWVA 4HEAJ 1LKXA 2NSFA 4DRHB 4DXWA 4CJOA 2ZXWC 2ZXRA 4JCZA 1ZU5A 2NPUA 2R05A 3RIPA 1AEPA 1IZMA 1Z7Qc 3EHMA 1HY5A 1C03A 1FMVA 1XZPA 2XXAB 5HSWA 1JPNA 2F22A 2IXMA 2YZSA 2VC9A 2ZXPA 3IQTA 4UDVA 3S9OA 3X1OA 4YT4A 1Y4CA 1VLTA 5K0IA 1H7IA 1V55C 4ZLCA 4ZLDA 1YAUO 1APCA 4MW3A 3IHUA 2L9JA 4XLPF 3QW1A 3C62A 3LNMB 4XPXA 2YL0A 1TFOB 3B0PA 3GODA 3FVYA 2WZLA 4NCQA 5KYXA 5KYYB 4PK4A 2A0UA 3SYNA 4YL1A 3LUTB 4MQ9F 3T6BA 5BQIA 1LS4A 4D4XA 1VYIA 1ZHTA 1CPQA 3JSZA 1J8MF 1ORJA 3C8GB 3SP1A 4JVSA 4EBBA 4EKWA 1FNTc 3FMSA 4JZAA 3U9JA 1OR3A 2H7BA 2EIKC 1MMDA 5COGA 3NKEA 1ZW3A 1OQCA 2NUPB 2LIGA 2GAQA 2KQ9A 4LDKA 4P6IC 5JRAA 4MVOA 4OIRF 3ZTMA 3POVA 1SZIA 1ZHXA 3DAFA 3EG9A 3JTLO 4NTBA 3HTKC 1NFOA 1Q0FA 4QDLA 5T3WA 1YA7O 5A6BA 2RSEB 5A6BD 4EUKB 1QZXA 1WASA 2ASRA 3AJMA 4AK9A 1C02A 4CJGA 3B71A 1QLEC 3K1HA 4RD9A 2LSEA 3K1IA 1GS9A 5A6KA 3DWWA 1VYKA 4U9DA 3IEEA 1K40A 1I4YA 3LEVA 3J06A 4FESA 5L0DA 2OG2A 3QMKA 3QZCA 4DBRA 3KPHA 3E70C 2UUHA 3ECSA 4G78A 2L81A 1D0ZA 1OW7A 1Q0MA 2IYLD 3H65A 1D1AA 5T1DB 3S90A 3Q6NA 2IXNA 2X0CA 3AQCA 3A9CA 4MS2A 4HFFB 3AQBA 2AWCA 2P1AA 2Y3HA 2LCHA 4Z9HA 1EQ1A 2QNLA 4OD5A 1RKEB 2IBFA 4R32A 1M2VB 3EH2A 3UGOA 1WGWA 2NG1A 2WZGA 2Y39A 4YL3A 5B1BC 1LI7A 2CNWA 2OQMA 2YLGA 1Z63A 3DAGA 4CDAA 1PD0A 2H7OA 4MVMA 2VASA 3EZIA 5AC5A 2CYDA 1E2XA 5F5HA 5L0GA 3M1CB 1ZZPA 1VTMP 1BBHA 2MHRA 1TFKB 3B29A 1VB5A 3WG7C 4F4BA 1NZEA 1R4TA 3SXYA 3WAQA 2ZD9A 3SZRA 4CIPA 3AGTA 2DI3A 2EPMX 2PBEA 2XL6A 2OU6A 1NU9C 2ZXOA 3U8VA 2VH3A 1M6TA 4IB4A 5T3TA 5B3IA 2V3CC 3KYJA 1TQGA 4IGGA 1H9GA 2LD6A 3TJ5A 5L0FA 4BJ1A 3JCUQ 3F47A 4XWJA 2R03A 1HW1A 5JP7A 2HV6A 5CI9A 4K7BA 4N06A 3CAXA 3S84A 2A6EF 3RFYA 2WL8A 3FOPA 3ZG1A 4EIYA 1S7ZA 2P0NA 3MLGA 2Q9CA 2DB4A 1T6IA 2WVNA 3U9MA 3UNGC 2EPNA 3H2UA 2GFHA 1MNDA 1YZCA 3EH1A 2WVQA 3O10A 1DOWA 4BJTA 1MNEA 2I8BA 3B0VC 5F5FA 1JPJA 1HE1A 1QPUA 2B0JA 2YKZA 3H2VA 4CS7A 4U5FE 1OW6A 3EPVA 2IXOA 4JE9A 3V5ZA 3UGPA 1F1MA 3ASNC 2W9YA 1YDIA 4O6MA 3DE8A 1LVKA 2R7UA 5CI8A 4XQ1A 3UMKA 5F28E 3S0XA 4E7ZA 2AU5A 3DZAA 3GWLA 1SMYF 3EGXB 4J30B 4CDVA 3NYJA 2KW3C 2XM0A 4C3EA 1T5OA 1TWGA 2FGYA 3KYIA 4O6YA 3W4YA 3X2QC 4YN0B 3LJBA 4E7SA 3LS1A 4P9TA 4Q4ZF 3ZQYA 1B68A 1QVXA 1HMDA 3JYYA 4DVYP 1HW2A 5BQHA 2QY9A 1YA9A 2GWWA 3DD7A 1QKRA 3VF0A 2EPLX 5L3QA 3CSKA 4U5HA 2R25A 3DMDA 3Q7LA 2DGJA 4BJ5A 1WATA 3PHF2 1RXQA 1BDJB 3HNKA 2B0HA 3JRMO 2KSFA 2XS1A 4G7HF 4CS9C 4W8KA 4IWBA 3ZC4A 1CGME 1KTMA 2QE9A 1KU2A 1LM3B 3UMHA 2YHSA 5JVEA 4CS8C 4XPWA 3TK0A 2PNOA 2LP4A 4JEBA 4DBQA 1JR8A 3HKKA 4GQHA 3G4ZA 1MMGA 1UG7A 2J46A 2J8WA 3EHNA 3GM2A 3US6A 4U5CE 3ABLC 5KYNA 1CPRA 1VLSA 4MTGA 1YYJA 4EWCA 5JSLA 1U89A 1Z23A 1Q0DA 2AVKA 2O9XA 3DM5A 3QVYA 4JEAA 1SR2A 2JD3A 2OKUA 3UMIA 4WGZA 2QTVA 3FHDA 4IAQA 4KC9A 1R5ID 2LFFA 4EBJA 4G7ZF 3LLIA 4XEKA 5D91A 2BE5F 1M56C 1WOLA 1ZHWA 2IOQA 1RJ9B 3M4CA 2R7TA 3CEXA 3OA1A 1LS1A 2J0WA 2W4MA 4JCHA 5TJ5E 5JLIA 3PDMP 4BJ6C 5CIVA 3K7DA 3RQEA 1M2OA 4H54A 4LLEA 4BEJA 4EHPA 1ST6A 5KYWB 4C7OB 2KC3A 2HS5A 1RKCA 3KL4A 1NFNA 2DYSC 1T9KA 3QTHA 4HFKB 1G5ZA 1OXBA 3AG1C 2R7QA 3QVZA 3NMIA 3EQLF 1FAPB 4BG0A 3DI5A 4ANJA 1NSGB 2R9RB 2WB7A 1G8XA 5EK0A 3EZHA 4B6IA 1U6HA 2AWYA 1ZHZA 2M4EA 2MWQA 4BEMJ 2VCCA 4E0HA 3ZIBA 1A41A 1UFBA 1NG1A 4PJLA 3V5YA 3ASOC 4IJJA 4KI2A 4PFPA 4QI2A 1CGNA 4MVQA 2HV7A 4DOZA 3TJ6A 1CGOA 4LACB 1S05A 2XRHA 2D4UA 2H7VC 1GQAA 5IY5C 3RYLA 1NU7D 4NC3A 3EFOA 1WWPA 4G0HA 2L6GA 1A0BA 4K0DA 256BA 2LQGA 2WVOA 3ITFA 1K04A 3L0IA 3G50A 4CSAC 5KYUA 1OCOC 2VB6A 3IPMO 3OWTA 5L3VA 3SXMA 1EKYA 3K6BA 1G4US 1HMOA 2LFDA 2NUTB 5E3CA 3CZ6A 1V54C 1QQ3A 1XWJA 4JJGA 1T6QA 2CDQA 2HMQA 4J7TA 5B3SC 2Q7RA 4NY3A 3LAYA 4ER9A 3RF3A 4L6RA 2JPUA 1NLXA 3SNHA 4ULVA 1VOMA 2I15A 2KYHA 3DM9B 3GM1A 4AE4B 2XXAA 4C3BA 3ZTZA 4YWQA 3NYLA 1AVOB 2V26A 4PFOA 3ZDLA 5JUAA 5DLJA 2HJMA 3DJUB 3EGDB 4O7GA 3QW0A 4I1MA 4YT8A 5BUOA 1TR2A 5KYYA 2PF4E 4OIQF 2Y3BA 3Q6MA 5A69A 3E9VA 4E0IA 2M64A 3GANA 1E86A 3ZSUA 4MVUA 3MBGA 2IM8A 2J9VA 4KNVA 3I5QA 2Q00A 2P61A 4PJMA 4C3DA 3C8GD 1G4WR 1BR4A 2PX0A 4GYTA 2OCCC 3K33A 4H4KC 1SYQA 2LK4A 4FAPB 5DS4A 2OOCA 2Q9AA 4EBKA 2HSBA 2XLWA 4JTCB 4E17A 2XLHA 2HFIA 2Y3GA 3NMJA 3UR3C
chains in the Genus database with same CATH topology
1JRAA 3GWNA 3O55A 3TK0A 2HJ3A 1OQCA 3GWLA 1JR8A 4LDKA 4E0IA 3U2MA 3W4YA 3LLKA 3MBGA 3R7CA 4E0HA 3U2LA 3LLIA 3TD7A 3U5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRA A;  3GWN A;  3O55 A;  3TK0 A;  2HJ3 A;  1OQC A;  3GWL A;  1JR8 A;  4LDK A;  4E0I A;  3U2M A;  3W4Y A;  3LLK A;  3MBG A;  3R7C A;  4E0H A;  3U2L A;  3LLI A;  3TD7 A;  3U5S A; 
#chains in the Genus database with same CATH topology
 3ATP A;  3MX3 A;  5KYX B;  3WHN A;  1RCP A;  1ORS C;  3HNI A;  3FOO A;  3KKB A;  3N24 A;  2YL7 A;  3Q7G A;  4U5B E;  4E18 A;  3ABK C;  2EIL C;  4KBL A;  2Y69 C;  3JRT A;  4AL1 A;  2TMV P;  4XEV A;  3U8P A;  3MFN A;  1A7V A;  2KNH A;  4JRZ A;  4P9F A;  4LDQ A;  1E84 A;  1E85 A;  3IQ5 A;  3N2Z B;  4I44 A;  4IAR A;  4NQF A;  2W4B A;  3S29 A;  2OJQ A;  3HJC A;  1HE9 A;  3U3F A;  3GOR A;  1KNY A;  1V74 B;  3SEO A;  1JMW A;  4J32 B;  2XLE A;  3BRJ A;  3JSE O;  3EG9 B;  2G3K A;  1T01 A;  2R7O A;  1Z5Z A;  3I4U A;  3SXK A;  5A6J A;  3NDB B;  3JT1 A;  4ONS A;  1DOV A;  3NYM A;  4U5D E;  4MTO A;  5E3A A;  2R7R A;  1LE2 A;  4PJJ A;  1OXK A;  2EPO A;  3LNR A;  1RKE A;  4YT5 A;  3T6J A;  4Q7C A;  4CS9 A;  3JYH A;  5L0I A;  4I3M A;  1OKK D;  3MYF A;  3IQ6 A;  3MYI A;  4YJW A;  4ULW A;  3RKO F;  4CS8 A;  5L0J A;  3T9O A;  3RQG A;  3RH3 A;  1ZU4 A;  2Z15 A;  5AGF A;  2HUJ A;  4FX5 A;  2Q4F A;  2J9B A;  4U9E A;  2W45 A;  1AUE A;  4MVR A;  4JJF A;  3I5P A;  2L6F A;  1LPE A;  3IQC A;  2GA0 A;  1PCX A;  1Z6A A;  2PP4 A;  1BZ4 A;  3RVZ A;  5KYU B;  3GEH A;  2PX3 A;  2YWA A;  2JX0 A;  2KK1 A;  3RQF A;  2XLM A;  3VM6 A;  4JTA B;  2R7S A;  2OEX A;  3NG1 A;  1ORY A;  2HZ8 A;  2OEV A;  1K05 A;  3DKA A;  3V7O A;  1FFH A;  2G3V A;  2YL1 A;  2C03 A;  3JZ0 A;  3FAP B;  5A6A A;  1XZQ A;  2A1D D;  2RD9 A;  2Q9B A;  3GEE A;  4XTK A;  3C18 A;  1LI5 A;  3L34 A;  2CCY A;  2DYR C;  4AX2 A;  4BJ6 A;  3R2P A;  4IRU A;  2KGO A;  4HE8 D;  4A4A A;  3M79 A;  1EI7 A;  1V4A A;  4CBE A;  2CGE A;  3HNL A;  1OR2 A;  5COF A;  5E33 A;  3B0U X;  3LS0 A;  4QI0 A;  1OCR C;  1O5H A;  3F46 A;  2H8A A;  2C04 A;  1M57 C;  4U5E E;  2G62 A;  1C17 M;  2E87 A;  1I5N A;  1QSP A;  3AGU A;  4K1O A;  4MND A;  4PAC A;  3NKD A;  3EGX A;  3L1M A;  3T6G B;  4WGY A;  3TOM A;  3SXZ A;  2EPK X;  4RDA A;  3DXJ F;  1H9T A;  5BQG A;  4PJN A;  1L3P A;  1JRA A;  2YLD A;  3G4X A;  5JT4 A;  3M4B A;  1YAR O;  1ZW2 A;  3GWN A;  3K66 A;  4JIO A;  4JUR I;  5EHH A;  1U0B B;  3PMR A;  2HJ3 A;  1VK5 A;  1D1C A;  2R02 A;  2XSE A;  4M63 A;  4DRJ B;  1J8Y F;  1FFT C;  1TWA A;  3S28 A;  2OJE D;  1NBB A;  2NSG A;  4IAO A;  5DS5 A;  2J9U A;  2YEV A;  1FR0 A;  3DJN B;  1I4Z A;  4W8P A;  2CW0 F;  5DS6 A;  2XS8 A;  1H6G A;  4DJ9 A;  5HV9 A;  4D4N A;  4CSA A;  5L0H A;  4LLC A;  4JTD B;  4DVZ A;  3GEI A;  1T6U A;  2EIM C;  1FMW A;  3HLZ A;  1MMN A;  2J9W A;  3HNJ A;  3S27 A;  4JC7 A;  3U3B A;  2BL2 A;  2UUI A;  2XM4 A;  4NTA A;  3K1I C;  4YT2 A;  4XLN F;  1JOG A;  4MVS A;  1Z3I X;  3LEO A;  4O79 A;  3T4R A;  2A69 F;  1A7E A;  2ETS A;  3AOU A;  2Y3D A;  2YRF A;  3L8J A;  3VYW A;  2HSQ A;  1Y6D A;  1RMV A;  1A7D A;  5DVW A;  3TQO A;  2EIJ C;  1ZVZ A;  3C63 A;  4LER A;  3O55 A;  2A68 F;  4AL0 A;  3RW0 A;  1O3U A;  2Q3T A;  2R7V A;  2A6H F;  3C8Z A;  4DRI B;  4G7O F;  1YJG A;  5FZT A;  1D0Y A;  3WOD F;  4U5G A;  3NRH A;  1MQV A;  4YL0 A;  3ABM C;  2YQY A;  4XEF A;  2AP3 A;  5D92 A;  3EJN A;  1PD1 A;  1LIH A;  1OCC C;  1Q0K A;  2X51 A;  4O6N A;  3W2V A;  2D5R B;  3W2W A;  1GGQ A;  2XLV A;  3M15 A;  3V5X A;  4A2N B;  4KNW A;  5COM A;  5DQZ A;  2XL4 A;  3C8G A;  1RJ9 A;  4PR9 A;  2CNW D;  1WTY A;  1PV3 A;  3DE9 A;  3AG2 C;  1JAF A;  1L7C A;  1LE4 A;  4X0R A;  2YLI A;  2P7V A;  3C7J A;  3RVY A;  2FFH A;  1BR2 A;  4J7Y A;  4MW8 A;  2PFD A;  3VAY A;  5KYW A;  1YYX A;  2J7P A;  4C7O A;  4MVZ A;  2J7P D;  2NUP A;  3O39 A;  3FAJ A;  2J0X A;  4GEH A;  1YVI A;  3B9Q A;  3VRC A;  5E2Q A;  2FAP B;  4N6C A;  3U0C A;  3TUL A;  3W8H A;  1VMA A;  4OD4 A;  5JS5 A;  3L8I A;  4LDR A;  5GPG B;  2A0B A;  2L6H A;  3BEH A;  2WZF A;  1FTS A;  2KJG A;  3NMK A;  1O87 A;  1YZA A;  3OEO A;  1ZHY A;  3U2M A;  2MYS A;  4Z9J A;  3W8I A;  1OW8 A;  1E83 A;  1OCZ C;  5DQT A;  2HKV A;  3TOL A;  2YL3 A;  4OIO F;  2R7X A;  1SF8 A;  3A11 A;  4BPM A;  1GM5 A;  2P6V A;  5EGY A;  3GM3 A;  2XLD A;  2YVK A;  3LES A;  4YK5 A;  3U2L A;  5L0C A;  4Z9I A;  4MTF A;  4XPY A;  2IXP A;  5B1A C;  2J45 A;  2L7A A;  4JW1 A;  4NTF A;  4RBN A;  3U5S A;  2VCA A;  4OIP F;  2QLA A;  1ZYR F;  2NUT A;  2BC5 A;  1M2V A;  1OKK A;  3FDQ A;  3AG3 C;  1TKN A;  4JKV A;  3ZQV A;  1IW7 F;  1Q0G A;  1EA8 A;  1BR1 A;  2VCB A;  4WAB A;  2EIN C;  3ZWI A;  4Q5S F;  4CIH A;  1D0X A;  3ZVR A;  3LLK A;  3O6X A;  4AE4 A;  1YLM A;  2ZPA A;  5AC4 A;  3PCV A;  5FCL A;  3N0T A;  3KMI A;  1WN0 A;  1D1B A;  3FXH A;  3EFO B;  4I1O B;  4CDY A;  2R7W A;  3CQZ A;  4CX9 A;  3R7C A;  4BJ5 C;  3EGD A;  4N6H A;  4N4W A;  4WJ0 A;  1MMA A;  1TWH A;  2HMZ A;  2XLO A;  1W2W A;  4OIN F;  2GDC A;  3AG4 C;  1TWC A;  2ICW G;  2QUP A;  3TD7 A;  1N1C A;  2XL8 A;  3KH2 A;  4FWV A;  4HEA J;  1LKX A;  2NSF A;  4DRH B;  4DXW A;  4CJO A;  2ZXW C;  2ZXR A;  4JCZ A;  1ZU5 A;  2NPU A;  2R05 A;  3RIP A;  1AEP A;  1IZM A;  1Z7Q c;  3EHM A;  1HY5 A;  1C03 A;  1FMV A;  1XZP A;  2XXA B;  5HSW A;  1JPN A;  2F22 A;  2IXM A;  2YZS A;  2VC9 A;  2ZXP A;  3IQT A;  4UDV A;  3S9O A;  3X1O A;  4YT4 A;  1Y4C A;  1VLT A;  5K0I A;  1H7I A;  1V55 C;  4ZLC A;  4ZLD A;  1YAU O;  1APC A;  4MW3 A;  3IHU A;  2L9J A;  4XLP F;  3QW1 A;  3C62 A;  3LNM B;  4XPX A;  2YL0 A;  1TFO B;  3B0P A;  3GOD A;  3FVY A;  2WZL A;  4NCQ A;  5KYX A;  5KYY B;  4PK4 A;  2A0U A;  3SYN A;  4YL1 A;  3LUT B;  4MQ9 F;  3T6B A;  5BQI A;  1LS4 A;  4D4X A;  1VYI A;  1ZHT A;  1CPQ A;  3JSZ A;  1J8M F;  1ORJ A;  3C8G B;  3SP1 A;  4JVS A;  4EBB A;  4EKW A;  1FNT c;  3FMS A;  4JZA A;  3U9J A;  1OR3 A;  2H7B A;  2EIK C;  1MMD A;  5COG A;  3NKE A;  1ZW3 A;  1OQC A;  2NUP B;  2LIG A;  2GAQ A;  2KQ9 A;  4LDK A;  4P6I C;  5JRA A;  4MVO A;  4OIR F;  3ZTM A;  3POV A;  1SZI A;  1ZHX A;  3DAF A;  3EG9 A;  3JTL O;  4NTB A;  3HTK C;  1NFO A;  1Q0F A;  4QDL A;  5T3W A;  1YA7 O;  5A6B A;  2RSE B;  5A6B D;  4EUK B;  1QZX A;  1WAS A;  2ASR A;  3AJM A;  4AK9 A;  1C02 A;  4CJG A;  3B71 A;  1QLE C;  3K1H A;  4RD9 A;  2LSE A;  3K1I A;  1GS9 A;  5A6K A;  3DWW A;  1VYK A;  4U9D A;  3IEE A;  1K40 A;  1I4Y A;  3LEV A;  3J06 A;  4FES A;  5L0D A;  2OG2 A;  3QMK A;  3QZC A;  4DBR A;  3KPH A;  3E70 C;  2UUH A;  3ECS A;  4G78 A;  2L81 A;  1D0Z A;  1OW7 A;  1Q0M A;  2IYL D;  3H65 A;  1D1A A;  5T1D B;  3S90 A;  3Q6N A;  2IXN A;  2X0C A;  3AQC A;  3A9C A;  4MS2 A;  4HFF B;  3AQB A;  2AWC A;  2P1A A;  2Y3H A;  2LCH A;  4Z9H A;  1EQ1 A;  2QNL A;  4OD5 A;  1RKE B;  2IBF A;  4R32 A;  1M2V B;  3EH2 A;  3UGO A;  1WGW A;  2NG1 A;  2WZG A;  2Y39 A;  4YL3 A;  5B1B C;  1LI7 A;  2CNW A;  2OQM A;  2YLG A;  1Z63 A;  3DAG A;  4CDA A;  1PD0 A;  2H7O A;  4MVM A;  2VAS A;  3EZI A;  5AC5 A;  2CYD A;  1E2X A;  5F5H A;  5L0G A;  3M1C B;  1ZZP A;  1VTM P;  1BBH A;  2MHR A;  1TFK B;  3B29 A;  1VB5 A;  3WG7 C;  4F4B A;  1NZE A;  1R4T A;  3SXY A;  3WAQ A;  2ZD9 A;  3SZR A;  4CIP A;  3AGT A;  2DI3 A;  2EPM X;  2PBE A;  2XL6 A;  2OU6 A;  1NU9 C;  2ZXO A;  3U8V A;  2VH3 A;  1M6T A;  4IB4 A;  5T3T A;  5B3I A;  2V3C C;  3KYJ A;  1TQG A;  4IGG A;  1H9G A;  2LD6 A;  3TJ5 A;  5L0F A;  4BJ1 A;  3JCU Q;  3F47 A;  4XWJ A;  2R03 A;  1HW1 A;  5JP7 A;  2HV6 A;  5CI9 A;  4K7B A;  4N06 A;  3CAX A;  3S84 A;  2A6E F;  3RFY A;  2WL8 A;  3FOP A;  3ZG1 A;  4EIY A;  1S7Z A;  2P0N A;  3MLG A;  2Q9C A;  2DB4 A;  1T6I A;  2WVN A;  3U9M A;  3UNG C;  2EPN A;  3H2U A;  2GFH A;  1MND A;  1YZC A;  3EH1 A;  2WVQ A;  3O10 A;  1DOW A;  4BJT A;  1MNE A;  2I8B A;  3B0V C;  5F5F A;  1JPJ A;  1HE1 A;  1QPU A;  2B0J A;  2YKZ A;  3H2V A;  4CS7 A;  4U5F E;  1OW6 A;  3EPV A;  2IXO A;  4JE9 A;  3V5Z A;  3UGP A;  1F1M A;  3ASN C;  2W9Y A;  1YDI A;  4O6M A;  3DE8 A;  1LVK A;  2R7U A;  5CI8 A;  4XQ1 A;  3UMK A;  5F28 E;  3S0X A;  4E7Z A;  2AU5 A;  3DZA A;  3GWL A;  1SMY F;  3EGX B;  4J30 B;  4CDV A;  3NYJ A;  2KW3 C;  2XM0 A;  4C3E A;  1T5O A;  1TWG A;  2FGY A;  3KYI A;  4O6Y A;  3W4Y A;  3X2Q C;  4YN0 B;  3LJB A;  4E7S A;  3LS1 A;  4P9T A;  4Q4Z F;  3ZQY A;  1B68 A;  1QVX A;  1HMD A;  3JYY A;  4DVY P;  1HW2 A;  5BQH A;  2QY9 A;  1YA9 A;  2GWW A;  3DD7 A;  1QKR A;  3VF0 A;  2EPL X;  5L3Q A;  3CSK A;  4U5H A;  2R25 A;  3DMD A;  3Q7L A;  2DGJ A;  4BJ5 A;  1WAT A;  3PHF 2;  1RXQ A;  1BDJ B;  3HNK A;  2B0H A;  3JRM O;  2KSF A;  2XS1 A;  4G7H F;  4CS9 C;  4W8K A;  4IWB A;  3ZC4 A;  1CGM E;  1KTM A;  2QE9 A;  1KU2 A;  1LM3 B;  3UMH A;  2YHS A;  5JVE A;  4CS8 C;  4XPW A;  3TK0 A;  2PNO A;  2LP4 A;  4JEB A;  4DBQ A;  1JR8 A;  3HKK A;  4GQH A;  3G4Z A;  1MMG A;  1UG7 A;  2J46 A;  2J8W A;  3EHN A;  3GM2 A;  3US6 A;  4U5C E;  3ABL C;  5KYN A;  1CPR A;  1VLS A;  4MTG A;  1YYJ A;  4EWC A;  5JSL A;  1U89 A;  1Z23 A;  1Q0D A;  2AVK A;  2O9X A;  3DM5 A;  3QVY A;  4JEA A;  1SR2 A;  2JD3 A;  2OKU A;  3UMI A;  4WGZ A;  2QTV A;  3FHD A;  4IAQ A;  4KC9 A;  1R5I D;  2LFF A;  4EBJ A;  4G7Z F;  3LLI A;  4XEK A;  5D91 A;  2BE5 F;  1M56 C;  1WOL A;  1ZHW A;  2IOQ A;  1RJ9 B;  3M4C A;  2R7T A;  3CEX A;  3OA1 A;  1LS1 A;  2J0W A;  2W4M A;  4JCH A;  5TJ5 E;  5JLI A;  3PDM P;  4BJ6 C;  5CIV A;  3K7D A;  3RQE A;  1M2O A;  4H54 A;  4LLE A;  4BEJ A;  4EHP A;  1ST6 A;  5KYW B;  4C7O B;  2KC3 A;  2HS5 A;  1RKC A;  3KL4 A;  1NFN A;  2DYS C;  1T9K A;  3QTH A;  4HFK B;  1G5Z A;  1OXB A;  3AG1 C;  2R7Q A;  3QVZ A;  3NMI A;  3EQL F;  1FAP B;  4BG0 A;  3DI5 A;  4ANJ A;  1NSG B;  2R9R B;  2WB7 A;  1G8X A;  5EK0 A;  3EZH A;  4B6I A;  1U6H A;  2AWY A;  1ZHZ A;  2M4E A;  2MWQ A;  4BEM J;  2VCC A;  4E0H A;  3ZIB A;  1A41 A;  1UFB A;  1NG1 A;  4PJL A;  3V5Y A;  3ASO C;  4IJJ A;  4KI2 A;  4PFP A;  4QI2 A;  1CGN A;  4MVQ A;  2HV7 A;  4DOZ A;  3TJ6 A;  1CGO A;  4LAC B;  1S05 A;  2XRH A;  2D4U A;  2H7V C;  1GQA A;  5IY5 C;  3RYL A;  1NU7 D;  4NC3 A;  3EFO A;  1WWP A;  4G0H A;  2L6G A;  1A0B A;  4K0D A;  256B A;  2LQG A;  2WVO A;  3ITF A;  1K04 A;  3L0I A;  3G50 A;  4CSA C;  5KYU A;  1OCO C;  2VB6 A;  3IPM O;  3OWT A;  5L3V A;  3SXM A;  1EKY A;  3K6B A;  1G4U S;  1HMO A;  2LFD A;  2NUT B;  5E3C A;  3CZ6 A;  1V54 C;  1QQ3 A;  1XWJ A;  4JJG A;  1T6Q A;  2CDQ A;  2HMQ A;  4J7T A;  5B3S C;  2Q7R A;  4NY3 A;  3LAY A;  4ER9 A;  3RF3 A;  4L6R A;  2JPU A;  1NLX A;  3SNH A;  4ULV A;  1VOM A;  2I15 A;  2KYH A;  3DM9 B;  3GM1 A;  4AE4 B;  2XXA A;  4C3B A;  3ZTZ A;  4YWQ A;  3NYL A;  1AVO B;  2V26 A;  4PFO A;  3ZDL A;  5JUA A;  5DLJ A;  2HJM A;  3DJU B;  3EGD B;  4O7G A;  3QW0 A;  4I1M A;  4YT8 A;  5BUO A;  1TR2 A;  5KYY A;  2PF4 E;  4OIQ F;  2Y3B A;  3Q6M A;  5A69 A;  3E9V A;  4E0I A;  2M64 A;  3GAN A;  1E86 A;  3ZSU A;  4MVU A;  3MBG A;  2IM8 A;  2J9V A;  4KNV A;  3I5Q A;  2Q00 A;  2P61 A;  4PJM A;  4C3D A;  3C8G D;  1G4W R;  1BR4 A;  2PX0 A;  4GYT A;  2OCC C;  3K33 A;  4H4K C;  1SYQ A;  2LK4 A;  4FAP B;  5DS4 A;  2OOC A;  2Q9A A;  4EBK A;  2HSB A;  2XLW A;  4JTC B;  4E17 A;  2XLH A;  2HFI A;  2Y3G A;  3NMJ A;  3UR3 C; 
#chains in the Genus database with same CATH homology
 1JRA A;  3GWN A;  3O55 A;  3TK0 A;  2HJ3 A;  1OQC A;  3GWL A;  1JR8 A;  4LDK A;  4E0I A;  3U2M A;  3W4Y A;  3LLK A;  3MBG A;  3R7C A;  4E0H A;  3U2L A;  3LLI A;  3TD7 A;  3U5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...