3W4YA

Crystal structure of yeast erv1 core
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
113
structure length
113
Chain Sequence
SRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPCNWCAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDGWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial FAD-linked sulfhydryl oxidase ERV1
publication title Crystal structure of yeast Erv1 core
rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 40
structure length 113
sequence length 113
chains with identical sequence B, C
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3w4yA01
3U5SA 3TD7A 3LLKA 3LLIA 3U2MA 4E0HA 4E0IA 1JR8A 3GWLA 3W4YA 3U2LA 3MBGA 3O55A 3TK0A 1JRAA 4LDKA 3GWNA 1OQCA 2HJ3A 3R7CA
chains in the Genus database with same CATH superfamily
1NFNA 4K1OA 1YZAA 3M15A 4XPYA 3AG3C 1LS4A 5CI9A 3VF0A 3TD7A 5KYXB 4CSAC 3U9JA 2HSQA 3AGTA 5JP7A 2A69F 1C03A 2MYSA 3LLKA 3X1OA 1R5ID 4BJ5A 4PR9A 2NPUA 3ZDLA 1OW7A 3IEEA 3KYJA 3VYWA 4XLPF 3U8PA 4YK5A 2NUPB 4GQHA 1U6HA 4RBNA 3L8IA 2H7OA 2KK1A 1H9TA 4O79A 2HKVA 1FFTC 2J0XA 3F47A 3LS1A 4CIHA 2YLIA 2XS8A 4BEJA 2XL8A 4YN0B 2YKZA 3GEEA 2XM0A 4BJ6C 1QQ3A 2NSFA 3EFOA 2Y69C 3ABMC 3GODA 3S29A 2JPUA 2QNLA 4CS8C 3TULA 3RQGA 4IJJA 3GEHA 4IRUA 4K7BA 1YJGA 1S05A 1CGNA 3QW1A 4G0HA 4W8KA 3V7OA 2WL8A 3ZQYA 4G7ZF 1EKYA 1OW6A 3ZC4A 1AEPA 1HMDA 2A0UA 1YYJA 4MTOA 3HTKC 2I15A 4CS9A 5A6BD 1SR2A 3GEIA 3O6XA 1BR1A 4AL0A 1TWCA 4ONSA 4C3EA 3W2VA 3GM1A 3Q7LA 4CBEA 4E0IA 1LE4A 1YAUO 2EPOA 3BRJA 4PFPA 4YL0A 1JPNA 2R7SA 1AUEA 2ZXRA 3N24A 1D1CA 3HNLA 2L6HA 1JOGA 1NU7D 3H65A 3FAPB 3B0VC 2OOCA 2ZXOA 4AE4A 4IAQA 2R7UA 1T5OA 3E70C 2LSEA 3JZ0A 2MWQA 4Z9JA 4X0RA 5AC4A 2P1AA 1O5HA 1D0XA 2R02A 2IXPA 1MNEA 2WVOA 3UR3C 4DRIB 5JSLA 3U0CA 1A7DA 2L7AA 1V4AA 3HKKA 2GAQA 1NBBA 1TFOB 2H8AA 1Q0KA 2EIMC 2F22A 2J9BA 2D5RB 2NG1A 3G50A 2DYRC 1OCOC 1NLXA 2R03A 3N2ZB 4L6RA 2H7BA 5IY5C 2R05A 2Y3BA 4JEAA 5DQTA 3W8IA 4CS9C 1D1BA 3I4UA 3NYJA 256BA 3PMRA 2EPKX 4IARA 5A6KA 4G7OF 4C3BA 1RXQA 4IAOA 4XPWA 3RW0A 4U9DA 3S0XA 3U2LA 5KYYA 1T6QA 2YL3A 1V54C 1XWJA 3LNRA 4Q5SF 1LM3B 5BQIA 2CGEA 4EBBA 3HNIA 3L1MA 3A9CA 5T3TA 3I5PA 1KNYA 3N0TA 3Q6NA 4MVRA 3ZVRA 2QUPA 4KNWA 3PCVA 5DLJA 3KL4A 4EHPA 3IHUA 2OEXA 5A6JA 1CGME 2W4MA 4WGZA 5L3QA 3DJUB 4C7OB 3U9MA 3SXZA 1NG1A 2IYLD 1OQCA 4U5EE 4KNVA 3T6JA 3DMDA 4LACB 1G8XA 3JT1A 3CEXA 3SEOA 2JD3A 4D4XA 1V74B 4EBJA 4N6HA 2ZPAA 3EFOB 3WODF 3A11A 2YL1A 3DI5A 3QVYA 1ORJA 1O87A 1U89A 2XLWA 1RKCA 4JE9A 4QDLA 5L0JA 2HS5A 5DS6A 5L0HA 1PD1A 4PJNA 2X0CA 3MYFA 3S27A 4FAPB 1MNDA 2ICWG 4I1OB 3W4YA 3SXKA 2DYSC 2EPLX 3T9OA 3LEVA 1RMVA 4PACA 5JUAA 3E9VA 2R7TA 3DM5A 2XLVA 4BJ1A 3IPMO 1G5ZA 3LS0A 3DXJF 3ASNC 4H4KC 3JRMO 2Y3HA 2YEVA 4OD5A 3RFYA 3U3BA 4CS7A 3CQZA 4B6IA 1SMYF 4M63A 5T3WA 2H7VC 1E2XA 2B0HA 2GA0A 1JAFA 1VB5A 3ABLC 3K33A 4JTDB 3DE8A 1T9KA 2AVKA 2ETSA 4R32A 4HEAJ 1E84A 1TQGA 1TWAA 1RJ9A 3SYNA 4AK9A 4DOZA 2XXAA 2OJQA 5EHHA 2XM4A 1H7IA 4IGGA 4E7ZA 3JCUQ 1OR3A 3EGXA 3RVYA 3TQOA 3DAFA 3IQ5A 3FAJA 4NC3A 5CI8A 5B1BC 1SYQA 1EQ1A 2EINC 4DVZA 3FHDA 3U8VA 3T6GB 2W4BA 3LNMB 4ANJA 2PBEA 2I8BA 3T4RA 5AC5A 4JCHA 3AJMA 4U5BE 5KYYB 2L6FA 2PX0A 4BJTA 3M4BA 3K66A 2P6VA 2O9XA 1D0ZA 2Q9CA 2Y3GA 3FDQA 4AL1A 5KYWB 2KNHA 1BZ4A 4JVSA 2B0JA 4XQ1A 1TWGA 3RVZA 2HSBA 1A0BA 3VM6A 4EUKB 4RDAA 3CAXA 3K7DA 3OA1A 2OG2A 3WAQA 1H9GA 3KKBA 3DJNB 1ZW2A 1I4YA 2PFDA 4LERA 1GM5A 1Z6AA 4OIQF 2YQYA 3HNKA 3S9OA 2R25A 3ZTZA 1GS9A 3QW0A 3Q6MA 3CSKA 2XS1A 4E17A 2R7OA 2IM8A 4P6IC 3MLGA 2M64A 2WZLA 4XTKA 5EGYA 2XRHA 4K0DA 4QI2A 1SZIA 4J7YA 3DE9A 3IQ6A 3DAGA 2YRFA 3ZQVA 5BUOA 4ZLCA 2W9YA 4YWQA 4C3DA 1FMVA 2HUJA 5BQGA 3DZAA 4PJLA 5JVEA 3TOMA 4BJ5C 1T6UA 5CIVA 2QY9A 2GDCA 2PP4A 4O6MA 2AP3A 3WG7C 5HSWA 3SXYA 4JTCB 3H2VA 1RJ9B 4DVYP 2XXAB 3ZSUA 3FOOA 3LEOA 3UMHA 4DRJB 5F5FA 2V26A 3EGXB 4J30B 5COMA 1YDIA 3QVZA 5D92A 3NYMA 2FGYA 1ORSC 2KSFA 2M4EA 4N06A 4MVOA 3K1IA 3W8HA 3EH1A 4U5HA 1FAPB 3EJNA 1YVIA 5F28E 5KYNA 1J8MF 4H54A 3V5ZA 1APCA 2KQ9A 1FR0A 2Q3TA 1OCZC 1PD0A 1V55C 3NDBB 4KC9A 2OQMA 5JLIA 1Q0FA 2HFIA 1NU9C 4JRZA 1OCCC 3UGOA 2UUHA 1ZYRF 4DBQA 1W2WA 2G3KA 4F4BA 3NMJA 4CX9A 3M79A 4Z9IA 1BDJB 1MMDA 3JSZA 4CDYA 2G62A 3FMSA 4OINF 4PJJA 1TWHA 1RKEA 1D1AA 2BL2A 2DB4A 3I5QA 4EWCA 4D4NA 1S7ZA 1M57C 1IW7F 1VMAA 4JC7A 1A7EA 1OXKA 4P9TA 5AGFA 4OIPF 3ASOC 2PX3A 2LP4A 2VCAA 3G4XA 3HLZA 4FWVA 4GEHA 4JURI 1CGOA 4ULVA 1LVKA 4AX2A 4EBKA 3EZHA 4FESA 4EKWA 1A41A 1ZU4A 3C8GD 5TJ5E 3U2MA 5DVWA 4DXWA 4E0HA 1E86A 4MS2A 3NKDA 1WGWA 2R7XA 1QZXA 3U3FA 2D4UA 2Q9BA 2XL6A 4XWJA 2W45A 1T6IA 2GWWA 2Q9AA 4MVSA 2HZ8A 4XEFA 4BG0A 3NRHA 3C18A 4ER9A 3DD7A 4KBLA 1HW1A 2QE9A 2YLGA 3RH3A 1U0BB 3O39A 4OD4A 5GPGB 3UMKA 4U5GA 4G78A 2YVKA 2KJGA 2A6HF 2KGOA 5DS5A 1QPUA 1BBHA 3LESA 2IOQA 2VCBA 4AE4B 2WZFA 2CNWD 2BE5F 2NUPA 3AG2C 3DWWA 4JIOA 1M6TA 1RCPA 4WJ0A 1CPRA 1VK5A 1Z7Qc 3J06A 3US6A 2R7VA 1LI7A 3C63A 5L0FA 1Z5ZA 4P9FA 2Q00A 1KU2A 2HMQA 2CCYA 2XLEA 2AWYA 3LUTB 4FX5A 1I5NA 2NUTA 1TFKB 3FOPA 2P0NA 4I44A 3C7JA 2YHSA 5DS4A 4OIRF 1BR2A 2VCCA 3EG9A 3POVA 1NZEA 1LE2A 2OCCC 1G4WR 2YL7A 1MMGA 2R9RB 2WVNA 2A6EF 2R7QA 2XLMA 3B71A 3GANA 3KPHA 5E33A 3ZG1A 5L0DA 3MYIA 3UGPA 3SXMA 1VYIA 3EPVA 3JSEO 3IQCA 4JJFA 1YA9A 4PJMA 4GYTA 1TR2A 4U5FE 4A2NB 4CDAA 1OW8A 1E83A 4LDRA 2V3CC 1ZVZA 3GM3A 3C8GA 1WN0A 4PFOA 3K1HA 4IWBA 3O10A 4CDVA 2LK4A 5E2QA 3LLIA 4I1MA 5T1DB 2IBFA 2L81A 4N4WA 3UMIA 1FFHA 5DQZA 2J46A 4NTBA 2LQGA 4JW1A 3GWLA 1ZW3A 3RIPA 5FCLA 3CZ6A 1LKXA 3QTHA 4RD9A 1DOWA 4MVMA 2Q4FA 4YL1A 5JS5A 2OJED 1VLTA 3VRCA 2VB6A 3O55A 3F46A 4LLEA 4U9EA 2ZXWC 3GM2A 1SF8A 5D91A 2TMVP 3OWTA 1WASA 4BJ6A 2P7VA 4I3MA 4Q4ZF 3TK0A 1QLEC 2CNWA 2YWAA 4MVQA 4LDKA 2QLAA 4LDQA 3DKAA 1EA8A 3RYLA 3B0UX 2HMZA 3QMKA 1D0YA 3V5XA 3X2QC 3S84A 1JPJA 2AWCA 1ZHTA 2C03A 3EHNA 1OXBA 1M2OA 1FTSA 1PCXA 2RD9A 3JYYA 2PNOA 5E3CA 2OU6A 3U5SA 3KH2A 4YT8A 4ULWA 2XLHA 5B3IA 4WGYA 1NFOA 2YL0A 2WB7A 1YA7O 1LS1A 3L34A 1FNTc 1Z3IX 2LFDA 2VC9A 3S90A 3MX3A 1JR8A 2WZGA 2J7PA 3AG1C 2XL4A 1Z63A 3RF3A 1ZHWA 4C7OA 4W8PA 4XPXA 2GFHA 1PV3A 3HNJA 1GQAA 1B68A 1VLSA 2L6GA 3AQBA 5K0IA 1IZMA 3TOLA 2YZSA 3R2PA 1LPEA 1WTYA 4HFFB 4MNDA 4J32B 2NUTB 1G4US 1HE9A 4Q7CA 3SP1A 3NYLA 2YLDA 3JRTA 1Q0GA 3EG9B 4BEMJ 4JZAA 2Y3DA 5JRAA 4UDVA 1UG7A 5A6AA 2L9JA 4MVUA 1VYKA 1K05A 2ASRA 4O6NA 5COFA 4J7TA 3ZIBA 3EHMA 1ZZPA 1Y6DA 2E87A 3EH2A 3K6BA 1KTMA 4MQ9F 4CJOA 4E7SA 1F1MA 3QZCA 2LFFA 3KYIA 1OKKD 3AGUA 2EILC 3C8GB 4YT5A 1WWPA 2AU5A 2IXOA 3L0IA 1FMWA 2A1DD 3AQCA 1HW2A 4OIOF 1Y4CA 2LIGA 2MHRA 4MTFA 1Q0MA 1Q0DA 2HV7A 2DGJA 1LIHA 3H2UA 1K04A 3GORA 4JKVA 3B29A 1O3UA 4CJGA 4KI2A 2Z15A 5L0IA 3B0PA 2R7RA 2IXMA 1LI5A 2OKUA 2VASA 3JTLO 5KYUA 1JRAA 1GGQA 2J9UA 2QTVA 3AOUA 3EGDA 3V5YA 3EQLF 2J9WA 3L8JA 1MMNA 3M4CA 2HJ3A 4JEBA 3RQEA 1DOVA 3K1IC 4N6CA 3S28A 1Z23A 2KYHA 4ZLDA 4NY3A 4EIYA 1L7CA 3BEHA 4YL3A 1EI7A 4CIPA 2ZXPA 4DBRA 1J8YF 3ITFA 2XLOA 1HMOA 4O6YA 4E18A 4MTGA 1JMWA 1BR4A 1M2VA 4YJWA 5COGA 2J45A 4G7HF 1XZPA 3DM9B 1N1CA 1L3PA 2LCHA 2LD6A 3FVYA 4WABA 4DRHB 4HE8D 2EIJC 2XSEA 3LJBA 3NG1A 3WHNA 2Y39A 4MVZA 1ST6A 1YYXA 3NMIA 2ZD9A 2Q7RA 5F5HA 5KYWA 1E85A 5EK0A 1VOMA 3G4ZA 4U5DE 4XEKA 3GWNA 2JX0A 5KYXA 2X51A 2J0WA 1C17M 1HE1A 2G3VA 2VH3A 3C8ZA 1M56C 4HFKB 1VTMP 5A6BA 1ZHZA 3KMIA 1OKKA 4YT4A 2EIKC 3T6BA 3ABKC 1ORYA 4BPMA 4XEVA 5HV9A 3JYHA 2C04A 4Z9HA 1YARO 3C62A 3UNGC 2OEVA 2CYDA 2DI3A 4NTFA 3SZRA 5L0GA 3PDMP 1A7VA 4NTAA 3MFNA 4DJ9A 1QKRA 1ZU5A 2R7WA 1WOLA 4JCZA 4U5CE 1C02A 2WVQA 3ATPA 3MBGA 3M1CB 2XLDA 3ECSA 1AVOB 1MMAA 2PF4E 2J7PD 4YT2A 5L3VA 3LAYA 3HJCA 5JT4A 2NSGA 3RQFA 2EPNA 3RKOF 2FAPB 2A0BA 3IQTA 2J9VA 3NKEA 5FZTA 3Q7GA 2P61A 3SNHA 3ZTMA 3VAYA 4NQFA 1NSGB 1RKEB 1QVXA 4A4AA 2UUIA 4PK4A 3TJ5A 2FFHA 5KYUB 3EGDB 2CW0F 4CSAA 3AG4C 3B9QA 2RSEB 3NMKA 2BC5A 2CDQA 4QI0A 1ZHXA 2HV6A 1YLMA 3OEOA 4XLNF 5BQHA 1HY5A 4MW3A 4NCQA 4O7GA 4JJGA 3ZWIA 2EPMX 1TKNA 4IB4A 1CPQA 1OCRC 5E3AA 2IXNA 2HJMA 2KC3A 3EZIA 5A69A 4LLCA 4MW8A 2KW3C 1M2VB 1MQVA 5L0CA 1K40A 1QSPA 1I4ZA 1WATA 3PHF2 1YZCA 2A68F 1XZQA 4JTAB 3W2WA 4CS8A 1UFBA 1T01A 1OR2A 5B3SC 5B1AC 1R4TA 1ZHYA 2J8WA 3TJ6A 3R7CA 1H6GA 3FXHA
chains in the Genus database with same CATH topology
3U5SA 3TD7A 3LLKA 3LLIA 3U2MA 4E0HA 4E0IA 1JR8A 3GWLA 3W4YA 3U2LA 3MBGA 3O55A 3TK0A 1JRAA 4LDKA 3GWNA 1OQCA 2HJ3A 3R7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5S A;  3TD7 A;  3LLK A;  3LLI A;  3U2M A;  4E0H A;  4E0I A;  1JR8 A;  3GWL A;  3W4Y A;  3U2L A;  3MBG A;  3O55 A;  3TK0 A;  1JRA A;  4LDK A;  3GWN A;  1OQC A;  2HJ3 A;  3R7C A; 
#chains in the Genus database with same CATH topology
 1NFN A;  4K1O A;  1YZA A;  3M15 A;  4XPY A;  3AG3 C;  1LS4 A;  5CI9 A;  3VF0 A;  3TD7 A;  5KYX B;  4CSA C;  3U9J A;  2HSQ A;  3AGT A;  5JP7 A;  2A69 F;  1C03 A;  2MYS A;  3LLK A;  3X1O A;  1R5I D;  4BJ5 A;  4PR9 A;  2NPU A;  3ZDL A;  1OW7 A;  3IEE A;  3KYJ A;  3VYW A;  4XLP F;  3U8P A;  4YK5 A;  2NUP B;  4GQH A;  1U6H A;  4RBN A;  3L8I A;  2H7O A;  2KK1 A;  1H9T A;  4O79 A;  2HKV A;  1FFT C;  2J0X A;  3F47 A;  3LS1 A;  4CIH A;  2YLI A;  2XS8 A;  4BEJ A;  2XL8 A;  4YN0 B;  2YKZ A;  3GEE A;  2XM0 A;  4BJ6 C;  1QQ3 A;  2NSF A;  3EFO A;  2Y69 C;  3ABM C;  3GOD A;  3S29 A;  2JPU A;  2QNL A;  4CS8 C;  3TUL A;  3RQG A;  4IJJ A;  3GEH A;  4IRU A;  4K7B A;  1YJG A;  1S05 A;  1CGN A;  3QW1 A;  4G0H A;  4W8K A;  3V7O A;  2WL8 A;  3ZQY A;  4G7Z F;  1EKY A;  1OW6 A;  3ZC4 A;  1AEP A;  1HMD A;  2A0U A;  1YYJ A;  4MTO A;  3HTK C;  2I15 A;  4CS9 A;  5A6B D;  1SR2 A;  3GEI A;  3O6X A;  1BR1 A;  4AL0 A;  1TWC A;  4ONS A;  4C3E A;  3W2V A;  3GM1 A;  3Q7L A;  4CBE A;  4E0I A;  1LE4 A;  1YAU O;  2EPO A;  3BRJ A;  4PFP A;  4YL0 A;  1JPN A;  2R7S A;  1AUE A;  2ZXR A;  3N24 A;  1D1C A;  3HNL A;  2L6H A;  1JOG A;  1NU7 D;  3H65 A;  3FAP B;  3B0V C;  2OOC A;  2ZXO A;  4AE4 A;  4IAQ A;  2R7U A;  1T5O A;  3E70 C;  2LSE A;  3JZ0 A;  2MWQ A;  4Z9J A;  4X0R A;  5AC4 A;  2P1A A;  1O5H A;  1D0X A;  2R02 A;  2IXP A;  1MNE A;  2WVO A;  3UR3 C;  4DRI B;  5JSL A;  3U0C A;  1A7D A;  2L7A A;  1V4A A;  3HKK A;  2GAQ A;  1NBB A;  1TFO B;  2H8A A;  1Q0K A;  2EIM C;  2F22 A;  2J9B A;  2D5R B;  2NG1 A;  3G50 A;  2DYR C;  1OCO C;  1NLX A;  2R03 A;  3N2Z B;  4L6R A;  2H7B A;  5IY5 C;  2R05 A;  2Y3B A;  4JEA A;  5DQT A;  3W8I A;  4CS9 C;  1D1B A;  3I4U A;  3NYJ A;  256B A;  3PMR A;  2EPK X;  4IAR A;  5A6K A;  4G7O F;  4C3B A;  1RXQ A;  4IAO A;  4XPW A;  3RW0 A;  4U9D A;  3S0X A;  3U2L A;  5KYY A;  1T6Q A;  2YL3 A;  1V54 C;  1XWJ A;  3LNR A;  4Q5S F;  1LM3 B;  5BQI A;  2CGE A;  4EBB A;  3HNI A;  3L1M A;  3A9C A;  5T3T A;  3I5P A;  1KNY A;  3N0T A;  3Q6N A;  4MVR A;  3ZVR A;  2QUP A;  4KNW A;  3PCV A;  5DLJ A;  3KL4 A;  4EHP A;  3IHU A;  2OEX A;  5A6J A;  1CGM E;  2W4M A;  4WGZ A;  5L3Q A;  3DJU B;  4C7O B;  3U9M A;  3SXZ A;  1NG1 A;  2IYL D;  1OQC A;  4U5E E;  4KNV A;  3T6J A;  3DMD A;  4LAC B;  1G8X A;  3JT1 A;  3CEX A;  3SEO A;  2JD3 A;  4D4X A;  1V74 B;  4EBJ A;  4N6H A;  2ZPA A;  3EFO B;  3WOD F;  3A11 A;  2YL1 A;  3DI5 A;  3QVY A;  1ORJ A;  1O87 A;  1U89 A;  2XLW A;  1RKC A;  4JE9 A;  4QDL A;  5L0J A;  2HS5 A;  5DS6 A;  5L0H A;  1PD1 A;  4PJN A;  2X0C A;  3MYF A;  3S27 A;  4FAP B;  1MND A;  2ICW G;  4I1O B;  3W4Y A;  3SXK A;  2DYS C;  2EPL X;  3T9O A;  3LEV A;  1RMV A;  4PAC A;  5JUA A;  3E9V A;  2R7T A;  3DM5 A;  2XLV A;  4BJ1 A;  3IPM O;  1G5Z A;  3LS0 A;  3DXJ F;  3ASN C;  4H4K C;  3JRM O;  2Y3H A;  2YEV A;  4OD5 A;  3RFY A;  3U3B A;  4CS7 A;  3CQZ A;  4B6I A;  1SMY F;  4M63 A;  5T3W A;  2H7V C;  1E2X A;  2B0H A;  2GA0 A;  1JAF A;  1VB5 A;  3ABL C;  3K33 A;  4JTD B;  3DE8 A;  1T9K A;  2AVK A;  2ETS A;  4R32 A;  4HEA J;  1E84 A;  1TQG A;  1TWA A;  1RJ9 A;  3SYN A;  4AK9 A;  4DOZ A;  2XXA A;  2OJQ A;  5EHH A;  2XM4 A;  1H7I A;  4IGG A;  4E7Z A;  3JCU Q;  1OR3 A;  3EGX A;  3RVY A;  3TQO A;  3DAF A;  3IQ5 A;  3FAJ A;  4NC3 A;  5CI8 A;  5B1B C;  1SYQ A;  1EQ1 A;  2EIN C;  4DVZ A;  3FHD A;  3U8V A;  3T6G B;  2W4B A;  3LNM B;  4ANJ A;  2PBE A;  2I8B A;  3T4R A;  5AC5 A;  4JCH A;  3AJM A;  4U5B E;  5KYY B;  2L6F A;  2PX0 A;  4BJT A;  3M4B A;  3K66 A;  2P6V A;  2O9X A;  1D0Z A;  2Q9C A;  2Y3G A;  3FDQ A;  4AL1 A;  5KYW B;  2KNH A;  1BZ4 A;  4JVS A;  2B0J A;  4XQ1 A;  1TWG A;  3RVZ A;  2HSB A;  1A0B A;  3VM6 A;  4EUK B;  4RDA A;  3CAX A;  3K7D A;  3OA1 A;  2OG2 A;  3WAQ A;  1H9G A;  3KKB A;  3DJN B;  1ZW2 A;  1I4Y A;  2PFD A;  4LER A;  1GM5 A;  1Z6A A;  4OIQ F;  2YQY A;  3HNK A;  3S9O A;  2R25 A;  3ZTZ A;  1GS9 A;  3QW0 A;  3Q6M A;  3CSK A;  2XS1 A;  4E17 A;  2R7O A;  2IM8 A;  4P6I C;  3MLG A;  2M64 A;  2WZL A;  4XTK A;  5EGY A;  2XRH A;  4K0D A;  4QI2 A;  1SZI A;  4J7Y A;  3DE9 A;  3IQ6 A;  3DAG A;  2YRF A;  3ZQV A;  5BUO A;  4ZLC A;  2W9Y A;  4YWQ A;  4C3D A;  1FMV A;  2HUJ A;  5BQG A;  3DZA A;  4PJL A;  5JVE A;  3TOM A;  4BJ5 C;  1T6U A;  5CIV A;  2QY9 A;  2GDC A;  2PP4 A;  4O6M A;  2AP3 A;  3WG7 C;  5HSW A;  3SXY A;  4JTC B;  3H2V A;  1RJ9 B;  4DVY P;  2XXA B;  3ZSU A;  3FOO A;  3LEO A;  3UMH A;  4DRJ B;  5F5F A;  2V26 A;  3EGX B;  4J30 B;  5COM A;  1YDI A;  3QVZ A;  5D92 A;  3NYM A;  2FGY A;  1ORS C;  2KSF A;  2M4E A;  4N06 A;  4MVO A;  3K1I A;  3W8H A;  3EH1 A;  4U5H A;  1FAP B;  3EJN A;  1YVI A;  5F28 E;  5KYN A;  1J8M F;  4H54 A;  3V5Z A;  1APC A;  2KQ9 A;  1FR0 A;  2Q3T A;  1OCZ C;  1PD0 A;  1V55 C;  3NDB B;  4KC9 A;  2OQM A;  5JLI A;  1Q0F A;  2HFI A;  1NU9 C;  4JRZ A;  1OCC C;  3UGO A;  2UUH A;  1ZYR F;  4DBQ A;  1W2W A;  2G3K A;  4F4B A;  3NMJ A;  4CX9 A;  3M79 A;  4Z9I A;  1BDJ B;  1MMD A;  3JSZ A;  4CDY A;  2G62 A;  3FMS A;  4OIN F;  4PJJ A;  1TWH A;  1RKE A;  1D1A A;  2BL2 A;  2DB4 A;  3I5Q A;  4EWC A;  4D4N A;  1S7Z A;  1M57 C;  1IW7 F;  1VMA A;  4JC7 A;  1A7E A;  1OXK A;  4P9T A;  5AGF A;  4OIP F;  3ASO C;  2PX3 A;  2LP4 A;  2VCA A;  3G4X A;  3HLZ A;  4FWV A;  4GEH A;  4JUR I;  1CGO A;  4ULV A;  1LVK A;  4AX2 A;  4EBK A;  3EZH A;  4FES A;  4EKW A;  1A41 A;  1ZU4 A;  3C8G D;  5TJ5 E;  3U2M A;  5DVW A;  4DXW A;  4E0H A;  1E86 A;  4MS2 A;  3NKD A;  1WGW A;  2R7X A;  1QZX A;  3U3F A;  2D4U A;  2Q9B A;  2XL6 A;  4XWJ A;  2W45 A;  1T6I A;  2GWW A;  2Q9A A;  4MVS A;  2HZ8 A;  4XEF A;  4BG0 A;  3NRH A;  3C18 A;  4ER9 A;  3DD7 A;  4KBL A;  1HW1 A;  2QE9 A;  2YLG A;  3RH3 A;  1U0B B;  3O39 A;  4OD4 A;  5GPG B;  3UMK A;  4U5G A;  4G78 A;  2YVK A;  2KJG A;  2A6H F;  2KGO A;  5DS5 A;  1QPU A;  1BBH A;  3LES A;  2IOQ A;  2VCB A;  4AE4 B;  2WZF A;  2CNW D;  2BE5 F;  2NUP A;  3AG2 C;  3DWW A;  4JIO A;  1M6T A;  1RCP A;  4WJ0 A;  1CPR A;  1VK5 A;  1Z7Q c;  3J06 A;  3US6 A;  2R7V A;  1LI7 A;  3C63 A;  5L0F A;  1Z5Z A;  4P9F A;  2Q00 A;  1KU2 A;  2HMQ A;  2CCY A;  2XLE A;  2AWY A;  3LUT B;  4FX5 A;  1I5N A;  2NUT A;  1TFK B;  3FOP A;  2P0N A;  4I44 A;  3C7J A;  2YHS A;  5DS4 A;  4OIR F;  1BR2 A;  2VCC A;  3EG9 A;  3POV A;  1NZE A;  1LE2 A;  2OCC C;  1G4W R;  2YL7 A;  1MMG A;  2R9R B;  2WVN A;  2A6E F;  2R7Q A;  2XLM A;  3B71 A;  3GAN A;  3KPH A;  5E33 A;  3ZG1 A;  5L0D A;  3MYI A;  3UGP A;  3SXM A;  1VYI A;  3EPV A;  3JSE O;  3IQC A;  4JJF A;  1YA9 A;  4PJM A;  4GYT A;  1TR2 A;  4U5F E;  4A2N B;  4CDA A;  1OW8 A;  1E83 A;  4LDR A;  2V3C C;  1ZVZ A;  3GM3 A;  3C8G A;  1WN0 A;  4PFO A;  3K1H A;  4IWB A;  3O10 A;  4CDV A;  2LK4 A;  5E2Q A;  3LLI A;  4I1M A;  5T1D B;  2IBF A;  2L81 A;  4N4W A;  3UMI A;  1FFH A;  5DQZ A;  2J46 A;  4NTB A;  2LQG A;  4JW1 A;  3GWL A;  1ZW3 A;  3RIP A;  5FCL A;  3CZ6 A;  1LKX A;  3QTH A;  4RD9 A;  1DOW A;  4MVM A;  2Q4F A;  4YL1 A;  5JS5 A;  2OJE D;  1VLT A;  3VRC A;  2VB6 A;  3O55 A;  3F46 A;  4LLE A;  4U9E A;  2ZXW C;  3GM2 A;  1SF8 A;  5D91 A;  2TMV P;  3OWT A;  1WAS A;  4BJ6 A;  2P7V A;  4I3M A;  4Q4Z F;  3TK0 A;  1QLE C;  2CNW A;  2YWA A;  4MVQ A;  4LDK A;  2QLA A;  4LDQ A;  3DKA A;  1EA8 A;  3RYL A;  3B0U X;  2HMZ A;  3QMK A;  1D0Y A;  3V5X A;  3X2Q C;  3S84 A;  1JPJ A;  2AWC A;  1ZHT A;  2C03 A;  3EHN A;  1OXB A;  1M2O A;  1FTS A;  1PCX A;  2RD9 A;  3JYY A;  2PNO A;  5E3C A;  2OU6 A;  3U5S A;  3KH2 A;  4YT8 A;  4ULW A;  2XLH A;  5B3I A;  4WGY A;  1NFO A;  2YL0 A;  2WB7 A;  1YA7 O;  1LS1 A;  3L34 A;  1FNT c;  1Z3I X;  2LFD A;  2VC9 A;  3S90 A;  3MX3 A;  1JR8 A;  2WZG A;  2J7P A;  3AG1 C;  2XL4 A;  1Z63 A;  3RF3 A;  1ZHW A;  4C7O A;  4W8P A;  4XPX A;  2GFH A;  1PV3 A;  3HNJ A;  1GQA A;  1B68 A;  1VLS A;  2L6G A;  3AQB A;  5K0I A;  1IZM A;  3TOL A;  2YZS A;  3R2P A;  1LPE A;  1WTY A;  4HFF B;  4MND A;  4J32 B;  2NUT B;  1G4U S;  1HE9 A;  4Q7C A;  3SP1 A;  3NYL A;  2YLD A;  3JRT A;  1Q0G A;  3EG9 B;  4BEM J;  4JZA A;  2Y3D A;  5JRA A;  4UDV A;  1UG7 A;  5A6A A;  2L9J A;  4MVU A;  1VYK A;  1K05 A;  2ASR A;  4O6N A;  5COF A;  4J7T A;  3ZIB A;  3EHM A;  1ZZP A;  1Y6D A;  2E87 A;  3EH2 A;  3K6B A;  1KTM A;  4MQ9 F;  4CJO A;  4E7S A;  1F1M A;  3QZC A;  2LFF A;  3KYI A;  1OKK D;  3AGU A;  2EIL C;  3C8G B;  4YT5 A;  1WWP A;  2AU5 A;  2IXO A;  3L0I A;  1FMW A;  2A1D D;  3AQC A;  1HW2 A;  4OIO F;  1Y4C A;  2LIG A;  2MHR A;  4MTF A;  1Q0M A;  1Q0D A;  2HV7 A;  2DGJ A;  1LIH A;  3H2U A;  1K04 A;  3GOR A;  4JKV A;  3B29 A;  1O3U A;  4CJG A;  4KI2 A;  2Z15 A;  5L0I A;  3B0P A;  2R7R A;  2IXM A;  1LI5 A;  2OKU A;  2VAS A;  3JTL O;  5KYU A;  1JRA A;  1GGQ A;  2J9U A;  2QTV A;  3AOU A;  3EGD A;  3V5Y A;  3EQL F;  2J9W A;  3L8J A;  1MMN A;  3M4C A;  2HJ3 A;  4JEB A;  3RQE A;  1DOV A;  3K1I C;  4N6C A;  3S28 A;  1Z23 A;  2KYH A;  4ZLD A;  4NY3 A;  4EIY A;  1L7C A;  3BEH A;  4YL3 A;  1EI7 A;  4CIP A;  2ZXP A;  4DBR A;  1J8Y F;  3ITF A;  2XLO A;  1HMO A;  4O6Y A;  4E18 A;  4MTG A;  1JMW A;  1BR4 A;  1M2V A;  4YJW A;  5COG A;  2J45 A;  4G7H F;  1XZP A;  3DM9 B;  1N1C A;  1L3P A;  2LCH A;  2LD6 A;  3FVY A;  4WAB A;  4DRH B;  4HE8 D;  2EIJ C;  2XSE A;  3LJB A;  3NG1 A;  3WHN A;  2Y39 A;  4MVZ A;  1ST6 A;  1YYX A;  3NMI A;  2ZD9 A;  2Q7R A;  5F5H A;  5KYW A;  1E85 A;  5EK0 A;  1VOM A;  3G4Z A;  4U5D E;  4XEK A;  3GWN A;  2JX0 A;  5KYX A;  2X51 A;  2J0W A;  1C17 M;  1HE1 A;  2G3V A;  2VH3 A;  3C8Z A;  1M56 C;  4HFK B;  1VTM P;  5A6B A;  1ZHZ A;  3KMI A;  1OKK A;  4YT4 A;  2EIK C;  3T6B A;  3ABK C;  1ORY A;  4BPM A;  4XEV A;  5HV9 A;  3JYH A;  2C04 A;  4Z9H A;  1YAR O;  3C62 A;  3UNG C;  2OEV A;  2CYD A;  2DI3 A;  4NTF A;  3SZR A;  5L0G A;  3PDM P;  1A7V A;  4NTA A;  3MFN A;  4DJ9 A;  1QKR A;  1ZU5 A;  2R7W A;  1WOL A;  4JCZ A;  4U5C E;  1C02 A;  2WVQ A;  3ATP A;  3MBG A;  3M1C B;  2XLD A;  3ECS A;  1AVO B;  1MMA A;  2PF4 E;  2J7P D;  4YT2 A;  5L3V A;  3LAY A;  3HJC A;  5JT4 A;  2NSG A;  3RQF A;  2EPN A;  3RKO F;  2FAP B;  2A0B A;  3IQT A;  2J9V A;  3NKE A;  5FZT A;  3Q7G A;  2P61 A;  3SNH A;  3ZTM A;  3VAY A;  4NQF A;  1NSG B;  1RKE B;  1QVX A;  4A4A A;  2UUI A;  4PK4 A;  3TJ5 A;  2FFH A;  5KYU B;  3EGD B;  2CW0 F;  4CSA A;  3AG4 C;  3B9Q A;  2RSE B;  3NMK A;  2BC5 A;  2CDQ A;  4QI0 A;  1ZHX A;  2HV6 A;  1YLM A;  3OEO A;  4XLN F;  5BQH A;  1HY5 A;  4MW3 A;  4NCQ A;  4O7G A;  4JJG A;  3ZWI A;  2EPM X;  1TKN A;  4IB4 A;  1CPQ A;  1OCR C;  5E3A A;  2IXN A;  2HJM A;  2KC3 A;  3EZI A;  5A69 A;  4LLC A;  4MW8 A;  2KW3 C;  1M2V B;  1MQV A;  5L0C A;  1K40 A;  1QSP A;  1I4Z A;  1WAT A;  3PHF 2;  1YZC A;  2A68 F;  1XZQ A;  4JTA B;  3W2W A;  4CS8 A;  1UFB A;  1T01 A;  1OR2 A;  5B3S C;  5B1A C;  1R4T A;  1ZHY A;  2J8W A;  3TJ6 A;  3R7C A;  1H6G A;  3FXH A; 
#chains in the Genus database with same CATH homology
 3U5S A;  3TD7 A;  3LLK A;  3LLI A;  3U2M A;  4E0H A;  4E0I A;  1JR8 A;  3GWL A;  3W4Y A;  3U2L A;  3MBG A;  3O55 A;  3TK0 A;  1JRA A;  4LDK A;  3GWN A;  1OQC A;  2HJ3 A;  3R7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...