3W4YA

Crystal structure of yeast erv1 core
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
113
structure length
113
Chain Sequence
SRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPCNWCAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDGWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial FAD-linked sulfhydryl oxidase ERV1
publication title Crystal structure of yeast Erv1 core
rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 40
structure length 113
sequence length 113
chains with identical sequence B, C
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3w4yA01
3R7CA 3U2LA 3U5SA 3GWNA 3LLKA 2HJ3A 3U2MA 3TK0A 3LLIA 4E0HA 3O55A 3GWLA 3MBGA 3W4YA 1JR8A 1JRAA 4E0IA 3TD7A 4LDKA 1OQCA
chains in the Genus database with same CATH superfamily
3TJ6A 1NFOA 4XQ1A 4BEJA 2EIMC 2R7RA 4XLPF 4LERA 3V5YA 1VYKA 1YA9A 256BA 3TOMA 1GGQA 3K33A 4JW1A 4MVQA 2M4EA 2YHSA 2A6EF 5KYNA 1NZEA 4Z9JA 1Y4CA 1OXBA 4E7ZA 4YT5A 1OXKA 1UFBA 1RCPA 2W45A 3DXJF 4PFPA 1H9TA 2A6HF 2EIJC 2WZFA 1V55C 1PD0A 5DQZA 2CCYA 2NUPA 3GANA 3GM2A 4GEHA 3ZQVA 1PCXA 5EK0A 4FWVA 1O3UA 4W8KA 3JT1A 3C7JA 3M4CA 3SZRA 2P6VA 1I5NA 2H8AA 2QTVA 1YZAA 1Q0GA 3MYIA 5D92A 1JOGA 1JAFA 1BZ4A 1LE4A 3ITFA 3T9OA 3TD7A 3ZTZA 4J30B 5JSLA 5BQGA 4EWCA 1B68A 4U9EA 3CZ6A 1AVOB 2VCCA 3V7OA 2Y3GA 4LLEA 1ZU5A 5CI8A 2ETSA 3RQFA 2J9UA 3NDBB 4FAPB 4BJ5A 2DYSC 4AE4A 3U8PA 4AL0A 2PFDA 4CSAA 2GFHA 3AGUA 2YLDA 3LLKA 4H54A 2L81A 4RD9A 2ASRA 3WG7C 5B3SC 2NG1A 3N24A 2YKZA 3NYJA 2Y3HA 1MMAA 4PJLA 2OOCA 1DOWA 2YVKA 4XPWA 3ZQYA 1Q0MA 3RF3A 3CEXA 2KC3A 4MS2A 2HMQA 2IXOA 2H7VC 3GWLA 4AX2A 5A6BA 1EQ1A 3DZAA 4MW8A 2ZPAA 2IM8A 4I3MA 5TJ5E 1G4US 1WASA 1ZU4A 2EPOA 5COGA 5A6KA 1OQCA 2CGEA 4DXWA 1A0BA 5DS4A 5FCLA 4L6RA 3HNKA 2OEXA 2MHRA 1OCRC 5E3CA 4QI2A 1V4AA 2KGOA 1ZHYA 4CJOA 4AL1A 5KYWB 3ZVRA 4IGGA 3WAQA 3I5QA 2J8WA 3JCUQ 3ZC4A 4NTAA 2B0HA 4WGZA 2AWCA 3B0PA 5JLIA 1RKEA 3FXHA 2EILC 3LUTB 4LLCA 3U3FA 4U5HA 4CS8A 4G7HF 2VB6A 3OA1A 3S9OA 4DBQA 1HMOA 1OR3A 2YL3A 4K0DA 4MVMA 4E0HA 2AWYA 2J0XA 2WZGA 3DJUB 3QVYA 5T3TA 3U9JA 4DRIB 4PACA 2XM4A 3S0XA 2IXMA 1JR8A 2IBFA 3M4BA 1TQGA 4JKVA 1GS9A 4BJTA 2LP4A 3AG1C 2R03A 3ABMC 4X0RA 4XTKA 3VAYA 5FZTA 1VK5A 1LI7A 1BR4A 4GYTA 1E85A 1OCOC 1Q0FA 4I44A 2NUPB 1TWGA 4IJJA 1J8YF 4HEAJ 4YL1A 4BJ5C 2XS8A 3JRMO 4CSAC 1ZZPA 2GAQA 4YL3A 3BRJA 3IPMO 2QUPA 5B1AC 3VM6A 4U5FE 2NUTA 4C3EA 2YLGA 3SXZA 2OEVA 2XL8A 4IB4A 3M1CB 3QZCA 4XWJA 5JRAA 3R2PA 4UDVA 1T6IA 1JMWA 1LE2A 2HKVA 3SXYA 5JUAA 2UUHA 1Z3IX 4H4KC 4BJ6C 3MBGA 5COMA 4BPMA 1U6HA 2CW0F 2XLDA 2ICWG 3KL4A 3V5XA 1VLTA 3NYLA 4EKWA 2OJQA 2J9WA 1S7ZA 2YEVA 4LDRA 3AGTA 4AE4B 1VTMP 5DVWA 1M57C 2G62A 1OKKA 3KH2A 1ORSC 3GEEA 2R7XA 1E83A 2EPLX 3OWTA 1YDIA 1E2XA 3AG3C 3JSEO 3MX3A 3EH1A 3NYMA 4HFFB 1U0BB 5KYYA 2XL6A 3EHMA 3HJCA 4KI2A 2DB4A 1CPRA 4RDAA 1CGOA 1NSGB 3ZTMA 4OIRF 5B3IA 2G3VA 2I15A 2Q3TA 3RH3A 4BJ1A 2FAPB 3TJ5A 3HNJA 4ANJA 2R7OA 2XRHA 3UMHA 5DQTA 2LCHA 3LAYA 4NC3A 2DYRC 1SR2A 2NSGA 4CS8C 4MVZA 4PK4A 1WWPA 2OKUA 5HV9A 4XLNF 2PX3A 5L0CA 3K6BA 1AEPA 5T3WA 2QE9A 3NKEA 4NCQA 2J0WA 1TKNA 3ZIBA 1VYIA 3A9CA 3GEHA 3JTLO 4U5CE 3CAXA 1NBBA 2EIKC 3VYWA 1T6UA 2Y39A 4JE9A 4QDLA 1E84A 3RYLA 2LSEA 4XEVA 3S90A 2FFHA 3ZG1A 3UGPA 1RKEB 2CYDA 1VLSA 2WB7A 5BQHA 2R25A 2A1DD 1FFHA 1JPNA 1NFNA 4YJWA 3TULA 2KW3C 2QY9A 1A7DA 1H6GA 1IZMA 4EHPA 1IW7F 1D0YA 3CSKA 3DE9A 1C03A 3IQ5A 2DGJA 4G78A 2KQ9A 3AG4C 2J9VA 1EI7A 1A7VA 1YAUO 2R7WA 4JJGA 1FR0A 4MQ9F 2BC5A 1M2VB 3FOPA 5IY5C 2YQYA 1T6QA 1ZHXA 5JS5A 3S28A 1ZHTA 4N06A 5L3QA 1TR2A 2EPKX 1OW7A 4C3BA 1TWAA 4MVSA 1H7IA 2YZSA 3ABLC 1E86A 4OINF 2D4UA 3FVYA 1JRAA 2L9JA 4PJJA 2HSQA 1QLEC 1PD1A 5DS6A 3C8ZA 2WVOA 2NUTB 3HNLA 1AUEA 3KYIA 3FAJA 3NRHA 3QTHA 4EIYA 1NU7D 3K7DA 1R4TA 2X51A 4N6CA 4N4WA 3NMKA 4MTFA 3QW0A 4JJFA 4DOZA 5L0IA 3W8HA 3FOOA 2LIGA 4MTGA 3Q7LA 3ABKC 2AU5A 2J7PD 3G4ZA 4WGYA 1YVIA 1D0XA 1LS1A 2IOQA 3ATPA 3LESA 3NMJA 3QMKA 3ECSA 4I1MA 4ZLDA 3O6XA 4O7GA 4XEFA 5DLJA 3ASNC 1HMDA 3W4YA 1PV3A 4A2NB 3C8GA 5CI9A 5KYYB 1CGNA 4C7OA 2HS5A 2EPMX 2HV7A 3B0UX 2R9RB 1A7EA 3EQLF 2HZ8A 1ORJA 4CDVA 2KNHA 3PDMP 1Y6DA 2A0BA 2KSFA 2WZLA 1Q0DA 3IQTA 2A0UA 5JP7A 3EG9A 2GA0A 3TOLA 4J7TA 1YARO 3UMKA 3DE8A 3JZ0A 4E7SA 3PMRA 1SMYF 3LEOA 3LNMB 2OG2A 3VRCA 4CS7A 1CGME 2D5RB 2XSEA 1YYXA 1V54C 3DJNB 2VC9A 3L34A 2H7OA 2VCAA 4G7ZF 5BQIA 3F46A 2G3KA 5AC5A 1A41A 5T1DB 2HFIA 3EHNA 4KBLA 1NLXA 2OQMA 5E2QA 3QW1A 1ZW3A 1YLMA 4MVRA 4JCHA 1LS4A 2ZD9A 2PF4E 3L0IA 2AVKA 3L8IA 2LFDA 5L0DA 1TFKB 2E87A 2J46A 2W4BA 3RIPA 1TWHA 1F1MA 1W2WA 2RSEB 4P9TA 2P61A 4JRZA 2BL2A 2KK1A 4P9FA 4O6NA 4YK5A 4XPXA 4N6HA 2YLIA 1GQAA 3UMIA 5K0IA 3PHF2 3O10A 3S84A 4YL0A 1SZIA 1CPQA 1ST6A 3B71A 3C18A 3M79A 1RMVA 1BR1A 1O5HA 1YYJA 2RD9A 1WGWA 2CDQA 4O79A 2JX0A 3X2QC 4CBEA 4DVZA 1VB5A 2C04A 3DKAA 3S27A 4U5DE 1KTMA 1LKXA 1HW2A 4U5GA 4EBBA 3EZIA 3UR3C 1L7CA 2Y3DA 3H2VA 4XEKA 3U2MA 3LLIA 1RXQA 1OCZC 3FDQA 2TMVP 5F5HA 4DVYP 4U5EE 5JT4A 3U0CA 4OIOF 2CNWD 4K7BA 1S05A 3IEEA 1RJ9A 1OW8A 3C62A 4KNVA 1C17M 1Z23A 3K1HA 5BUOA 3WODF 4OIQF 1T5OA 2M64A 2P0NA 3GODA 1QPUA 2ZXPA 2YL7A 4I1OB 4LDQA 3L1MA 3RVYA 1QSPA 1WATA 2LK4A 1D1AA 3SNHA 2L6FA 4DBRA 1TWCA 1NG1A 2JPUA 2H7BA 4C7OB 2WVQA 4FX5A 4ULVA 1L3PA 3SP1A 3EFOA 5KYUA 2XLHA 3K1IA 1XZQA 2VH3A 1YZCA 1QKRA 3VF0A 1G4WR 4JCZA 2DI3A 4ZLCA 5L0FA 1EKYA 1ZW2A 2R7VA 3EG9B 4EBKA 2ZXOA 3DAFA 2Z15A 5EHHA 4DJ9A 2VCBA 4JURI 4BEMJ 1DOVA 4Q5SF 2GWWA 2W9YA 2A68F 1FTSA 4OD5A 5A69A 1SF8A 2Q9CA 2YRFA 1FAPB 3E70C 3B0VC 1WOLA 1OR2A 4JTCB 1QVXA 3HNIA 2XLOA 5E3AA 2R7QA 3AJMA 3OEOA 4JC7A 2PP4A 1K05A 3KYJA 3B29A 3IQ6A 1Z7Qc 4ULWA 4DRJB 4IAQA 2L6HA 1I4YA 4EUKB 3KKBA 3LJBA 3AQCA 3EGXA 4PFOA 3U9MA 2OU6A 5EGYA 1LIHA 2HJ3A 5KYXA 2PX0A 4W8PA 3T4RA 5KYWA 2J45A 1QQ3A 1BR2A 4JZAA 2PNOA 5D91A 1BDJB 3IHUA 4MTOA 4CJGA 4XPYA 5JVEA 2P7VA 4HFKB 3ASOC 4PJNA 1I4ZA 1MMGA 3AQBA 4K1OA 1N1CA 3EGDA 1APCA 4Q4ZF 3US6A 1TFOB 5COFA 4E0IA 1BBHA 2XL4A 3O39A 3RVZA 1M6TA 5A6BD 2MYSA 2LD6A 4G7OF 3RFYA 2UUIA 4DRHB 1FFTC 3DD7A 2FGYA 1ZHZA 3UGOA 2YL0A 2HJMA 1FMVA 3HLZA 1M2OA 2IXPA 3IQCA 1LI5A 2R02A 3U2LA 3Q6MA 3HTKC 2LFFA 3GWNA 1RJ9B 2NSFA 4U9DA 4QI0A 3JSZA 2EINC 3K1IC 1K04A 4HE8D 1HW1A 4IRUA 3FMSA 3LS1A 4WABA 2R7SA 5B1BC 5L0HA 1ZYRF 2V26A 2Q7RA 4OD4A 4NY3A 3LEVA 1WTYA 4MNDA 1OCCC 2GDCA 3PCVA 4Q7CA 2Q9AA 4CS9A 1KU2A 1O87A 2P1AA 2KJGA 5CIVA 4JIOA 1MMNA 3MLGA 5L0JA 3LS0A 3NMIA 1T9KA 3W8IA 4A4AA 2Y3BA 3GM1A 3HKKA 3EFOB 1D0ZA 2YWAA 3E9VA 1VMAA 2OJED 2WVNA 3H2UA 4GQHA 5KYUB 2XXAA 3JRTA 5A6AA 1HE1A 4G0HA 4MVUA 3G4XA 2QLAA 1MQVA 2HMZA 4IAOA 2C03A 3SXKA 1T01A 2ZXRA 1FNTc 4CDAA 3TQOA 4D4XA 1MMDA 4M63A 4MW3A 1YJGA 4BJ6A 3BEHA 4CX9A 5F5FA 5AC4A 1GM5A 3DM5A 2F22A 1VOMA 2L7AA 3EPVA 4YWQA 3DM9B 3EJNA 3JYYA 2XS1A 2ZXWC 5HSWA 4CIHA 1Z6AA 1XZPA 3EGXB 1HY5A 3SEOA 4JEAA 3UNGC 3I4UA 1EA8A 4O6MA 2X0CA 3S29A 5KYXB 1OKKD 3H65A 4E17A 4U5BE 4P6IC 3ZWIA 3M15A 3MFNA 2MWQA 2J7PA 4BG0A 4J32B 3U3BA 2EPNA 3EGDB 2IYLD 3RW0A 2Q4FA 1LPEA 2V3CC 3J06A 3WHNA 4JVSA 4PJMA 3DMDA 2QNLA 1C02A 4MVOA 4EBJA 1XWJA 2XM0A 3MYFA 2BE5F 1Z63A 1J8MF 1Q0KA 3Q6NA 4YT4A 3L8JA 5L3VA 1M2VA 3FHDA 1U89A 4CS9C 2L6GA 3GM3A 4F4BA 3JYHA 5GPGB 2I8BA 4LDKA 3G50A 2R7UA 4OIPF 3RQEA 4JTDB 2W4MA 2R7TA 2YL1A 3W2VA 2HUJA 1MNEA 2PBEA 3ZSUA 3W2WA 2R05A 3T6BA 3EZHA 1V74B 1OW6A 2XLMA 3RKOF 2Q9BA 4YT2A 4IWBA 1D1CA 3R7CA 5DS5A 4D4NA 2OCCC 4J7YA 3U5SA 4YN0B 3EH2A 3C8GB 3KMIA 3NG1A 3U8VA 3DAGA 4B6IA 3POVA 3N2ZB 2XLEA 2XLVA 4WJ0A 1YA7O 3B9QA 3GEIA 3O55A 2WL8A 3SYNA 2A69F 1LVKA 4ONSA 2NPUA 4Z9HA 4NQFA 2XXAB 1JPJA 3RQGA 2J9BA 2AP3A 3AG2C 4E18A 1SYQA 1FMWA 3C63A 3NKDA 5L0GA 2Q00A 1R5ID 1LM3B 2JD3A 1UG7A 4CDYA 3CQZA 3V5ZA 4Z9IA 2LQGA 3A11A 3ZDLA 1HE9A 4NTBA 4JEBA 1MNDA 4RBNA 4YT8A 3FAPB 1M56C 4NTFA 5A6JA 3Q7GA 4CIPA 3AOUA 1G8XA 1K40A 4C3DA 1WN0A 3K66A 4ER9A 3GORA 5F28E 2IXNA 1QZXA 4LACB 3F47A 3QVZA 3X1OA 2CNWA 3KPHA 3SXMA 4AK9A 2VASA 4KC9A 4PR9A 3TK0A 1ZHWA 4KNWA 5AGFA 3DI5A 2O9XA 5E33A 1RKCA 4JTAB 1ORYA 2HV6A 3N0TA 2XLWA 4IARA 3T6GB 3I5PA 4R32A 1ZVZA 2B0JA 4FESA 2Y69C 1H9GA 3C8GD 1D1BA 3LNRA 1NU9C 3DWWA 4O6YA 1G5ZA 2KYHA 2HSBA 1KNYA 3T6JA 1Z5ZA
chains in the Genus database with same CATH topology
3R7CA 3U2LA 3U5SA 3GWNA 3LLKA 2HJ3A 3U2MA 3TK0A 3LLIA 4E0HA 3O55A 3GWLA 3MBGA 3W4YA 1JR8A 1JRAA 4E0IA 3TD7A 4LDKA 1OQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7C A;  3U2L A;  3U5S A;  3GWN A;  3LLK A;  2HJ3 A;  3U2M A;  3TK0 A;  3LLI A;  4E0H A;  3O55 A;  3GWL A;  3MBG A;  3W4Y A;  1JR8 A;  1JRA A;  4E0I A;  3TD7 A;  4LDK A;  1OQC A; 
#chains in the Genus database with same CATH topology
 3TJ6 A;  1NFO A;  4XQ1 A;  4BEJ A;  2EIM C;  2R7R A;  4XLP F;  4LER A;  3V5Y A;  1VYK A;  1YA9 A;  256B A;  3TOM A;  1GGQ A;  3K33 A;  4JW1 A;  4MVQ A;  2M4E A;  2YHS A;  2A6E F;  5KYN A;  1NZE A;  4Z9J A;  1Y4C A;  1OXB A;  4E7Z A;  4YT5 A;  1OXK A;  1UFB A;  1RCP A;  2W45 A;  3DXJ F;  4PFP A;  1H9T A;  2A6H F;  2EIJ C;  2WZF A;  1V55 C;  1PD0 A;  5DQZ A;  2CCY A;  2NUP A;  3GAN A;  3GM2 A;  4GEH A;  3ZQV A;  1PCX A;  5EK0 A;  4FWV A;  1O3U A;  4W8K A;  3JT1 A;  3C7J A;  3M4C A;  3SZR A;  2P6V A;  1I5N A;  2H8A A;  2QTV A;  1YZA A;  1Q0G A;  3MYI A;  5D92 A;  1JOG A;  1JAF A;  1BZ4 A;  1LE4 A;  3ITF A;  3T9O A;  3TD7 A;  3ZTZ A;  4J30 B;  5JSL A;  5BQG A;  4EWC A;  1B68 A;  4U9E A;  3CZ6 A;  1AVO B;  2VCC A;  3V7O A;  2Y3G A;  4LLE A;  1ZU5 A;  5CI8 A;  2ETS A;  3RQF A;  2J9U A;  3NDB B;  4FAP B;  4BJ5 A;  2DYS C;  4AE4 A;  3U8P A;  4AL0 A;  2PFD A;  4CSA A;  2GFH A;  3AGU A;  2YLD A;  3LLK A;  4H54 A;  2L81 A;  4RD9 A;  2ASR A;  3WG7 C;  5B3S C;  2NG1 A;  3N24 A;  2YKZ A;  3NYJ A;  2Y3H A;  1MMA A;  4PJL A;  2OOC A;  1DOW A;  2YVK A;  4XPW A;  3ZQY A;  1Q0M A;  3RF3 A;  3CEX A;  2KC3 A;  4MS2 A;  2HMQ A;  2IXO A;  2H7V C;  3GWL A;  4AX2 A;  5A6B A;  1EQ1 A;  3DZA A;  4MW8 A;  2ZPA A;  2IM8 A;  4I3M A;  5TJ5 E;  1G4U S;  1WAS A;  1ZU4 A;  2EPO A;  5COG A;  5A6K A;  1OQC A;  2CGE A;  4DXW A;  1A0B A;  5DS4 A;  5FCL A;  4L6R A;  3HNK A;  2OEX A;  2MHR A;  1OCR C;  5E3C A;  4QI2 A;  1V4A A;  2KGO A;  1ZHY A;  4CJO A;  4AL1 A;  5KYW B;  3ZVR A;  4IGG A;  3WAQ A;  3I5Q A;  2J8W A;  3JCU Q;  3ZC4 A;  4NTA A;  2B0H A;  4WGZ A;  2AWC A;  3B0P A;  5JLI A;  1RKE A;  3FXH A;  2EIL C;  3LUT B;  4LLC A;  3U3F A;  4U5H A;  4CS8 A;  4G7H F;  2VB6 A;  3OA1 A;  3S9O A;  4DBQ A;  1HMO A;  1OR3 A;  2YL3 A;  4K0D A;  4MVM A;  4E0H A;  2AWY A;  2J0X A;  2WZG A;  3DJU B;  3QVY A;  5T3T A;  3U9J A;  4DRI B;  4PAC A;  2XM4 A;  3S0X A;  2IXM A;  1JR8 A;  2IBF A;  3M4B A;  1TQG A;  4JKV A;  1GS9 A;  4BJT A;  2LP4 A;  3AG1 C;  2R03 A;  3ABM C;  4X0R A;  4XTK A;  3VAY A;  5FZT A;  1VK5 A;  1LI7 A;  1BR4 A;  4GYT A;  1E85 A;  1OCO C;  1Q0F A;  4I44 A;  2NUP B;  1TWG A;  4IJJ A;  1J8Y F;  4HEA J;  4YL1 A;  4BJ5 C;  2XS8 A;  3JRM O;  4CSA C;  1ZZP A;  2GAQ A;  4YL3 A;  3BRJ A;  3IPM O;  2QUP A;  5B1A C;  3VM6 A;  4U5F E;  2NUT A;  4C3E A;  2YLG A;  3SXZ A;  2OEV A;  2XL8 A;  4IB4 A;  3M1C B;  3QZC A;  4XWJ A;  5JRA A;  3R2P A;  4UDV A;  1T6I A;  1JMW A;  1LE2 A;  2HKV A;  3SXY A;  5JUA A;  2UUH A;  1Z3I X;  4H4K C;  4BJ6 C;  3MBG A;  5COM A;  4BPM A;  1U6H A;  2CW0 F;  2XLD A;  2ICW G;  3KL4 A;  3V5X A;  1VLT A;  3NYL A;  4EKW A;  2OJQ A;  2J9W A;  1S7Z A;  2YEV A;  4LDR A;  3AGT A;  4AE4 B;  1VTM P;  5DVW A;  1M57 C;  2G62 A;  1OKK A;  3KH2 A;  1ORS C;  3GEE A;  2R7X A;  1E83 A;  2EPL X;  3OWT A;  1YDI A;  1E2X A;  3AG3 C;  3JSE O;  3MX3 A;  3EH1 A;  3NYM A;  4HFF B;  1U0B B;  5KYY A;  2XL6 A;  3EHM A;  3HJC A;  4KI2 A;  2DB4 A;  1CPR A;  4RDA A;  1CGO A;  1NSG B;  3ZTM A;  4OIR F;  5B3I A;  2G3V A;  2I15 A;  2Q3T A;  3RH3 A;  4BJ1 A;  2FAP B;  3TJ5 A;  3HNJ A;  4ANJ A;  2R7O A;  2XRH A;  3UMH A;  5DQT A;  2LCH A;  3LAY A;  4NC3 A;  2DYR C;  1SR2 A;  2NSG A;  4CS8 C;  4MVZ A;  4PK4 A;  1WWP A;  2OKU A;  5HV9 A;  4XLN F;  2PX3 A;  5L0C A;  3K6B A;  1AEP A;  5T3W A;  2QE9 A;  3NKE A;  4NCQ A;  2J0W A;  1TKN A;  3ZIB A;  1VYI A;  3A9C A;  3GEH A;  3JTL O;  4U5C E;  3CAX A;  1NBB A;  2EIK C;  3VYW A;  1T6U A;  2Y39 A;  4JE9 A;  4QDL A;  1E84 A;  3RYL A;  2LSE A;  4XEV A;  3S90 A;  2FFH A;  3ZG1 A;  3UGP A;  1RKE B;  2CYD A;  1VLS A;  2WB7 A;  5BQH A;  2R25 A;  2A1D D;  1FFH A;  1JPN A;  1NFN A;  4YJW A;  3TUL A;  2KW3 C;  2QY9 A;  1A7D A;  1H6G A;  1IZM A;  4EHP A;  1IW7 F;  1D0Y A;  3CSK A;  3DE9 A;  1C03 A;  3IQ5 A;  2DGJ A;  4G78 A;  2KQ9 A;  3AG4 C;  2J9V A;  1EI7 A;  1A7V A;  1YAU O;  2R7W A;  4JJG A;  1FR0 A;  4MQ9 F;  2BC5 A;  1M2V B;  3FOP A;  5IY5 C;  2YQY A;  1T6Q A;  1ZHX A;  5JS5 A;  3S28 A;  1ZHT A;  4N06 A;  5L3Q A;  1TR2 A;  2EPK X;  1OW7 A;  4C3B A;  1TWA A;  4MVS A;  1H7I A;  2YZS A;  3ABL C;  1E86 A;  4OIN F;  2D4U A;  3FVY A;  1JRA A;  2L9J A;  4PJJ A;  2HSQ A;  1QLE C;  1PD1 A;  5DS6 A;  3C8Z A;  2WVO A;  2NUT B;  3HNL A;  1AUE A;  3KYI A;  3FAJ A;  3NRH A;  3QTH A;  4EIY A;  1NU7 D;  3K7D A;  1R4T A;  2X51 A;  4N6C A;  4N4W A;  3NMK A;  4MTF A;  3QW0 A;  4JJF A;  4DOZ A;  5L0I A;  3W8H A;  3FOO A;  2LIG A;  4MTG A;  3Q7L A;  3ABK C;  2AU5 A;  2J7P D;  3G4Z A;  4WGY A;  1YVI A;  1D0X A;  1LS1 A;  2IOQ A;  3ATP A;  3LES A;  3NMJ A;  3QMK A;  3ECS A;  4I1M A;  4ZLD A;  3O6X A;  4O7G A;  4XEF A;  5DLJ A;  3ASN C;  1HMD A;  3W4Y A;  1PV3 A;  4A2N B;  3C8G A;  5CI9 A;  5KYY B;  1CGN A;  4C7O A;  2HS5 A;  2EPM X;  2HV7 A;  3B0U X;  2R9R B;  1A7E A;  3EQL F;  2HZ8 A;  1ORJ A;  4CDV A;  2KNH A;  3PDM P;  1Y6D A;  2A0B A;  2KSF A;  2WZL A;  1Q0D A;  3IQT A;  2A0U A;  5JP7 A;  3EG9 A;  2GA0 A;  3TOL A;  4J7T A;  1YAR O;  3UMK A;  3DE8 A;  3JZ0 A;  4E7S A;  3PMR A;  1SMY F;  3LEO A;  3LNM B;  2OG2 A;  3VRC A;  4CS7 A;  1CGM E;  2D5R B;  2XSE A;  1YYX A;  1V54 C;  3DJN B;  2VC9 A;  3L34 A;  2H7O A;  2VCA A;  4G7Z F;  5BQI A;  3F46 A;  2G3K A;  5AC5 A;  1A41 A;  5T1D B;  2HFI A;  3EHN A;  4KBL A;  1NLX A;  2OQM A;  5E2Q A;  3QW1 A;  1ZW3 A;  1YLM A;  4MVR A;  4JCH A;  1LS4 A;  2ZD9 A;  2PF4 E;  3L0I A;  2AVK A;  3L8I A;  2LFD A;  5L0D A;  1TFK B;  2E87 A;  2J46 A;  2W4B A;  3RIP A;  1TWH A;  1F1M A;  1W2W A;  2RSE B;  4P9T A;  2P61 A;  4JRZ A;  2BL2 A;  2KK1 A;  4P9F A;  4O6N A;  4YK5 A;  4XPX A;  4N6H A;  2YLI A;  1GQA A;  3UMI A;  5K0I A;  3PHF 2;  3O10 A;  3S84 A;  4YL0 A;  1SZI A;  1CPQ A;  1ST6 A;  3B71 A;  3C18 A;  3M79 A;  1RMV A;  1BR1 A;  1O5H A;  1YYJ A;  2RD9 A;  1WGW A;  2CDQ A;  4O79 A;  2JX0 A;  3X2Q C;  4CBE A;  4DVZ A;  1VB5 A;  2C04 A;  3DKA A;  3S27 A;  4U5D E;  1KTM A;  1LKX A;  1HW2 A;  4U5G A;  4EBB A;  3EZI A;  3UR3 C;  1L7C A;  2Y3D A;  3H2V A;  4XEK A;  3U2M A;  3LLI A;  1RXQ A;  1OCZ C;  3FDQ A;  2TMV P;  5F5H A;  4DVY P;  4U5E E;  5JT4 A;  3U0C A;  4OIO F;  2CNW D;  4K7B A;  1S05 A;  3IEE A;  1RJ9 A;  1OW8 A;  3C62 A;  4KNV A;  1C17 M;  1Z23 A;  3K1H A;  5BUO A;  3WOD F;  4OIQ F;  1T5O A;  2M64 A;  2P0N A;  3GOD A;  1QPU A;  2ZXP A;  2YL7 A;  4I1O B;  4LDQ A;  3L1M A;  3RVY A;  1QSP A;  1WAT A;  2LK4 A;  1D1A A;  3SNH A;  2L6F A;  4DBR A;  1TWC A;  1NG1 A;  2JPU A;  2H7B A;  4C7O B;  2WVQ A;  4FX5 A;  4ULV A;  1L3P A;  3SP1 A;  3EFO A;  5KYU A;  2XLH A;  3K1I A;  1XZQ A;  2VH3 A;  1YZC A;  1QKR A;  3VF0 A;  1G4W R;  4JCZ A;  2DI3 A;  4ZLC A;  5L0F A;  1EKY A;  1ZW2 A;  2R7V A;  3EG9 B;  4EBK A;  2ZXO A;  3DAF A;  2Z15 A;  5EHH A;  4DJ9 A;  2VCB A;  4JUR I;  4BEM J;  1DOV A;  4Q5S F;  2GWW A;  2W9Y A;  2A68 F;  1FTS A;  4OD5 A;  5A69 A;  1SF8 A;  2Q9C A;  2YRF A;  1FAP B;  3E70 C;  3B0V C;  1WOL A;  1OR2 A;  4JTC B;  1QVX A;  3HNI A;  2XLO A;  5E3A A;  2R7Q A;  3AJM A;  3OEO A;  4JC7 A;  2PP4 A;  1K05 A;  3KYJ A;  3B29 A;  3IQ6 A;  1Z7Q c;  4ULW A;  4DRJ B;  4IAQ A;  2L6H A;  1I4Y A;  4EUK B;  3KKB A;  3LJB A;  3AQC A;  3EGX A;  4PFO A;  3U9M A;  2OU6 A;  5EGY A;  1LIH A;  2HJ3 A;  5KYX A;  2PX0 A;  4W8P A;  3T4R A;  5KYW A;  2J45 A;  1QQ3 A;  1BR2 A;  4JZA A;  2PNO A;  5D91 A;  1BDJ B;  3IHU A;  4MTO A;  4CJG A;  4XPY A;  5JVE A;  2P7V A;  4HFK B;  3ASO C;  4PJN A;  1I4Z A;  1MMG A;  3AQB A;  4K1O A;  1N1C A;  3EGD A;  1APC A;  4Q4Z F;  3US6 A;  1TFO B;  5COF A;  4E0I A;  1BBH A;  2XL4 A;  3O39 A;  3RVZ A;  1M6T A;  5A6B D;  2MYS A;  2LD6 A;  4G7O F;  3RFY A;  2UUI A;  4DRH B;  1FFT C;  3DD7 A;  2FGY A;  1ZHZ A;  3UGO A;  2YL0 A;  2HJM A;  1FMV A;  3HLZ A;  1M2O A;  2IXP A;  3IQC A;  1LI5 A;  2R02 A;  3U2L A;  3Q6M A;  3HTK C;  2LFF A;  3GWN A;  1RJ9 B;  2NSF A;  4U9D A;  4QI0 A;  3JSZ A;  2EIN C;  3K1I C;  1K04 A;  4HE8 D;  1HW1 A;  4IRU A;  3FMS A;  3LS1 A;  4WAB A;  2R7S A;  5B1B C;  5L0H A;  1ZYR F;  2V26 A;  2Q7R A;  4OD4 A;  4NY3 A;  3LEV A;  1WTY A;  4MND A;  1OCC C;  2GDC A;  3PCV A;  4Q7C A;  2Q9A A;  4CS9 A;  1KU2 A;  1O87 A;  2P1A A;  2KJG A;  5CIV A;  4JIO A;  1MMN A;  3MLG A;  5L0J A;  3LS0 A;  3NMI A;  1T9K A;  3W8I A;  4A4A A;  2Y3B A;  3GM1 A;  3HKK A;  3EFO B;  1D0Z A;  2YWA A;  3E9V A;  1VMA A;  2OJE D;  2WVN A;  3H2U A;  4GQH A;  5KYU B;  2XXA A;  3JRT A;  5A6A A;  1HE1 A;  4G0H A;  4MVU A;  3G4X A;  2QLA A;  1MQV A;  2HMZ A;  4IAO A;  2C03 A;  3SXK A;  1T01 A;  2ZXR A;  1FNT c;  4CDA A;  3TQO A;  4D4X A;  1MMD A;  4M63 A;  4MW3 A;  1YJG A;  4BJ6 A;  3BEH A;  4CX9 A;  5F5F A;  5AC4 A;  1GM5 A;  3DM5 A;  2F22 A;  1VOM A;  2L7A A;  3EPV A;  4YWQ A;  3DM9 B;  3EJN A;  3JYY A;  2XS1 A;  2ZXW C;  5HSW A;  4CIH A;  1Z6A A;  1XZP A;  3EGX B;  1HY5 A;  3SEO A;  4JEA A;  3UNG C;  3I4U A;  1EA8 A;  4O6M A;  2X0C A;  3S29 A;  5KYX B;  1OKK D;  3H65 A;  4E17 A;  4U5B E;  4P6I C;  3ZWI A;  3M15 A;  3MFN A;  2MWQ A;  2J7P A;  4BG0 A;  4J32 B;  3U3B A;  2EPN A;  3EGD B;  2IYL D;  3RW0 A;  2Q4F A;  1LPE A;  2V3C C;  3J06 A;  3WHN A;  4JVS A;  4PJM A;  3DMD A;  2QNL A;  1C02 A;  4MVO A;  4EBJ A;  1XWJ A;  2XM0 A;  3MYF A;  2BE5 F;  1Z63 A;  1J8M F;  1Q0K A;  3Q6N A;  4YT4 A;  3L8J A;  5L3V A;  1M2V A;  3FHD A;  1U89 A;  4CS9 C;  2L6G A;  3GM3 A;  4F4B A;  3JYH A;  5GPG B;  2I8B A;  4LDK A;  3G50 A;  2R7U A;  4OIP F;  3RQE A;  4JTD B;  2W4M A;  2R7T A;  2YL1 A;  3W2V A;  2HUJ A;  1MNE A;  2PBE A;  3ZSU A;  3W2W A;  2R05 A;  3T6B A;  3EZH A;  1V74 B;  1OW6 A;  2XLM A;  3RKO F;  2Q9B A;  4YT2 A;  4IWB A;  1D1C A;  3R7C A;  5DS5 A;  4D4N A;  2OCC C;  4J7Y A;  3U5S A;  4YN0 B;  3EH2 A;  3C8G B;  3KMI A;  3NG1 A;  3U8V A;  3DAG A;  4B6I A;  3POV A;  3N2Z B;  2XLE A;  2XLV A;  4WJ0 A;  1YA7 O;  3B9Q A;  3GEI A;  3O55 A;  2WL8 A;  3SYN A;  2A69 F;  1LVK A;  4ONS A;  2NPU A;  4Z9H A;  4NQF A;  2XXA B;  1JPJ A;  3RQG A;  2J9B A;  2AP3 A;  3AG2 C;  4E18 A;  1SYQ A;  1FMW A;  3C63 A;  3NKD A;  5L0G A;  2Q00 A;  1R5I D;  1LM3 B;  2JD3 A;  1UG7 A;  4CDY A;  3CQZ A;  3V5Z A;  4Z9I A;  2LQG A;  3A11 A;  3ZDL A;  1HE9 A;  4NTB A;  4JEB A;  1MND A;  4RBN A;  4YT8 A;  3FAP B;  1M56 C;  4NTF A;  5A6J A;  3Q7G A;  4CIP A;  3AOU A;  1G8X A;  1K40 A;  4C3D A;  1WN0 A;  3K66 A;  4ER9 A;  3GOR A;  5F28 E;  2IXN A;  1QZX A;  4LAC B;  3F47 A;  3QVZ A;  3X1O A;  2CNW A;  3KPH A;  3SXM A;  4AK9 A;  2VAS A;  4KC9 A;  4PR9 A;  3TK0 A;  1ZHW A;  4KNW A;  5AGF A;  3DI5 A;  2O9X A;  5E33 A;  1RKC A;  4JTA B;  1ORY A;  2HV6 A;  3N0T A;  2XLW A;  4IAR A;  3T6G B;  3I5P A;  4R32 A;  1ZVZ A;  2B0J A;  4FES A;  2Y69 C;  1H9G A;  3C8G D;  1D1B A;  3LNR A;  1NU9 C;  3DWW A;  4O6Y A;  1G5Z A;  2KYH A;  2HSB A;  1KNY A;  3T6J A;  1Z5Z A; 
#chains in the Genus database with same CATH homology
 3R7C A;  3U2L A;  3U5S A;  3GWN A;  3LLK A;  2HJ3 A;  3U2M A;  3TK0 A;  3LLI A;  4E0H A;  3O55 A;  3GWL A;  3MBG A;  3W4Y A;  1JR8 A;  1JRA A;  4E0I A;  3TD7 A;  4LDK A;  1OQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...